4DZ3A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation m61h from burkholderia pseudomallei complexed with fk506
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGHVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz3A00
4DRKA 4ITZA 4U84A 3RFWA 4U85A 2F2DA 1QPLA 4DH0A 1Q1CA 4ODKA 4DRHA 2M1IA 1FKTA 4J4NA 2M08A 4TW8A 3O5LA 1FKFA 1PBKA 2KE0A 4DROA 4LAWA 2M2AA 5HWBA 3IHZA 1B6CA 2ZR5A 3TC5A 5HUAA 2F4EA 5J6EA 3JYJA 1YW5A 3IK8A 3KAIA 4NNRA 2PV1A 3KAFA 5DITA 1FKRA 2MLZA 2XP4A 3EY6A 3KADA 1ROUA 3KZ7A 3JYMA 1J4IA 2MPHA 1F8AB 3PA7A 2KO7A 1J4RA 3UF8A 2RSEA 1HXVA 2ZR4A 2RUCA 4FN2A 4DIPA 5B8IC 5I98A 2VCDA 1F40A 2AWGA 4ODMA 2DG3A 4ODLA 4DZ3A 4ODPA 2OFNA 1FJDA 2RQSA 3O5RA 3O5JA 3GPKA 1FKBA 2LKNA 1A7XA 2ZR6A 4QT2A 4TW7A 3CGNA 4QIBA 3TDBA 1D7HA 2XPAA 2VN1A 1P5QA 2XP7A 5HWCA 4JFJA 3UI6A 1FKHA 1FKLA 3IKDA 5HKGA 2Y78A 3IKGA 4JYSA 1ZK6A 1Q6HA 1JVWA 3LUOA 1FKGA 3KCEA 3O5KA 4TX0A 4TYOA 5BXJA 5HW6A 2XP5A 1JNTA 4TNSA 4R0XA 1D7IA 4IPXA 1EQ3A 2IF4A 3KACA 2DG9A 2MF9A 4JFKA 5GPGA 1J4HA 1Q6UA 1FD9A 2KI3A 3PRBA 3ODKA 2F21A 4W9QA 2PV2A 1R9HA 4LAYA 4ODRA 3CGMA 4DRNA 3OOBA 1PINA 2ZQSA 2XP9A 2D9FA 1N1AA 1Y0OA 4W9PA 1L1PA 1FAPA 5D75A 3UI4A 5HT1A 2RUDA 4MGVA 3O5IA 4GIVA 2Q5AA 1YATA 5DIUA 2LGOA 4LAXA 3NI6A 4QT3A 1FKJA 3NRKA 2XPBA 5DIVA 1FKIA 4FAPA 3UQAA 2PV3A 2ZQUA 4DT4A 2PBCA 2ZQTA 3RGCA 4LAVA 4MSPA 4O2TA 3UI5A 3TCZA 2L2SA 5HW8A 3FAPA 2N87A 1ROTA 1KT1A 4IQ2A 3O5QA 1KT0A 1BKFA 2JZVA 4G2PA 4GGQA 4JFIA 4ODNA 4J4OA 2XP6A 1J6YA 1NMWA 3VAWA 1M5YA 2FAPA 3WH0A 3NTPA 1NSGA 3UQBA 1JNSA 4DRMA 1FKSA 2ZQVA 4ODQA 4TW6A 2FKEA 2KR7A 4N19A 2MLYA 3I6CA 3JXVA 1NMVA 2UZ5A 2KFWA 1Q6IA 3UQIA 1QPFA 4W9OA 3O5EA 2LPVA 4ODOA 2PPNA 4DRJA 3KABA 4G50A 5HW7A 2MNTA 3H9RB 3O5MA 4DRQA 1U79A 1BL4A 1TCOC 3O5FA 1T11A 2K8IA 2DG4A 1C9HA 2XP3A 1ZCNA 3PRDA 4JFMA 1QZ2A 2PPPA 4U86A 4DZ2A 3O5OA 5HTGA 4DRIA 4JFLA 3O5PA 2KGJA 1FKDA 2RURA 1W26A 1FKKA 2XP8A 3O5GA 2RUQA 4C02B 3O5DA 2ITKA 4BF8A 3KAHA 2PPOA 3B7XA 3KAGA 4IQCA 4DRPA 1D6OA 1EYMA 2MLXA 2LJ4A 3MDYB 1D7JA
chains in the Genus database with same CATH superfamily
4ITZA 3ARTA 1EIBA 3RFWA 4U85A 2F2DA 4DH0A 1Q1CA 4DRHA 2M1IA 1KFWA 4TW8A 2M08A 4Z2KA 1FKFA 2KE0A 3WL0A 3CHEA 4LAWA 1HKKA 3AS1A 3WKZA 3RM8A 4XAKA 4NNRA 3JYMA 2MPHA 1F8AB 3WIJA 4FN2A 2AWGA 2OFNA 2RQSA 1HJWA 1W1TA 3CHDA 1A7XA 3PRAA 4QT2A 2F23A 1P5QA 3IKDA 1HJVA 4Q7NA 2DT3A 1HJXA 1FKGA 3KCEA 3B9AA 4S3KA 3ARXA 3WL1A 4JFKA 3ARRA 1FD9A 2F21A 1R9HA 4LAYA 3CGMA 4DRNA 1PINA 3ARUA 2D9FA 4WKHA 3GTYX 3AQUA 4GIVA 1NH6A 3NI6A 1FKJA 2XPBA 3UQAA 1ZBCA 2DSWA 1ZBWA 2PV3A 2B31A 2ZQTA 1FFQA 3RGCA 4MSPA 1H0IA 1JCHB 2L2SA 5HW8A 3FAPA 2N87A 2ETNA 