4DZ3A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation m61h from burkholderia pseudomallei complexed with fk506
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
b'STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGHVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz3A00
1Y0OA 2F2DA 1T11A 4MSPA 3CGMA 4ODKA 1ZCNA 2ZQTA 2UZ5A 1F8AB 4LAYA 2JZVA 1BL4A 3O5FA 4G50A 4O2TA 4U84A 4IQCA 4ODNA 4TW8A 4GGQA 2L2SA 3WH0A 2XPAA 3UQBA 5HW7A 2XPBA 5DITA 2ZQUA 1JVWA 1D7IA 2FAPA 2LPVA 3CGNA 3O5RA 4ODQA 1NSGA 1JNTA 2N87A 3UI6A 4BF8A 2IF4A 1QPLA 3O5MA 1NMWA 5GPGA 3JYJA 4DT4A 1F40A 4J4OA 4JFJA 4JFLA 5HKGA 1KT0A 1PINA 4J4NA 5HW6A 1YW5A 5HWCA 4DRQA 1FKFA 1Q1CA 2DG4A 4GIVA 1Q6UA 4QT3A 4QIBA 4FN2A 2RSEA 4ODLA 3UQIA 1EYMA 1A7XA 2D9FA 3UQAA 2F4EA 1U79A 1Q6IA 1TCOC 2VCDA 2XP9A 3O5GA 3O5QA 2LGOA 3GPKA 5HTGA 1FJDA 1HXVA 4W9QA 4LAXA 3TC5A 4DRIA 1Q6HA 1FKTA 2ITKA 1FKDA 1J4HA 2K8IA 2VN1A 4TNSA 4ODPA 2DG9A 3EY6A 3PRBA 1ROUA 3RGCA 3KAHA 2KGJA 1L1PA 5DIVA 1D7JA 1FKJA 3JXVA 3PRDA 2LKNA 2KO7A 1FAPA 3FAPA 3O5PA 2Y78A 3VAWA 2PV2A 1W26A 4ITZA 1NMVA 2F21A 2PPPA 4IPXA 3KADA 1BKFA 2MF9A 3PA7A 4NNRA 2RQSA 5HW8A 1P5QA 2FKEA 3JYMA 2M1IA 1J4IA 1QPFA 3KZ7A 1D7HA 2ZR4A 4DZ3A 1M5YA 2M2AA 2ZQVA 1FKGA 1KT1A 2PBCA 4ODOA 2DG3A 4N19A 4TX0A 3O5OA 3NRKA 3IKDA 5J6EA 4QT2A 1ZK6A 2XP5A 4JFIA 5HWBA 4ODRA 3NI6A 2PV3A 3LUOA 4JYSA 2RUCA 1C9HA 3TDBA 2ZR5A 2ZQSA 1N1AA 3B7XA 3IHZA 3KACA 2OFNA 3KAFA 4TW6A 4TW7A 1J4RA 2MLYA 2MLXA 3O5IA 3KABA 3MDYB 1FKHA 3O5DA 3NTPA 4U85A 1FKBA 1JNSA 2M08A 1J6YA 4R0XA 1EQ3A 1ROTA 2XP6A 1FKLA 1R9HA 4DRNA 4W9OA 2MLZA 3OOBA 4DRPA 4DROA 2AWGA 4DZ2A 2PPOA 4G2PA 4LAWA 5BXJA 2XP7A 1B6CA 2XP4A 4W9PA 4C02B 5D75A 2KR7A 3ODKA 4IQ2A 2ZR6A 4ODMA 4FAPA 2PPNA 4TYOA 3IKGA 1FKSA 1PBKA 2KE0A 2XP8A 5HT1A 2RUDA 1D6OA 2PV1A 3O5LA 5I98A 1FKKA 3UI4A 3IK8A 4JFKA 5DIUA 2MPHA 3O5KA 2LJ4A 3RFWA 1YATA 3O5EA 2KI3A 4JFMA 1FKRA 2RURA 3TCZA 5HUAA 4DH0A 2KFWA 1QZ2A 3KAGA 3KCEA 3UI5A 3UF8A 4DRJA 4DRHA 3O5JA 1FKIA 1FD9A 3KAIA 3I6CA 5B8IC 2XP3A 4DRMA 2RUQA 3H9RB 4U86A 4DIPA 2Q5AA 4LAVA 4DRKA 2MNTA 4MGVA
chains in the Genus database with same CATH superfamily
4MSPA 2YBTA 4G50A 2IUZA 2DSZA 4LGXA 1JVWA 1LL4A 4ZPTR 1NMWA 3JYJA 1NWRA 1ITXA 4WKAA 5HKGA 1PINA 4J4NA 1WB0A 4DRQA 4AY1A 4IT4A 4GIVA 1Q6UA 4QT3A 3UQIA 1EYMA 3EIPA 1U79A 1TCOC 2VCDA 3O5GA 1W1PA 4Z2GA 4MTVA 4DWSA 2QF8A 2EULA 4LAXA 1HXVA 1Q6HA 1ZL1A 4TNSA 1VF8A 1L1PA 1E6ZA 2KGJA 1W1VA 3O5PA 2PV2A 4ITZA 3KADA 2MF9A 3ARZA 1P5QA 2B31A 2M1IA 1J4IA 4DZ3A 2O9OA 1X6NA 1FKGA 1KT1A 1IX5A 4N19A 1WAWA 1W9UA 2PV3A 3LUOA 2RUCA 1HKMA 2WM0A 1E6PA 2ZR5A 3B7XA 4TW6A 2MLYA 1FKHA 3O5DA 3NTPA 2A3EA 