4DZ5A

W227f active site mutant of akr1c3
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
318
structure length
305
Chain Sequence
b'KHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRFVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Validating PR-104A binding to AKR1C3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 305
sequence length 318
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dz5A00
5HNTA 4QXIA 2QXWA 2P5NA 3UZYA 4IJRA 1VP5A 4GQGA 2HDJA 5KETA 3EAUA 4YS1A 4JQ4A 1MI3A 1S1RA 1ZUAX 2BGQA 3V0SA 4YU1A 2PDQA 5JH1A 2PDIA 3CAQA 4WDWA 3M4HA 1HW6A 1YE4A 1Z3NA 1FRBA 1K8CA 4XZMX 3R43A 3T42A 4JQ1A 3BURA 2ACUA 1AZ2A 2PDJA 4JQ3A 2IPWA 2PDPA 4ASTA 2IPFA 4FA3A 4GA8A 1Q5MA 4WDTA 3QKZA 2PD9A 3KRBA 4AUBA 4ICCX 1T40A 5LIKX 2F2KA 2AGTA 3UZXA 1HQTA 3H7UA 4JTRA 1RALA 1YNQA 2A79A 4H7CA 4JTAA 3UWEA 2I17A 5JH2A 4DBWA 3RX3A 3UGRA 3LZ3A 3G5EA 1T41A 2PDMA 2IKIA 5M2FX 3DOPA 4XZHA 3CMFA 1JEZA 4EXBA 4Q3MA 3M0IA 1EL3A 4DBSA 4G5DA 4JQ2A 1AH0A 4FAMA 3LBOA 2PDXA 2NVDA 2NVCA 4QR6A 1A80A 4IGSA 3LENA 2HV5A 3V0UA 2PF8A 1LWIA 3LEPA 1ZQ5A 2PDUA 3H7RA 2IPJA 4WGHA 1SM9A 2FZ8A 3GHRA 2ACRA 2PDYA 4PUUA 4WDXA 1Z8AA 2HE5A 1XJBA 4OTKA 2PDHA 3R8GA 2FZDA 2PFHA 3P2VA 1S2CA 3M64A 4XAPA 3LQGA 3FX4A 1S2AA 3O3RA 1US0A 1XF0A 2ISFA 1AH3A 2CLPA 3BV7A 2VDGA 4PRRA 2IKHA 3R58A 1ZSXA 5HA7A 3LUTA 2WZTA 3UZZA 2DV0A 1M9HA 2BP1A 3LZ5A 1Z89A 2FZ9A 3LN3A 3NTYA 5LIWX 2FZBA 2PDCA 5C7HA 4WEVX 3CV7A 3UP8A 4PRTA 4JIHA 4H8NA 1EF3A 3GHUA 4GCAA 1GVEA 1QWKA 2DUZA 4L1XA 2F38A 4PUWA 2ACSA 1AH4A 1YE6A 3R7MA 4GIEA 4IJCA 2PEVA 1UR3M 2PDBA 4QX4A 4PR4A 4L1WA 5LIXX 2ACQA 3LNMA 3CAVA 3EB4A 4LBRA 5LIYX 4JTDA 5LIUX 3R6IA 1EKOA 2R24A 4WRHA 4XZLX 1VBJA 4XO6A 3BUVA 4WDUA 5HNUA 2IQ0A 4HBKA 1ADSA 4DBUA 3V36A 2PD5A 4LB4A 3DN5A 1PWLA 1X98A 4XZIA 4EXAA 4R9OA 2BGSA 3H4GA 1IHIA 4HMNA 1Q13A 5DANA 2FVLA 4LAUA 2INZA 3WBYA 1LQAA 2IKGA 1PWMA 3RX4A 3ONBA 1X97A 3B3DA 1Z9AA 4Q7BA 3R8HA 4LAZA 3R94A 2R9RA 3EB3A 2HVNA 3ERPA 2DUXA 3UZWA 1AZ1A 2IPGA 2C91A 2PZNA 4LB3A 1C9WA 4XZNX 2WZMA 1ZGDA 2IKJA 4FALA 2PDNA 4I5XA 3WCZA 1OG6A 4GABA 1XGDA 2PDWA 4QBXA 3Q67A 4YVXA 2HE8A 2IQDA 3CV6A 1QRQA 4ZFCA 4JTCA 1PYFA 1MRQA 3BCJA 2HVOA 4GACA 3GHSA 3G1RA 3LD5A 3ONCA 3UG8A 2J8TA 1YNPA 2PDGA 1MZRA 4XK2A 3UYIA 3WG6A 4XVEA 4XO7A 2I16A 3FJNA 4DZ5A 3LQLA 4JIIX 3V35A 3COTA 1PZ1A 3Q65A 4MHBA 1IEIA 3WBXA 2INEA 2PDLA 4JQAA 1EXBA 2PDFA 3D3FA 5AZ1A 4PMJA 3CASA 3C3UA 1RY8A 1AFSA 2FGBA 4JTQA 5AZ0A 4F40A 4YVVA 1X96A 4FZIA 1R38A 4RPQA 3N6QA 4JIRA 3MB9A 4XVDA 3F7JA 3U2CA 4LBSA 4NKCA 3UFYA 1PZ0A 3GHTA 2HEJA 2IS7A 3RX2A 3WBWA 3O0KA 3N2TA 1J96A 1RY0A 3S3GA 3MC5A 2ALRA 4GQ0A 1S1PA 2PDKA 3GUGA 3V0TA 3VXGA 4YVPA
chains in the Genus database with same CATH superfamily
3MI6A 4PMVA 2QW5A 3HG4A 3GR7A 3A22A 1UR0A 3FA3A 2RJHA 1OX6A 2X05A 2G41A 1RBAA 1MI3A 4XKYA 4MYXA 3IK2A 3LLFA 2ZDRA 3PPCA 3E5PA 3WDRA 4GFIA 5GJNA 1HJWA 4MZ8A 5G4WA 1YE4A 3EPNA 1TV3A 4CCCA 1VH7A 2FZMA 4NAEB 1QK0A 4JDYA 4ADTA 3CZ8A 3ANYA 3AC0A 3UXDA 2QJIA 1JQVA 2A3HA 1E4IA 2IPWA 2ZX7A 1TUXA 1DTNA 2QCCA 3F4VA 1OB0A 2MUCA 4UMAA 5I23A 1S46A 4D1JA 4GI8A 2BXYA 3OIHA 4PFMA 4NZ5A 3UA3A 2P3EA 1RJRA 3W2JA 2Q8XA 2JIWA 4LCQA 5E1QA 1XLDA 3C0QA 4TUFA 4HYWA 1BVZA 2X16A 4K8GA 5JBEA 3OBEA 1V5XA 3WLTA 4DB7A 2GVJA 3CQ0A 2HK0A 3TW9A 3PNUA 3R10A 3L5LA 4DBWA 5CZKA 4ZE4A 1UWIA 2BVDA 1T41A 3RO6A 4US5D 1CXLA 3B9AA 3L65A 1Q6GA 3CNYA 1DP0A 3VX0A 4EXBA 5TF0A 1XLFA 5I3FA 2C0HA 3UR2A 2CETA 4K8HA 4JCMA 3UR8A 3DERA 3QN3A 3W7QA 4RW5A 2WCSA 2VNCA 3LM7A 3KVMA 2JK2A 2BX7A 1ZRQA 2DFAA 4MTVA 4UFMA 1DJIA 1Y5WA 2VCBA 2WB5A 3W25A 4P7OA 2XGIA 2IPJA 1W8GA 1I75A 1J0ZA 4K7YA 2YCLB 5FI8A 4HHMA 4MSSA 7XIMA 2OWXA 3DFPA 4FP1A 3AIEA 2ON3A 2PDHA 3URBA 2ZZ4A 3U0HA 1Z44A 1W9BM 4DUOA 5C54A 2B7OA 2YDSA 4S1FA 1PS9A 3DBPA 2RJGA 1WKFA 2WKLA 5M17A 4D8LA 3M43A 1AH3A 1OFEA 4WJEA 3TWBA 2QF8A 1XCFA 3RU6A 1E6PA 3A47A 4PTWA 3B8UA 2VCAA 3SCPA 1HN1A 4XD5A 4D6EA 2YPIA 3TZFA 4DO5A 4DJDA 2WOQA 1WXZA 2EJAA 3TIMA 2FZBA 1SPQA 5CXPA 1BEUA 4IHCA 2J7DA 5A6MA 5CLWA 5HOSA 3TQKA 1S3TC 4FLQA 3QV9A 2XWEA 1US3A 4AIEA 5C2GA 1FXPA 1QO2A 4BA0A 1I2NA 1W3IA 4Z2IA 5E0FA 2PTZA 1DIEA 3TA9A 3VC5A 4C7GA 1PKLA 1ZL1A 3GC2A 2HNHA 3SGGA 3UR7A 3PSVA 4IXXA 3WLKX 1EYEA 3RF9A 3LNMA 4J3WA 3NZ1A 3R6IA 3U4FA 1VCFA 1VHNA 2ZC8A 2UY4A 1HKMA 3KDOA 5D37A 4RDVA 3TSMA 3QZEA 4ZOBA 4DNMA 1VR6A 3MS8A 