3WD1A 4GGQA 4JFIA 1NMWA 3FXYA 2ZQVA 5DO2A 4TW6A 1IX5A 3I6CA 3EIPA 4MPKA 3B9EA 4P8XA 1QPFA 4W9OA 1ZU8A 3KABA 5HW7A 1WB0A 4DRQA 3O5MA 1VF8A 2EULA 2DSVA 1T11A 1ZCNA 2A3BA 4DZ2A 1NWSA 3BXWA 4JFLA 2KGJA 3ARWA 4ZPVR 2XP8A 3O5GA 4C02B 4BF8A 3WQWA 3B7XA 4IQCA 5GQBA 5JH8A 3W4RA 3CHCA 2G8ZA 4L72B 4J4NA 1E6NA 5J6EA 4W5UA 3IK8A 4Z2GA 1WNOA 2MLZA 3EY6A 1ROUA 1J4IA 1LL4A 1X6LA 1HXVA 2RSEA 4DIPA 2RUCA 4DZ3A 3O5RA 1EHNA 2PI6A 2DT1A 2LKNA 3RM9A 5DEZA 1LG2A 1OGBA 2QF8A 3CGNA 4QIBA 3TDBA 3B9DA 2XPAA 2VN1A 5HWCA 3UI6A 1FKLA 5HKGA 2Y78A 4JYSA 1ZK6A 1Q6HA 1JVWA 2AOSA 4TX0A 4TYOA 3WD2A 2XP5A 3ALFA 4IPXA 1HKMA 1E6ZA 3PRBA 3ODKA 4W9QA 2ESCA 5HBFA 2ZQSA 4DWSB 4W9PA 1E44A 4Z2JA 3UI4A 4ZS6A 3CH9A 4MGVA 1LL6A 2WM0A 4QT3A 3GU0A 3AS0A 2DSZA 4LAVA 4O2TA 4HBEA 3G6MA 3BMBA 1OGGA 3O5QA 1BKFA 2JZVA 4G2PA 4MNJA 3G6LA 4J4OA 1SR0A 3VAWA 4Z2HA 1NSGA 4DRMA 2O9OA 4ODQA 3ARQA 1W1PA 1EDQA 1NMVA 1H0GA 1NWUA 2UZ5A 2KFWA 3O5EA 2LPVA 4ODOA 1U79A 3ARVA 4P8VA 2WK2A 4WIWA 2K8IA 4P8UA 4JFMA 1W9PA 1UR8A 2PPPA 1XHGA 3O5OA 5HTGA 3O5PA 1FKDA 3WD4A 2ITKA 2PPOA 3CHFA 1D6OA 1W1VA 1D7JA 4DWSC 2OLHA 4MNMA 4ODKA 1CTNA 1PBKA 1LL7A 1UR9A 3PR9A 1E6RA 2M2AA 5HWBA 2B5UB 3IHZA 2ZR5A 5HUAA 2F4EA 3RMEA 1YW5A 1FKRA 5DITA 4DWSA 3KADA 4Q22A 3UF8A 1J4RA 4Z2LA 2ZR4A 1F40A 2DG3A 1LQ0A 1ITXA 4ODPA 4ZPWR 3WD3A 3O5JA 3GPKA 2P4VA 4NZCA 3ARSA 1D7HA 2XP7A 4JFJA 3IKGA 3ARYA 3LUOA 5HW6A 2A3AA 1JNTA 1TFVA 4WKAA 2IF4A 3KACA 2DG9A 1O6IA 2MF9A 5GPGA 1J4HA 2O92A 2KI3A 2PV2A 2G41A 4DWSD 2XP9A 2DSUA 2WLZA 5HT1A 4NSBA 1YATA 5DIUA 4ML4A 4QZVB 3ALGA 4MTVA 3NRKA 5DIVA 4FAPA 1K9TA 1GUVA 1E15A 1WAWA 4IT6A 4DT4A 4UDMA 1GOIA 3UI5A 2PN0A 3TCZA 1ROTA 1KT1A 1OWQA 4IQ2A 1ZB5A 2XP6A 1M5YA 4AY1A 3WH0A 1JNSA 5GPRA 4L3NA 1GRJA 2KR7A 4N19A 2MLYA 1ZBVA 1Q6IA 4WKFA 4WK9A 3UQIA 4MNLA 4DRJA 4G50A 3H9RB 1JNEA 1BL4A 1TCOC 1E6PA 1C9HA 2XP3A 3PRDA 4DRIA 3OA5A 3KAHA 3KAGA 4WJXA 1HKIA 2LJ4A 4R5EA 4DRKA 2FDMA 4U84A 3CZ8A 1QPLA 3ARPA 1FKTA 1SYTA 4URIA 3O5LA 1LJYA 1X6NA 2A3EA 4DROA 3RM4A 1B6CA 3TC5A 3WD0A 3JYJA 3KAIA 1NWTA 2PV1A 3KAFA 5DF0A 2XP4A 3KZ7A 3PA7A 1LG1A 2KO7A 4PTMA 5B8IC 2VCDA 4ODMA 1FJDA 4ODLA 1FKBA 2ZR6A 3AROA 4TW7A 1RD6A 3FY1A 1FKHA 2DPEA 4LGXA 3O5KA 1E9LA 5BXJA 4TNSA 4R0XA 1D7IA 1FFRA 3WQVA 1EQ3A 4HBOA 1GPFA 4IT4A 1Q6UA 3AS2A 4HARA 4ODRA 2DT2A 3OOBA 4P8WA 1L1PA 1N1AA 1Y0OA 1FAPA 5D75A 2RUDA 1JNDA 2YBTA 3O5IA 2Q5AA 2LGOA 1ZBKA 4LAXA 1FKIA 2YBUA 2ZQUA 1W1YA 2PBCA 2A3CA 2WLYA 4KR0B 4ODNA 1KT0A 1XRVA 1J6YA 3AS3A 3ARZA 2FAPA 4MAVA 3NTPA 3UQBA 1W9VA 1FKSA 2FKEA 1W9UA 3JXVA 1NWRA 2DT0A 5I98A 2PPNA 3B8SA 2MNTA 1ZL1A 4Z2IA 4S3JA 3QOKA 1D2KA 3O5FA 2DG4A 4MNKA 4U86A 1QZ2A 2IUZA 1HKJA 2RURA 1W26A 1FKKA 2RUQA 3O5DA 4KQZA 4DRPA 1EYMA 2MLXA 4ZPTR 3MDYB