4HBOA 1NWUA 4R0XA 4Q22A 1ROTA 1OGBA 3ARVA 1FKLA 4G2PA 2DPEA 2XP7A 2KR7A 4ODMA 2PPNA 3ARYA 1PBKA 2WLYA 1D6OA 1SYTA 1NWSA 3CZ8A 4HARA 4MPKA 3RFWA 1GPFA 4MNJA 2KFWA 2PI6A 3B8SA 3GU0A 1GUVA 3O5JA 1FKIA 1FD9A 1HJVA 4MNMA 1TFVA 4ODPA 4DRKA 2F2DA 3CGMA 1JNEA 3WD1A 2UZ5A 2WK2A 1SR0A 4ODNA 4HBEA 2L2SA 3WIJA 1RD6A 2FAPA 3AS1A 3O5RA 3AQUA 3UI6A 2OLHA 3G6LA 1HJWA 5GPGA 4DWSC 1HKJA 3ARUA 3ALGA 1YW5A 2P4VA 1FKFA 1Q1CA 4ML4A 1FFRA 4FN2A 3O5QA 4QZVB 2LGOA 5HTGA 3OA5A 1FJDA 4DRIA 3FXYA 4DWSD 1FKTA 4Z2KA 1FKDA 4WKFA 1J4HA 2K8IA 2VN1A 2A3CA 3EY6A 3PRAA 3CHCA 3KAHA 4Z2LA 1D2KA 3AS2A 3PRDA 4NZCA 3B9EA 4W5UA 1NMVA 3WKZA 2FKEA 1D7HA 1LL7A 1H0IA 2ZR4A 2M2AA 2ZQVA 2G41A 4KR0B 2B5UB 3GTYX 1W9VA 1ZK6A 4JFIA 5HWBA 3NI6A 2DT0A 3RM8A 3FY1A 4WJXA 1ZU8A 2OFNA 5GPRA 1W1TA 3KAFA 4TW7A 3RM9A 4URIA 3KABA 3MDYB 3WD0A 1FKBA 2DT3A 3ALFA 1EQ3A 4ZPVR 2XP6A 4DRNA 1JNDA 3OOBA 4W9PA 2AOSA 2XP4A 5D75A 3CHFA 3ODKA 4P8UA 4IQ2A 2DSVA 3IKGA 1FKSA 5HT1A 4WKHA 2MPHA 2LJ4A 3O5EA 1ZBVA 4JFMA 2A3BA 4L3NA 1QZ2A 3KCEA 3AS0A 4DRHA 3I6CA 5B8IC 4DRMA 4U86A 4Z2JA 2G8ZA 4MGVA 1OGGA 1T11A 3AS3A 4ODKA 1ZCNA 2ZQTA 1E15A 1F8AB 4LAYA 2JZVA 1BL4A 1GRJA 4TW8A 1W9PA 5DITA 2ZQUA 4ODQA 1GOIA 4BF8A 3CGNA 5BXJA 1JNTA 2DSUA 1QPLA 4DT4A 1HKKA 3WD3A 3ARRA 1KT0A 3W4RA 2DG4A 3CH9A 1W1YA 1XRVA 4ODLA 1A7XA 2D9FA 2XP9A 2ITKA 3PRBA 1LL6A 1WNOA 4DWSB 1D7JA 4ZPWR 1FKJA 1UR9A 1FAPA 3FAPA 2Y78A 3VAWA 1JCHB 1FFQA 2F21A 1H0GA 4NNRA 3WL1A 3PA7A 3ARWA 1QPFA 3KZ7A 3WD2A 4ODOA 2DG3A 3O5OA 3NRKA 3WL0A 3ARTA 4QT2A 2ESCA 4S3KA 4ODRA 4JYSA 3KACA 3BMBA 2FDMA 3O5IA 3WQVA 4U85A 1ZBWA 4WK9A 1J6YA 4P8XA 2DSWA 4W9OA 2MLZA 4DZ2A 1EIBA 1HKIA 4C02B 2YBUA 4XAKA 1E6NA 2ZR6A 4FAPA 4TYOA 2KE0A 2XP8A 1ZB5A 3B9DA 5I98A 3UI4A 1OWQA 3IK8A 5DIUA 3O5KA 1YATA 1FKRA 2KI3A 2DT1A 2RURA 1LJYA 4UDMA 3UI5A 4DRJA 1ZBKA 3RM4A 1LG2A 4MAVA 4MNKA 2RUQA 3H9RB 4P8WA 4MNLA 4LAVA 1E44A 1Y0OA 4ZS6A 1EHNA 3O5FA 4U84A 4O2TA 4IQCA 1NH6A 4GGQA 4S3JA 2XPAA 3WH0A 5HW7A 3UQBA 2XPBA 1D7IA 1LQ0A 2LPVA 1E6RA 1NSGA 2N87A 2IF4A 3O5MA 5GQBA 1F40A 4IT6A 4J4OA 2ETNA 4WIWA 4JFJA 4JFLA 3G6MA 5HW6A 5DF0A 5HWCA 1NWTA 4NSBA 3ARXA 4QIBA 2RSEA 1K9TA 3UQAA 2F4EA 1Q6IA 3QOKA 4Q7NA 5HBFA 3GPKA 4W9QA 3TC5A 4PTMA 2DG9A 3CHDA 1ROUA 3RGCA 5DIVA 3JXVA 3RMEA 1E9LA 2LKNA 3WD4A 2KO7A 5DEZA 3CHEA 4R5EA 2O92A 1W26A 1X6LA 2PPPA 4IPXA 1BKFA 1LG1A 2F23A 5HW8A 2RQSA 3AROA 3JYMA 3ARPA 3BXWA 1M5YA 2DT2A 2PBCA 4TX0A 4KQZA 4L72B 5J6EA 3IKDA 3WQWA 2XP5A 1KFWA 1C9HA 2WLZA 4P8VA 3TDBA 2ZQSA 1N1AA 3IHZA 1UR8A 1J4RA 2MLXA 2A3AA 1JNSA 3B9AA 1EDQA 2M08A 1HJXA 1CTNA 2PN0A 5JH8A 1R9HA 4DRPA 1ZBCA 4DROA 2AWGA 2PPOA 4LAWA 4Z2HA 1B6CA 2RUDA 2PV1A 3O5LA 1FKKA 4JFKA 3TCZA 5HUAA 4Z2IA 1O6IA 4DH0A 3KAGA 3ARSA 3UF8A 3KAIA 5DO2A 1XHGA 2XP3A 3PR9A 4DIPA 3ARQA 2Q5AA 2MNTA
