4DZ3A

Crystal structure of a peptidyl-prolyl cis-trans isomerase with surface mutation m61h from burkholderia pseudomallei complexed with fk506
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
113
structure length
113
Chain Sequence
STVVTTESGLKYEDLTEGSGAEARAGQTVSVHYTGWLTDGQKFDSSKDRNDPFAFVLGGGHVIKGWDEGVQGMKVGGVRRLTIPPQLGYGARGAGGVIPPNATLVFEVELLDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural biology approach enables the development of antimicrobials targeting bacterial immunophilins.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase
total genus 29
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dz3A00
3KADA 2VN1A 2M2AA 1KT1A 4O2TA 1J4RA 1QPFA 1ZK6A 2JZVA 1FKFA 3UI4A 1ROTA 1HXVA 4MGVA 2KE0A 1L1PA 4LAXA 1FKRA 2LJ4A 1W26A 4JFLA 5J6EA 5HTGA 3UQBA 2F21A 2ITKA 2AWGA 1J6YA 3EY6A 4TW6A 4DH0A 1Q6HA 3KAFA 5DIVA 2ZQTA 1NMVA 2KI3A 4R0XA 1M5YA 1TCOC 4DROA 3ODKA 1JVWA 3KZ7A 3I6CA 5DIUA 4J4NA 3IHZA 3LUOA 2IF4A 2ZQSA 2KGJA 3MDYB 2XPBA 4GIVA 4TW7A 2PV3A 2XP6A 4J4OA 3WH0A 1EQ3A 3O5EA 3H9RB 4QT2A 4DIPA 2PPNA 3O5OA 3O5KA 3O5FA 4ODQA 5HWBA 3UF8A 2FAPA 1FKJA 4DRNA 3O5RA 1N1AA 2L2SA 3O5LA 3O5IA 5HT1A 2N87A 2Q5AA 3RGCA 1FJDA 2LKNA 4DRQA 3KACA 4LAWA 1J4HA 2LPVA 4DZ3A 1NMWA 2F4EA 1EYMA 1FKLA 3JYJA 1FKKA 3KAGA 3UI5A 5HW6A 2M08A 1FD9A 3PRBA 2MLXA 1Q1CA 1R9HA 1YATA 1PINA 4DRKA 2RSEA 3O5QA 4MSPA 4JFIA 4FN2A 2PBCA 2ZQUA 4ODRA 3GPKA 1F8AB 1Q6IA 2MF9A 2RUQA 4ODOA 1F40A 4W9QA 1FKDA 3IKDA 1FKGA 2PPPA 4C02B 2XP8A 4JFJA 2DG3A 2MPHA 2PV2A 3NTPA 4DRHA 1C9HA 4TW8A 4U86A 5HKGA 1FAPA 4IPXA 3TDBA 4DRPA 3CGMA 2PV1A 3JYMA 1BKFA 2MLYA 4DT4A 5GPGA 4G2PA 2XPAA 5I98A 3JXVA 1P5QA 3UI6A 1B6CA 2ZR6A 3PA7A 3VAWA 4FAPA 2MLZA 4DRIA 2PPOA 3IKGA 4TNSA 4DRMA 1Y0OA 3TC5A 4LAYA 4U84A 4JFMA 5BXJA 3OOBA 2RURA 5HW8A 1PBKA 2VCDA 2XP7A 2MNTA 4G50A 4ODNA 2DG4A 2ZQVA 2ZR5A 1D7IA 4QIBA 1FKSA 3KAIA 1Q6UA 3O5MA 4BF8A 4TX0A 1FKTA 3TCZA 1D6OA 2XP5A 1U79A 2OFNA 4ITZA 2K8IA 1D7HA 2KFWA 3O5JA 4U85A 1QPLA 1NSGA 2ZR4A 4DZ2A 2D9FA 5B8IC 1JNTA 4W9OA 3O5PA 1QZ2A 1FKBA 3PRDA 5D75A 4N19A 5HWCA 2F2DA 1KT0A 4ODPA 5HUAA 1JNSA 3CGNA 3KCEA 3O5GA 2FKEA 3IK8A 4LAVA 4QT3A 2Y78A 4TYOA 1A7XA 3NI6A 1T11A 2DG9A 3RFWA 4ODMA 3UQAA 3KAHA 4IQCA 4ODLA 1ROUA 4IQ2A 3NRKA 2RQSA 3B7XA 4NNRA 4GGQA 2LGOA 4JYSA 2XP4A 2XP3A 1YW5A 4W9PA 2KO7A 1J4IA 2RUDA 2KR7A 3FAPA 2UZ5A 3UQIA 3KABA 5HW7A 4ODKA 1FKHA 2M1IA 4JFKA 1FKIA 1BL4A 5DITA 4DRJA 2XP9A 3O5DA 1D7JA 1ZCNA 2RUCA
chains in the Genus database with same CATH superfamily