chains in the Genus database with same CATH topology
4ITZA 3ARTA 1EIBA 3RFWA 4U85A 2F2DA 4DH0A 1Q1CA 4DRHA 2M1IA 1KFWA 4TW8A 2M08A 4Z2KA 1FKFA 2KE0A 3WL0A 3CHEA 4LAWA 1HKKA 3AS1A 3WKZA 3RM8A 4XAKA 4NNRA 3JYMA 2MPHA 1F8AB 3WIJA 4FN2A 2AWGA 2OFNA 2RQSA 1HJWA 1W1TA 3CHDA 1A7XA 3PRAA 4QT2A 1P5QA 3IKDA 1HJVA 4Q7NA 2DT3A 1HJXA 1FKGA 3KCEA 3B9AA 4S3KA 3ARXA 3WL1A 4JFKA 3ARRA 1FD9A 2F21A 1R9HA 4LAYA 3CGMA 4DRNA 1PINA 3ARUA 2D9FA 4WKHA 3AQUA 4GIVA 1NH6A 3NI6A 1FKJA 2XPBA 3UQAA 1ZBCA 2DSWA 1ZBWA 2PV3A 2B31A 2ZQTA 1FFQA 3RGCA 4MSPA 1H0IA 2L2SA 5HW8A 3FAPA 2N87A 3WD1A 4GGQA 4JFIA 1NMWA 3FXYA 2ZQVA 5DO2A 4TW6A 1IX5A 3I6CA 4MPKA 3B9EA 4P8XA 1QPFA 4W9OA 1ZU8A 3KABA 5HW7A 1WB0A 4DRQA 3O5MA 1VF8A 2DSVA 1T11A 1ZCNA 2A3BA 4DZ2A 1NWSA 3BXWA 4JFLA 2KGJA 3ARWA 4ZPVR 2XP8A 3O5GA 4C02B 4BF8A 3WQWA 3B7XA 4IQCA 5GQBA 5JH8A 3W4RA 3CHCA 2G8ZA 4L72B 4J4NA 1E6NA 5J6EA 4W5UA 3IK8A 4Z2GA 1WNOA 2MLZA 3EY6A 1ROUA 1J4IA 1LL4A 1X6LA 1HXVA 2RSEA 4DIPA 2RUCA 4DZ3A 3O5RA 1EHNA 2PI6A 2DT1A 2LKNA 3RM9A 5DEZA 1LG2A 1OGBA 2QF8A 3CGNA 4QIBA 3TDBA 3B9DA 2XPAA 2VN1A 5HWCA 3UI6A 1FKLA 5HKGA 2Y78A 4JYSA 1ZK6A 1Q6HA 1JVWA 2AOSA 4TX0A 4TYOA 3WD2A 2XP5A 3ALFA 4IPXA 1HKMA 1E6ZA 3PRBA 3ODKA 4W9QA 2ESCA 5HBFA 2ZQSA 4DWSB 4W9PA 4Z2JA 3UI4A 4ZS6A 3CH9A 4MGVA 1LL6A 2WM0A 4QT3A 3AS0A 2DSZA 4LAVA 4O2TA 4HBEA 3G6MA 1OGGA 3O5QA 1BKFA 2JZVA 4G2PA 4MNJA 3G6LA 4J4OA 1SR0A 3VAWA 4Z2HA 1NSGA 4DRMA 2O9OA 4ODQA 3ARQA 1W1PA 1EDQA 1NMVA 1H0GA 1NWUA 2UZ5A 2KFWA 3O5EA 2LPVA 4ODOA 1U79A 3ARVA 4P8VA 2WK2A 4WIWA 2K8IA 4P8UA 4JFMA 1W9PA 1UR8A 2PPPA 1XHGA 3O5OA 5HTGA 3O5PA 1FKDA 3WD4A 2ITKA 2PPOA 3CHFA 1D6OA 1W1VA 1D7JA 4DWSC 2OLHA 4MNMA 4ODKA 1CTNA 1PBKA 1LL7A 1UR9A 3PR9A 1E6RA 2M2AA 5HWBA 3IHZA 2ZR5A 5HUAA 2F4EA 3RMEA 1YW5A 1FKRA 5DITA 4DWSA 3KADA 4Q22A 3UF8A 1J4RA 4Z2LA 2ZR4A 1F40A 2DG3A 1LQ0A 1ITXA 4ODPA 4ZPWR 3WD3A 3O5JA 3GPKA 4NZCA 3ARSA 1D7HA 2XP7A 4JFJA 3IKGA 3ARYA 3LUOA 5HW6A 2A3AA 1JNTA 1TFVA 4WKAA 2IF4A 3KACA 2DG9A 1O6IA 2MF9A 5GPGA 1J4HA 2O92A 2KI3A 2PV2A 2G41A 4DWSD 2XP9A 2DSUA 2WLZA 5HT1A 4NSBA 1YATA 5DIUA 4ML4A 4QZVB 3ALGA 4MTVA 3NRKA 5DIVA 4FAPA 1K9TA 1GUVA 1E15A 1WAWA 4IT6A 4DT4A 1GOIA 3UI5A 3TCZA 1ROTA 1KT1A 1OWQA 4IQ2A 1ZB5A 2XP6A 1M5YA 4AY1A 3WH0A 1JNSA 5GPRA 4L3NA 2KR7A 4N19A 2MLYA 1ZBVA 1Q6IA 4WKFA 4WK9A 3UQIA 4MNLA 4DRJA 4G50A 3H9RB 1JNEA 1BL4A 1TCOC 1E6PA 1C9HA 2XP3A 3PRDA 4DRIA 3OA5A 3KAHA 3KAGA 4WJXA 1HKIA 2LJ4A 4R5EA 4DRKA 2FDMA 4U84A 3CZ8A 1QPLA 3ARPA 1FKTA 1SYTA 4URIA 3O5LA 1LJYA 1X6NA 2A3EA 4DROA 3RM4A 1B6CA 3TC5A 3WD0A 3JYJA 3KAIA 1NWTA 2PV1A 3KAFA 5DF0A 