chains in the Genus database with same CATH topology
4MSPA 2YBTA 4G50A 2IUZA 2DSZA 4LGXA 1JVWA 1LL4A 4ZPTR 1NMWA 3JYJA 1NWRA 1ITXA 4WKAA 5HKGA 1PINA 4J4NA 1WB0A 4DRQA 4AY1A 4IT4A 4GIVA 1Q6UA 4QT3A 3UQIA 1EYMA 1U79A 1TCOC 2VCDA 3O5GA 1W1PA 4Z2GA 4MTVA 4DWSA 2QF8A 1HXVA 4LAXA 1Q6HA 1ZL1A 4TNSA 1VF8A 1L1PA 1E6ZA 2KGJA 1W1VA 3O5PA 2PV2A 4ITZA 3KADA 2MF9A 3ARZA 1P5QA 2B31A 2M1IA 1J4IA 4DZ3A 2O9OA 1X6NA 1FKGA 1KT1A 1IX5A 4N19A 1WAWA 1W9UA 2PV3A 3LUOA 2RUCA 1HKMA 2WM0A 1E6PA 2ZR5A 3B7XA 4TW6A 2MLYA 1FKHA 3O5DA 3NTPA 2A3EA 4HBOA 1NWUA 4R0XA 4Q22A 1ROTA 1OGBA 3ARVA 1FKLA 4G2PA 2DPEA 2XP7A 2KR7A 4ODMA 2PPNA 3ARYA 1PBKA 2WLYA 1D6OA 1SYTA 1NWSA 3CZ8A 4HARA 4MPKA 3RFWA 1GPFA 4MNJA 2KFWA 2PI6A 3B8SA 1GUVA 3O5JA 1FKIA 1FD9A 1HJVA 4MNMA 1TFVA 4ODPA 4DRKA 2F2DA 3CGMA 1JNEA 3WD1A 2UZ5A 2WK2A 1SR0A 4ODNA 4HBEA 2L2SA 3WIJA 1RD6A 2FAPA 3AS1A 3O5RA 3AQUA 3UI6A 2OLHA 3G6LA 1HJWA 5GPGA 4DWSC 1HKJA 3ARUA 3ALGA 1YW5A 1FKFA 1Q1CA 4ML4A 1FFRA 4FN2A 3O5QA 4QZVB 2LGOA 5HTGA 3OA5A 1FJDA 4DRIA 3FXYA 4DWSD 1FKTA 4Z2KA 1FKDA 4WKFA 1J4HA 2K8IA 2VN1A 2A3CA 3EY6A 3PRAA 3CHCA 3KAHA 4Z2LA 1D2KA 3AS2A 3PRDA 4NZCA 3B9EA 4W5UA 1NMVA 3WKZA 2FKEA 1D7HA 1LL7A 1H0IA 2ZR4A 2M2AA 2ZQVA 2G41A 4KR0B 1W9VA 1ZK6A 4JFIA 5HWBA 3NI6A 2DT0A 3RM8A 3FY1A 4WJXA 1ZU8A 2OFNA 5GPRA 1W1TA 3KAFA 4TW7A 3RM9A 4URIA 3KABA 3MDYB 3WD0A 1FKBA 2DT3A 3ALFA 1EQ3A 4ZPVR 2XP6A 4DRNA 1JNDA 3OOBA 4W9PA 2AOSA 2XP4A 5D75A 3CHFA 3ODKA 4P8UA 4IQ2A 2DSVA 3IKGA 1FKSA 5HT1A 4WKHA 2MPHA 2LJ4A 3O5EA 1ZBVA 4JFMA 2A3BA 4L3NA 1QZ2A 3KCEA 3AS0A 4DRHA 3I6CA 5B8IC 4DRMA 4U86A 4Z2JA 2G8ZA 4MGVA 1OGGA 1T11A 3AS3A 4ODKA 1ZCNA 2ZQTA 1E15A 1F8AB 4LAYA 2JZVA 1BL4A 4TW8A 1W9PA 5DITA 2ZQUA 4ODQA 1GOIA 4BF8A 3CGNA 5BXJA 1JNTA 2DSUA 1QPLA 4DT4A 1HKKA 3WD3A 3ARRA 1KT0A 3W4RA 2DG4A 3CH9A 1W1YA 1XRVA 4ODLA 1A7XA 2D9FA 2XP9A 2ITKA 3PRBA 1LL6A 1WNOA 4DWSB 1D7JA 4ZPWR 1FKJA 1UR9A 1FAPA 3FAPA 2Y78A 3VAWA 1FFQA 2F21A 1H0GA 4NNRA 3WL1A 3PA7A 3ARWA 1QPFA 3KZ7A 3WD2A 4ODOA 2DG3A 3O5OA 3NRKA 3WL0A 3ARTA 4QT2A 2ESCA 4S3KA 4ODRA 4JYSA 3KACA 2FDMA 3O5IA 3WQVA 4U85A 1ZBWA 4WK9A 1J6YA 4P8XA 2DSWA 4W9OA 2MLZA 4DZ2A 1EIBA 1HKIA 4C02B 2YBUA 4XAKA 1E6NA 2ZR6A 4FAPA 4TYOA 2KE0A 2XP8A 1ZB5A 3B9DA 5I98A 3UI4A 1OWQA 3IK8A 5DIUA 3O5KA 1YATA 1FKRA 2KI3A 2DT1A 2RURA 1LJYA 3UI5A 4DRJA 1ZBKA 3RM4A 1LG2A 4MAVA 4MNKA 2RUQA 3H9RB 4P8WA 4MNLA 4LAVA 1Y0OA 4ZS6A 1EHNA 3O5FA 4U84A 4O2TA 4IQCA 1NH6A 4GGQA 4S3JA 2XPAA 3WH0A 5HW7A 3UQBA 2XPBA 1D7IA 1LQ0A 2LPVA 1E6RA 1NSGA 2N87A 2IF4A 3O5MA 5GQBA 1F40A 4IT6A 4J4OA 