2A3CA 4EVZA 4IGNA 3UYCA 1DVJA 1XG4A 4RLIA 3CZGA 1V79A 3B8WA 2GSEA 4NZ1A 2QDDA 1KV5A 5KTLA 2FDMA 3EMQA 2QUVA 2RGMA 3LX9A 2O55A 5EFFA 1ICSA 4UZUA 2HXTA 3HG2A 4R33A 1WQ5A 3PK7A 3P6LA 4MJZA 3W22A 3TU9A 4H9TA 2DSZA 3S6TA 3GFXA 5D2VA 2DVTA 4HNOA 4C60A 4UTWA 4Y7EA 2WVVA 1QPNA 3PUOA 3F4NA 4R7OA 3DKJA 1HJSA 3GIQA 1ZJHA 3B8IA 4GINA 3AMLA 1EOKA 1DWAM 1E1FA 3LCXA 2GGEA 3H2CA 5BU6A 1UMYA 2YA1A 3W07A 3LI0A 4CQCA 3FKKA 4J5NA 2HE8A 1CWYA 3MSGA 1TYGA 4Q4KA 2VURA 4NZCA 3HFYA 2E1DA 3N17A 4GYKA 1ZALA 5CGQA 3L2MA 5CAKA 1VFMA 4TX6A 1OHLA 4XZWA 3STGA 4RE2A 8XIAA 1R9XA 4XK2A 1GEHA 5CSSA 5FEPA 5EMJA 1G67A 4IPJA 2I16A 3WEMA 4WSHA 3G0SA 1K70A 1DQUA 2HRWA 5T8GA 4LALA 1LLOA 4LT9A 3L2LA 4KFOA 3LHUA 3W85A 3LV6A 3K46A 2DZUA 1GOOA 1XFCA 3W6YA 5A8GA 2NW0A 3NQEA 4WK9A 4JIRA 1W2PA 3WMBA 2VX7A 4NJGA 2QV5A 1XP3A 3C2YA 1U33A 2PLMA 2HEJA 5C9RA 2XZ7A 1R8LA 4IMDA 3DI0A 1EP1A 2WQDA 4CNSA 1YPFA 3BAXA 2H3BA 1KTCA 1TV7A 4B90A 3KCJA 4HTBA 5DT5A 2W63A 4O0ZA 2HJPA 1XICA 1MRAA 3LXCA 4CD5A 1TPB1 1TELA 4PMQA 2X0YA 4Q6JA 3MUAA 3DHDA 4MMWA 1ZLPA 4YS1A 4RZBA 5CSUA 2PTWA 5D8WA 4BQ5A 3KOWA 4N42A 1BSLA 1EIXA 1RD5A 3M6YA 3CUXA 1CGXA 2CLEA 1HVXA 4XAYA 1XRSA 1THFD 1ME8A 3WLQA 1AJ2A 4P2VA 3KX6A 4NASA 1AZ2A 1ISVA 1JI2A 5HINA 2BXVA 4ZCWA 4S38A 1GTHA 1AK5A 1V3MA 2YZRA 3UWUA 2OYKA 1Q5MA 2D69A 3LTPA 1L6SA 3SUUA 2GJLA 1K77A 3IVUA 5MKGA 3A21A 1K3UA 3KCOA 1C8YA 4X0VA 2H6RA 1B9ZA 3Q58A 4MFEA 5E09A 4B2DD 3M0ZA 2GWGA 1K8ZA 1UKSA 1NM9A 1ME7A 1UA3A 4CQDA 5JH2A 3A9BA 3RX3A 4Z08A 3SSZA 2I14A 3SCQA 1QU4A 1IWPA 4MKNA 2GK1B 1RQEA 4O8AA 3APTA 3W71A 3FIGA 1UW9A 2QCFA 2R1LA 2POTA 5EU9A 4LOCA 4LQ1A 1EJRC 3WQDA 4IMFA 4QE4A 4UFLA 3FK4A 4XBSA 5A2AA 4B16A 4B3KA 2CYGA 1K7FA 3WLIA 2XN0A 5I3DA 1F5ZA 4XD6A 4AC1X 3C6CA 1RCXB 4M51A 2ZA3A 3EMCA 1EYWA 1UD8A 4XAFA 3TV8A 5HMFA 3WMCA 2VGGA 1H63A 2AMXA 5L6UA 4PUUA 1NOFA 2VQTA 2ATSA 3AHYA 4GI6A 4O1AA 2J9XA 1VYPX 2V5DA 4KRTA 3WLJA 2E9BA 3NQGA 2ZRWA 3W7LA 4PMUA 1R9YA 6XIAA 3C2VA 1XIFA 4INFA 3BLIA 3FEQA 2QDEA 2WYSA 2V30A 5C2CA 4S3KA 2BHUA 4X2PA 2BY1A 2PP3A 5C0QA 2X7VA 4NG3A 3LUTA 3WUEA 3RPTA 2XYLA 2GDUA 2TODA 2X2YA 1W5OA 5BNKA 1FX6A 3DKLA 3W7JA 3CPGA 1Q6OA 3PUDA 2DZSA 2PDCA 3GNDA 2OZ8A 2WSKA 3GFYA 3BZGA 5T9CE 2UWFA 4JKKA 5EBAA 3CS2A 3RPDA 1GQLA 5REQA 5FAGA 1R3SA 3VNDA 1W1TA 1DYSA 3QZ6A 1E71M 2F38A 2X8RA 4XSMA 1QBAA 4UTTA 2ABAA 4DWSC 2FJUB 2PEVA 1LT8A 1U2YA 3FHQA 1LRNA 3GXPA 2Y7DA 3W24A 4LUTB 4BQ3A 1VCVA 3E6EA 3REQB 2FTYA 2FVMA 5FJRA 2ACQA 3DZ1A 6PTDA 3CAVA 4IM4A 2J4GA 3ECQA 3IGXA 2CBIA 5LIUX 3EKZA 4IJBA 2GJXB 1RLDA 3PAOA 2EG7A 4HCLA 3A5FA 4GNKB 1POKA 3ARTA 1HXJA 1TE1A 4NHVA 1E0WA 1UBSA 4X61A 3WD4A 4JYEA 4CCZA 3VZXA 2WWCA 4GVHA 1DWJM 4B5NA 3P8JA 4LAUA 4AMAA 2F6XA 1P48A 1XIDA 4B5TA 3TVAA 2OODA 3M5XA 3JZUA 1UR1A 4JIEA 4GKLA 3M46A 3CPRA 4HOWA 3RITA 1XL9A 4P7LA 1IEXA 3EWZA 1JNDA 1LWHA 4BS0A 5BRBA 2FTWA 1MXGA 3PZNA 4R5EA 2A7PA 1E1EA 1W3NA 2PZ0A 3WJZA 2IPGA 3QR3A 2VEFA 4AY8A 2BZNA 2X2GA 3ZFHA 4D6JA 4WGXA 1TPH1 3MYPA 3GXIA 2CHNA 3KFTA 3VNYA 1ZTVA 1ESWA 1LBMA 4DQWA 3AXKA 3QMTA 4YNGA 1RCQA 2J77A 4ZE5A 2NUYA 2XGZA 3MUY1 1SMDA 4MY9A 3LGDA 4S3EA 3VCCA 3GHSA 2CNCA 1Q85A 1BLIA 4LX4A 1YNPA 4G7EA 2XG9A 4IICA 1TCMA 2WHMA 9XIMA 5E0CA 3OLGA 3AMDA 4FR6A 1C8QA 4XO7A 4D8AA 1RQBA 2F9RA 3BSHA 2J88A 2XTKA 2RDWA 3RCMA 4O16A 2YYUA 2R82A 5DELA 4UTIA 4ERIA 4GC3A 4RV3A 2YCJA 4BEQA 3WF0A 4UTKA 3V3WA 3AISA 3KBWA 4HMEA 1N82A 1DQWA 1M1BA 3VNKA 1GW9A 4JHOA 1YQ2A 3G24A 1MQRA 4E4PA 3PM6A 1V3LA 3TTQA 4ICMA 1EP3A 2FHFA 4O1FA 2CLFA 3KDNA 4QDMA 1A49A 3MSDA 4MAZA 3CZKA 3QW4B 4J2PA 1R9ZA 3WNKA 3EMZA 1OM0A 2YKKA 1E3ZA 1ZP3A 2CCRA 1LL6A 4YVPA 3GC5A 1E0UA 4U4MA 2ESCA 2WW5A 1HVQA 3NL5A 2Q6ZA 3KBNA 4IJRA 2D2HA 4EPDC 1DJWA 4PTMA 3RK8A 2YL9A 4GYFA 5LNUA 3T55A 3PBWA 4DUWA 4KCUA 5FESA 2PDIA 4JYFA 3C5QA 4KKXA 3W1TA 1YW1A 3R13A 6TIMA 3GG0A 4JN6A 5LKYA 2HSAA 4FLRA 4CNPA 1CB2A 3NQ8A 3MI2A 2Y5SA 3I7QA 3EXRA 3O2LA 2CESA 1K03A 1Q6DA 5JU6A 4LY4A 2VR4A 3EX6A 5K2ZA 4EPBC 3S83A 3HPSA 2QPSA 3WLHA 3B40A 1IXOA 4IFKB 1DIOA 3W6MA 2NQJA 1FWDC 3JUGA 2XFYA 1K6WA 1LQ2A 1TVNA 3OZOA 3UZXA 3L4WA 1HJVA 2YR1A 2VWTA 5CJ5A 3ZLHA 4EX4A 1F74A 1H5VA 3QR1A 4IL0A 3SAZA 4JTAA 4E38A 2BOFX 3NQVA 1PVNA 4NXSA 3PZTA 3HMJG 3G5EA 4DZHA 1TPUA 3AYRA 3IJQA 4OOUA 1KKRA 5AECA 1Q3NA 2FPTA 3GTIA 1W56A 3V75A 1N55A 1PPIA 1CCWB 1A5SA 4U10A 4X60A 4OIFA 5BYWA 1M7PA 1QMLA 2VCCA 5F1UA 