2XP4A 3KZ7A 3PA7A 1LG1A 2KO7A 4PTMA 5B8IC 2VCDA 4ODMA 1FJDA 4ODLA 1FKBA 2ZR6A 3AROA 4TW7A 1RD6A 3FY1A 1FKHA 2DPEA 4LGXA 3O5KA 1E9LA 5BXJA 4TNSA 4R0XA 1D7IA 1FFRA 3WQVA 1EQ3A 4HBOA 1GPFA 4IT4A 1Q6UA 3AS2A 4HARA 4ODRA 2DT2A 3OOBA 4P8WA 1L1PA 1N1AA 1Y0OA 1FAPA 5D75A 2RUDA 1JNDA 2YBTA 3O5IA 2Q5AA 2LGOA 1ZBKA 4LAXA 1FKIA 2YBUA 2ZQUA 1W1YA 2PBCA 2A3CA 2WLYA 4KR0B 4ODNA 1KT0A 1XRVA 1J6YA 3AS3A 3ARZA 2FAPA 4MAVA 3NTPA 3UQBA 1W9VA 1FKSA 2FKEA 1W9UA 3JXVA 1NWRA 2DT0A 5I98A 2PPNA 3B8SA 2MNTA 1ZL1A 4Z2IA 4S3JA 3QOKA 1D2KA 3O5FA 2DG4A 4MNKA 4U86A 1QZ2A 2IUZA 1HKJA 2RURA 1W26A 1FKKA 2RUQA 3O5DA 4KQZA 4DRPA 1EYMA 2MLXA 4ZPTR 3MDYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DRK A;  4ITZ A;  4U84 A;  3RFW A;  4U85 A;  2F2D A;  1QPL A;  4DH0 A;  1Q1C A;  4ODK A;  4DRH A;  2M1I A;  1FKT A;  4J4N A;  2M08 A;  4TW8 A;  3O5L A;  1FKF A;  1PBK A;  2KE0 A;  4DRO A;  4LAW A;  2M2A A;  5HWB A;  3IHZ A;  1B6C A;  2ZR5 A;  3TC5 A;  5HUA A;  2F4E A;  5J6E A;  3JYJ A;  1YW5 A;  3IK8 A;  3KAI A;  4NNR A;  2PV1 A;  3KAF A;  5DIT A;  1FKR A;  2MLZ A;  2XP4 A;  3EY6 A;  3KAD A;  1ROU A;  3KZ7 A;  3JYM A;  1J4I A;  2MPH A;  1F8A B;  3PA7 A;  2KO7 A;  1J4R A;  3UF8 A;  2RSE A;  1HXV A;  2ZR4 A;  2RUC A;  4FN2 A;  4DIP A;  5B8I C;  5I98 A;  2VCD A;  1F40 A;  2AWG A;  4ODM A;  2DG3 A;  4ODL A;  4DZ3 A;  4ODP A;  2OFN A;  1FJD A;  2RQS A;  3O5R A;  3O5J A;  3GPK A;  1FKB A;  2LKN A;  1A7X A;  2ZR6 A;  4QT2 A;  4TW7 A;  3CGN A;  4QIB A;  3TDB A;  1D7H A;  2XPA A;  2VN1 A;  1P5Q A;  2XP7 A;  5HWC A;  4JFJ A;  3UI6 A;  1FKH A;  1FKL A;  3IKD A;  5HKG A;  2Y78 A;  3IKG A;  4JYS A;  1ZK6 A;  1Q6H A;  1JVW A;  3LUO A;  1FKG A;  3KCE A;  3O5K A;  4TX0 A;  4TYO A;  5BXJ A;  5HW6 A;  2XP5 A;  1JNT A;  4TNS A;  4R0X A;  1D7I A;  4IPX A;  1EQ3 A;  2IF4 A;  3KAC A;  2DG9 A;  2MF9 A;  4JFK A;  5GPG A;  1J4H A;  1Q6U A;  1FD9 A;  2KI3 A;  3PRB A;  3ODK A;  2F21 A;  4W9Q A;  2PV2 A;  1R9H A;  4LAY A;  4ODR A;  3CGM A;  4DRN A;  3OOB A;  1PIN A;  2ZQS A;  2XP9 A;  2D9F A;  1N1A A;  1Y0O A;  4W9P A;  1L1P A;  1FAP A;  5D75 A;  3UI4 A;  5HT1 A;  2RUD A;  4MGV A;  3O5I A;  4GIV A;  2Q5A A;  1YAT A;  5DIU A;  2LGO A;  4LAX A;  3NI6 A;  4QT3 A;  1FKJ A;  3NRK A;  2XPB A;  5DIV A;  1FKI A;  4FAP A;  3UQA A;  2PV3 A;  2ZQU A;  4DT4 A;  2PBC A;  2ZQT A;  3RGC A;  4LAV A;  4MSP A;  4O2T A;  3UI5 A;  3TCZ A;  2L2S A;  5HW8 A;  3FAP A;  2N87 A;  1ROT A;  1KT1 A;  4IQ2 A;  3O5Q A;  1KT0 A;  1BKF A;  2JZV A;  4G2P A;  4GGQ A;  4JFI A;  4ODN A;  4J4O A;  2XP6 A;  1J6Y A;  1NMW A;  3VAW A;  1M5Y A;  2FAP A;  3WH0 A;  3NTP A;  1NSG