4DZ3A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation m61h from burkholderia pseudomallei complexed with fk506
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGHVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz3A00
4ODRA 1FKGA 5DITA 3KACA 3VAWA 1J4IA 2PPOA 4FN2A 2MLXA 2RURA 3CGNA 3KZ7A 1HXVA 1BL4A 1Q1CA 1M5YA 2ZR5A 2MF9A 4U84A 3UQAA 3KABA 3O5MA 2ZR6A 3KADA 3JYJA 3JYMA 2VCDA 4ODLA 4DIPA 5HKGA 2F4EA 2XP3A 2AWGA 3O5OA 4MSPA 1YATA 2XP8A 4DRJA 1ROTA 2XP6A 2ZQSA 1W26A 4TYOA 4DT4A 1FD9A 2LPVA 3RGCA 3O5IA 2F2DA 2KE0A 1D6OA 1FKLA 2XP5A 1FKSA 3NTPA 2F21A 1FKIA 3UQBA 4TNSA 4U86A 1NSGA 4DRNA 1KT1A 4DRMA 5HWCA 3O5LA 4N19A 2KO7A 1FKKA 1Q6HA 4DRKA 2RUQA 2KFWA 3O5DA 4GGQA 4O2TA 1NMVA 3UI6A 5BXJA 5HW6A 4W9PA 5HUAA 1FKTA 1P5QA 3PRDA 5HT1A 1FKDA 1FKJA 2LGOA 2ITKA 4IQCA 5HW7A 4J4OA 2OFNA 1JNTA 1QZ2A 2KGJA 4R0XA 3LUOA 4TX0A 2PV2A 4LAVA 3OOBA 3PA7A 4JYSA 4DZ2A 1FKRA 4QT3A 2XP4A 1R9HA 4ODQA 4NNRA 4C02B 2DG4A 3ODKA 1JVWA 2L2SA 2M1IA 3UI4A 5HTGA 2D9FA 2PV3A 2IF4A 3NRKA 3PRBA 4MGVA 4ODNA 3TDBA 4DRIA 1QPFA 2XP9A 2RUCA 3O5JA 4FAPA 3RFWA 2Q5AA 1F40A 1JNSA 1L1PA 3CGMA 1YW5A 2PV1A 3IK8A 2FAPA 1C9HA 2K8IA 4IQ2A 2MNTA 3GPKA 5B8IC 2XP7A 2Y78A 4G2PA 1ZCNA 3KAGA 4LAWA 4ODOA 4TW8A 4W9QA 4W9OA 3TCZA 3IHZA 5GPGA 1U79A 2LKNA 1KT0A 2ZQUA 4DZ3A 3KCEA 4TW6A 2MLYA 4TW7A 3IKGA 1F8AB 3FAPA 3O5RA 3UI5A 1ZK6A 2PPNA 5D75A 4ODKA 2KI3A 1Y0OA 4QT2A 2UZ5A 1FKHA 2DG9A 1BKFA 3IKDA 4JFMA 2PPPA 1FAPA 2ZQTA 4JFKA 4JFIA 4QIBA 1TCOC 2VN1A 3O5GA 3O5FA 3NI6A 3UF8A 2DG3A 2FKEA 3WH0A 2XPAA 2MPHA 1B6CA 1D7HA 2M08A 2XPBA 3MDYB 4G50A 1ROUA 4J4NA 2ZQVA 4JFJA 2RSEA 1J6YA 2MLZA 2N87A 4GIVA 4DRPA 1FKBA 3KAHA 4LAYA 4ODMA 1EYMA 4ODPA 1EQ3A 1PINA 1FKFA 1Q6IA 3JXVA 4DRHA 4ITZA 4JFLA 3KAIA 2JZVA 1J4RA 5HWBA 2ZR4A 1D7IA 1D7JA 5I98A 1QPLA 1A7XA 3KAFA 5DIUA 3O5PA 4DH0A 1NMWA 5HW8A 5DIVA 2RUDA 1Q6UA 2KR7A 2LJ4A 3B7XA 4LAXA 4BF8A 3O5EA 3I6CA 4IPXA 3TC5A 1T11A 4DRQA 4U85A 3UQIA 3H9RB 3EY6A 2M2AA 3O5QA 4DROA 5J6EA 3O5KA 2RQSA 1J4HA 1PBKA 1N1AA 1FJDA 2PBCA
chains in the Genus database with same CATH superfamily
2A3EA 1RD6A 3FY1A 1LL7A 2PPOA 2MLXA 1FFQA 3CGNA 2MF9A 4DIPA 3JYMA 2VCDA 3FXYA 2XP3A 2ZQSA 2F2DA 4Z2IA 1ZBVA 1FKIA 4Q22A 4MPKA 4U86A 1NSGA 4DRNA 4MNJA 4N19A 2KO7A 1UR9A 4GGQA 4O2TA 1NMVA 3UI6A 4MNMA 4URIA 1CTNA 4NZCA 3AS3A 3RM4A 1FKJA 2LGOA 2ITKA 2OFNA 4TX0A 3WQWA 1UR8A 4LAVA 3B8SA 1LL4A 1R9HA 2DG4A 5HTGA 1ZBKA 4Z2KA 3NRKA 4ODNA 4DRIA 1TFVA 1NWRA 2FAPA 3GPKA 4W9QA 4ZPVR 1WAWA 1NWSA 1ZL1A 2P4VA 1ITXA 3IHZA 4L3NA 2ZQUA 3CHDA 2G41A 1GRJA 5D75A 3ALGA 4QT2A 4JFMA 1FAPA 3O5FA 3UF8A 3NI6A 2DT2A 2MPHA 3CZ8A 1FFRA 3PR9A 4J4NA 5GPRA 