4WIWA 4JFJA 4JFLA 3G6MA 5HW6A 5DF0A 5HWCA 1NWTA 4NSBA 3ARXA 4QIBA 2RSEA 1K9TA 3UQAA 2F4EA 1Q6IA 3QOKA 4Q7NA 5HBFA 3GPKA 4W9QA 3TC5A 4PTMA 2DG9A 3CHDA 1ROUA 3RGCA 5DIVA 3JXVA 3RMEA 1E9LA 2LKNA 3WD4A 2KO7A 5DEZA 3CHEA 4R5EA 2O92A 1W26A 1X6LA 2PPPA 4IPXA 1BKFA 1LG1A 5HW8A 2RQSA 3AROA 3JYMA 3ARPA 3BXWA 1M5YA 2DT2A 2PBCA 4TX0A 4KQZA 4L72B 5J6EA 3IKDA 3WQWA 2XP5A 1KFWA 1C9HA 2WLZA 4P8VA 3TDBA 2ZQSA 1N1AA 3IHZA 1UR8A 1J4RA 2MLXA 2A3AA 1JNSA 3B9AA 1EDQA 2M08A 1HJXA 1CTNA 5JH8A 1R9HA 4DRPA 1ZBCA 4DROA 2AWGA 2PPOA 4LAWA 4Z2HA 1B6CA 2RUDA 2PV1A 3O5LA 1FKKA 4JFKA 3TCZA 5HUAA 4Z2IA 1O6IA 4DH0A 3KAGA 3ARSA 3UF8A 3KAIA 5DO2A 1XHGA 2XP3A 3PR9A 4DIPA 3ARQA 2Q5AA 2MNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y0O A;  2F2D A;  1T11 A;  4MSP A;  3CGM A;  4ODK A;  1ZCN A;  2ZQT A;  2UZ5 A;  1F8A B;  4LAY A;  2JZV A;  1BL4 A;  3O5F A;  4G50 A;  4O2T A;  4U84 A;  4IQC A;  4ODN A;  4TW8 A;  4GGQ A;  2L2S A;  3WH0 A;  2XPA A;  3UQB A;  5HW7 A;  2XPB A;  5DIT A;  2ZQU A;  1JVW A;  1D7I A;  2FAP A;  2LPV A;  3CGN A;  3O5R A;  4ODQ A;  1NSG A;  1JNT A;  2N87 A;  3UI6 A;  4BF8 A;  2IF4 A;  1QPL A;  3O5M A;  1NMW A;  5GPG A;  3JYJ A;  4DT4 A;  1F40 A;  4J4O A;  4JFJ A;  4JFL A;  5HKG A;  1KT0 A;  1PIN A;  4J4N A;  5HW6 A;  1YW5 A;  5HWC A;  4DRQ A;  1FKF A;  1Q1C A;  2DG4 A;  4GIV A;  1Q6U A;  4QT3 A;  4QIB A;  4FN2 A;  2RSE A;  4ODL A;  3UQI A;  1EYM A;  1A7X A;  2D9F A;  3UQA A;  2F4E A;  1U79 A;  1Q6I A;  1TCO C;  2VCD A;  2XP9 A;  3O5G A;  3O5Q A;  2LGO A;  3GPK A;  5HTG A;  1FJD A;  1HXV A;  4W9Q A;  4LAX A;  3TC5 A;  4DRI A;  1Q6H A;  1FKT A;  2ITK A;  1FKD A;  1J4H A;  2K8I A;  2VN1 A;  4TNS A;  4ODP A;  2DG9 A;  3EY6 A;  3PRB A;  1ROU A;  3RGC A;  3KAH A;  2KGJ A;  1L1P A;  5DIV A;  1D7J A;  1FKJ A;  3JXV A;  3PRD A;  2LKN A;  2KO7 A;  1FAP A;  3FAP A;  3O5P A;  2Y78 A;  3VAW A;  2PV2 A;  1W26 A;  4ITZ A;  1NMV A;  2F21 A;  2PPP A;  4IPX A;  3KAD A;  1BKF A;  2MF9 A;  3PA7 A;  4NNR A;  2RQS A;  5HW8 A;  1P5Q A;  2FKE A;  3JYM A;  2M1I A;  1J4I A;  1QPF A;  3KZ7 A;  1D7H A;  2ZR4 A;  4DZ3 A;  1M5Y A;  2M2A A;  2ZQV A;  1FKG A;  1KT1 A;  2PBC A;  4ODO A;  2DG3 A;  4N19 A;  4TX0 A;  3O5O A;  3NRK A;  3IKD A;  5J6E A;  4QT2 A;  1ZK6 A;  2XP5 A;  4JFI A;  5HWB A;  4ODR A;  3NI6 A;  2PV3 A;  3LUO A;  4JYS A;  2RUC A;  1C9H A;  3TDB A;  2ZR5 A;  2ZQS A;  1N1A A;  3B7X A;  3IHZ A;  3KAC A;  2OFN A;  3KAF A;  4TW6 A;  4TW7 A;  1J4R A;  2MLY A;  2MLX A;  3O5I A;  3KAB A;  3MDY B;  1FKH A;  3O5D A;  3NTP A;  4U85 A;  1FKB A;  1JNS A;  2M08 A;  1J6Y A;  4R0X A;  1EQ3 A;  1ROT A;  2XP6 A;  1FKL A;  