A;  3UQB A;  1JNS A;  4DRM A;  1FKS A;  2ZQV A;  4ODQ A;  4TW6 A;  2FKE A;  2KR7 A;  4N19 A;  2MLY A;  3I6C A;  3JXV A;  1NMV A;  2UZ5 A;  2KFW A;  1Q6I A;  3UQI A;  1QPF A;  4W9O A;  3O5E A;  2LPV A;  4ODO A;  2PPN A;  4DRJ A;  3KAB A;  4G50 A;  5HW7 A;  2MNT A;  3H9R B;  3O5M A;  4DRQ A;  1U79 A;  1BL4 A;  1TCO C;  3O5F A;  1T11 A;  2K8I A;  2DG4 A;  1C9H A;  2XP3 A;  1ZCN A;  3PRD A;  4JFM A;  1QZ2 A;  2PPP A;  4U86 A;  4DZ2 A;  3O5O A;  5HTG A;  4DRI A;  4JFL A;  3O5P A;  2KGJ A;  1FKD A;  2RUR A;  1W26 A;  1FKK A;  2XP8 A;  3O5G A;  2RUQ A;  4C02 B;  3O5D A;  2ITK A;  4BF8 A;  3KAH A;  2PPO A;  3B7X A;  3KAG A;  4IQC A;  4DRP A;  1D6O A;  1EYM A;  2MLX A;  2LJ4 A;  3MDY B;  1D7J A; 
#chains in the Genus database with same CATH topology
 4ITZ A;  3ART A;  1EIB A;  3RFW A;  4U85 A;  2F2D A;  4DH0 A;  1Q1C A;  4DRH A;  2M1I A;  1KFW A;  4TW8 A;  2M08 A;  4Z2K A;  1FKF A;  2KE0 A;  3WL0 A;  3CHE A;  4LAW A;  1HKK A;  3AS1 A;  3WKZ A;  3RM8 A;  4XAK A;  4NNR A;  3JYM A;  2MPH A;  1F8A B;  3WIJ A;  4FN2 A;  2AWG A;  2OFN A;  2RQS A;  1HJW A;  1W1T A;  3CHD A;  1A7X A;  3PRA A;  4QT2 A;  2F23 A;  1P5Q A;  3IKD A;  1HJV A;  4Q7N A;  2DT3 A;  1HJX A;  1FKG A;  3KCE A;  3B9A A;  4S3K A;  3ARX A;  3WL1 A;  4JFK A;  3ARR A;  1FD9 A;  2F21 A;  1R9H A;  4LAY A;  3CGM A;  4DRN A;  1PIN A;  3ARU A;  2D9F A;  4WKH A;  3GTY X;  3AQU A;  4GIV A;  1NH6 A;  3NI6 A;  1FKJ A;  2XPB A;  3UQA A;  1ZBC A;  2DSW A;  1ZBW A;  2PV3 A;  2B31 A;  2ZQT A;  1FFQ A;  3RGC A;  4MSP A;  1H0I A;  1JCH B;  2L2S A;  5HW8 A;  3FAP A;  2N87 A;  2ETN A;  3WD1 A;  4GGQ A;  4JFI A;  1NMW A;  3FXY A;  2ZQV A;  5DO2 A;  4TW6 A;  1IX5 A;  3I6C A;  3EIP A;  4MPK A;  3B9E A;  4P8X A;  1QPF A;  4W9O A;  1ZU8 A;  3KAB A;  5HW7 A;  1WB0 A;  4DRQ A;  3O5M A;  1VF8 A;  2EUL A;  2DSV A;  1T11 A;  1ZCN A;  2A3B A;  4DZ2 A;  1NWS A;  3BXW A;  4JFL A;  2KGJ A;  3ARW A;  4ZPV R;  2XP8 A;  3O5G A;  4C02 B;  4BF8 A;  3WQW A;  3B7X A;  4IQC A;  5GQB A;  5JH8 A;  3W4R A;  3CHC A;  2G8Z A;  4L72 B;  4J4N A;  1E6N A;  5J6E A;  4W5U A;  3IK8 A;  4Z2G A;  1WNO A;  2MLZ A;  3EY6 A;  1ROU A;  1J4I A;  1LL4 A;  1X6L A;  1HXV A;  2RSE A;  4DIP A;  2RUC A;  4DZ3 A;  3O5R A;  1EHN A;  2PI6 A;  2DT1 A;  2LKN A;  3RM9 A;  5DEZ A;  1LG2 A;  1OGB A;  2QF8 A;  3CGN A;  4QIB A;  3TDB A;  3B9D A;  2XPA A;  2VN1 A;  5HWC A;  3UI6 A;  1FKL A;  5HKG A;  2Y78 A;  4JYS A;  1ZK6 A;  1Q6H A;  1JVW A;  2AOS A;  4TX0 A;  4TYO A;  3WD2 A;  2XP5 A;  3ALF A;  4IPX A;  1HKM A;  1E6Z A;  3PRB A;  3ODK A;  4W9Q A;  2ESC A;  5HBF A;  2ZQS A;  4DWS B;  4W9P