4GIVA 3PRAA 4XAKA 2ZR4A 1LG2A 4WKHA 1QPLA 2EULA 3ARSA 1W1PA 3GTYX 1D2KA 4DWSB 3O5PA 4UDMA 3O5EA 3I6CA 4IPXA 3H9RB 3ARPA 3O5KA 4WK9A 1N1AA 2PBCA 2A3CA 4ODRA 3WD4A 3ARTA 3KACA 2A3AA 1J4IA 4IT4A 3KZ7A 1HXVA 2WK2A 1Q1CA 1M5YA 2B31A 3O5MA 2ZR6A 3JYJA 5HKGA 2F4EA 4MSPA 2XP8A 1ROTA 1GPFA 2XP6A 1W26A 2ETNA 4P8VA 2DT3A 4DT4A 2DPEA 4QZVB 1D6OA 2F21A 4TNSA 3WD0A 4HBOA 5HWCA 3EIPA 1SYTA 4Z2GA 2KFWA 1ZBWA 3G6MA 4LGXA 3RM9A 1VF8A 3AS0A 5HW6A 1HJWA 1NWUA 1P5QA 1FKDA 4J4OA 1XRVA 3ARWA 2KGJA 5DEZA 3OOBA 4JYSA 1FKRA 4ZPTR 1E6ZA 2XP4A 3CHEA 1W1VA 2L2SA 1X6LA 2M1IA 2D9FA 2PV3A 1EHNA 3TDBA 2XP9A 3O5JA 1W1TA 4R5EA 3CGMA 1YW5A 2XP7A 4ODOA 4LAWA 1ZCNA 4TW8A 3TCZA 1U79A 2LKNA 5JH8A 3KCEA 3IKGA 5DO2A 3UI5A 4Q7NA 2PPNA 2KI3A 3WKZA 1LQ0A 2DG9A 1BKFA 3IKDA 1W1YA 2PPPA 2ZQTA 4ZS6A 1D7HA 2M08A 1ROUA 4JFJA 1J6YA 2RSEA 4P8WA 1E15A 3KAHA 4LAYA 3WL0A 2AOSA 1EYMA 1PINA 1GOIA 3JXVA 4ITZA 4WKFA 1D7IA 1OGGA 2OLHA 3W4RA 1NMWA 4WJXA 1HKJA 2RUDA 5HBFA 4S3JA 4DRQA 3UQIA 3CH9A 1XHGA 2M2AA 4NSBA 5J6EA 3RMEA 1FJDA 2PN0A 1FKGA 5DITA 3VAWA 1W9PA 2RURA 2ZR5A 4U84A 1HJVA 2DSZA 3B9DA 3KABA 3KADA 1E6RA 1YATA 4DRJA 1E6PA 3BXWA 3WD2A 1KFWA 1FD9A 2LPVA 3RGCA 4DWSD 3O5IA 2XP5A 1FKSA 4WIWA 1W9UA 1E6NA 4AY1A 1KT1A 4DRMA 3O5LA 5DF0A 1Q6HA 4DRKA 2RUQA 3O5DA 5HUAA 2O9OA 4W9PA 3WD1A 2G8ZA 4IQCA 1JNTA 1HKIA 1HJXA 2YBTA 2WLZA 1JNEA 4PTMA 4C02B 1ZU8A 1JVWA 3UI4A 4MGVA 1QPFA 2RUCA 1X6NA 1NWTA 4DWSC 2PV1A 2F23A 3IK8A 4IQ2A 1HKMA 2Y78A 3KAGA 4W9OA 1GUVA 1LL6A 1HKKA 3AROA 3B9EA 4TW7A 1F8AB 3FAPA 3O5RA 3ARVA 4P8UA 1ZK6A 1IX5A 4ODKA 2UZ5A 4JFIA 4QIBA 1TCOC 2VN1A 5GQBA 2DG3A 3BMBA 1OWQA 1B6CA 3OA5A 4MAVA 2PI6A 1SR0A 3AS1A 2MLZA 4ODMA 1EQ3A 2DT0A 3B9AA 4Z2LA 2YBUA 3KAIA 1EDQA 5HWBA 3G6LA 1E44A 2O92A 2DSUA 5DIUA 5HW8A 5DIVA 1Q6UA 3ARXA 4BF8A 2IUZA 3WD3A 1EIBA 4DROA 1LG1A 1OGBA 3RM8A 2RQSA 2WM0A 1FKHA 1KT0A 4FN2A 1LJYA 3AQUA 1BL4A 3UQAA 3CHCA 3CHFA 4P8XA 4ODLA 1K9TA 2DSVA 2AWGA 3O5OA 1ZB5A 1JCHB 4TYOA 4L72B 2B5UB 2KE0A 1FKLA 3NTPA 4MNLA 1JNDA 1W9VA 3UQBA 4ZPWR 3ARYA 3ARZA 1WNOA 1FKKA 1H0IA 5BXJA 3ARRA 1FKTA 1WB0A 3PRDA 3QOKA 5HT1A 5HW7A 1QZ2A 4R0XA 4ML4A 3LUOA 1NH6A 2PV2A 3PA7A 4IT6A 4DZ2A 4QT3A 2A3BA 4ODQA 4NNRA 3ODKA 1E9LA 2IF4A 3PRBA 1F40A 4KR0B 1H0GA 3RFWA 2Q5AA 4FAPA 1JNSA 3WIJA 2DSWA 1C9HA 2K8IA 2MNTA 1L1PA 5B8IC 4WKAA 4G2PA 3WL1A 5GPGA 2WLYA 4DWSA 4DZ3A 4TW6A 2MLYA 4Z2JA 1ZBCA 2QF8A 2ESCA 4HARA 4MNKA 1O6IA 1Y0OA 4JFKA 4Z2HA 2FDMA 3O5GA 4W5UA 2FKEA 3WH0A 2XPAA 3AS2A 3ARQA 3MDYB 2XPBA 4G50A 2ZQVA 3GU0A 2N87A 4DRPA 1FKBA 4S3KA 4ODPA 4KQZA 1FKFA 1Q6IA 4DRHA 4JFLA 2JZVA 1J4RA 1D7JA 4HBEA 5I98A 1A7XA 3KAFA 2DT1A 4DH0A 2KR7A 2LJ4A 3ARUA 3B7XA 3ALFA 4LAXA 4MTVA 3TC5A 1T11A 4U85A 3O5QA 3EY6A 1J4HA 1PBKA 3WQVA