1R9H A;  4DRN A;  4W9O A;  2MLZ A;  3OOB A;  4DRP A;  4DRO A;  2AWG A;  4DZ2 A;  2PPO A;  4G2P A;  4LAW A;  5BXJ A;  2XP7 A;  1B6C A;  2XP4 A;  4W9P A;  4C02 B;  5D75 A;  2KR7 A;  3ODK A;  4IQ2 A;  2ZR6 A;  4ODM A;  4FAP A;  2PPN A;  4TYO A;  3IKG A;  1FKS A;  1PBK A;  2KE0 A;  2XP8 A;  5HT1 A;  2RUD A;  1D6O A;  2PV1 A;  3O5L A;  5I98 A;  1FKK A;  3UI4 A;  3IK8 A;  4JFK A;  5DIU A;  2MPH A;  3O5K A;  2LJ4 A;  3RFW A;  1YAT A;  3O5E A;  2KI3 A;  4JFM A;  1FKR A;  2RUR A;  3TCZ A;  5HUA A;  4DH0 A;  2KFW A;  1QZ2 A;  3KAG A;  3KCE A;  3UI5 A;  3UF8 A;  4DRJ A;  4DRH A;  3O5J A;  1FKI A;  1FD9 A;  3KAI A;  3I6C A;  5B8I C;  2XP3 A;  4DRM A;  2RUQ A;  3H9R B;  4U86 A;  4DIP A;  2Q5A A;  4LAV A;  4DRK A;  2MNT A;  4MGV A; 
#chains in the Genus database with same CATH topology
 4MSP A;  2YBT A;  4G50 A;  2IUZ A;  2DSZ A;  4LGX A;  1JVW A;  1LL4 A;  4ZPT R;  1NMW A;  3JYJ A;  1NWR A;  1ITX A;  4WKA A;  5HKG A;  1PIN A;  4J4N A;  1WB0 A;  4DRQ A;  4AY1 A;  4IT4 A;  4GIV A;  1Q6U A;  4QT3 A;  3UQI A;  1EYM A;  3EIP A;  1U79 A;  1TCO C;  2VCD A;  3O5G A;  1W1P A;  4Z2G A;  4MTV A;  4DWS A;  2QF8 A;  2EUL A;  4LAX A;  1HXV A;  1Q6H A;  1ZL1 A;  4TNS A;  1VF8 A;  1L1P A;  1E6Z A;  2KGJ A;  1W1V A;  3O5P A;  2PV2 A;  4ITZ A;  3KAD A;  2MF9 A;  3ARZ A;  1P5Q A;  2B31 A;  2M1I A;  1J4I A;  4DZ3 A;  2O9O A;  1X6N A;  1FKG A;  1KT1 A;  1IX5 A;  4N19 A;  1WAW A;  1W9U A;  2PV3 A;  3LUO A;  2RUC A;  1HKM A;  2WM0 A;  1E6P A;  2ZR5 A;  3B7X A;  4TW6 A;  2MLY A;  1FKH A;  3O5D A;  3NTP A;  2A3E A;  4HBO A;  1NWU A;  4R0X A;  4Q22 A;  1ROT A;  1OGB A;  3ARV A;  1FKL A;  4G2P A;  2DPE A;  2XP7 A;  2KR7 A;  4ODM A;  2PPN A;  3ARY A;  1PBK A;  2WLY A;  1D6O A;  1SYT A;  1NWS A;  3CZ8 A;  4HAR A;  4MPK A;  3RFW A;  1GPF A;  4MNJ A;  2KFW A;  2PI6 A;  3B8S A;  3GU0 A;  1GUV A;  3O5J A;  1FKI A;  1FD9 A;  1HJV A;  4MNM A;  1TFV A;  4ODP A;  4DRK A;  2F2D A;  3CGM A;  1JNE A;  3WD1 A;  2UZ5 A;  2WK2 A;  1SR0 A;  4ODN A;  4HBE A;  2L2S A;  3WIJ A;  1RD6 A;  2FAP A;  3AS1 A;  3O5R A;  3AQU A;  3UI6 A;  2OLH A;  3G6L A;  1HJW A;  5GPG A;  4DWS C;  1HKJ A;  3ARU A;  3ALG A;  1YW5 A;  2P4V A;  1FKF A;  1Q1C A;  4ML4 A;  1FFR A;  4FN2 A;  3O5Q A;  4QZV B;  2LGO A;  5HTG A;  3OA5 A;  1FJD A;  4DRI A;  3FXY A;  4DWS D;  1FKT A;  4Z2K A;  1FKD A;  4WKF A;  1J4H A;  2K8I A;  2VN1 A;  2A3C A;  3EY6 A;  3PRA A;  3CHC A;  3KAH A;  4Z2L A;  1D2K A;  3AS2 A;  3PRD A;  4NZC A;  3B9E A;  4W5U A;  1NMV A;  3WKZ A;  2FKE A;  1D7H A;  1LL7 A;  1H0I A;  2ZR4 A;  2M2A A;  2ZQV A;  2G41 A;  4KR0 B;  2B5U B;  3GTY X;  1W9V A;  