A;  1E44 A;  4Z2J A;  3UI4 A;  4ZS6 A;  3CH9 A;  4MGV A;  1LL6 A;  2WM0 A;  4QT3 A;  3GU0 A;  3AS0 A;  2DSZ A;  4LAV A;  4O2T A;  4HBE A;  3G6M A;  3BMB A;  1OGG A;  3O5Q A;  1BKF A;  2JZV A;  4G2P A;  4MNJ A;  3G6L A;  4J4O A;  1SR0 A;  3VAW A;  4Z2H A;  1NSG A;  4DRM A;  2O9O A;  4ODQ A;  3ARQ A;  1W1P A;  1EDQ A;  1NMV A;  1H0G A;  1NWU A;  2UZ5 A;  2KFW A;  3O5E A;  2LPV A;  4ODO A;  1U79 A;  3ARV A;  4P8V A;  2WK2 A;  4WIW A;  2K8I A;  4P8U A;  4JFM A;  1W9P A;  1UR8 A;  2PPP A;  1XHG A;  3O5O A;  5HTG A;  3O5P A;  1FKD A;  3WD4 A;  2ITK A;  2PPO A;  3CHF A;  1D6O A;  1W1V A;  1D7J A;  4DWS C;  2OLH A;  4MNM A;  4ODK A;  1CTN A;  1PBK A;  1LL7 A;  1UR9 A;  3PR9 A;  1E6R A;  2M2A A;  5HWB A;  2B5U B;  3IHZ A;  2ZR5 A;  5HUA A;  2F4E A;  3RME A;  1YW5 A;  1FKR A;  5DIT A;  4DWS A;  3KAD A;  4Q22 A;  3UF8 A;  1J4R A;  4Z2L A;  2ZR4 A;  1F40 A;  2DG3 A;  1LQ0 A;  1ITX A;  4ODP A;  4ZPW R;  3WD3 A;  3O5J A;  3GPK A;  2P4V A;  4NZC A;  3ARS A;  1D7H A;  2XP7 A;  4JFJ A;  3IKG A;  3ARY A;  3LUO A;  5HW6 A;  2A3A A;  1JNT A;  1TFV A;  4WKA A;  2IF4 A;  3KAC A;  2DG9 A;  1O6I A;  2MF9 A;  5GPG A;  1J4H A;  2O92 A;  2KI3 A;  2PV2 A;  2G41 A;  4DWS D;  2XP9 A;  2DSU A;  2WLZ A;  5HT1 A;  4NSB A;  1YAT A;  5DIU A;  4ML4 A;  4QZV B;  3ALG A;  4MTV A;  3NRK A;  5DIV A;  4FAP A;  1K9T A;  1GUV A;  1E15 A;  1WAW A;  4IT6 A;  4DT4 A;  4UDM A;  1GOI A;  3UI5 A;  2PN0 A;  3TCZ A;  1ROT A;  1KT1 A;  1OWQ A;  4IQ2 A;  1ZB5 A;  2XP6 A;  1M5Y A;  4AY1 A;  3WH0 A;  1JNS A;  5GPR A;  4L3N A;  1GRJ A;  2KR7 A;  4N19 A;  2MLY A;  1ZBV A;  1Q6I A;  4WKF A;  4WK9 A;  3UQI A;  4MNL A;  4DRJ A;  4G50 A;  3H9R B;  1JNE A;  1BL4 A;  1TCO C;  1E6P A;  1C9H A;  2XP3 A;  3PRD A;  4DRI A;  3OA5 A;  3KAH A;  3KAG A;  4WJX A;  1HKI A;  2LJ4 A;  4R5E A;  4DRK A;  2FDM A;  4U84 A;  3CZ8 A;  1QPL A;  3ARP A;  1FKT A;  1SYT A;  4URI A;  3O5L A;  1LJY A;  1X6N A;  2A3E A;  4DRO A;  3RM4 A;  1B6C A;  3TC5 A;  3WD0 A;  3JYJ A;  3KAI A;  1NWT A;  2PV1 A;  3KAF A;  5DF0 A;  2XP4 A;  3KZ7 A;  3PA7 A;  1LG1 A;  2KO7 A;  4PTM A;  5B8I C;  2VCD A;  4ODM A;  1FJD A;  4ODL A;  1FKB A;  2ZR6 A;  3ARO A;  4TW7 A;  1RD6 A;  3FY1 A;  1FKH A;  2DPE A;  4LGX A;  3O5K A;  1E9L A;  5BXJ A;  4TNS A;  4R0X A;  1D7I A;  1FFR A;  3WQV A;  1EQ3 A;  4HBO A;  1GPF A;  4IT4 A;  1Q6U A;  3AS2 A;  4HAR A;  4ODR A;  2DT2 A;  3OOB A;  4P8W A;  1L1P A;  1N1A A;  1Y0O A;  1FAP A;  5D75 A;  2RUD A;  1JND A;  2YBT A;  3O5I A;  2Q5A A;  2LGO A;  1ZBK A;  4LAX A;  1FKI A;  2YBU A;  2ZQU A;  1W1Y A;  2PBC A;  2A3C A;  2WLY A;  4KR0 B;  4ODN A;  