chains in the Genus database with same CATH topology
2A3EA 1RD6A 3FY1A 1LL7A 2PPOA 2MLXA 1FFQA 3CGNA 2MF9A 4DIPA 3JYMA 2VCDA 3FXYA 2XP3A 2ZQSA 2F2DA 4Z2IA 1ZBVA 1FKIA 4Q22A 4MPKA 4U86A 1NSGA 4DRNA 4MNJA 4N19A 2KO7A 1UR9A 4GGQA 4O2TA 1NMVA 3UI6A 4MNMA 4URIA 1CTNA 4NZCA 3AS3A 3RM4A 1FKJA 2LGOA 2ITKA 2OFNA 4TX0A 3WQWA 1UR8A 4LAVA 3B8SA 1LL4A 1R9HA 2DG4A 5HTGA 1ZBKA 4Z2KA 3NRKA 4ODNA 4DRIA 1TFVA 1NWRA 2FAPA 3GPKA 4W9QA 4ZPVR 1WAWA 1NWSA 1ZL1A 1ITXA 3IHZA 4L3NA 2ZQUA 3CHDA 2G41A 5D75A 3ALGA 4QT2A 4JFMA 1FAPA 3O5FA 3UF8A 3NI6A 2DT2A 2MPHA 3CZ8A 1FFRA 3PR9A 4J4NA 5GPRA 4GIVA 3PRAA 4XAKA 2ZR4A 1LG2A 4WKHA 1QPLA 3ARSA 1W1PA 1D2KA 4DWSB 3O5PA 3O5EA 3I6CA 4IPXA 3H9RB 3ARPA 3O5KA 4WK9A 1N1AA 2PBCA 2A3CA 4ODRA 3WD4A 3ARTA 3KACA 2A3AA 1J4IA 4IT4A 3KZ7A 1HXVA 2WK2A 1Q1CA 1M5YA 2B31A 3O5MA 2ZR6A 3JYJA 5HKGA 2F4EA 4MSPA 2XP8A 1ROTA 1GPFA 2XP6A 1W26A 4P8VA 2DT3A 4DT4A 2DPEA 4QZVB 1D6OA 2F21A 4TNSA 3WD0A 4HBOA 5HWCA 1SYTA 4Z2GA 2KFWA 1ZBWA 3G6MA 4LGXA 3RM9A 1VF8A 3AS0A 5HW6A 1HJWA 1NWUA 1P5QA 1FKDA 4J4OA 1XRVA 3ARWA 2KGJA 5DEZA 3OOBA 4JYSA 1FKRA 4ZPTR 1E6ZA 2XP4A 3CHEA 1W1VA 2L2SA 1X6LA 2M1IA 2D9FA 2PV3A 1EHNA 3TDBA 2XP9A 3O5JA 1W1TA 4R5EA 3CGMA 1YW5A 2XP7A 4ODOA 4LAWA 1ZCNA 4TW8A 3TCZA 1U79A 2LKNA 5JH8A 3KCEA 3IKGA 5DO2A 3UI5A 4Q7NA 2PPNA 2KI3A 3WKZA 1LQ0A 2DG9A 1BKFA 3IKDA 1W1YA 2PPPA 2ZQTA 4ZS6A 1D7HA 2M08A 1ROUA 4JFJA 1J6YA 2RSEA 4P8WA 1E15A 3KAHA 4LAYA 3WL0A 2AOSA 1EYMA 1PINA 1GOIA 3JXVA 4ITZA 4WKFA 1D7IA 1OGGA 2OLHA 3W4RA 1NMWA 4WJXA 1HKJA 2RUDA 5HBFA 4S3JA 4DRQA 3UQIA 3CH9A 1XHGA 2M2AA 4NSBA 5J6EA 3RMEA 1FJDA 1FKGA 5DITA 3VAWA 1W9PA 2RURA 2ZR5A 4U84A 1HJVA 2DSZA 3B9DA 3KABA 3KADA 1E6RA 1YATA 4DRJA 1E6PA 3BXWA 3WD2A 1KFWA 1FD9A 2LPVA 3RGCA 4DWSD 3O5IA 2XP5A 1FKSA 4WIWA 1W9UA 1E6NA 4AY1A 1KT1A 4DRMA 3O5LA 5DF0A 1Q6HA 4DRKA 2RUQA 3O5DA 5HUAA 2O9OA 4W9PA 3WD1A 2G8ZA 4IQCA 1JNTA 1HKIA 1HJXA 2YBTA 2WLZA 1JNEA 4PTMA 4C02B 1ZU8A 1JVWA 3UI4A 4MGVA 1QPFA 2RUCA 1X6NA 1NWTA 4DWSC 2PV1A 3IK8A 4IQ2A 1HKMA 2Y78A 3KAGA 4W9OA 1GUVA 1LL6A 1HKKA 3AROA 3B9EA 4TW7A 1F8AB 3FAPA 3O5RA 3ARVA 4P8UA 1ZK6A 1IX5A 4ODKA 2UZ5A 4JFIA 4QIBA 1TCOC 2VN1A 5GQBA 2DG3A 1OWQA 1B6CA 3OA5A 4MAVA 2PI6A 1SR0A 3AS1A 2MLZA 4ODMA 1EQ3A 2DT0A 3B9AA 4Z2LA 2YBUA 3KAIA 1EDQA 5HWBA 3G6LA 2O92A 2DSUA 5DIUA 5HW8A 5DIVA 1Q6UA 3ARXA 4BF8A 2IUZA 3WD3A 1EIBA 4DROA 1LG1A 1OGBA 3RM8A 2RQSA 2WM0A 1FKHA 1KT0A 4FN2A 1LJYA 3AQUA 1BL4A 3UQAA 3CHCA 3CHFA 4P8XA 4ODLA 1K9TA 2DSVA 2AWGA 3O5OA 1ZB5A 4TYOA 4L72B 2KE0A 1FKLA 3NTPA 4MNLA 1JNDA 1W9VA 3UQBA 4ZPWR 3ARYA 3ARZA 1WNOA 1FKKA 1H0IA 