3MQTA 3IVTA 4TVDA 2QJMA 5AYYA 1RXOB 1TA3B 3CT7A 3I6RA 2PGEA 4AF0B 1C8XA 2VD8A 3S6DA 5J8LA 3FVDA 4JOMA 1BHGA 4JEJA 2Z4GA 1Q45A 4JY9A 2EO7A 3DIPA 1BYDA 4O50A 1EZWA 3DFQA 3NVTA 5F7UA 5A6BA 3EEGA 3GHRA 4HNTA 3P80A 3WSUA 3AICA 1IF2A 1KB3A 4OTKA 1K7EA 4HSOA 5HATA 2YOCA 1EUAA 4MWAC 1LTDA 4L6HA 4C6QA 2YFNA 3WK2A 3AMCA 2E4TA 3AZSA 1US0A 3TC6A 1UOKA 2J74A 3QVQA 3F2DA 1GVOA 4GY7A 4M80A 3RYSA 3NM1A 1PHQA 1XSIA 2XSBA 1BYAA 5HR7A 1UKQA 3V4BA 1L8PA 4FXRA 2OG9A 5I02A 1HKKA 2RAGA 4WEVX 1JYXA 1ENUA 5L9FA 3U7BA 1F3XA 1FP8A 1YXYA 4MPKA 1CGWA 2D23A 1EF3A 3OTRA 1X1ZA 1TMLA 3EOSA 4NX5A 4WD0A 1OFAA 4F0LA 4BF7A 3P93A 4WKAA 2WC4A 1VIWA 4H04A 4U33A 1QI2A 1L2UA 3IV3A 1OINA 1J6OA 2JF7A 2WM0A 4MADA 1FWNA 5FL0A 5CPSA 2ZE3A 3GU9A 1CTNA 5LIYX 1UKOA 3NVDA 1EQPA 3BWWA 1HKVA 3TDFA 2QIWA 3O15A 5FSDC 2VC5A 5FD0A 4A22A 4KCWA 1FCBA 1WKEA 3DESA 3O6CA 1V6UA 4LB4A 3L21A 1U5JA 1W3HA 2BFGA 1Q65A 4S3FA 1KXTA 4AWTA 3BDKA 6REQA 1E56A 3VIGA 2QIIA 1WDWA 1PE1A 3SUWA 4GXPA 3IARA 4LY8A 2BMBA 1XLMA 2NT1A 4ZMGA 3ITGA 3IUDA 1GYMA 1EHNA 5FIPA 4AZCA 1ICQA 2FIQA 3PJTA 4DIAA 3FJ6A 3R0DA 3DFNA 2OZ3A 2FGZA 3GB6A 3EDFA 4W8AA 1X38A 4PB3A 1CT5A 1OT2A 4HD5A 3VILA 5KEZA 3BLPX 4I7UA 1TV5A 2XU2A 2ZQ0A 3WCZA 3PTKA 1GJPA 3W7EA 1XGDA 2NWSA 4KCVA 2A3BA 1H1ZA 2C1GA 3OJGA 4ZTXA 3M0JA 4URIA 1A0DA 2OQLA 4ZFCA 2V81A 1V02A 2Z28A 2E9LA 2FZNA 3UXKA 3S1WA 2V38A 3HPZA 4V15A 3JU2A 4C1KA 1KD0A 4H9YA 4PFHA 4MVAA 3HF3A 3DEQA 3WL1A 3H2FA 3H54A 3JR2A 3TOYA 2E6YA 3UYIA 1QBBA 3NZPA 2Q3RA 3G8EA 2QJJA 3ZQ9A 4C7FA 2YIHA 3FW6A 2EF9A 3NDOA 5AZ1A 2QUUA 3O9NA 3HV8A 4Q4RA 1XM3A 3P82A 1KXVA 4R53A 1WNOA 2E0PA 4ERAA 5AZ0A 1VBRA 5FSEC 3W1AA 4HK7A 2E5BA 3HM7A 3ORWA 3DCPA 4RPQA 4AIBA 2VP8A 4M29A 2DPEA 3P81A 5FKYA 4H9XA 2PC4A 1BD0A 4XG1A 3PTMA 4H83A 3ZZ1A 3VNLA 3W37A 3G1VA 1R0MA 2QMKA 5LZLA 3C0JA 1O5KA 2WV8A 4H6KA 2GYIA 4H9ZA 3LCGA 4RNIA 1JPDX 2NSXA 3RAOA 4QXIA 4YHGA 3GNRA 3POHA 1A5NC 3C2EA 3CWOX 2D1ZA 4F9JA 1C92A 4LF1A 1AJZA 5EMMA 1QT1A 2Y89A 1KBJA 2DQWA 4LS0A 1ZCOA 4ALDA 2SFPA 3DYOA 3WDJA 2V5LA 4WJXA 1RHCA 1XGEA 1B3OA 4H6EA 4D6CA 1O5QA 1AQFA 3EX2A 3S5ZA 8RUCA 2TYSA 3G22A 4JTEA 1XH2A 4BQ4A 3V1HA 5C55A 3GG7A 1NOWA 2PD9A 2QULA 4UR9A 1CX9A 4P8XA 4A29A 3E5BA 3RN6A 1E0TA 4XX6A 2AGTA 1H60A 1MW3A 4WKFA 1VYSX 5BROA 2XIQA 5IHRA 4JIQA 1QJWA 4Y9OA 1D3HA 3ZVHB 2GFTA 1SR0A 4C1NA 3TX9A 4H9VA 4A6GA 1EIBA 3UGRA 4UOZA 2EHHA 4EOUA 4BCEA 4W88A 1JYWA 3QV7A 4GFSA 1NDVA 3W2UA 4FIQA 3E0IA 4RJEA 2PAJA 5A69A 3P74A 3MP5A 1NTHA 3NDZA 4FXJA 2Z25A 1EL3A 4JKMA 3TOPA 5LA2A 3NFUA 1XRVA 3AXIA 3VOGA 3WNNA 1B3ZA 1O1ZA 4JNZA 4DLFA 1QXLA 2Y7FA 3HB9A 3NPXA 3U5YA 2J7GA 4OV9A 1UH3A 4DVOA 1ISXA 4TXEA 5I00A 3NOYA 3IIOA 3CZLA 4H01A 4H8VA 1J12A 1ISWA 4UCGA 1ZQ5A 3C4UA 3BQ5A 3LCIA 5FF2A 4W8LA 1PL9A 5FJIA 2XDFA 4MNKA 1R3YA 4KCTA 3W01A 1OCBA 3STPA 4O53A 3A3WA 4J40A 3BLFA 4TMCA 1E43A 2D2OA 4UQDA 2YXXA 4UNKA 4LNCA 1J0YA 1VJSA 3WMLA 4HA3A 2ZA2A 1KBIA 3PPHA 3OVPA 1S2AA 3W7KA 2F6KA 4NXKA 2XH0A 5SWUA 3IVSA 3TC3A 3W2KA 2I56A 4Y8FA 1DHKA 4DJEC 2QZRA 5HNNA 5DFAA 4Z17A 1W9DM 3Q2DA 1M9HA 4A2SA 2WNQA 2NQHA 1RP8A 3K8MA 1YIXA 3S0CA 4J9JA 5C7HA 3T2PA 2GL5A 2Z2BA 1XYMA 1JZ3A 4OFCA 5BRQA 1UKTA 3DBNA 2VFEA 4ZO9A 2NQ5A 1YXDA 1GVEA 4O8RA 4ACZA 3GDKA 5AYIA 3QPZA 3N4EA 3OLDA 1CLVA 3KP1A 1RD6A 1WAUA 4HPXA 1ITXA 3A13A 4E8GA 4R9XA 2NX9A 4QX4A 4X2RA 5A94A 3BXWA 4C65A 3AIWA 4BEUA 2NV1A 2W6RA 4LYQA 2WCAA 3IJ6A 2O92A 4XO6A 5D2WA 4FB7A 1KLZA 2QUNA 5D03A 3DG6A 5I5RA 3W74A 5A6KA 3CUJA 3CV2A 1QI3A 4J35A 3ES8A 2OKOA 1ITCA 4KIRA 3W7RA 4L61A 2OLSA 2IKGA 2WPGA 2J25A 3BAKA 3T0TA 1AW1A 1AQHA 4RK8A 3CTTA 1A50A 4N9EA 4DEFA 2GGIA 4DNHA 1PBGA 1NEYA 3R94A 4U3CA 3NQDA 5XINA 3D0CA 3HGOA 2HVNA 3ARZA 1J9YA 1ISZA 1NAL1 3T0DA 1L6WA 2GJNA 4AYGA 2ZXDA 1HP5A 3LHVA 3CBWA 5C9ZA 3U9IA 1N8FA 3ZJ7A 1B3WA 1AMYA 2H3DA 2JEPA 2PS2A 3CHDA 1PKMA 2QV4A 1QW9A 2A6LA 2QAPA 1X6NA 1DJNA 1OADA 4RR4A 1FHUA 3W1UA 4ADSA 1UD6A 3QHOA 3HZ3A 3GTXA 1MRQA 5G2HA 1F6YA 1KC7A 3M9YA 3H2AA 4ZXLA 3PY2A 2OT1A 3QQ1A 3USBA 2CBUA 3M0KA 3URQA 4XTIA 4B3ZA 3ITXA 1DXIA 1B3YA 4XVEA 4TMBA 1TRIA 1UH2A 3IPWA 3O1NA 1FBAA 1IEIA 4I9JA 4MGGA 2PDLA 1TJ2A 2PWUA 3NWRA 4I3GA 4O19A 1I2OA 1OEPA 3TAOA 3JS3A 3CASA 3B9NA 1EFZA 4BI6A 6TAAA 2CZEA 3PHAA 5I3KA 4P7RA 4JTQA 1PDZA 1LYXA 4F40A 1I2QA 3TFXA 3UG3A 1MQPA 3PANA 4CNTA 4DXVA 4N4PA 2BOGX 5EL1A 4XIAA 3TYDA 1E3XA 2IS7A 3NPUA 2GUYA 4O1BA 1MDRA 1UZ4A 2GSJA 1RY0A 4Q8TA 2ALRA 4CQBA 3GM8A 3LCLA 4ERGA 2A7NA 1UR9A 1EJSC 4GOAA 1D7FA 1WKYA 1ZNNA 5AC7A 2R1NA 1EX5A 1E1CA 3VGBA 3LOTA 2DIKA 4JL2A 4GQGA 4UTLA 4U31A 1L0PA 2EXOA 3UPWA 3OHIA 1SU5A 3PTQA 4E3VA 3L7RA 1W32A 4QNEA 3D47A 2ZZ2A 1ZJIA 1O4UA 3R43A 1H4PA 3BJTA 4HHPA 3IK4A 4HJWA 1FCQA 4XZ9A 2VUYA 4GNJA 4EF9A 1JPKA 3VO0A 4D6DA 3VAVA 3ITYA 2IPFA 3ZOAA 1LCOA 2F8QA 1TR9A 3SB0A 2OO6A 1HIZA 1KM1A 4ICCX 1X8CA 4DPPA 4E5TA 4AFYA 3K1DA 5H2ZA 3WUBA 1OIMA 4DWSA 3QFWA 4QS5A 2CBVA 3FY1A 4KH2A 3N6JA 4PB5A 1FH7A 4WF7A 1WZKA 2IKIA 1W1PA 4V28A 2E6FA 2INFA 1J0HA 4P8VA 5BCAA 1A0CA 4DO7A 4W8BA 3LB0A 5E6YA 4FOKA 4KQNA 4JQ2A 3HFTA 1XSJA 2XH2A 4LUIA 2J9ZA 2BASA 3TROA 1US2A 1XXXA 3W7HA 4PTDA 5FOOA 3OQEA 2HWGA 4QSHA 5CEWA 1E6XM 1O5XA 1H1NA 2VRKA 3IJLA 2VC6A 4FMVA 1ZJBA 5HXMA 4XBJA 4DO6A 2ZUUA 3VD4A 4E4FA 4DJDD 1MNZA 4E8CA 4C91A 1XJBA 4LCSA 4NJJA 5F4SA 3KWSA 4GBDA 2DW6A 4GZEA 2DW7A 1SYTA 3L0GA 3WNOA 1H51A 1QHPA 4RNHA 1UC5A 2Y5EA 2PWHA 3UWYA 3PN8A 1XBZA 3IRDA 1Y5VA 2QJGA 1G4EA 1H7XA 3II1A 2R14A 1FTXA 4GY0A 1GG1A 2CLPA 4L4PA 1PTDA 1VAHA 1NJJA 2PUZA 1PCWA 4Y96A 3HMCA 1CXKA 3R58A 4K1WA 1EC7A 2O4MA 1LLWA 1XINA 3AS3A 2G97A 4GO9A 3APGA 4JFTA 1TTPA 3AMGA 1HJUA 5GPRA 2PMQA 1KTBA 1XDMA 2VOMA 4KS0A 5BRPA 1J4EA 4G6CA 3RM9A 1F73A 4LV4A 1LOLA 4S3GA 1T6MA 2PWEA 3AI0A 4EE9A 1J2WA 4PRTA 1GOXA 1OX4A 4MM1A 4QIUA 5BXPA 5I03A 2EG8A 3K1GA 4Q8OA 3MANA 2BV9A 4GCAA 2WQPA 1GYNA 4BZYA 4L1XA 3T1GA 1IEWA 3HOJA 3R79A 4JS3A 3ZJ8A 2QCLA 1W1B1 4CN1A 4B91A 4DYJA 1OWQA 1S5VA 3FOKA 1S5MA 4L1WA 4AQLA 2YBUA 4M6VA 4PUEA 3VD7A 3LPGA 1TJPA 3TSBA 3W7DA 3CWNA 4XKYB 4NYUA 4XSLA 3EX1A 4KESA 2ZTJA 3BCFA 3CC1A 3A9IA 4WDUA 3PULA 3V36A 2PD5A 3GO2A 2UZ9A 3RDKA 1R87A 2BBFA 1X98A 4XZIA 3N29A 2NXGA 2BGSA 2WSQA 2VTFA 3RLUA 2POZA 5J04A 4UMBA 4ILSA 4L4MA 1QR7A 1V03A 1IXPA 2NSOA 5ABTA 4MUPA 1VFSA 3ZVIA 1W31A 4H7VA 4A8LA 1H7NA 1QPRA 3CQHA 4LAZA 3UY8A 3L67A 2E40A 1H7OA 3BW4A 4KW2A 1VIZA 4KWOA 4S3AA 5CZSA 3AIRA 1UPMB 1H7WA 3CGTA 2PA6A 1GNXA 1VLIA 2C13A 3FFSA 4AX6A 4ZB5A 3L66A 2DSVA 3KM8A 4I5XA 4IMGA 3W1NA 1TTIA 3CV1A 2EPHA 1DIDA 4DZAA 1R5YA 2PURA 3AOFA 3QYSA 3AIBA 5JIPA 2G4JA 4FX7A 4IQEA 4GKTA 4CLMA 1MWOA 1YBQA 3BCJA 1YRRA 1UD2A 3KP0A 1UIPA 3G1RA 3SUTA 1TPC1 6XIMA 3FAWA 3QF0A 3R0UA 4MKVA 3T08A 3VX1A 4AWSA 3KXQA 2QS8A 2BVTA 1M65A 1KQZA 3FJNA 5M1TA 3A4AA 1ZCCA 2QCHA 3OYXA 5AHNA 5AB3A 3ITOA 1YADA 3BJFA 3QXBA 4NAEA 3D3FA 2OO0A 1FUYA 2J7BA 3WFZA 1R47A 3OZPA 3IGSA 1U83A 3QRHA 4LNYA 1U1UA 3EKGA 4NNCA 3ZWTA 1X96A 3SQLA 2OWWA 1R2SA 1TV4A 3O0FA 3GVGA 2WZIA 3N6QA 1KR0A 2VC7A 1P4CA 2XFRA 8CGTA 2CW6A 4LBSA 1NDWA 3NQAA 3SFWA 3N9RA 1F4AA 2Z29A 1DKWA 1G94A 4K1GA 3G2GA 1RZMA 1CGUA 3WDPP 4RPPA 2J7FA 1IXNA 3NIYA 3QTGA 1Q7ZA 3TONA 3V0TA 1DJGA 3K5XA 4MWAA 4H1ZA 2XIIA 1KFBA 1C91A 1H0IA 3RM4A 1J0KA 4DYKA 1GZ1A 3HG5A 3SGZA 2QJNA 3GBDA 1ZU8A 2PLCA 3W7IA 3B05A 3MCNA 3EOUA 5DCBA 1W5NA 1GPWA 1P0BA 4HA4A 1RCOB 3ITCA 3M4HA 4KWVA 1UOZA 3ANVA 5DT7A 3WDIA 2E7FA 5LXEA 3UG5A 4FXFA 1UP3A 1M68A 4YLWA 4FNSA 3W2NA 3UPBA 3EX3A 1DJZA 1NQ6A 3EOLA 1E4MM 3F2CA 3ZM8A 5EMYA 4UWMA 4HJFA 2EPMX 2YCLA 2GQ9A 3DHUA 2PBOA 1GQJA 3SN4A 2I5QA 3OB8A 3IV8A 3GW3A 5HUPA 4AUBA 4HPJA 1R3TA 5LIKX 1MFVA 2Q3OA 1KO0A 1O94A 1Z42A 3KVLA 4IUOA 4S2CA 1JZ5A 2DZWA 3W82A 5B7YA 3DYPA 4ML4A 4N7QA 1B1YA 1G01A 5HMEA 3C0LA 4YTUA 3UZ5A 3GTHA 2HS8A 3SQSA 3L2IA 4A21A 2CIPA 3BMWA 1L8NA 1SJAA 3H2OA 2J6VA 1RR2A 5JMUA 2D0GA 4X63A 1IWAA 1XW8A 4K3ZA 4NX0A 2YCKX 3MSYA 4DBSA 4J28A 2R6OA 3MMUA 1EJXC 1C7TA 5M3WA 3J7HA 2D73A 3BAWA 3MZNA 3T8LA 2NVCA 2O9OA 1A80A 3I3BA 5IHSA 4L56A 4PEEA 1E55A 2VOTA 1FWEC 3PP7A 3CT2A 1LWIA 4W9TA 1A53A 1V02E 1JRCA 2OB3A 1B90A 3NXLA 3RMJA 1V0NA 5IXEA 3N3TA 3BCDA 3BJSA 3O6DA 3EOOA 3NZGA 4PCTA 2A3AA 2O56A 2B7QA 3H8AA 2FZDA 1KTNA 2NUXA 1SQ7A 4Q8NA 3W00A 1KM5A 1OD0A 1IIGA 2W67A 3GIYA 4H00A 3PJWA 2Z27A 1I1WA 5IFTA 4HZ8A 1JI1A 4LFYA 2Y24A 3WQVA 2F2HA 2O7SA 5I2UA 3TYAA 1QUMA 4HU4A 5JXQA 1CLXA 3GXFA 2QMJA 2WZTA 3GW0A 4G1NA 2WSYA 2WHKA 1XX1A 4EXQA 2HPIA 4MNJA 4AZBA 4TO8A 3LHZA 3TJLA 6ENLA 2FGLA 3S8HA 3KW3A 1P0KA 1FWGC 4LPCA 1IV8A 3WQWA 6ALDA 4PBEA 3PR2A 2ZX6A 3TYBA 4FPSA 4OJYA 5C70A 4LS1A 1FH9A 4W7UA 1W17A 4QDWA 3TZNA 3VOIA 4QAWA 4E6MA 3UVIA 3P7YA 3KUMA 1AH4A 2NWRA 1RBLA 5D38A 1NF0A 4DM2A 7TAAA 2PDBA 4Q8MA 1R7AA 3QKEA 4UOQA 3T7VA 4GCXA 2E8ZA 1MEIA 1VB9A 1G7VA 4I5RA 3VKDA 5CZTA 2E6AA 