1D2KA 2M2AA 3GTYX 2DT3A 1QPFA 3UI4A 1ROTA 3ALGA 4KR0B 1L1PA 4LAXA 2LJ4A 3ARWA 4JFLA 3ALFA 3ARXA 3UQBA 4P8XA 2ITKA 1J6YA 4DH0A 2ZQTA 1LG2A 2A3AA 1SYTA 3ODKA 1JVWA 5DIUA 2B31A 2DSZA 2IF4A 2KGJA 2O92A 2XPBA 2B5UB 1HKMA 2PPNA 4ODQA 4WK9A 3UF8A 1FKJA 1H0IA 3O5RA 2L2SA 3O5IA 4MNMA 2N87A 1RD6A 2LPVA 1FFRA 3JYJA 2M08A 4IT4A 1Q1CA 2PI6A 1YATA 2WLYA 4DRKA 2RSEA 2PBCA 1Q6IA 1F40A 1JCHB 4ZPTR 1SR0A 4NSBA 2PV2A 3B9AA 4P8UA 4U86A 2PV1A 3AQUA 2MLYA 4DT4A 1X6LA 4WKAA 1B6CA 3PA7A 2MLZA 4DRIA 2PPOA 3TC5A 2DT2A 4JFMA 1JNEA 3OOBA 4DWSA 3AS1A 4G50A 3WD1A 5GPRA 3GU0A 4ZPVR 1D6OA 3CH9A 1D7HA 3O5JA 4DZ2A 3O5PA 1QZ2A 1WB0A 3PRDA 5HWCA 3WIJA 1KT0A 3ARVA 3CGNA 2FKEA 3ARUA 2WM0A 1ITXA 1XRVA 2DG9A 1ZBWA 2EULA 3AS2A 3B8SA 2ESCA 2G41A 2RQSA 4GGQA 2LGOA 4JYSA 3RM8A 4MPKA 1YW5A 4W9PA 2UZ5A 3WL0A 1E6PA 4W5UA 2O9OA 4JFKA 1LL4A 3O5DA 3ARZA 1D7JA 3KADA 2VN1A 1FFQA 1KT1A 3FY1A 4O2TA 1LJYA 1ZK6A 4Z2LA 5JH8A 1LL7A 2KE0A 3WD2A 1H0GA 5HTGA 3EY6A 1HJXA 3EIPA 3WD3A 1Q6HA 3KAFA 4QZVB 2KI3A 2DT0A 1TCOC 4DROA 1W9VA 1LG1A 2ZQSA 3CHEA 4GIVA 2XP6A 3WH0A 1EQ3A 3O5EA 1WAWA 3O5OA 3O5KA 3O5FA 3RGCA 1N1AA 2P4VA 5HT1A 4HARA 4DRQA 1J4HA 4URIA 1OGBA 4MNLA 4DZ3A 4XAKA 2DSVA 1EYMA 1CTNA 1FKLA 1FKKA 3UI5A 5HW6A 3O5QA 1HJWA 4MSPA 4ODRA 4FN2A 2ZQUA 3W4RA 3ARTA 4ODOA 3FXYA 2AOSA 4C02B 1EHNA 4JFJA 2IUZA 4DRHA 3WKZA 1C9HA 4IPXA 4DRPA 1ZBKA 5GPGA 2DSWA 2YBUA 4LGXA 3JXVA 4FAPA 1E9LA 1OGGA 4TNSA 1Y0OA 1ZL1A 4U84A 5BXJA 4ZS6A 5DO2A 1JNDA 2DG4A 2ZQVA 1Q6UA 3PR9A 4TX0A 3TCZA 1W1YA 2XP5A 2OFNA 4ITZA 3WD4A 3CHCA 4U85A 1LL6A 1QPLA 4W9OA 1E6NA 3ARSA 5D75A 4ODPA 3O5GA 4TYOA 2Y78A 1A7XA 1XHGA 1E6RA 1NWSA 2DT1A 1ROUA 1ZU8A 3WQVA 3NRKA 2FDMA 2OLHA 3AROA 3FAPA 1ZB5A 4KQZA 3KABA 5HW7A 4L3NA 4ODKA 1FKIA 2XP9A 1WNOA 4ODLA 2MF9A 2RUCA 3BMBA 4HBOA 4AY1A 3RMEA 1ZBCA 1IX5A 1HXVA 2JZVA 1VF8A 1FKFA 3AS0A 4WKHA 4MGVA 2WK2A 1ZBVA 1W26A 5J6EA 2ETNA 5DF0A 1UR9A 1E15A 3KZ7A 4J4NA 4TW7A 1W9UA 4J4OA 4PTMA 3ARQA 1E44A 4QT2A 2FAPA 2PN0A 3ARYA 1HJVA 4DRNA 4DWSD 3ARRA 4LAWA 1KFWA 3KAGA 1LQ0A 3CHDA 3PRBA 1K9TA 1R9HA 4ML4A 1PINA 3GPKA 1GUVA 4W9QA 3IKDA 1FKDA 1EDQA 2PPPA 2A3EA 2MPHA 3G6MA 3NTPA 4TW8A 5HKGA 1FAPA 4DWSC 1EIBA 2WLZA 1BKFA 4MTVA 4Q22A 5I98A 1P5QA 3VAWA 1GOIA 4MNJA 3IKGA 3WD0A 4DRMA 4WKFA 2RURA 5HW8A 4Z2JA 2MNTA 4ODNA 3G6LA 3O5MA 4BF8A 2F23A 1FKTA 4Z2HA 4S3KA 1U79A 2KFWA 1NSGA 2ZR4A 2D9FA 3CHFA 2G8ZA 1O6IA 2F2DA 4QT3A 4Z2IA 3NI6A 1T11A 2DPEA 3UQAA 4R5EA 4UDMA 1W9PA 4NNRA 1J4IA 2KR7A 1E6ZA 2M1IA 1ZCNA 1J4RA 1NWRA 4L72B 1FKRA 5HBFA 3WL1A 4MAVA 2F21A 2AWGA 4TW6A 5DIVA 1NMVA 4MNKA 4WJXA 4R0XA 1M5YA 3I6CA 3IHZA 3LUOA 3MDYB 4P8VA 2PV3A 3H9RB 4DIPA 3OA5A 5HWBA 3O5LA 2Q5AA 1FJDA 2LKNA 3KACA 3AS3A 1NMWA 2F4EA 4Z2KA 3BXWA 1FD9A 2MLXA 4JFIA 1F8AB 1GRJA 2RUQA 3B9DA 4NZCA 2A3CA 1FKGA 2XP8A 2QF8A 2DG3A 4S3JA 3TDBA 3QOKA 3CGMA 1HKJA 3JYMA 4G2PA 2XPAA 2DSUA 1NWTA 1UR8A 2ZR6A 3UI6A 1X6NA 4Z2GA 4LAYA 4P8WA 3CZ8A 1PBKA 2VCDA 2XP7A 2ZR5A 3B9EA 1D7IA 4QIBA 1HKKA 1FKSA 3KAIA 1W1VA 1W1PA 2K8IA 4HBEA 5B8IC 4WIWA 1OWQA 5GQBA 1JNTA 3RM9A 3WQWA 1W1TA 1FKBA 5HUAA 4N19A 1JNSA 3KCEA 2A3BA 3IK8A 4LAVA 1GPFA 1HKIA 4DWSB 3RFWA 4ODMA 3KAHA 4IQCA 3ARPA 2YBTA 4IQ2A 3B7XA 4Q7NA 2XP4A 2XP3A 1TFVA 1NH6A 2KO7A 2RUDA 3RM4A 5DEZA 3UQIA 4ZPWR 1NWUA 3PRAA 4IT6A 1FKHA 5DITA 4DRJA 1BL4A