5BXJA 3ARRA 1FKTA 1WB0A 3PRDA 3QOKA 5HT1A 5HW7A 1QZ2A 4R0XA 4ML4A 3LUOA 1NH6A 2PV2A 3PA7A 4IT6A 4DZ2A 4QT3A 2A3BA 4ODQA 4NNRA 3ODKA 1E9LA 2IF4A 3PRBA 1F40A 4KR0B 1H0GA 3RFWA 2Q5AA 4FAPA 1JNSA 3WIJA 2DSWA 1C9HA 2K8IA 2MNTA 1L1PA 5B8IC 4WKAA 4G2PA 3WL1A 5GPGA 2WLYA 4DWSA 4DZ3A 4TW6A 2MLYA 4Z2JA 1ZBCA 2QF8A 2ESCA 4HARA 4MNKA 1O6IA 1Y0OA 4JFKA 4Z2HA 2FDMA 3O5GA 4W5UA 2FKEA 3WH0A 2XPAA 3AS2A 3ARQA 3MDYB 2XPBA 4G50A 2ZQVA 2N87A 4DRPA 1FKBA 4S3KA 4ODPA 4KQZA 1FKFA 1Q6IA 4DRHA 4JFLA 2JZVA 1J4RA 1D7JA 4HBEA 5I98A 1A7XA 3KAFA 2DT1A 4DH0A 2KR7A 2LJ4A 3ARUA 3B7XA 3ALFA 4LAXA 4MTVA 3TC5A 1T11A 4U85A 3O5QA 3EY6A 1J4HA 1PBKA 3WQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODR A;  1FKG A;  5DIT A;  3KAC A;  3VAW A;  1J4I A;  2PPO A;  4FN2 A;  2MLX A;  2RUR A;  3CGN A;  3KZ7 A;  1HXV A;  1BL4 A;  1Q1C A;  1M5Y A;  2ZR5 A;  2MF9 A;  4U84 A;  3UQA A;  3KAB A;  3O5M A;  2ZR6 A;  3KAD A;  3JYJ A;  3JYM A;  2VCD A;  4ODL A;  4DIP A;  5HKG A;  2F4E A;  2XP3 A;  2AWG A;  3O5O A;  4MSP A;  1YAT A;  2XP8 A;  4DRJ A;  1ROT A;  2XP6 A;  2ZQS A;  1W26 A;  4TYO A;  4DT4 A;  1FD9 A;  2LPV A;  3RGC A;  3O5I A;  2F2D A;  2KE0 A;  1D6O A;  1FKL A;  2XP5 A;  1FKS A;  3NTP A;  2F21 A;  1FKI A;  3UQB A;  4TNS A;  4U86 A;  1NSG A;  4DRN A;  1KT1 A;  4DRM A;  5HWC A;  3O5L A;  4N19 A;  2KO7 A;  1FKK A;  1Q6H A;  4DRK A;  2RUQ A;  2KFW A;  3O5D A;  4GGQ A;  4O2T A;  1NMV A;  3UI6 A;  5BXJ A;  5HW6 A;  4W9P A;  5HUA A;  1FKT A;  1P5Q A;  3PRD A;  5HT1 A;  1FKD A;  1FKJ A;  2LGO A;  2ITK A;  4IQC A;  5HW7 A;  4J4O A;  2OFN A;  1JNT A;  1QZ2 A;  2KGJ A;  4R0X A;  3LUO A;  4TX0 A;  2PV2 A;  4LAV A;  3OOB A;  3PA7 A;  4JYS A;  4DZ2 A;  1FKR A;  4QT3 A;  2XP4 A;  1R9H A;  4ODQ A;  4NNR A;  4C02 B;  2DG4 A;  3ODK A;  1JVW A;  2L2S A;  2M1I A;  3UI4 A;  5HTG A;  2D9F A;  2PV3 A;  2IF4 A;  3NRK A;  3PRB A;  4MGV A;  4ODN A;  3TDB A;  4DRI A;  1QPF A;  2XP9 A;  2RUC A;  3O5J A;  4FAP A;  3RFW A;  2Q5A A;  1F40 A;  1JNS A;  1L1P A;  3CGM A;  1YW5 A;  2PV1 A;  3IK8 A;  2FAP A;  1C9H A;  2K8I A;  4IQ2 A;  2MNT A;  3GPK A;  5B8I C;  2XP7 A;  2Y78 A;  4G2P A;  1ZCN A;  3KAG A;  4LAW A;  4ODO A;  4TW8 A;  4W9Q A;  4W9O A;  3TCZ A;  3IHZ A;  5GPG A;  1U79 A;  2LKN A;  1KT0 A;  2ZQU A;  4DZ3 A;  3KCE A;  4TW6 A;  2MLY A;  4TW7 A;  3IKG A;  1F8A B;  3FAP A;  3O5R A;  3UI5 A;  1ZK6 A;  2PPN A;  5D75 A;  4ODK A;  2KI3 A;  1Y0O A;  4QT2 A;  2UZ5 A;  1FKH A;  2DG9 A;  1BKF A;  3IKD A;  4JFM A;  2PPP A;  1FAP A;  2ZQT A;  4JFK A;  4JFI A;  4QIB A;  1TCO C;  2VN1 A;  3O5G A;  3O5F A;  3NI6 A;  3UF8 A;  2DG3 A;  2FKE A;  3WH0 