4GUGA 1FCVA 1ECQA 4IPIA 3DGRA 4YCPA 3BUVA 2C6QA 1P43A 2VZVA 2W3ZA 1E9ZB 4PMNA 2WSRA 5CBJA 3RG6A 4TTUA 4DUXA 2E3ZA 4U3AA 1G9HA 5C9UA 4Y9PA 3A3XA 1AL7A 1CZ1A 2G3NA 3UWVA 3VFLA 1FFRA 4GI9A 4HMNA 5A6SA 2FVLA 1W37A 3MWAA 1E9YB 4M7TA 3WQEA 2INZA 2ALDA 1V3KA 2G3FA 1EA0A 3B4YA 1QI4A 1R3QA 1Z9AA 1J0IA 3C2OA 1TWDA 2BXZA 1RAKA 4UB9A 4O14A 2B4GA 4L4LA 1QPQA 3S1XA 1SFLA 1OABA 2E09A 3GAYA 5I06A 3DH7A 3ERPA 1P6BA 1BTCA 1XIHA 4CVWA 1NWRA 4AIUA 3EOEA 3IGHX 3WJYA 1QNVA 3K4WA 1UP2A 3WLSA 3BANA 4DWDA 1PX8A 2IXVA 2BY3A 2QCMA 4Q4QA 3GSMA 1KCLA 3T40A 4XUGA 4ZSUA 4MLJA 2F7FA 3HGSA 2YDQA 1HUVA 4ZSTA 2FLIA 5D04C 5DLCA 3DFSA 3WK3A 1G5AA 4TTGA 4E2DA 3LD5A 1ZHAA 3MUCA 4JYDA 1J5TA 3I7SA 3WFAA 3F2BA 5I7GA 3ISIX 2D20A 4X0NA 1XS2A 4DZ5A 3W1XA 4JIIX 2J79A 2INEA 5AHMA 1W6TA 4JQAA 2J47A 1BQGA 3O05A 3TLLA 5EY5A 5HANA 4E2BA 3QPEA 5FJUA 1AFSA 3SUSA 1E0VA 4HYRA 4AD5A 4F4RA 1KRAC 4Q8QA 4NUWA 5B7ZA 3UY7A 5D2XA 3VTRA 3OOQA 3T44A 2IQTA 1V0LA 1V0MA 5HPOA 3BLDA 2Z6IA 3UCDA 4X9YA 2CLIA 3VPLA 4EWND 3VOFA 1ZP4A 4RX0A 5I09A 4WQ6A 3GK0A 3PG9A 1MUMA 1Q6QA 4C7DA 1PSCA 2HPMA 5G2IA 4F8XA 3PFMA 2EKGA 3LLDA 3A6OA 1KCXA 4UR7A 3CEUA 4O52A 4NIRA 2XWDA 4LJ3A 4Q4PA 2Z1KA 5FA5A 5REQB 1CW2A 3UZYA 3M44A 4H3DA 2VC9A 3FNDA 2XVKA 4YIWA 4J2MA 3RXZA 4LSBA 2DSUA 3BLEA 1PIFA 2AOSA 5LNSA 3EAUA 4JTLA 1C93A 2VJXA 1W91A 4KMQA 1I60A 3CUGA 3GUWA 4GUFA 3W1MA 4RDZA 2BG5A 4DJEA 4PRWA 4ZZ9A 4H2HA 4L6OA 1A5MC 1OQFA 1GPFA 3DHFA 3WH5A 2A1YA 4RXGA 3TJ4A 2X1SA 3GBEA 4I8YA 3TTSA 4LF2A 4KPLA 3TE9A 3GDLA 4FLSA 3QY6A 1OFPA 4FX8A 3N2BA 1EWDA 2DY3A 2CERA 3HPAA 3QC0A 1UD5A 2C8NA 4FSAA 3VUPA 4Z1CA 5EB8A 2V82A 3KVJA 1TJ1A 2ZZ1A 3WLRA 1E6NA 3FA4A 4O18A 4Z2KA 3H7UA 3G1YA 1L6FA 2DH2A 3Q94A 1LOQA 1B2YA 3PVFA 5FJTA 2PP0A 3VKJA 3S5OA 2Z7KA 4G1KA 4AD2A 5A6BD 2PDMA 3H24A 4WCJA 1E51A 3FJLA 4UC5A 2NT0A 4WSJA 4ICNA 2A2IA 3MMTA 2EQDA 2YDAA 3PBGA 5AVHA 1KA9F 1QI5A 2XUCA 2HVMA 2X30A 3RR4A 1PZ3A 4IPPA 4OE7A 2VDIA 3LBOA 3WH9A 4GQQA 5CSRA 1U1HA 1NDYA 5HWJA 4ATWA 1QFEA 4QITA 4D71A 3WELA 4JFWA 1KM6A 4JTUA 1TTQA 5TQLA 3H7RA 5FJOA 3P5ZA 3WQPA 3B9OA 4WDXA 2JGYA 3OP2A 3BK0A 4ZODA 1BXNA 1B0IA 1V3JA 3GC4A 3ARXA 2VGFA 4LUTA 3L9CA 1ALDA 2CU0A 5FEXA 1WDPA 2YA0A 5KZMA 1SW3A 2H8XA 2GJXA 3E2SA 8XIMA 1E40A 4U2ZA 4BK9A 3L12A 3WMSA 2KZHA 3VYLA 1WOBA 4CQAA 1MW2A 4Z2JA 3E49A 3SADA 1XG3A 1WDSA 4RNFA 4EAMA 3ARQA 1Z89A 1GVIA 1MYRA 3IS4A 3MV11 5A95A 4O57A 4BI7A 3A4JA 3EWUA 5G4EA 3BW2A 3GRIA 3YPIA 5FCZA 2VHLA 1BKHA 3LCWA 7ENLA 3UP8A 5GJPA 3PWGA 5CG7A 4M1BA 3G6MA 4L5ZA 5HWMA 1G0CA 3LTYA 3W88A 1S39A 2C3ZA 4WZHA 2RH9A 3MP4A 3NEHA 4JTIA 2W61A 3MBDA 5E5CA 3C8NA 4IJCA 4PGLA 2EBNA 1K9DA 3WK0A 1YPXA 2ZFAA 4CU8A 2C7FA 1PX3A 4QE5A 2C0AA 4LVGA 1H50A 4KWWA 4AEEA 3CH9A 1OFDA 3AZRA 1WV2A 5FF4A 1GEQA 3M5ZA 4HN4A 4C5YA 1QATA 1L6GA 3PUGA 4HZMA 2Y1HA 1CPUA 3S47A 4BFAA 3CWHA 5CKSA 3WFLA 4I6KA 3M1ZA 4CGTA 5DY3A 4QHRA 3IACA 2BLEA 4RZ4A 4AB4A 4JNYA 2P50A 4O11A 3QGKC 3WQ5A 2EG6A 4IUGA 5DANA 5XIAA 4OKDA 1B54A 2J8GA 3B0UX 3CL6A 1P5BA 2C79A 1TRDA 2J27A 1NFPA 1OF8A 1H09A 1LORA 5HJLA 4NJKA 4XB3A 3PUEA 3AWOA 5I3GA 2HXUA 3B8SA 5GNZA 4NP7A 3VDBA 4RKAA 4H8UA 4FIRA 2VZUA 1D3GA 5AC8A 5BOOA 4FNQA 3AROA 5JBDA 1AZ1A 3N73A 2CHRA 2KX9A 1M3UA 2PRHA 1XUZA 3MHGA 4E3TA 2AMGA 1HGWA 4YJ5A 1SO3A 1Q7MA 5CC5A 2RDTA 2HK1A 1EOMA 1OG6A 4YWIA 5EMUA 1W2VA 1Q2RA 1ONWA 3WYZA 3M5VA 2R8WA 3W7CA 2OJPA 5DBTA 2UBPC 4HSHA 1GG0A 3E96A 2PGRA 1ADOA 5G5IA 3LGEA 3R89A 2ZXQA 3AFBA 3MKKA 4JTCA 1KW1A 1A5UA 3RLVA 3STFA 4EKJA 2Q02A 3WD2A 1VFTA 3S9IA 1SFTA 4B5VA 2ASHA 3SDOA 1NQKA 1TR1A 1EQCA 3C52A 3G0UA 4Q8WA 4K36A 3W81A 3HIJA 3ITTA 2WK2A 1KXHA 5CLTA 3Q65A 3BARA 3Q37A 2QAFA 1JCLA 3AIUA 1FCUA 4JX4A 1Y0EA 3IIXA 4MZ1A 2O0TA 5IBXC 3S2LA 1KM4A 1VBGA 4ZENA 3M0MA 1RY8A 1JNEA 3N14A 3N6HA 4DBDA 1KWGA 4QISA 3EDDA 4L6DA 1IR2A 2X1UA 4E8DA 4IFKA 2OEJA 3TCEA 3F7JA 2X40A 4MAVA 1QPKA 1IT8A 4M6PA 1CGTA 1PZ0A 5IOBA 1RPXA 1V6XA 4TV6A 3OGSA 1RP9A 2GVLA 1PHWA 1ZPTA 4TU1A 1SJDA 3H26A 1BVWA 1TPEA 4NF7A 3ARSA 3FJ4A 3AHZA 5HMSA 1YHTA 3VXGA 1P6CA 1XLBA 4GYPC 2Y6ZA 4HOXA 3E02A 1OG0A 3GXDA 5A8PA 1GVSA 4OT7A 2RDUA 4GPNA 4MNMA 4HN8A 4DAFA 1XIJA 1TUFA 4GI4A 3HBLA 4QROA 4EF8A 4F3HA 4XAGA 3S1GA 3G1SA 1UROA 3BC9A 2JKAA 1LUCB 4PE8A 3NSNA 3I6TA 1TA3A 3S2CA 4AAJA 4UQAA 3C56A 4QG9A 4AF0A 1FRBA 1I2PA 4PCPA 4FF5A 1EUNA 3EA1A 4XZMX 5CC6A 2G50A 2B7PA 3A12A 1QNQA 1UUMA 1HKIA 