chains in the Genus database with same CATH topology
1D2KA 2M2AA 2DT3A 1QPFA 3UI4A 1ROTA 3ALGA 4KR0B 1L1PA 4LAXA 2LJ4A 3ARWA 4JFLA 3ALFA 3ARXA 3UQBA 4P8XA 2ITKA 1J6YA 4DH0A 2ZQTA 1LG2A 2A3AA 1SYTA 3ODKA 1JVWA 5DIUA 2B31A 2DSZA 2IF4A 2KGJA 2O92A 2XPBA 1HKMA 2PPNA 4ODQA 4WK9A 3UF8A 1FKJA 1H0IA 3O5RA 2L2SA 3O5IA 4MNMA 2N87A 1RD6A 2LPVA 1FFRA 3JYJA 2M08A 4IT4A 1Q1CA 2PI6A 1YATA 2WLYA 4DRKA 2RSEA 2PBCA 1Q6IA 1F40A 4ZPTR 1SR0A 4NSBA 2PV2A 3B9AA 4P8UA 4U86A 2PV1A 3AQUA 2MLYA 4DT4A 1X6LA 4WKAA 1B6CA 3PA7A 2MLZA 4DRIA 2PPOA 3TC5A 2DT2A 4JFMA 1JNEA 3OOBA 4DWSA 3AS1A 4G50A 3WD1A 5GPRA 4ZPVR 1D6OA 3CH9A 1D7HA 3O5JA 4DZ2A 3O5PA 1QZ2A 1WB0A 3PRDA 5HWCA 3WIJA 1KT0A 3ARVA 3CGNA 2FKEA 3ARUA 2WM0A 1ITXA 1XRVA 2DG9A 1ZBWA 3AS2A 3B8SA 2ESCA 2G41A 2RQSA 4GGQA 2LGOA 4JYSA 3RM8A 4MPKA 1YW5A 4W9PA 2UZ5A 3WL0A 1E6PA 4W5UA 2O9OA 4JFKA 1LL4A 3O5DA 3ARZA 1D7JA 3KADA 2VN1A 1FFQA 1KT1A 3FY1A 4O2TA 1LJYA 1ZK6A 4Z2LA 5JH8A 1LL7A 2KE0A 3WD2A 1H0GA 5HTGA 3EY6A 1HJXA 3WD3A 1Q6HA 3KAFA 4QZVB 2KI3A 2DT0A 1TCOC 4DROA 1W9VA 1LG1A 2ZQSA 3CHEA 4GIVA 2XP6A 3WH0A 1EQ3A 3O5EA 1WAWA 3O5OA 3O5KA 3O5FA 3RGCA 1N1AA 5HT1A 4HARA 4DRQA 1J4HA 4URIA 1OGBA 4MNLA 4DZ3A 4XAKA 2DSVA 1EYMA 1CTNA 1FKLA 1FKKA 3UI5A 5HW6A 3O5QA 1HJWA 4MSPA 4ODRA 4FN2A 2ZQUA 3W4RA 3ARTA 4ODOA 3FXYA 2AOSA 4C02B 1EHNA 4JFJA 2IUZA 4DRHA 3WKZA 1C9HA 4IPXA 4DRPA 1ZBKA 5GPGA 2DSWA 2YBUA 4LGXA 3JXVA 4FAPA 1E9LA 1OGGA 4TNSA 1Y0OA 1ZL1A 4U84A 5BXJA 4ZS6A 5DO2A 1JNDA 2DG4A 2ZQVA 1Q6UA 3PR9A 4TX0A 3TCZA 1W1YA 2XP5A 2OFNA 4ITZA 3WD4A 3CHCA 4U85A 1LL6A 1QPLA 4W9OA 1E6NA 3ARSA 5D75A 4ODPA 3O5GA 4TYOA 2Y78A 1A7XA 1XHGA 1E6RA 1NWSA 2DT1A 1ROUA 1ZU8A 3WQVA 3NRKA 2FDMA 2OLHA 3AROA 3FAPA 1ZB5A 4KQZA 3KABA 5HW7A 4L3NA 4ODKA 1FKIA 2XP9A 1WNOA 4ODLA 2MF9A 2RUCA 4HBOA 4AY1A 3RMEA 1ZBCA 1IX5A 1HXVA 2JZVA 1VF8A 1FKFA 3AS0A 4WKHA 4MGVA 2WK2A 1ZBVA 1W26A 5J6EA 5DF0A 1UR9A 1E15A 3KZ7A 4J4NA 4TW7A 1W9UA 4J4OA 4PTMA 3ARQA 4QT2A 2FAPA 3ARYA 1HJVA 4DRNA 4DWSD 3ARRA 4LAWA 1KFWA 3KAGA 1LQ0A 3CHDA 3PRBA 1K9TA 1R9HA 4ML4A 1PINA 3GPKA 1GUVA 4W9QA 1FKDA 3IKDA 1EDQA 2PPPA 2A3EA 2MPHA 3G6MA 3NTPA 4TW8A 5HKGA 1FAPA 4DWSC 1EIBA 2WLZA 1BKFA 4MTVA 4Q22A 5I98A 1P5QA 3VAWA 1GOIA 4MNJA 3IKGA 3WD0A 4DRMA 4WKFA 2RURA 5HW8A 4Z2JA 2MNTA 4ODNA 3G6LA 3O5MA 4BF8A 1FKTA 4Z2HA 4S3KA 1U79A 2KFWA 