1KT0 A;  1XRV A;  1J6Y A;  3AS3 A;  3ARZ A;  2FAP A;  4MAV A;  3NTP A;  3UQB A;  1W9V A;  1FKS A;  2FKE A;  1W9U A;  3JXV A;  1NWR A;  2DT0 A;  5I98 A;  2PPN A;  3B8S A;  2MNT A;  1ZL1 A;  4Z2I A;  4S3J A;  3QOK A;  1D2K A;  3O5F A;  2DG4 A;  4MNK A;  4U86 A;  1QZ2 A;  2IUZ A;  1HKJ A;  2RUR A;  1W26 A;  1FKK A;  2RUQ A;  3O5D A;  4KQZ A;  4DRP A;  1EYM A;  2MLX A;  4ZPT R;  3MDY B; 
#chains in the Genus database with same CATH homology
 4ITZ A;  3ART A;  1EIB A;  3RFW A;  4U85 A;  2F2D A;  4DH0 A;  1Q1C A;  4DRH A;  2M1I A;  1KFW A;  4TW8 A;  2M08 A;  4Z2K A;  1FKF A;  2KE0 A;  3WL0 A;  3CHE A;  4LAW A;  1HKK A;  3AS1 A;  3WKZ A;  3RM8 A;  4XAK A;  4NNR A;  3JYM A;  2MPH A;  1F8A B;  3WIJ A;  4FN2 A;  2AWG A;  2OFN A;  2RQS A;  1HJW A;  1W1T A;  3CHD A;  1A7X A;  3PRA A;  4QT2 A;  1P5Q A;  3IKD A;  1HJV A;  4Q7N A;  2DT3 A;  1HJX A;  1FKG A;  3KCE A;  3B9A A;  4S3K A;  3ARX A;  3WL1 A;  4JFK A;  3ARR A;  1FD9 A;  2F21 A;  1R9H A;  4LAY A;  3CGM A;  4DRN A;  1PIN A;  3ARU A;  2D9F A;  4WKH A;  3AQU A;  4GIV A;  1NH6 A;  3NI6 A;  1FKJ A;  2XPB A;  3UQA A;  1ZBC A;  2DSW A;  1ZBW A;  2PV3 A;  2B31 A;  2ZQT A;  1FFQ A;  3RGC A;  4MSP A;  1H0I A;  2L2S A;  5HW8 A;  3FAP A;  2N87 A;  3WD1 A;  4GGQ A;  4JFI A;  1NMW A;  3FXY A;  2ZQV A;  5DO2 A;  4TW6 A;  1IX5 A;  3I6C A;  4MPK A;  3B9E A;  4P8X A;  1QPF A;  4W9O A;  1ZU8 A;  3KAB A;  5HW7 A;  1WB0 A;  4DRQ A;  3O5M A;  1VF8 A;  2DSV A;  1T11 A;  1ZCN A;  2A3B A;  4DZ2 A;  1NWS A;  3BXW A;  4JFL A;  2KGJ A;  3ARW A;  4ZPV R;  2XP8 A;  3O5G A;  4C02 B;  4BF8 A;  3WQW A;  3B7X A;  4IQC A;  5GQB A;  5JH8 A;  3W4R A;  3CHC A;  2G8Z A;  4L72 B;  4J4N A;  1E6N A;  5J6E A;  4W5U A;  3IK8 A;  4Z2G A;  1WNO A;  2MLZ A;  3EY6 A;  1ROU A;  1J4I A;  1LL4 A;  1X6L A;  1HXV A;  2RSE A;  4DIP A;  2RUC A;  4DZ3 A;  3O5R A;  1EHN A;  2PI6 A;  2DT1 A;  2LKN A;  3RM9 A;  5DEZ A;  1LG2 A;  1OGB A;  2QF8 A;  3CGN A;  4QIB A;  3TDB A;  3B9D A;  2XPA A;  2VN1 A;  5HWC A;  3UI6 A;  1FKL A;  5HKG A;  2Y78 A;  4JYS A;  1ZK6 A;  1Q6H A;  1JVW A;  2AOS A;  4TX0 A;  4TYO A;  3WD2 A;  2XP5 A;  3ALF A;  4IPX A;  1HKM A;  1E6Z A;  3PRB A;  3ODK A;  4W9Q A;  2ESC A;  5HBF A;  2ZQS A;  4DWS B;  4W9P A;  4Z2J A;  3UI4 A;  4ZS6 A;  3CH9 A;  4MGV A;  1LL6 A;  2WM0 A;  4QT3 A;  3AS0 A;  2DSZ A;  4LAV A;  4O2T A;  4HBE A;  3G6M A;  1OGG A;  3O5Q A;  1BKF A;  2JZV A;  4G2P A;  4MNJ A;  3G6L A;  4J4O A;  1SR0 A;  3VAW A;  4Z2H A;  1NSG A;  4DRM A;  2O9O A;  4ODQ A;  3ARQ A;  1W1P A;  1EDQ A;  1NMV A;  1H0G A;  1NWU A;  2UZ5 A;  2KFW A;  3O5E A;  2LPV A;  4ODO A;  