3E0LA 2HBXA 3ZO9A 5EYWA 3AUOA 3M7WA 4LUSB 3TR9A 3U48A 2BWGA 4C90A 1UQZA 4GA8A 1DE6A 1FWJC 1TZ9A 4GH3A 1PDYA 1AD1A 3NO3A 2ZRVA 2F2KA 4YHEA 2NQ9A 4WIWA 2W66A 1QNSA 4LC8A 3MTWA 4ZO6A 1ZJAA 4M8UA 5C7VA 3O7UA 1ZBKA 2BOEX 2Q01A 2QNEA 1XYCA 1D8CA 3THAA 3IEBA 1BWKA 3P60A 3PSWA 5M5DA 3AU6A 2BY0A 7REQA 3W7NA 3QY8A 1XIIA 3UWWA 3WF4A 3VIHA 4UFKA 1OT1A 4RZ6A 5TBOA 1R7OA 3W7OA 5AHLA 4OZOA 2Y0FA 2PRMA 3H21A 4IGSA 4HHHA 4P5UA 1HF6A 1SGJA 2R1KA 1XIBA 1Z69A 5AC4A 3ZT6A 1KRCC 4TVUA 4O4WA 3C0SA 5EMLA 3W87A 1L2QA 1SM9A 5HQLA 3MKCA 4QAIA 3GX9A 4BR1A 3BICA 3GY1A 3ARYA 3L4XA 1K8YA 1LG1A 4MB3A 1Q63A 3NCOA 1KRMA 3RIKA 1CEOA 1NF7A 1G4PA 4V2XA 2ISWA 4NILA 4BF5A 4FNRA 3GLCA 4JTGA 3HPFA 3NR0A 4C5ZA 1JDEA 4QCFA 2WMGA 1MEWA 2DZTA 3MY9A 1M7OA 1WB0A 5U7SA 3BV7A 1W9PA 2PF0A 4M81A 4JTSA 3CUHA 2DV0A 4QJ5B 1XWYA 2BHZA 2VO5A 5BWAA 3OZMA 1XQLA 1ZENA 3W28A 3M0HA 3CK5A 2OOGA 2VEIA 4FHAA 4JZ5A 3LBCA 3QHMA 3PPGA 4DYEA 1XDJA 3F03K 4PZVA 5JBFA 3LV5A 3AYVA 4MWAE 3NQMA 5H8PA 2HZGA 3KRZA 3T81A 5K9CA 1W3LA 2RHGA 1SMAA 3EZ4A 1MO0A 1U5HA 3IAQA 1TTJA 1X1OA 2VWSA 3FHAA 4W7VA 2YZ5A 4I7VA 3WLLA 4W84A 1ZBWA 3VMNA 3JRKA 2DJXA 1JPIA 3QM3A 1SZEA 3HQNA 4AXKA 4REQB 4Z0SA 3BPWA 4RV8A 2IQ0A 5FAJA 1YDVA 3LHTA 3MBFA 4PMRA 1TJ0A 1BVNP 3JZEA 2WMIA 4M82A 2NV2A 3KHJA 5JQ9A 1QDSA 3KE0A 3G6LA 3RFAA 2WVTA 2ZRYA 3QQWA 4KIEA 2J6XA 4TX9A 3BAYA 2PWGA 3THCA 5HQEA 1A47A 3U5UA 3M0LA 1UYQA 3WKZA 3KS6A 4Q7BA 1O68A 1E5JA 3BLOA 4AMCA 2R9RA 3M0XA 3MDWA 2FB2A 4C1NB 4A3UA 1XLJA 1E0XA 1ZBCA 3PZGA 2C91A 1B3XA 3VINA 1LWJA 1E6QM 3WF1A 2OYMA 3CUZA 3NGFA 1ZGDA 2ZRXA 4FALA 4UFHA 1F7BA 2B81A 3UW6A 2PDNA 3SRHA 1QNRA 1SO5A 4PMDA 1XLGA 1J18A 2QCEA 1OK4A 3VGFA 3AYSA 3O06A 4BHYA 1AG1O 2YGYA 2WPBA 3PJXA 2BY2A 1QCWA 2OELA 1ZBVA 1MEHA 2BVYA 1BWLA 3ONCA 4AXNA 2J7HA 1ME9A 4LAOA 1LBFA 1DWHM 1WKDA 1VENA 3ALFA 3LERA 3HV9A 1TMQA 3PF3A 2ZIDA 3AXXA 1H2JA 1XRFA 1HJXA 1JL8A 1EC9A 1Q4WA 4M5PA 5A6TC 3COTA 3GVQA 2V3DA 3P3BA 1FWAC 2VVNA 4M7SA 1NARA 4ZBCA 1B4EA 3GR4A 2VEPA 2VVSA 2E67A 4DF0A 2Z2UA 1KLYA 3WLNA 2X1TA 1RSCA 3GWQA 2V9DA 2Y70A 1GKQA 2ZX9A 1UC4A 2PLJA 1OD8A 5D09A 3OA3A 4Q32A 2YB1A 4XD4A 2V3FA 1XISA 3GHTA 3SW6A 4M56A 2CLLA 3QW3A 2D3LA 3GTFA 4MZYA 3MI3A 3I7RA 1K9TA 3BO9A 1DOSA 4ZR8A 2NV9A 4LW7A 3TEVA 3UJFA 1M41A 4W7WA 1ONRA 1R3VA 3B8DA 3TYZA 4YL2A 4ACZB 3QHNA 4IX2A 5TAOA 3CIWA 1ZUAX 4HK6A 4YU1A 1FXQA 2WVSA 4HMDA 4DWSD 3KOXA 1I9CB 1ICPA 5HK4A 4R27A 2HCVA 2VELA 1JXKA 5FL1A 4LVDA 1K8CA 1SZGA 3KL5A 2ACUA 1HNYA 4OHQA 3IIPA 3UPMA 3OW1A 4B92A 1O12A 3B0VC 4ASTA 2HISA 3NYDA 2ZOXA 4U28A 1BGAA 1XLCA 3UT0A 2DZBA 3PZOA 4GXMA 4GC4A 1LT7A 3K2GA 1TV2A 5HAOA 4Q7NA 4JTHA 3MUZ1 3MJMA 4IMAA 4Z42C 3KTXA 2ZUNA 5D2TA 3QV8A 2XINA 1QOQA 3WQGA 1MXSA 2Y8VA 4LYRA 1JCMP 4TQTA 5DCEA 3LZ3A 5IDIA 4AZIA 3HGJA 4M0XA 2JALA 5M2FX 4XZHA 2RKXA 2V5CA 1KBBA 3HJZA 4B9ZA 4CEUC 3UG4A 1WAWA 3N34A 3RRAA 4JX6A 3VA8A 1ITUA 2CBJA 4FAMA 2A5HA 4NL1A 1BG9A 1JGMA 2WAGA 2ISVA 3P84A 1I1XA 3UWZA 4ZL1A 4UZSA 4WR3A 3GXNA 1OVDA 1Q66A 4WLCA 2Z1BA 3LEPA 4GD0A 3INPA 3NUKA 2NQLA 2OSWA 3QMRA 2PDUA 2ICSA 2XHYA 4E2OA 4Y9NA 1D7KA 3NZRA 4XQ6A 2DZXA 1DHPA 1WPCA 2QHAA 5RUBA 5AYBA 4QP0A 3LRKA 1JAKA 3BZJA 4PB4A 2V67A 3P2VA 4WJ8A 3EWYA 3I68A 1Z32X 2XSAA 3T9PA 1V93A 4QLKA 1CBGA 3OPSA 3FX4A 1IZJA 3UVAA 3O3RA 3TJIA 2VZSA 2ODOA 4J1OA 2PE4A 4IH3A 1DORA 1T99A 2WMFA 3QLLA 1RA0A 1KGXA 4FO4A 1W3TA 3U2EA 4TOQA 3VDGA 1V0KA 3LN3A 3NTYA 5LIWX 1GWJA 1XLEA 5GNXA 4DF1A 3N04A 1JDCA 2O9TA 2GPTA 3S2MA 4JIHA 2VEGA 2BNJA 4PBFA 1YNYA 4QQUA 1F8MA 1FH8A 1BF2A 3B0XA 1LDCA 4GRSA 3APYA 3OO2A 3SN1A 1GT8A 1E9LA 1I6NA 4MG4A 2PBGA 1E1CB 4F66A 4GIEA 1UCWA 4GIYA 2NX1A 4F79A 1HJQA 4PR4A 2FPYA 3VD3A 1XYBA 2Y4SA 5ABFB 1A4MA 2C16A 3GYCA 3WDHA 2FTPA 1S5WA 2QT3A 3LG3A 1TCDA 3OGRA 2GSHA 5DEZA 5A1AA 4S2BA 4HBKA 3GTNA 3VNIA 3KBVA 1KCKA 4Q33A 5E9XA 1UJQA 4I9TA 3UJEA 2WJDA 4TIMA 1X6UA 3KHDA 2NLIA 1P0EA 1YDNA 5G2WA 3EGJA 3KTCA 4YTRA 2NXHA 1IEQA 3UJ2A 5BMXA 4PTVA 3V1PA 3C3NA 1PTGA 5D02A 5C71A 1LQAA 1W1ZA 1SO4A 2GQ8A 3PWAA 4N02A 2YL8A 1JFHA 4NAFB 4DWSB 3O6YX 2DZPA 1E5NA 5D9OA 2DORA 3ZIZA 1XYLA 2ZYFA 1DWFM 2DUXA 4JFSA 3FXYA 2E5CA 4NRRA 1IQ8A 1XIGA 3Q45A 3VDCA 3DC8A 1OIFA 4O1CA 3WQFA 5FF0A 2FPVA 1OYAA 3I10A 5E93A 1SUXA 3OZYA 3LBMA 3MHFA 2J13A 4GISA 3NO5A 4CN4A 1VRDA 2PDWA 5D9MA 3AU2A 1PZ2A 1ML1A 1R3RA 1TPVA 4GUHA 4NRSA 1I4NA 5K3VA 1WUFA 1SO6A 1KGWA 1AA1B 7CGTA 