1NSGA 2ZR4A 2D9FA 3CHFA 2G8ZA 1O6IA 2F2DA 4QT3A 4Z2IA 3NI6A 1T11A 2DPEA 3UQAA 4R5EA 1W9PA 4NNRA 1J4IA 2KR7A 1E6ZA 2M1IA 1ZCNA 1J4RA 1NWRA 4L72B 1FKRA 5HBFA 3WL1A 4MAVA 2F21A 2AWGA 4TW6A 5DIVA 1NMVA 4MNKA 4WJXA 4R0XA 1M5YA 3I6CA 3IHZA 3LUOA 3MDYB 4P8VA 2PV3A 3H9RB 4DIPA 3OA5A 5HWBA 3O5LA 2Q5AA 1FJDA 2LKNA 3KACA 3AS3A 1NMWA 2F4EA 4Z2KA 3BXWA 1FD9A 2MLXA 4JFIA 1F8AB 2RUQA 3B9DA 4NZCA 2A3CA 1FKGA 2XP8A 2QF8A 2DG3A 4S3JA 3TDBA 3QOKA 3CGMA 1HKJA 3JYMA 4G2PA 2XPAA 2DSUA 1NWTA 1UR8A 2ZR6A 3UI6A 1X6NA 4Z2GA 4LAYA 4P8WA 3CZ8A 1PBKA 2VCDA 2XP7A 2ZR5A 3B9EA 1D7IA 4QIBA 1HKKA 1FKSA 3KAIA 1W1VA 1W1PA 2K8IA 4HBEA 5B8IC 4WIWA 1OWQA 5GQBA 1JNTA 3RM9A 3WQWA 1W1TA 1FKBA 5HUAA 4N19A 1JNSA 3KCEA 2A3BA 3IK8A 4LAVA 1GPFA 1HKIA 4DWSB 3RFWA 4ODMA 3KAHA 4IQCA 3ARPA 2YBTA 4IQ2A 3B7XA 4Q7NA 2XP4A 2XP3A 1TFVA 1NH6A 2KO7A 2RUDA 3RM4A 5DEZA 3UQIA 4ZPWR 1NWUA 3PRAA 4IT6A 1FKHA 5DITA 4DRJA 1BL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KAD A;  2VN1 A;  2M2A A;  1KT1 A;  4O2T A;  1J4R A;  1QPF A;  1ZK6 A;  2JZV A;  1FKF A;  3UI4 A;  1ROT A;  1HXV A;  4MGV A;  2KE0 A;  1L1P A;  4LAX A;  1FKR A;  2LJ4 A;  1W26 A;  4JFL A;  5J6E A;  5HTG A;  3UQB A;  2F21 A;  2ITK A;  2AWG A;  1J6Y A;  3EY6 A;  4TW6 A;  4DH0 A;  1Q6H A;  3KAF A;  5DIV A;  2ZQT A;  1NMV A;  2KI3 A;  4R0X A;  1M5Y A;  1TCO C;  4DRO A;  3ODK A;  1JVW A;  3KZ7 A;  3I6C A;  5DIU A;  4J4N A;  3IHZ A;  3LUO A;  2IF4 A;  2ZQS A;  2KGJ A;  3MDY B;  2XPB A;  4GIV A;  4TW7 A;  2PV3 A;  2XP6 A;  4J4O A;  3WH0 A;  1EQ3 A;  3O5E A;  3H9R B;  4QT2 A;  4DIP A;  2PPN A;  3O5O A;  3O5K A;  3O5F A;  4ODQ A;  5HWB A;  3UF8 A;  2FAP A;  1FKJ A;  4DRN A;  3O5R A;  1N1A A;  2L2S A;  3O5L A;  3O5I A;  5HT1 A;  2N87 A;  2Q5A A;  3RGC A;  1FJD A;  2LKN A;  4DRQ A;  3KAC A;  4LAW A;  1J4H A;  2LPV A;  4DZ3 A;  1NMW A;  2F4E A;  1EYM A;  1FKL A;  3JYJ A;  1FKK A;  3KAG A;  3UI5 A;  5HW6 A;  2M08 A;  1FD9 A;  3PRB A;  2MLX A;  1Q1C A;  1R9H A;  1YAT A;  1PIN A;  4DRK A;  2RSE A;  3O5Q A;  4MSP A;  4JFI A;  4FN2 A;  2PBC A;  2ZQU A;  4ODR A;  3GPK A;  1F8A B;  1Q6I A;  2MF9 A;  2RUQ A;  4ODO A;  1F40 A;  4W9Q A;  1FKD A;  3IKD A;  1FKG A;  2PPP A;  4C02 B;  2XP8 A;  4JFJ A;  2DG3 A;  2MPH A;  2PV2 A;  3NTP A;  4DRH A;  1C9H A;  4TW8 A;  4U86 A;  5HKG A;  1FAP A;  4IPX A;  3TDB A;  4DRP A;  3CGM A;  2PV1 A;  3JYM A;  1BKF A;  2MLY A;  4DT4 A;  5GPG A;  4G2P A;  2XPA A;  5I98 A;  3JXV A;  1P5Q A;  3UI6 A;  1B6C A;  2ZR6 A;  3PA7 A;  3VAW A;  4FAP A;  2MLZ A;  4DRI A;  2PPO A;  3IKG A;  4TNS A;  4DRM A;  1Y0O A;  3TC5 A;  4LAY A;  4U84 A;  4JFM A;  5BXJ A;  3OOB A;  2RUR A;  5HW8 A;  1PBK A;  2VCD A;  2XP7 A;  