1ZK6 A;  4JFI A;  5HWB A;  3NI6 A;  2DT0 A;  3RM8 A;  3FY1 A;  4WJX A;  1ZU8 A;  2OFN A;  5GPR A;  1W1T A;  3KAF A;  4TW7 A;  3RM9 A;  4URI A;  3KAB A;  3MDY B;  3WD0 A;  1FKB A;  2DT3 A;  3ALF A;  1EQ3 A;  4ZPV R;  2XP6 A;  4DRN A;  1JND A;  3OOB A;  4W9P A;  2AOS A;  2XP4 A;  5D75 A;  3CHF A;  3ODK A;  4P8U A;  4IQ2 A;  2DSV A;  3IKG A;  1FKS A;  5HT1 A;  4WKH A;  2MPH A;  2LJ4 A;  3O5E A;  1ZBV A;  4JFM A;  2A3B A;  4L3N A;  1QZ2 A;  3KCE A;  3AS0 A;  4DRH A;  3I6C A;  5B8I C;  4DRM A;  4U86 A;  4Z2J A;  2G8Z A;  4MGV A;  1OGG A;  1T11 A;  3AS3 A;  4ODK A;  1ZCN A;  2ZQT A;  1E15 A;  1F8A B;  4LAY A;  2JZV A;  1BL4 A;  1GRJ A;  4TW8 A;  1W9P A;  5DIT A;  2ZQU A;  4ODQ A;  1GOI A;  4BF8 A;  3CGN A;  5BXJ A;  1JNT A;  2DSU A;  1QPL A;  4DT4 A;  1HKK A;  3WD3 A;  3ARR A;  1KT0 A;  3W4R A;  2DG4 A;  3CH9 A;  1W1Y A;  1XRV A;  4ODL A;  1A7X A;  2D9F A;  2XP9 A;  2ITK A;  3PRB A;  1LL6 A;  1WNO A;  4DWS B;  1D7J A;  4ZPW R;  1FKJ A;  1UR9 A;  1FAP A;  3FAP A;  2Y78 A;  3VAW A;  1JCH B;  1FFQ A;  2F21 A;  1H0G A;  4NNR A;  3WL1 A;  3PA7 A;  3ARW A;  1QPF A;  3KZ7 A;  3WD2 A;  4ODO A;  2DG3 A;  3O5O A;  3NRK A;  3WL0 A;  3ART A;  4QT2 A;  2ESC A;  4S3K A;  4ODR A;  4JYS A;  3KAC A;  3BMB A;  2FDM A;  3O5I A;  3WQV A;  4U85 A;  1ZBW A;  4WK9 A;  1J6Y A;  4P8X A;  2DSW A;  4W9O A;  2MLZ A;  4DZ2 A;  1EIB A;  1HKI A;  4C02 B;  2YBU A;  4XAK A;  1E6N A;  2ZR6 A;  4FAP A;  4TYO A;  2KE0 A;  2XP8 A;  1ZB5 A;  3B9D A;  5I98 A;  3UI4 A;  1OWQ A;  3IK8 A;  5DIU A;  3O5K A;  1YAT A;  1FKR A;  2KI3 A;  2DT1 A;  2RUR A;  1LJY A;  4UDM A;  3UI5 A;  4DRJ A;  1ZBK A;  3RM4 A;  1LG2 A;  4MAV A;  4MNK A;  2RUQ A;  3H9R B;  4P8W A;  4MNL A;  4LAV A;  1E44 A;  1Y0O A;  4ZS6 A;  1EHN A;  3O5F A;  4U84 A;  4O2T A;  4IQC A;  1NH6 A;  4GGQ A;  4S3J A;  2XPA A;  3WH0 A;  5HW7 A;  3UQB A;  2XPB A;  1D7I A;  1LQ0 A;  2LPV A;  1E6R A;  1NSG A;  2N87 A;  2IF4 A;  3O5M A;  5GQB A;  1F40 A;  4IT6 A;  4J4O A;  2ETN A;  4WIW A;  4JFJ A;  4JFL A;  3G6M A;  5HW6 A;  5DF0 A;  5HWC A;  1NWT A;  4NSB A;  3ARX A;  4QIB A;  2RSE A;  1K9T A;  3UQA A;  2F4E A;  1Q6I A;  3QOK A;  4Q7N A;  5HBF A;  3GPK A;  4W9Q A;  3TC5 A;  4PTM A;  2DG9 A;  3CHD A;  1ROU A;  3RGC A;  5DIV A;  3JXV A;  3RME A;  1E9L A;  2LKN A;  3WD4 A;  2KO7 A;  5DEZ A;  3CHE A;  4R5E A;  2O92 A;  1W26 A;  1X6L A;  2PPP A;  4IPX A;  1BKF A;  1LG1 A;  2F23 A;  5HW8 A;  2RQS A;  3ARO A;  3JYM A;  3ARP A;  3BXW A;  1M5Y A;  2DT2 A;  2PBC A;  4TX0 A;  4KQZ A;  4L72 B;  5J6E A;  3IKD A;  3WQW A;  2XP5 A;  1KFW A;  1C9H A;  2WLZ A;  4P8V A;  3TDB A;  2ZQS A;  1N1A