A;  2XPA A;  2MPH A;  1B6C A;  1D7H A;  2M08 A;  2XPB A;  3MDY B;  4G50 A;  1ROU A;  4J4N A;  2ZQV A;  4JFJ A;  2RSE A;  1J6Y A;  2MLZ A;  2N87 A;  4GIV A;  4DRP A;  1FKB A;  3KAH A;  4LAY A;  4ODM A;  1EYM A;  4ODP A;  1EQ3 A;  1PIN A;  1FKF A;  1Q6I A;  3JXV A;  4DRH A;  4ITZ A;  4JFL A;  3KAI A;  2JZV A;  1J4R A;  5HWB A;  2ZR4 A;  1D7I A;  1D7J A;  5I98 A;  1QPL A;  1A7X A;  3KAF A;  5DIU A;  3O5P A;  4DH0 A;  1NMW A;  5HW8 A;  5DIV A;  2RUD A;  1Q6U A;  2KR7 A;  2LJ4 A;  3B7X A;  4LAX A;  4BF8 A;  3O5E A;  3I6C A;  4IPX A;  3TC5 A;  1T11 A;  4DRQ A;  4U85 A;  3UQI A;  3H9R B;  3EY6 A;  2M2A A;  3O5Q A;  4DRO A;  5J6E A;  3O5K A;  2RQS A;  1J4H A;  1PBK A;  1N1A A;  1FJD A;  2PBC A; 
#chains in the Genus database with same CATH topology
 2A3E A;  1RD6 A;  3FY1 A;  1LL7 A;  2PPO A;  2MLX A;  1FFQ A;  3CGN A;  2MF9 A;  4DIP A;  3JYM A;  2VCD A;  3FXY A;  2XP3 A;  2ZQS A;  2F2D A;  4Z2I A;  1ZBV A;  1FKI A;  4Q22 A;  4MPK A;  4U86 A;  1NSG A;  4DRN A;  4MNJ A;  4N19 A;  2KO7 A;  1UR9 A;  4GGQ A;  4O2T A;  1NMV A;  3UI6 A;  4MNM A;  4URI A;  1CTN A;  4NZC A;  3AS3 A;  3RM4 A;  1FKJ A;  2LGO A;  2ITK A;  2OFN A;  4TX0 A;  3WQW A;  1UR8 A;  4LAV A;  3B8S A;  1LL4 A;  1R9H A;  2DG4 A;  5HTG A;  1ZBK A;  4Z2K A;  3NRK A;  4ODN A;  4DRI A;  1TFV A;  1NWR A;  2FAP A;  3GPK A;  4W9Q A;  4ZPV R;  1WAW A;  1NWS A;  1ZL1 A;  2P4V A;  1ITX A;  3IHZ A;  4L3N A;  2ZQU A;  3CHD A;  2G41 A;  1GRJ A;  5D75 A;  3ALG A;  4QT2 A;  4JFM A;  1FAP A;  3O5F A;  3UF8 A;  3NI6 A;  2DT2 A;  2MPH A;  3CZ8 A;  1FFR A;  3PR9 A;  4J4N A;  5GPR A;  4GIV A;  3PRA A;  4XAK A;  2ZR4 A;  1LG2 A;  4WKH A;  1QPL A;  2EUL A;  3ARS A;  1W1P A;  3GTY X;  1D2K A;  4DWS B;  3O5P A;  4UDM A;  3O5E A;  3I6C A;  4IPX A;  3H9R B;  3ARP A;  3O5K A;  4WK9 A;  1N1A A;  2PBC A;  2A3C A;  4ODR A;  3WD4 A;  3ART A;  3KAC A;  2A3A A;  1J4I A;  4IT4 A;  3KZ7 A;  1HXV A;  2WK2 A;  1Q1C A;  1M5Y A;  2B31 A;  3O5M A;  2ZR6 A;  3JYJ A;  5HKG A;  2F4E A;  4MSP A;  2XP8 A;  1ROT A;  1GPF A;  2XP6 A;  1W26 A;  2ETN A;  4P8V A;  2DT3 A;  4DT4 A;  2DPE A;  4QZV B;  1D6O A;  2F21 A;  4TNS A;  3WD0 A;  4HBO A;  5HWC A;  3EIP A;  1SYT A;  4Z2G A;  2KFW A;  1ZBW A;  3G6M A;  4LGX A;  3RM9 A;  1VF8 A;  3AS0 A;  5HW6 A;  1HJW A;  1NWU A;  1P5Q A;  1FKD A;  4J4O A;  1XRV A;  3ARW A;  2KGJ A;  5DEZ A;  3OOB A;  4JYS A;  1FKR A;  4ZPT R;  1E6Z A;  2XP4 A;  3CHE A;  1W1V A;  2L2S A;  1X6L A;  2M1I A;  2D9F A;  2PV3 A;  1EHN A;  3TDB A;  2XP9 A;  3O5J A;  1W1T A;  4R5E A;  3CGM A;  1YW5 A;  2XP7 A;  4ODO A;  4LAW A;  1ZCN A;  4TW8 A;  3TCZ A;  1U79 A;  2LKN A;  5JH8 A;  3KCE A;  3IKG A;  5DO2 A;  3UI5 A;  4Q7N A;  2PPN A;  2KI3 A;  3WKZ A;  1LQ0 A;  2DG9 A;  1BKF A;  3IKD A;  1W1Y A;  2PPP A;  2ZQT A;  4ZS6 A;  1D7H A;  2M08 A;  1ROU A;  4JFJ A;  1J6Y A;  2RSE A;  4P8W A;  1E15 A;  3KAH A;  4LAY A;  3WL0 A;  2AOS A;  1EYM A;  1PIN A;  1GOI A;  3JXV A;  4ITZ A;  4WKF A;  1D7I A;  1OGG A;  2OLH A;  3W4R A;  1NMW A;  4WJX A;  1HKJ A;  2RUD A;  5HBF A;  4S3J A;  4DRQ A;  3UQI A;  3CH9 A;  1XHG A;  2M2A A;  4NSB A;  5J6E A;  3RME A;  1FJD A;  2PN0 A;  1FKG A;  5DIT A;  3VAW A;  1W9P A;  2RUR A;  2ZR5 A;  4U84 A;  1HJV A;  2DSZ A;  3B9D A;  3KAB A;  3KAD A;  1E6R A;  1YAT A;  4DRJ A;  1E6P A;  3BXW A;  3WD2 A;  1KFW A;  1FD9 A;  2LPV A;  3RGC A;  4DWS D;  3O5I A;  2XP5 A;  1FKS A;  4WIW A;  1W9U A;  1E6N A;  4AY1 A;  1KT1 A;  4DRM A;  3O5L A;  5DF0 A;  1Q6H A;  4DRK A;  2RUQ A;  3O5D A;  5HUA A;  2O9O A;  4W9P A;  3WD1 A;  2G8Z A;  4IQC A;  1JNT A;  1HKI A;  1HJX A;  2YBT A;  2WLZ A;  1JNE A;  4PTM A;  4C02 B;  1ZU8 A;  1JVW A;  3UI4 A;  4MGV A;  1QPF A;  2RUC A;  1X6N A;  1NWT A;  4DWS C;  2PV1 A;  2F23 A;  3IK8 A;  4IQ2 A;  1HKM A;  2Y78 A;  3KAG A;  4W9O A;  1GUV A;  1LL6 A;  1HKK A;  3ARO A;  3B9E A;  4TW7 A;  1F8A B;  3FAP A;  3O5R A;  3ARV A;  4P8U A;  1ZK6 A;  1IX5 A;  4ODK A;  2UZ5 A;  4JFI A;  4QIB A;  1TCO C;  2VN1 A;  5GQB A;  2DG3 A;  3BMB A;  1OWQ A;  1B6C A;  3OA5 A;  4MAV A;  2PI6 A;  1SR0 A;  3AS1 A;  2MLZ A;  4ODM A;  1EQ3 A;  2DT0 A;  3B9A A;  4Z2L A;  2YBU A;  3KAI A;  1EDQ A;  5HWB A;  3G6L A;  1E44 A;  2O92 A;  2DSU A;  5DIU A;  5HW8 A;  5DIV A;  1Q6U A;  3ARX A;  4BF8 A;  2IUZ A;  3WD3 A;  1EIB A;  4DRO A;  1LG1 A;  1OGB A;  3RM8 A;  2RQS A;  2WM0 A;  1FKH A;  1KT0 A;  4FN2 A;  1LJY A;  3AQU A;  1BL4 A;  3UQA A;  3CHC A;  3CHF A;  4P8X A;  4ODL A;  1K9T A;  2DSV A;  2AWG A;  3O5O A;  1ZB5 A;  1JCH B;  4TYO A;  4L72 B;  2B5U B;  2KE0 A;  1FKL A;  3NTP A;  4MNL A;  1JND A;  1W9V A;  3UQB A;  4ZPW R;  3ARY A;  3ARZ A;  1WNO A;  1FKK A;  1H0I A;  5BXJ A;  3ARR A;  1FKT A;  1WB0 A;  3PRD A;  3QOK A;  5HT1 A;  5HW7 A;  1QZ2 A;  4R0X A;  4ML4 A;  3LUO A;  1NH6 A;  2PV2 A;  3PA7 A;  4IT6 A;  4DZ2 A;  4QT3 A;  2A3B A;  4ODQ A;  4NNR A;  3ODK A;  1E9L A;  2IF4 A;  3PRB A;  1F40 A;  4KR0 B;  1H0G A;  3RFW A;  2Q5A A;  4FAP A;  1JNS A;  3WIJ A;  2DSW A;  1C9H A;  2K8I A;  2MNT A;  1L1P A;  5B8I C;  4WKA A;  4G2P A;  3WL1 A;  5GPG A;  2WLY A;  4DWS A;  4DZ3 A;  4TW6 A;  2MLY A;  4Z2J A;  1ZBC A;  2QF8 A;  2ESC A;  4HAR A;  4MNK A;  1O6I A;  1Y0O A;  4JFK A;  4Z2H A;  2FDM A;  3O5G A;  4W5U A;  2FKE A;  