2MNT A;  4G50 A;  4ODN A;  2DG4 A;  2ZQV A;  2ZR5 A;  1D7I A;  4QIB A;  1FKS A;  3KAI A;  1Q6U A;  3O5M A;  4BF8 A;  4TX0 A;  1FKT A;  3TCZ A;  1D6O A;  2XP5 A;  1U79 A;  2OFN A;  4ITZ A;  2K8I A;  1D7H A;  2KFW A;  3O5J A;  4U85 A;  1QPL A;  1NSG A;  2ZR4 A;  4DZ2 A;  2D9F A;  5B8I C;  1JNT A;  4W9O A;  3O5P A;  1QZ2 A;  1FKB A;  3PRD A;  5D75 A;  4N19 A;  5HWC A;  2F2D A;  1KT0 A;  4ODP A;  5HUA A;  1JNS A;  3CGN A;  3KCE A;  3O5G A;  2FKE A;  3IK8 A;  4LAV A;  4QT3 A;  2Y78 A;  4TYO A;  1A7X A;  3NI6 A;  1T11 A;  2DG9 A;  3RFW A;  4ODM A;  3UQA A;  3KAH A;  4IQC A;  4ODL A;  1ROU A;  4IQ2 A;  3NRK A;  2RQS A;  3B7X A;  4NNR A;  4GGQ A;  2LGO A;  4JYS A;  2XP4 A;  2XP3 A;  1YW5 A;  4W9P A;  2KO7 A;  1J4I A;  2RUD A;  2KR7 A;  3FAP A;  2UZ5 A;  3UQI A;  3KAB A;  5HW7 A;  4ODK A;  1FKH A;  2M1I A;  4JFK A;  1FKI A;  1BL4 A;  5DIT A;  4DRJ A;  2XP9 A;  3O5D A;  1D7J A;  1ZCN A;  2RUC A; 
#chains in the Genus database with same CATH topology
 1D2K A;  2M2A A;  3GTY X;  2DT3 A;  1QPF A;  3UI4 A;  1ROT A;  3ALG A;  4KR0 B;  1L1P A;  4LAX A;  2LJ4 A;  3ARW A;  4JFL A;  3ALF A;  3ARX A;  3UQB A;  4P8X A;  2ITK A;  1J6Y A;  4DH0 A;  2ZQT A;  1LG2 A;  2A3A A;  1SYT A;  3ODK A;  1JVW A;  5DIU A;  2B31 A;  2DSZ A;  2IF4 A;  2KGJ A;  2O92 A;  2XPB A;  2B5U B;  1HKM A;  2PPN A;  4ODQ A;  4WK9 A;  3UF8 A;  1FKJ A;  1H0I A;  3O5R A;  2L2S A;  3O5I A;  4MNM A;  2N87 A;  1RD6 A;  2LPV A;  1FFR A;  3JYJ A;  2M08 A;  4IT4 A;  1Q1C A;  2PI6 A;  1YAT A;  2WLY A;  4DRK A;  2RSE A;  2PBC A;  1Q6I A;  1F40 A;  1JCH B;  4ZPT R;  1SR0 A;  4NSB A;  2PV2 A;  3B9A A;  4P8U A;  4U86 A;  2PV1 A;  3AQU A;  2MLY A;  4DT4 A;  1X6L A;  4WKA A;  1B6C A;  3PA7 A;  2MLZ A;  4DRI A;  2PPO A;  3TC5 A;  2DT2 A;  4JFM A;  1JNE A;  3OOB A;  4DWS A;  3AS1 A;  4G50 A;  3WD1 A;  5GPR A;  3GU0 A;  4ZPV R;  1D6O A;  3CH9 A;  1D7H A;  3O5J A;  4DZ2 A;  3O5P A;  1QZ2 A;  1WB0 A;  3PRD A;  5HWC A;  3WIJ A;  1KT0 A;  3ARV A;  3CGN A;  2FKE A;  3ARU A;  2WM0 A;  1ITX A;  1XRV A;  2DG9 A;  1ZBW A;  2EUL A;  3AS2 A;  3B8S A;  2ESC A;  2G41 A;  2RQS A;  4GGQ A;  2LGO A;  4JYS A;  3RM8 A;  4MPK A;  1YW5 A;  4W9P A;  2UZ5 A;  3WL0 A;  1E6P A;  4W5U A;  2O9O A;  4JFK A;  1LL4 A;  3O5D A;  3ARZ A;  1D7J A;  3KAD A;  2VN1 A;  1FFQ A;  1KT1 A;  3FY1 A;  4O2T A;  1LJY A;  1ZK6 A;  4Z2L A;  5JH8 A;  1LL7 A;  2KE0 A;  3WD2 A;  1H0G A;  5HTG A;  3EY6 A;  1HJX A;  3EIP A;  3WD3 A;  1Q6H A;  3KAF A;  4QZV B;  2KI3 A;  2DT0 A;  1TCO C;  4DRO A;  1W9V A;  1LG1 A;  2ZQS A;  3CHE A;  4GIV A;  2XP6 A;  3WH0 A;  1EQ3 A;  3O5E A;  1WAW A;  3O5O A;  3O5K A;  3O5F A;  3RGC A;  1N1A A;  2P4V A;  