A;  3IHZ A;  1UR8 A;  1J4R A;  2MLX A;  2A3A A;  1JNS A;  3B9A A;  1EDQ A;  2M08 A;  1HJX A;  1CTN A;  2PN0 A;  5JH8 A;  1R9H A;  4DRP A;  1ZBC A;  4DRO A;  2AWG A;  2PPO A;  4LAW A;  4Z2H A;  1B6C A;  2RUD A;  2PV1 A;  3O5L A;  1FKK A;  4JFK A;  3TCZ A;  5HUA A;  4Z2I A;  1O6I A;  4DH0 A;  3KAG A;  3ARS A;  3UF8 A;  3KAI A;  5DO2 A;  1XHG A;  2XP3 A;  3PR9 A;  4DIP A;  3ARQ A;  2Q5A A;  2MNT A; 
#chains in the Genus database with same CATH homology
 4MSP A;  2YBT A;  4G50 A;  2IUZ A;  2DSZ A;  4LGX A;  1JVW A;  1LL4 A;  4ZPT R;  1NMW A;  3JYJ A;  1NWR A;  1ITX A;  4WKA A;  5HKG A;  1PIN A;  4J4N A;  1WB0 A;  4DRQ A;  4AY1 A;  4IT4 A;  4GIV A;  1Q6U A;  4QT3 A;  3UQI A;  1EYM A;  1U79 A;  1TCO C;  2VCD A;  3O5G A;  1W1P A;  4Z2G A;  4MTV A;  4DWS A;  2QF8 A;  1HXV A;  4LAX A;  1Q6H A;  1ZL1 A;  4TNS A;  1VF8 A;  1L1P A;  1E6Z A;  2KGJ A;  1W1V A;  3O5P A;  2PV2 A;  4ITZ A;  3KAD A;  2MF9 A;  3ARZ A;  1P5Q A;  2B31 A;  2M1I A;  1J4I A;  4DZ3 A;  2O9O A;  1X6N A;  1FKG A;  1KT1 A;  1IX5 A;  4N19 A;  1WAW A;  1W9U A;  2PV3 A;  3LUO A;  2RUC A;  1HKM A;  2WM0 A;  1E6P A;  2ZR5 A;  3B7X A;  4TW6 A;  2MLY A;  1FKH A;  3O5D A;  3NTP A;  2A3E A;  4HBO A;  1NWU A;  4R0X A;  4Q22 A;  1ROT A;  1OGB A;  3ARV A;  1FKL A;  4G2P A;  2DPE A;  2XP7 A;  2KR7 A;  4ODM A;  2PPN A;  3ARY A;  1PBK A;  2WLY A;  1D6O A;  1SYT A;  1NWS A;  3CZ8 A;  4HAR A;  4MPK A;  3RFW A;  1GPF A;  4MNJ A;  2KFW A;  2PI6 A;  3B8S A;  1GUV A;  3O5J A;  1FKI A;  1FD9 A;  1HJV A;  4MNM A;  1TFV A;  4ODP A;  4DRK A;  2F2D A;  3CGM A;  1JNE A;  3WD1 A;  2UZ5 A;  2WK2 A;  1SR0 A;  4ODN A;  4HBE A;  2L2S A;  3WIJ A;  1RD6 A;  2FAP A;  3AS1 A;  3O5R A;  3AQU A;  3UI6 A;  2OLH A;  3G6L A;  1HJW A;  5GPG A;  4DWS C;  1HKJ A;  3ARU A;  3ALG A;  1YW5 A;  1FKF A;  1Q1C A;  4ML4 A;  1FFR A;  4FN2 A;  3O5Q A;  4QZV B;  2LGO A;  5HTG A;  3OA5 A;  1FJD A;  4DRI A;  3FXY A;  4DWS D;  1FKT A;  4Z2K A;  1FKD A;  4WKF A;  1J4H A;  2K8I A;  2VN1 A;  2A3C A;  3EY6 A;  3PRA A;  3CHC A;  3KAH A;  4Z2L A;  1D2K A;  3AS2 A;  3PRD A;  4NZC A;  3B9E A;  4W5U A;  1NMV A;  3WKZ A;  2FKE A;  1D7H A;  1LL7 A;  1H0I A;  2ZR4 A;  2M2A A;  2ZQV A;  2G41 A;  4KR0 B;  1W9V A;  1ZK6 A;  4JFI A;  5HWB A;  3NI6 A;  2DT0 A;  3RM8 A;  3FY1 A;  4WJX A;  1ZU8 A;  2OFN A;  5GPR A;  1W1T A;  3KAF A;  4TW7 A;  3RM9 A;  4URI A;  3KAB A;  3MDY B;  3WD0 A;  1FKB A;  2DT3 A;  3ALF A;  1EQ3 A;  4ZPV R;  2XP6 A;  4DRN A;  1JND A;  3OOB A;  4W9P A;  2AOS A;  2XP4 A;  5D75 A;  3CHF A;  3ODK A;  4P8U A;  4IQ2 A;  2DSV A;  3IKG A;  1FKS A;  5HT1 A;  4WKH A;  2MPH A;  2LJ4 