3WH0 A;  2XPA A;  3AS2 A;  3ARQ A;  3MDY B;  2XPB A;  4G50 A;  2ZQV A;  3GU0 A;  2N87 A;  4DRP A;  1FKB A;  4S3K A;  4ODP A;  4KQZ A;  1FKF A;  1Q6I A;  4DRH A;  4JFL A;  2JZV A;  1J4R A;  1D7J A;  4HBE A;  5I98 A;  1A7X A;  3KAF A;  2DT1 A;  4DH0 A;  2KR7 A;  2LJ4 A;  3ARU A;  3B7X A;  3ALF A;  4LAX A;  4MTV A;  3TC5 A;  1T11 A;  4U85 A;  3O5Q A;  3EY6 A;  1J4H A;  1PBK A;  3WQV A; 
#chains in the Genus database with same CATH homology
 2A3E A;  1RD6 A;  3FY1 A;  1LL7 A;  2PPO A;  2MLX A;  1FFQ A;  3CGN A;  2MF9 A;  4DIP A;  3JYM A;  2VCD A;  3FXY A;  2XP3 A;  2ZQS A;  2F2D A;  4Z2I A;  1ZBV A;  1FKI A;  4Q22 A;  4MPK A;  4U86 A;  1NSG A;  4DRN A;  4MNJ A;  4N19 A;  2KO7 A;  1UR9 A;  4GGQ A;  4O2T A;  1NMV A;  3UI6 A;  4MNM A;  4URI A;  1CTN A;  4NZC A;  3AS3 A;  3RM4 A;  1FKJ A;  2LGO A;  2ITK A;  2OFN A;  4TX0 A;  3WQW A;  1UR8 A;  4LAV A;  3B8S A;  1LL4 A;  1R9H A;  2DG4 A;  5HTG A;  1ZBK A;  4Z2K A;  3NRK A;  4ODN A;  4DRI A;  1TFV A;  1NWR A;  2FAP A;  3GPK A;  4W9Q A;  4ZPV R;  1WAW A;  1NWS A;  1ZL1 A;  1ITX A;  3IHZ A;  4L3N A;  2ZQU A;  3CHD A;  2G41 A;  5D75 A;  3ALG A;  4QT2 A;  4JFM A;  1FAP A;  3O5F A;  3UF8 A;  3NI6 A;  2DT2 A;  2MPH A;  3CZ8 A;  1FFR A;  3PR9 A;  4J4N A;  5GPR A;  4GIV A;  3PRA A;  4XAK A;  2ZR4 A;  1LG2 A;  4WKH A;  1QPL A;  3ARS A;  1W1P A;  1D2K A;  4DWS B;  3O5P A;  3O5E A;  3I6C A;  4IPX A;  3H9R B;  3ARP A;  3O5K A;  4WK9 A;  1N1A A;  2PBC A;  2A3C A;  4ODR A;  3WD4 A;  3ART A;  3KAC A;  2A3A A;  1J4I A;  4IT4 A;  3KZ7 A;  1HXV A;  2WK2 A;  1Q1C A;  1M5Y A;  2B31 A;  3O5M A;  2ZR6 A;  3JYJ A;  5HKG A;  2F4E A;  4MSP A;  2XP8 A;  1ROT A;  1GPF A;  2XP6 A;  1W26 A;  4P8V A;  2DT3 A;  4DT4 A;  2DPE A;  4QZV B;  1D6O A;  2F21 A;  4TNS A;  3WD0 A;  4HBO A;  5HWC A;  1SYT A;  4Z2G A;  2KFW A;  1ZBW A;  3G6M A;  4LGX A;  3RM9 A;  1VF8 A;  3AS0 A;  5HW6 A;  1HJW A;  1NWU A;  1P5Q A;  1FKD A;  4J4O A;  1XRV A;  3ARW A;  2KGJ A;  5DEZ A;  3OOB A;  4JYS A;  1FKR A;  4ZPT R;  1E6Z A;  2XP4 A;  3CHE A;  1W1V A;  2L2S A;  1X6L A;  2M1I A;  2D9F A;  2PV3 A;  1EHN A;  3TDB A;  2XP9 A;  3O5J A;  1W1T A;  4R5E A;  3CGM A;  1YW5 A;  2XP7 A;  4ODO A;  4LAW A;  1ZCN A;  4TW8 A;  3TCZ A;  1U79 A;  2LKN A;  5JH8 A;  3KCE A;  3IKG A;  5DO2 A;  3UI5 A;  4Q7N A;  2PPN A;  2KI3 A;  3WKZ A;  1LQ0 A;  2DG9 A;  1BKF A;  3IKD A;  1W1Y A;  2PPP A;  2ZQT A;  4ZS6 A;  1D7H A;  2M08 A;  1ROU A;  4JFJ A;  1J6Y A;  2RSE A;  4P8W A;  1E15 A;  3KAH A;  4LAY A;  3WL0 A;  2AOS A;  1EYM A;  1PIN A;  1GOI A;  3JXV A;  4ITZ A;  4WKF A;  1D7I A;  1OGG A;  2OLH A;  3W4R A;  