5HT1 A;  4HAR A;  4DRQ A;  1J4H A;  4URI A;  1OGB A;  4MNL A;  4DZ3 A;  4XAK A;  2DSV A;  1EYM A;  1CTN A;  1FKL A;  1FKK A;  3UI5 A;  5HW6 A;  3O5Q A;  1HJW A;  4MSP A;  4ODR A;  4FN2 A;  2ZQU A;  3W4R A;  3ART A;  4ODO A;  3FXY A;  2AOS A;  4C02 B;  1EHN A;  4JFJ A;  2IUZ A;  4DRH A;  3WKZ A;  1C9H A;  4IPX A;  4DRP A;  1ZBK A;  5GPG A;  2DSW A;  2YBU A;  4LGX A;  3JXV A;  4FAP A;  1E9L A;  1OGG A;  4TNS A;  1Y0O A;  1ZL1 A;  4U84 A;  5BXJ A;  4ZS6 A;  5DO2 A;  1JND A;  2DG4 A;  2ZQV A;  1Q6U A;  3PR9 A;  4TX0 A;  3TCZ A;  1W1Y A;  2XP5 A;  2OFN A;  4ITZ A;  3WD4 A;  3CHC A;  4U85 A;  1LL6 A;  1QPL A;  4W9O A;  1E6N A;  3ARS A;  5D75 A;  4ODP A;  3O5G A;  4TYO A;  2Y78 A;  1A7X A;  1XHG A;  1E6R A;  1NWS A;  2DT1 A;  1ROU A;  1ZU8 A;  3WQV A;  3NRK A;  2FDM A;  2OLH A;  3ARO A;  3FAP A;  1ZB5 A;  4KQZ A;  3KAB A;  5HW7 A;  4L3N A;  4ODK A;  1FKI A;  2XP9 A;  1WNO A;  4ODL A;  2MF9 A;  2RUC A;  3BMB A;  4HBO A;  4AY1 A;  3RME A;  1ZBC A;  1IX5 A;  1HXV A;  2JZV A;  1VF8 A;  1FKF A;  3AS0 A;  4WKH A;  4MGV A;  2WK2 A;  1ZBV A;  1W26 A;  5J6E A;  2ETN A;  5DF0 A;  1UR9 A;  1E15 A;  3KZ7 A;  4J4N A;  4TW7 A;  1W9U A;  4J4O A;  4PTM A;  3ARQ A;  1E44 A;  4QT2 A;  2FAP A;  2PN0 A;  3ARY A;  1HJV A;  4DRN A;  4DWS D;  3ARR A;  4LAW A;  1KFW A;  3KAG A;  1LQ0 A;  3CHD A;  3PRB A;  1K9T A;  1R9H A;  4ML4 A;  1PIN A;  3GPK A;  1GUV A;  4W9Q A;  3IKD A;  1FKD A;  1EDQ A;  2PPP A;  2A3E A;  2MPH A;  3G6M A;  3NTP A;  4TW8 A;  5HKG A;  1FAP A;  4DWS C;  1EIB A;  2WLZ A;  1BKF A;  4MTV A;  4Q22 A;  5I98 A;  1P5Q A;  3VAW A;  1GOI A;  4MNJ A;  3IKG A;  3WD0 A;  4DRM A;  4WKF A;  2RUR A;  5HW8 A;  4Z2J A;  2MNT A;  4ODN A;  3G6L A;  3O5M A;  4BF8 A;  2F23 A;  1FKT A;  4Z2H A;  4S3K A;  1U79 A;  2KFW A;  1NSG A;  2ZR4 A;  2D9F A;  3CHF A;  2G8Z A;  1O6I A;  2F2D A;  4QT3 A;  4Z2I A;  3NI6 A;  1T11 A;  2DPE A;  3UQA A;  4R5E A;  4UDM A;  1W9P A;  4NNR A;  1J4I A;  2KR7 A;  1E6Z A;  2M1I A;  1ZCN A;  1J4R A;  1NWR A;  4L72 B;  1FKR A;  5HBF A;  3WL1 A;  4MAV A;  2F21 A;  2AWG A;  4TW6 A;  5DIV A;  1NMV A;  4MNK A;  4WJX A;  4R0X A;  1M5Y A;  3I6C A;  3IHZ A;  3LUO A;  3MDY B;  4P8V A;  2PV3 A;  3H9R B;  4DIP A;  3OA5 A;  5HWB A;  3O5L A;  2Q5A A;  1FJD A;  2LKN A;  3KAC A;  3AS3 A;  1NMW A;  2F4E A;  4Z2K A;  3BXW A;  1FD9 A;  2MLX A;  4JFI A;  1F8A B;  1GRJ A;  2RUQ A;  3B9D A;  4NZC A;  2A3C A;  1FKG A;  2XP8 A;  2QF8 A;  2DG3 A;  4S3J A;  3TDB A;  3QOK A;  3CGM A;  1HKJ A;  3JYM A;  4G2P A;  2XPA A;  2DSU A;  1NWT A;  1UR8 A;  2ZR6 A;  3UI6 A;  1X6N A;  4Z2G A;  4LAY A;  4P8W A;  3CZ8 A;  1PBK A;  2VCD A;  2XP7 A;  2ZR5 A;  3B9E A;  