1U79 A;  3ARV A;  4P8V A;  2WK2 A;  4WIW A;  2K8I A;  4P8U A;  4JFM A;  1W9P A;  1UR8 A;  2PPP A;  1XHG A;  3O5O A;  5HTG A;  3O5P A;  1FKD A;  3WD4 A;  2ITK A;  2PPO A;  3CHF A;  1D6O A;  1W1V A;  1D7J A;  4DWS C;  2OLH A;  4MNM A;  4ODK A;  1CTN A;  1PBK A;  1LL7 A;  1UR9 A;  3PR9 A;  1E6R A;  2M2A A;  5HWB A;  3IHZ A;  2ZR5 A;  5HUA A;  2F4E A;  3RME A;  1YW5 A;  1FKR A;  5DIT A;  4DWS A;  3KAD A;  4Q22 A;  3UF8 A;  1J4R A;  4Z2L A;  2ZR4 A;  1F40 A;  2DG3 A;  1LQ0 A;  1ITX A;  4ODP A;  4ZPW R;  3WD3 A;  3O5J A;  3GPK A;  4NZC A;  3ARS A;  1D7H A;  2XP7 A;  4JFJ A;  3IKG A;  3ARY A;  3LUO A;  5HW6 A;  2A3A A;  1JNT A;  1TFV A;  4WKA A;  2IF4 A;  3KAC A;  2DG9 A;  1O6I A;  2MF9 A;  5GPG A;  1J4H A;  2O92 A;  2KI3 A;  2PV2 A;  2G41 A;  4DWS D;  2XP9 A;  2DSU A;  2WLZ A;  5HT1 A;  4NSB A;  1YAT A;  5DIU A;  4ML4 A;  4QZV B;  3ALG A;  4MTV A;  3NRK A;  5DIV A;  4FAP A;  1K9T A;  1GUV A;  1E15 A;  1WAW A;  4IT6 A;  4DT4 A;  1GOI A;  3UI5 A;  3TCZ A;  1ROT A;  1KT1 A;  1OWQ A;  4IQ2 A;  1ZB5 A;  2XP6 A;  1M5Y A;  4AY1 A;  3WH0 A;  1JNS A;  5GPR A;  4L3N A;  2KR7 A;  4N19 A;  2MLY A;  1ZBV A;  1Q6I A;  4WKF A;  4WK9 A;  3UQI A;  4MNL A;  4DRJ A;  4G50 A;  3H9R B;  1JNE A;  1BL4 A;  1TCO C;  1E6P A;  1C9H A;  2XP3 A;  3PRD A;  4DRI A;  3OA5 A;  3KAH A;  3KAG A;  4WJX A;  1HKI A;  2LJ4 A;  4R5E A;  4DRK A;  2FDM A;  4U84 A;  3CZ8 A;  1QPL A;  3ARP A;  1FKT A;  1SYT A;  4URI A;  3O5L A;  1LJY A;  1X6N A;  2A3E A;  4DRO A;  3RM4 A;  1B6C A;  3TC5 A;  3WD0 A;  3JYJ A;  3KAI A;  1NWT A;  2PV1 A;  3KAF A;  5DF0 A;  2XP4 A;  3KZ7 A;  3PA7 A;  1LG1 A;  2KO7 A;  4PTM A;  5B8I C;  2VCD A;  4ODM A;  1FJD A;  4ODL A;  1FKB A;  2ZR6 A;  3ARO A;  4TW7 A;  1RD6 A;  3FY1 A;  1FKH A;  2DPE A;  4LGX A;  3O5K A;  1E9L A;  5BXJ A;  4TNS A;  4R0X A;  1D7I A;  1FFR A;  3WQV A;  1EQ3 A;  4HBO A;  1GPF A;  4IT4 A;  1Q6U A;  3AS2 A;  4HAR A;  4ODR A;  2DT2 A;  3OOB A;  4P8W A;  1L1P A;  1N1A A;  1Y0O A;  1FAP A;  5D75 A;  2RUD A;  1JND A;  2YBT A;  3O5I A;  2Q5A A;  2LGO A;  1ZBK A;  4LAX A;  1FKI A;  2YBU A;  2ZQU A;  1W1Y A;  2PBC A;  2A3C A;  2WLY A;  4KR0 B;  4ODN A;  1KT0 A;  1XRV A;  1J6Y A;  3AS3 A;  3ARZ A;  2FAP A;  4MAV A;  3NTP A;  3UQB A;  1W9V A;  1FKS A;  2FKE A;  1W9U A;  3JXV A;  1NWR A;  2DT0 A;  5I98 A;  2PPN A;  3B8S A;  2MNT A;  1ZL1 A;  4Z2I A;  4S3J A;  3QOK A;  1D2K A;  3O5F A;  2DG4 A;  4MNK A;  4U86 A;  1QZ2 A;  2IUZ A;  1HKJ A;  2RUR A;  1W26 A;  1FKK A;  2RUQ A;  3O5D A;  4KQZ A;  4DRP A;  1EYM A;  2MLX A;  4ZPT R;  3MDY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...