1PYMA 3RLGA 4O12A 4LAMA 3GNPA 1E4NA 1F8IA 5EFDA 5AYXA 4MDPA 3F4DA 2A4AA 3WNMA 1YX1A 2OPJA 4RXFA 1ISYA 1QASA 3I4KA 3NO1A 4LEFA 4UTJA 3AWNA 3QPYA 4HHLA 5DMYA 3WQCA 3CO4A 5A8OA 3EDEA 3S6OA 3S2NA 1PZ1A 3GDBA 4MHBA 1YLVA 2ZXBA 4XISA 2X0SA 4AVOA 3K4DA 4KFNA 4MWAD 4PMJA 1GOIA 1X8FA 1E6RA 4XTDA 3VZZA 1QTWA 1X1NA 4R85A 3IUIA 4FZIA 2BGNE 2E68A 1XC6A 4NNAA 2X09A 5HDRA 4JN7A 4F2TA 3CIXA 3S2JA 4XIMA 4I9MA 1Q4NX 2ZX8A 2OX1A 2REQB 4NKCA 4AYSA 3HN3A 4N9BA 4KWUA 1PTAA 3IGUA 4KERA 1B31A 3N2TA 3F4WA 2C71A 3ES7A 2WMHA 3ICJA 3MC5A 2RGLA 3AZTA 2QPUA 4RCXA 5DY2A 3TQ0A 4ZQPA 4HGXA 4PUJA 3CYVA 4IG2B 5FF7A 3AS0A 2X0HA 5ABHA 1F07A 3TQVA 3T2OA 1MUWA 5F2GA 4GE8A 2E1WA 4Y8EA 4ZQRA 1TVPA 4V27A 5KZEA 2BGQA 3WK1A 1KV8A 1HGYA 3KRSA 3IJ8A 1JIBA 3SCOA 1HW6A 1VEMA 3VD9A 2EKCA 4JHZA 3MJYA 4HK5A 3T42A 3WJWA 2VFIA 3E9AA 1PJ9A 1P7TB 3GD6A 1JF5A 2I57A 2TPSA 3CU2A 4UTFA 1KR1A 1IIHA 3E74A 1KFCA 4AVNA 1KKOA 1T0OA 2TSYA 1SW7A 4B3LA 1ZY9A 5HBFA 4HNVA 4HYVA 4O15A 1UUOA 1B30A 1CIUA 3UNDA 4DLMA 1RK6A 3QYQA 1AVAA 4ZQMA 1GOMA 3TFCA 3K8LA 2H90A 2XIMA 1UQYA 1JJKA 4IX0A 4HCHA 5JIWA 2I17A 5C2XA 2PC8A 4GHRA 1F9CA 3TXZA 3G1DA 3L0KA 3JW7A 4HNCA 1KFJA 2QDHA 4EAYA 4DZIA 4I90A 1TZZA 1E4LA 5AY7A 3EBVA 4GH1A 3NG3A 3MSRA 4O54A 1UPPA 3W7MA 3LCFA 4GJIA 4G2DA 2WMKA 3HJEA 2D3NA 4GNVA 1B5TA 1Q6FA 4AZ5A 5H6HA 2NVDA 1K9EA 3URAA 3SEPA 2GDQA 2NX3A 3NA8A 1BRLA 3GNXA 3PZQA 3PWIA 4KEUA 1TKKA 1XKYA 2I9UA 1BGGA 3SBFA 4BF9A 1JAEA 3HQPA 4UXDA 3BG9A 4OVXA 4PH6A 3VOJA 1G4TA 1NY1A 1QW8A 2ACRA 2A21A 1L6YA 2A3EA 1YBQB 4PEKA 3CQKA 3GE7A 3F1QA 4CQ9A 1T8QA 1CECA 4RE0A 3TYCA 1BG4A 3S1UA 2J62A 4MB5A 1S2CA 1XRTA 1PCKA 2D2GA 3B04A 4HKPA 2ZVIA 2YYTA 4IL2A 2VR2A 3NQCA 3QV6A 4S23A 2A7RA 4AHOA 1DL3A 2AL2B 4HPGA 3TUUA 6CGTA 4JFUA 4MY8A 4J3TA 3U8GA 4NY2A 4NZFA 2Q71A 2I5IA 3GXMA 4YWSA 3RO8A 4C6EA 3MO4A 3W02A 3TMLA 2Z2AA 2VX5A 1OFBA 1FVPA 1FWRA 2XVGA 4PUMA 1XLLA 5CCZA 1VBHA 1T7LA 2Z6JA 2CZFA 2GOUA 3AHXA 4EP8C 2VR5A 1M53A 2V0TA 4PSRA 1U30A 1TO3A 2VGIA 3AIQA 4CU6A 4H8NA 3RJXA 2EPNA 3VKBA 3PBUA 2BB0A 5C8BB 1CXFA 3S5YA 2VI0A 2I7GA 4MWAB 1JRBA 3AUJA 4MJ4A 9CGTA 3TN5A 3ZR5A 3VDHA 3R7MA 3U6WA 5IBXA 4H6QA 4GIRA 2OT0A 3N11A 1XKJA 4WVXA 5XIMA 2DP3A 1LF1A 5F4XA 3UA4A 3GDMA 4LBRA 2FH6A 4P7QA 4UNLA 5CZJA 1HKWA 2YLLA 1C8VA 3PZVA 2OEKA 4JCLA 5I6SA 3LGGA 3V18A 4M3PA 1NELA 2QEZA 2C14A 4H41A 2XVPA 1I2RA 1XCXA 1Z6KA 4EXAA 4DAIA 1MFUA 3U4AA 4NZJA 5HR6A 1V08A 4N0RA 4Z2GA 1QPOA 3OVRA 2DSKA 2YL5A 4GYPA 1LRQA 4N6EA 2W92A 4C6JA 5CG0A 3VD5A 3WENA 3CH0A 2VT0A 4UNIA 4DBEA 3OG3A 1GQIA 3P8IA 2NQZA 4W85A 3L4UA 4KEZA 5LA0A 4GQRA 3EWDA 1HZYA 1IEVA 4OOZA 2F6UA 3EDJA 1VPYA 5GVJA 4GUIA 4LV9A 4Z1BA 3NL2A 4ZOCA 3E3HA 4DF2A 2HS6A 5A3HA 4GUJA 1CXEA 2V6AA 3DG3A 3PBMA 3S9YA 4HU0A 3WNPA 1EO7A 4FX6M 1V8EA 2J9YA 3R1ZA 2GUUA 3EPMA 3E2RA 4Q22A 4FNTA 4K68A 3P61A 1W54A 3MKVA 3QOMA 1LJYA 3NOEA 3WQ4A 2VX6A 3DDMA 1VFLA 4YYFA 1LL7A 1G7UA 3LY0A 3C2RA 4LUYA 1JUBA 4ZO8A 4AD0A 2OFJA 3MHUA 2XH4A 4R7WA 1NWTA 3MVTA 3L5MA 1FDYA 1J2BA 3HPXA 2WXDM 4NI8A 5PTDA 4JFVA 3FGCA 4EIVA 1KM0A 4WY0B 3MMDA 3USZA 3B8VA 1ZB5A 3LM3A 1EJVC 1JZ7A 1DWGM 1VEPA 3K8KA 3CXOA 2WNNA 5FJJA 4YVVA 2CKSA 5FEWA 4ZQNA 1SZNA 3SCRA 4ROQA 1KQYA 2WC7A 5F2MA 1RVKA 5G4HC 5KZDA 4KETA 4IXHA 4DJED 3NSMA 3TP4A 1YKWA 4JGDA 1W3KA 2JIEA 1TZ7A 2Z24A 5A5WA 2G4FA 4BQ2A 3MO7A 2VZTA 2G3MA 1J10A 1S2UA 1UH4A 1OYBA 4DN1A 1DXFA 3ABOA 2PB1A 4QJ1A 5FEZA 3B9EA 3AXHA 3QGVA 3FCPA 3UQNA 2UV8G 1PX4A 4JICA 3H7VA 1RQHA 2NVAA 4JY8A 3OLIA 1GUVA 3V0SA 4EPEC 1H11A 2P0IA 3BQ6A 1I0DA 1Y7VA 1OFQA 2E5DA 3VKCA 3TTYA 2OVLA 1DJHA 1J93A 4JQ1A 3TMQA 2BTMA 5HJXA 2XVLA 4JQ3A 4LS2A 4N9DA 1REQA 2PDPA 2G3JA 3FYPA 2YX0A 3CM4A 3THQA 3T4WA 1LG2A 1EWEA 3OU8A 1H62A 1XLKA 4FXSA 2OSYA 2AAAA 5DF0A 1NP0A 3GDTA 4QGCA 3DFHA 3PFRA 3S5NA 1UWTA 5AHIA 5EBUA 3MYOA 4MJMA 4GZ7A 1NWUA 1T5AA 1A5OC 3R8RA 1CGYA 2HQAA 3CHEA 4HZ6A 1G1YA 4GK8A 1XH1A 3KWXA 1RJPA 4GQBA 3NDYA 3NGJA 4MF4A 1YDOA 3LRMA 2RDXA 1KXQA 2DGAA 4DO4A 3M7SA 1F3WA 3SCTA 4C6PA 2WKGA 1UJPA 1KNWA 2CLMA 3NL3A 3VM7A 3H70A 2DVXA 4GY1A 4TR9A 3GZ3A 4ZB0A 1HO4A 4UQCA 3W84A 2PDXA 3G77A 3WH7A 2VQUA 4S3CA 2IMRA 2OXNA 4QR6A 3UESA 1AQMA 5C5YA 3NYZA 4EWJA 4AEFA 2PU0A 1O60A 3GU2A 3CL7A 2PU1A 4HOZA 1FWCC 4N9CA 3NQ2A 1DWIM 1JGIA 1XV8A 1MNSA 4H9MA 1Z8AA 4GGBA 1J01A 3STEA 1WE5A 3VKKA 4BWLC 2AKMA 4E0CA 4JTJA 2ZBTA 2WBKA 2W9MA 3POCA 3LLXA 3MU7A 