1NMW A;  4WJX A;  1HKJ A;  2RUD A;  5HBF A;  4S3J A;  4DRQ A;  3UQI A;  3CH9 A;  1XHG A;  2M2A A;  4NSB A;  5J6E A;  3RME A;  1FJD A;  1FKG A;  5DIT A;  3VAW A;  1W9P A;  2RUR A;  2ZR5 A;  4U84 A;  1HJV A;  2DSZ A;  3B9D A;  3KAB A;  3KAD A;  1E6R A;  1YAT A;  4DRJ A;  1E6P A;  3BXW A;  3WD2 A;  1KFW A;  1FD9 A;  2LPV A;  3RGC A;  4DWS D;  3O5I A;  2XP5 A;  1FKS A;  4WIW A;  1W9U A;  1E6N A;  4AY1 A;  1KT1 A;  4DRM A;  3O5L A;  5DF0 A;  1Q6H A;  4DRK A;  2RUQ A;  3O5D A;  5HUA A;  2O9O A;  4W9P A;  3WD1 A;  2G8Z A;  4IQC A;  1JNT A;  1HKI A;  1HJX A;  2YBT A;  2WLZ A;  1JNE A;  4PTM A;  4C02 B;  1ZU8 A;  1JVW A;  3UI4 A;  4MGV A;  1QPF A;  2RUC A;  1X6N A;  1NWT A;  4DWS C;  2PV1 A;  3IK8 A;  4IQ2 A;  1HKM A;  2Y78 A;  3KAG A;  4W9O A;  1GUV A;  1LL6 A;  1HKK A;  3ARO A;  3B9E A;  4TW7 A;  1F8A B;  3FAP A;  3O5R A;  3ARV A;  4P8U A;  1ZK6 A;  1IX5 A;  4ODK A;  2UZ5 A;  4JFI A;  4QIB A;  1TCO C;  2VN1 A;  5GQB A;  2DG3 A;  1OWQ A;  1B6C A;  3OA5 A;  4MAV A;  2PI6 A;  1SR0 A;  3AS1 A;  2MLZ A;  4ODM A;  1EQ3 A;  2DT0 A;  3B9A A;  4Z2L A;  2YBU A;  3KAI A;  1EDQ A;  5HWB A;  3G6L A;  2O92 A;  2DSU A;  5DIU A;  5HW8 A;  5DIV A;  1Q6U A;  3ARX A;  4BF8 A;  2IUZ A;  3WD3 A;  1EIB A;  4DRO A;  1LG1 A;  1OGB A;  3RM8 A;  2RQS A;  2WM0 A;  1FKH A;  1KT0 A;  4FN2 A;  1LJY A;  3AQU A;  1BL4 A;  3UQA A;  3CHC A;  3CHF A;  4P8X A;  4ODL A;  1K9T A;  2DSV A;  2AWG A;  3O5O A;  1ZB5 A;  4TYO A;  4L72 B;  2KE0 A;  1FKL A;  3NTP A;  4MNL A;  1JND A;  1W9V A;  3UQB A;  4ZPW R;  3ARY A;  3ARZ A;  1WNO A;  1FKK A;  1H0I A;  5BXJ A;  3ARR A;  1FKT A;  1WB0 A;  3PRD A;  3QOK A;  5HT1 A;  5HW7 A;  1QZ2 A;  4R0X A;  4ML4 A;  3LUO A;  1NH6 A;  2PV2 A;  3PA7 A;  4IT6 A;  4DZ2 A;  4QT3 A;  2A3B A;  4ODQ A;  4NNR A;  3ODK A;  1E9L A;  2IF4 A;  3PRB A;  1F40 A;  4KR0 B;  1H0G A;  3RFW A;  2Q5A A;  4FAP A;  1JNS A;  3WIJ A;  2DSW A;  1C9H A;  2K8I A;  2MNT A;  1L1P A;  5B8I C;  4WKA A;  4G2P A;  3WL1 A;  5GPG A;  2WLY A;  4DWS A;  4DZ3 A;  4TW6 A;  2MLY A;  4Z2J A;  1ZBC A;  2QF8 A;  2ESC A;  4HAR A;  4MNK A;  1O6I A;  1Y0O A;  4JFK A;  4Z2H A;  2FDM A;  3O5G A;  4W5U A;  2FKE A;  3WH0 A;  2XPA A;  3AS2 A;  3ARQ A;  3MDY B;  2XPB A;  4G50 A;  2ZQV A;  2N87 A;  4DRP A;  1FKB A;  4S3K A;  4ODP A;  4KQZ A;  1FKF A;  1Q6I A;  4DRH A;  4JFL A;  2JZV A;  1J4R A;  1D7J A;  4HBE A;  5I98 A;  1A7X A;  3KAF A;  2DT1 A;  4DH0 A;  2KR7 A;  2LJ4 A;  3ARU A;  3B7X A;  3ALF A;  4LAX A;  4MTV A;  3TC5 A;  1T11 A;  4U85 A;  3O5Q A;  3EY6 A;  1J4H A;  1PBK A;  3WQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...