1D7I A;  4QIB A;  1HKK A;  1FKS A;  3KAI A;  1W1V A;  1W1P A;  2K8I A;  4HBE A;  5B8I C;  4WIW A;  1OWQ A;  5GQB A;  1JNT A;  3RM9 A;  3WQW A;  1W1T A;  1FKB A;  5HUA A;  4N19 A;  1JNS A;  3KCE A;  2A3B A;  3IK8 A;  4LAV A;  1GPF A;  1HKI A;  4DWS B;  3RFW A;  4ODM A;  3KAH A;  4IQC A;  3ARP A;  2YBT A;  4IQ2 A;  3B7X A;  4Q7N A;  2XP4 A;  2XP3 A;  1TFV A;  1NH6 A;  2KO7 A;  2RUD A;  3RM4 A;  5DEZ A;  3UQI A;  4ZPW R;  1NWU A;  3PRA A;  4IT6 A;  1FKH A;  5DIT A;  4DRJ A;  1BL4 A; 
#chains in the Genus database with same CATH homology
 1D2K A;  2M2A A;  2DT3 A;  1QPF A;  3UI4 A;  1ROT A;  3ALG A;  4KR0 B;  1L1P A;  4LAX A;  2LJ4 A;  3ARW A;  4JFL A;  3ALF A;  3ARX A;  3UQB A;  4P8X A;  2ITK A;  1J6Y A;  4DH0 A;  2ZQT A;  1LG2 A;  2A3A A;  1SYT A;  3ODK A;  1JVW A;  5DIU A;  2B31 A;  2DSZ A;  2IF4 A;  2KGJ A;  2O92 A;  2XPB A;  1HKM A;  2PPN A;  4ODQ A;  4WK9 A;  3UF8 A;  1FKJ A;  1H0I A;  3O5R A;  2L2S A;  3O5I A;  4MNM A;  2N87 A;  1RD6 A;  2LPV A;  1FFR A;  3JYJ A;  2M08 A;  4IT4 A;  1Q1C A;  2PI6 A;  1YAT A;  2WLY A;  4DRK A;  2RSE A;  2PBC A;  1Q6I A;  1F40 A;  4ZPT R;  1SR0 A;  4NSB A;  2PV2 A;  3B9A A;  4P8U A;  4U86 A;  2PV1 A;  3AQU A;  2MLY A;  4DT4 A;  1X6L A;  4WKA A;  1B6C A;  3PA7 A;  2MLZ A;  4DRI A;  2PPO A;  3TC5 A;  2DT2 A;  4JFM A;  1JNE A;  3OOB A;  4DWS A;  3AS1 A;  4G50 A;  3WD1 A;  5GPR A;  4ZPV R;  1D6O A;  3CH9 A;  1D7H A;  3O5J A;  4DZ2 A;  3O5P A;  1QZ2 A;  1WB0 A;  3PRD A;  5HWC A;  3WIJ A;  1KT0 A;  3ARV A;  3CGN A;  2FKE A;  3ARU A;  2WM0 A;  1ITX A;  1XRV A;  2DG9 A;  1ZBW A;  3AS2 A;  3B8S A;  2ESC A;  2G41 A;  2RQS A;  4GGQ A;  2LGO A;  4JYS A;  3RM8 A;  4MPK A;  1YW5 A;  4W9P A;  2UZ5 A;  3WL0 A;  1E6P A;  4W5U A;  2O9O A;  4JFK A;  1LL4 A;  3O5D A;  3ARZ A;  1D7J A;  3KAD A;  2VN1 A;  1FFQ A;  1KT1 A;  3FY1 A;  4O2T A;  1LJY A;  1ZK6 A;  4Z2L A;  5JH8 A;  1LL7 A;  2KE0 A;  3WD2 A;  1H0G A;  5HTG A;  3EY6 A;  1HJX A;  3WD3 A;  1Q6H A;  3KAF A;  4QZV B;  2KI3 A;  2DT0 A;  1TCO C;  4DRO A;  1W9V A;  1LG1 A;  2ZQS A;  3CHE A;  4GIV A;  2XP6 A;  3WH0 A;  1EQ3 A;  3O5E A;  1WAW A;  3O5O A;  3O5K A;  3O5F A;  3RGC A;  1N1A A;  5HT1 A;  4HAR A;  4DRQ A;  1J4H A;  4URI A;  1OGB A;  4MNL A;  4DZ3 A;  4XAK A;  2DSV A;  1EYM A;  1CTN A;  1FKL A;  1FKK A;  3UI5 A;  5HW6 A;  3O5Q A;  1HJW A;  4MSP A;  4ODR A;  4FN2 A;  2ZQU A;  3W4R A;  3ART A;  4ODO A;  3FXY A;  2AOS A;  4C02 B;  1EHN A;  4JFJ A;  2IUZ A;  4DRH A;  3WKZ A;  1C9H A;  4IPX A;  4DRP A;  1ZBK A;  5GPG A;  2DSW A;  2YBU A;  4LGX A;  3JXV A;  4FAP A;  1E9L A;  1OGG A;  4TNS A;  1Y0O A;  1ZL1 A;  4U84 A;  5BXJ A;  4ZS6 A;  5DO2 A;  1JND