A;  3O5E A;  1ZBV A;  4JFM A;  2A3B A;  4L3N A;  1QZ2 A;  3KCE A;  3AS0 A;  4DRH A;  3I6C A;  5B8I C;  4DRM A;  4U86 A;  4Z2J A;  2G8Z A;  4MGV A;  1OGG A;  1T11 A;  3AS3 A;  4ODK A;  1ZCN A;  2ZQT A;  1E15 A;  1F8A B;  4LAY A;  2JZV A;  1BL4 A;  4TW8 A;  1W9P A;  5DIT A;  2ZQU A;  4ODQ A;  1GOI A;  4BF8 A;  3CGN A;  5BXJ A;  1JNT A;  2DSU A;  1QPL A;  4DT4 A;  1HKK A;  3WD3 A;  3ARR A;  1KT0 A;  3W4R A;  2DG4 A;  3CH9 A;  1W1Y A;  1XRV A;  4ODL A;  1A7X A;  2D9F A;  2XP9 A;  2ITK A;  3PRB A;  1LL6 A;  1WNO A;  4DWS B;  1D7J A;  4ZPW R;  1FKJ A;  1UR9 A;  1FAP A;  3FAP A;  2Y78 A;  3VAW A;  1FFQ A;  2F21 A;  1H0G A;  4NNR A;  3WL1 A;  3PA7 A;  3ARW A;  1QPF A;  3KZ7 A;  3WD2 A;  4ODO A;  2DG3 A;  3O5O A;  3NRK A;  3WL0 A;  3ART A;  4QT2 A;  2ESC A;  4S3K A;  4ODR A;  4JYS A;  3KAC A;  2FDM A;  3O5I A;  3WQV A;  4U85 A;  1ZBW A;  4WK9 A;  1J6Y A;  4P8X A;  2DSW A;  4W9O A;  2MLZ A;  4DZ2 A;  1EIB A;  1HKI A;  4C02 B;  2YBU A;  4XAK A;  1E6N A;  2ZR6 A;  4FAP A;  4TYO A;  2KE0 A;  2XP8 A;  1ZB5 A;  3B9D A;  5I98 A;  3UI4 A;  1OWQ A;  3IK8 A;  5DIU A;  3O5K A;  1YAT A;  1FKR A;  2KI3 A;  2DT1 A;  2RUR A;  1LJY A;  3UI5 A;  4DRJ A;  1ZBK A;  3RM4 A;  1LG2 A;  4MAV A;  4MNK A;  2RUQ A;  3H9R B;  4P8W A;  4MNL A;  4LAV A;  1Y0O A;  4ZS6 A;  1EHN A;  3O5F A;  4U84 A;  4O2T A;  4IQC A;  1NH6 A;  4GGQ A;  4S3J A;  2XPA A;  3WH0 A;  5HW7 A;  3UQB A;  2XPB A;  1D7I A;  1LQ0 A;  2LPV A;  1E6R A;  1NSG A;  2N87 A;  2IF4 A;  3O5M A;  5GQB A;  1F40 A;  4IT6 A;  4J4O A;  4WIW A;  4JFJ A;  4JFL A;  3G6M A;  5HW6 A;  5DF0 A;  5HWC A;  1NWT A;  4NSB A;  3ARX A;  4QIB A;  2RSE A;  1K9T A;  3UQA A;  2F4E A;  1Q6I A;  3QOK A;  4Q7N A;  5HBF A;  3GPK A;  4W9Q A;  3TC5 A;  4PTM A;  2DG9 A;  3CHD A;  1ROU A;  3RGC A;  5DIV A;  3JXV A;  3RME A;  1E9L A;  2LKN A;  3WD4 A;  2KO7 A;  5DEZ A;  3CHE A;  4R5E A;  2O92 A;  1W26 A;  1X6L A;  2PPP A;  4IPX A;  1BKF A;  1LG1 A;  5HW8 A;  2RQS A;  3ARO A;  3JYM A;  3ARP A;  3BXW A;  1M5Y A;  2DT2 A;  2PBC A;  4TX0 A;  4KQZ A;  4L72 B;  5J6E A;  3IKD A;  3WQW A;  2XP5 A;  1KFW A;  1C9H A;  2WLZ A;  4P8V A;  3TDB A;  2ZQS A;  1N1A A;  3IHZ A;  1UR8 A;  1J4R A;  2MLX A;  2A3A A;  1JNS A;  3B9A A;  1EDQ A;  2M08 A;  1HJX A;  1CTN A;  5JH8 A;  1R9H A;  4DRP A;  1ZBC A;  4DRO A;  2AWG A;  2PPO A;  4LAW A;  4Z2H A;  1B6C A;  2RUD A;  2PV1 A;  3O5L A;  1FKK A;  4JFK A;  3TCZ A;  5HUA A;  4Z2I A;  1O6I A;  4DH0 A;  3KAG A;  3ARS A;  3UF8 A;  3KAI A;  5DO2 A;  1XHG A;  2XP3 A;  3PR9 A;  4DIP A;  3ARQ A;  2Q5A A;  2MNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...