A;  2DG4 A;  2ZQV A;  1Q6U A;  3PR9 A;  4TX0 A;  3TCZ A;  1W1Y A;  2XP5 A;  2OFN A;  4ITZ A;  3WD4 A;  3CHC A;  4U85 A;  1LL6 A;  1QPL A;  4W9O A;  1E6N A;  3ARS A;  5D75 A;  4ODP A;  3O5G A;  4TYO A;  2Y78 A;  1A7X A;  1XHG A;  1E6R A;  1NWS A;  2DT1 A;  1ROU A;  1ZU8 A;  3WQV A;  3NRK A;  2FDM A;  2OLH A;  3ARO A;  3FAP A;  1ZB5 A;  4KQZ A;  3KAB A;  5HW7 A;  4L3N A;  4ODK A;  1FKI A;  2XP9 A;  1WNO A;  4ODL A;  2MF9 A;  2RUC A;  4HBO A;  4AY1 A;  3RME A;  1ZBC A;  1IX5 A;  1HXV A;  2JZV A;  1VF8 A;  1FKF A;  3AS0 A;  4WKH A;  4MGV A;  2WK2 A;  1ZBV A;  1W26 A;  5J6E A;  5DF0 A;  1UR9 A;  1E15 A;  3KZ7 A;  4J4N A;  4TW7 A;  1W9U A;  4J4O A;  4PTM A;  3ARQ A;  4QT2 A;  2FAP A;  3ARY A;  1HJV A;  4DRN A;  4DWS D;  3ARR A;  4LAW A;  1KFW A;  3KAG A;  1LQ0 A;  3CHD A;  3PRB A;  1K9T A;  1R9H A;  4ML4 A;  1PIN A;  3GPK A;  1GUV A;  4W9Q A;  1FKD A;  3IKD A;  1EDQ A;  2PPP A;  2A3E A;  2MPH A;  3G6M A;  3NTP A;  4TW8 A;  5HKG A;  1FAP A;  4DWS C;  1EIB A;  2WLZ A;  1BKF A;  4MTV A;  4Q22 A;  5I98 A;  1P5Q A;  3VAW A;  1GOI A;  4MNJ A;  3IKG A;  3WD0 A;  4DRM A;  4WKF A;  2RUR A;  5HW8 A;  4Z2J A;  2MNT A;  4ODN A;  3G6L A;  3O5M A;  4BF8 A;  1FKT A;  4Z2H A;  4S3K A;  1U79 A;  2KFW A;  1NSG A;  2ZR4 A;  2D9F A;  3CHF A;  2G8Z A;  1O6I A;  2F2D A;  4QT3 A;  4Z2I A;  3NI6 A;  1T11 A;  2DPE A;  3UQA A;  4R5E A;  1W9P A;  4NNR A;  1J4I A;  2KR7 A;  1E6Z A;  2M1I A;  1ZCN A;  1J4R A;  1NWR A;  4L72 B;  1FKR A;  5HBF A;  3WL1 A;  4MAV A;  2F21 A;  2AWG A;  4TW6 A;  5DIV A;  1NMV A;  4MNK A;  4WJX A;  4R0X A;  1M5Y A;  3I6C A;  3IHZ A;  3LUO A;  3MDY B;  4P8V A;  2PV3 A;  3H9R B;  4DIP A;  3OA5 A;  5HWB A;  3O5L A;  2Q5A A;  1FJD A;  2LKN A;  3KAC A;  3AS3 A;  1NMW A;  2F4E A;  4Z2K A;  3BXW A;  1FD9 A;  2MLX A;  4JFI A;  1F8A B;  2RUQ A;  3B9D A;  4NZC A;  2A3C A;  1FKG A;  2XP8 A;  2QF8 A;  2DG3 A;  4S3J A;  3TDB A;  3QOK A;  3CGM A;  1HKJ A;  3JYM A;  4G2P A;  2XPA A;  2DSU A;  1NWT A;  1UR8 A;  2ZR6 A;  3UI6 A;  1X6N A;  4Z2G A;  4LAY A;  4P8W A;  3CZ8 A;  1PBK A;  2VCD A;  2XP7 A;  2ZR5 A;  3B9E A;  1D7I A;  4QIB A;  1HKK A;  1FKS A;  3KAI A;  1W1V A;  1W1P A;  2K8I A;  4HBE A;  5B8I C;  4WIW A;  1OWQ A;  5GQB A;  1JNT A;  3RM9 A;  3WQW A;  1W1T A;  1FKB A;  5HUA A;  4N19 A;  1JNS A;  3KCE A;  2A3B A;  3IK8 A;  4LAV A;  1GPF A;  1HKI A;  4DWS B;  3RFW A;  4ODM A;  3KAH A;  4IQC A;  3ARP A;  2YBT A;  4IQ2 A;  3B7X A;  4Q7N A;  2XP4 A;  2XP3 A;  1TFV A;  1NH6 A;  2KO7 A;  2RUD A;  3RM4 A;  5DEZ A;  3UQI A;  4ZPW R;  1NWU A;  3PRA A;  4IT6 A;  1FKH A;  5DIT A;  4DRJ A;  1BL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...