2VXNA 2WNZA 3LPFA 3B97A 3LDVA 3ZWSA 1R85A 3R11A 2H9AB 1JCTA 1OFRA 2D2JA 1O7AA 1GONA 1ZAHA 1QHZA 4AU0A 2C1HA 1SFSA 4AIOA 4NT0A 7ODCA 3XISA 3U2ZA 4QS6A 1TWWA 1NU5A 5HWNA 2PI6A 2AQOA 1SZRA 3KBSA 2YA2A 1H3GA 3DC0A 1WDQA 2R1MA 3A3HA 2V5BA 3W1RA 4KWSA 1NVMA 2D0HA 5G1MA 1ZS2A 1IXQA 4M24A 1YE6A 4EACA 3PZIA 3FS2A 1HTIA 1UR3M 2WJFA 1AW2A 1S2TA 2DUAA 3BG5A 1K9FA 5CPLA 4J3XA 3DFYA 3VGHA 3SRKA 5CQ1A 1TPDA 1K6AA 1R2TA 2FKPA 3UJSA 4HMCA 1B57A 4D1IA 4WY0F 5I78A 1YXCA 5HNUA 4CNNA 4LGXA 4Q8VA 2FYMA 3TC7A 2ATMA 3TH6A 4CEXC 2PWFA 1XIEA 2VX4A 3ME3A 3VNZA 4HIBA 3T78A 4MB4A 2QDGA 1XCWA 1UUQA 2JFEX 1RK5A 1O66A 1MZHA 3NEVA 4W89A 1IHIA 3W23A 1EGMA 5D4YA 4I7WA 1GK8A 4I8DA 3H4XA 2W5FA 3HO8A 3WBYA 4NVTA 1UWAA 1V77A 2QCDA 3FYOA 5D33A 3ZS4A 4IOTA 4PTNA 1V6YA 4F0HA 3TW7A 3TN3A 2ANUA 3N2OA 4Y9MA 1DBTA 1H5YA 4AISA 3SQMA 3BOLA 1GVQA 3BTNA 4IFRA 1JDFA 1NOUA 3UZWA 1TSIA 2PZNA 2AL1A 2MANA 2NLYA 3O16A 4YCOA 3WO8A 4JR5A 3GKAA 5CSYA 1BF6A 3SY5A 2F61A 4FF7A 2CHOA 4DM1A 3GQYA 5DBUA 1BTMA 2OWCA 2Z1VA 4PL2A 1XPGA 1Z7AA 1TWZA 4TVCA 3VCRA 4J3UA 4PMYA 3F5JA 1QRQA 3GAKA 1WXJA 5CJNA 7PTDA 5E70A 1N8WA 3LYEA 4ORIA 3OLEA 2B31A 2ZADA 4J4KA 4OQVA 4PUNA 2WNWA 3ZLFA 4FR1A 1DPMA 1M01A 3R5EA 1MMFA 3EB2A 1OJXA 2C18A 3W3OA 2A6NA 3IJDA 1KCZA 3I65A 4WOZA 3MV01 1TQXA 4P8UA 1EBHA 3LPOA 1F4HA 5AN7A 1HP4A 4HPNA 4HP5A 4BKNA 3OODA 2OYLA 4A8NA 4OWGA 5GQBA 1T8XA 4HCDA 3TK7A 1W9VA 3NL6A 5CGMA 1KFLA 3UFYA 4HNNA 3FKRA 2FMNA 3RJYA 1W8SA 4L1GA 3SY8A 2WC3A 4ZA0A 3S3GA 4DUVA 4GQ0A 4PMXA 3XIMA 1S2WA 4MFDA 4CQ8A 3OQ8A 4ZGYA 4L7ZA 1GCYA 5HNTA 1W0MA 1QHOA 2JE8A 3AHTA 5CBIA 1PKYA 4AY1A 4V33A 2CLOA 1FWIC 4ONVA 3TTEA 3LU2A 1SZFA 1SR9A 5EA9A 3ABSA 2HDJA 3PTDA 5BWFA 3DYMA 3F5KA 2PPGA 1GJUA 1EB3A 3EEZA 3QOKA 5BXTA 3DGBA 1EZ2A 1DJYA 2DT3A 1CI1A 2CZ5A 1QNOA 3AJXA 1RH9A 1AUSL 3PS7A 1S5NA 5I3HA 2XIOA 5KITA 5I3JA 4NJIA 2YLAA 1OFOA 2YXGA 3C86A 2HTMA 3NJ3A 4FA3A 4IMEA 4RW3A 1ONXA 3W6LA 3O07A 4WHBA 2WO5A 4AC7C 3CMJA 4B5SA 4U2YA 3VIOA 3QSTA 5I0DA 4GWEA 1K8XA 1RALA 1YNQA 2A79A 1IZCA 4XWUA 3W0KA 2YCEA 4RL3A 3UWEA 3MVIA 3JVAA 3KOZA 3G0XA 1BYCA 2FJKA 4J7RA 2G37A 2CKRA 1OGBA 5K9DA 1Y65A 2GUBA 3W2MA 3AALA 2XVNA 5T9BG 1ZZMA 3BOXA 2CC0A 4MUZA 4Q3MA 1H7PA 1XIMA 4G5DA 2GQAA 4C6BA 1XQKA 5A8QA 4PA8A 3FDKA 4C6OA 4JBRA 7A3HA 4PBGA 3EA3A 3PBVA 3V0UA 2PF8A 3K4AA 5BOEA 4GJJA 2B7NA 1WO2A 4Z0JA 4BY3A 2GVEA 1DXEA 4ES4A 3L23A 1JD7A 3DUGA 3OVQA 1YDYA 3LHWA 3L68A 3TLQA 3THDA 1FFQA 2E8YA 2ISSA 2FVKA 1BWVA 1DE5A 1IZKA 4GMEA 5LHFA 3U3HA 1HG3A 3WF3A 3ZT7A 4HNUA 1I8JA 2E77A 1JQXA 1FWBC 4FLOA 3LTSA 4OBTA 4YMZA 4MB1A 3M07A 2GDVA 3FXGA 2R94A 4CD8A 8TIMA 2OTDA 4POCA 1RPKA 2VDGA 1MW1A 3ZSTA 3UWQA 3BOFA 1VHCA 4G8TA 3ARWA 5HA7A 1QWGA 4N6FA 3T0AA 3MUXA 4B9YA 3LZ5A 2FZ9A 1MXDA 1P1MA 2F84A 2Y62A 4FOJA 2XSXA 4JEQA 2FB3A 5DXXA 4AWUA 1R2RA 1K7XA 3H4WA 4R88A 1R6WA 4LUJA 1A3XA 2MNRA 5ECUA 3T0CA 5LGZA 2Z7GA 3CLMA 4A05A 4F48A 1OC5A 1GZJA 2YW4A 4Q4MA 2I5GA 3LXAA 1H49A 2V2DA 4AWEA 1PB0A 3PG8A 5G1YA 4IP4A 1JPMA 4PUWA 1PAMA 3TSDA 2OX4A 5LNVA 1MW0A 3IWPA 3QQ0A 1W1IE 1L9WA 2OOFA 1KBKA 2ONEA 3GZAA 3UBPC 3I3DA 3LCHA 3CZEA 3BGAA 3W53A 4JTDA 3SFKA 1EKOA 5E0KA 1NSJA 1VBJA 3PZUA 4KT2A 2GVGA 1WDDA 1OX5A 3DENA 3KBJA 4A3RA 4KEVA 2GZXA 4HU8A 3IUHA 1EDQA 2YB4A 2XM1A 3DN5A 3ZSSA 2PP1A 3MZ2A 4DJFD 1CYGA 4LC6A 2Y63A 4PCFA 4GX9A 3H4GA 1M7JA 1Q13A 4ATLA 2FFIA 4NZ3A 1TPFA 4R7JA 4IF2A 1PWMA 3W38A 4AVFA 4XZBA 4LEQA 2IXUA 1NWSA 3NSXA 3P5YA 3VOHA 3V16A 2B0MA 4B4HA 1XBYA 4IMCA 1VCGA 5LNWA 3ZJ6A 4RE4A 1J6PA 3VABA 4ACYA 4JHMA 3OEXA 4LB3A 1EP2A 1V3IA 2D24A 2PGWA 2Z1SA 7REQB 1EF2A 1B4KA 1VJZA 3KVKA 3IANA 3S5SA 4FOUA 3GS6A 4U5KA 3W76A 3ALGA 1E73M 2QUMA 4ZQOA 4IP5A 1GKPA 1EJWC 2Q8LA 3W4RA 3Q67A 1J5SA 2PRLA 1BPLB 1VPQA 3SRFA 2V2HA 4DJFC 1FDJA 3CUIA 2J8FA 2OKTA 3VDAA 5T91A 2DVUA 1Y5XA 1EDTA 3EA2A 2FHBA 1LL4A 1A3HA 1GHSA 4UQ9A 4CKQA 4PN2A 4HA1A 2VMFA 1CXHA 1O1HA 1V51A 4UQBA 3UG8A 4PCNA 4MIMA 2P1FA 3MT1A 4AX7A 1FA2A 1LUCA 5I77A 2PODA 3HQ1A 2XFWA 3V35A 3BE7A 1QO5A 4S39A 4H19A 4F2UA 2YL6A 2Z26A 3BW3A 2YBTA 3T2QA 2PTXA 1G4SA 4K7VA 3IJIA 2E25A 3B4UA 4LUSA 1R38A 4MPQA 2WLZA 2WVVB 3OBKA 3SURA 2OR2A 4F0RA 4QE1A 4XVDA 2AGKA 5LA1A 4XAZA 3VGGA 3HA1A 4PUKA 3PC0A 2O4QA 3WBAA 3LMYA 3CYJA 1JZ6A 3L4ZA 2WKJA 1E15A 4A3YA 1EBGA 2GVYA 3LPPA 5F2IA 4P61A 1P0DA 1XLIA 1S1PA 2ZA1A 1F6KA 4XKMA 3XINA 1W5PA 5K7JA 3TA6A 2FQIA 1RVGA 1KBLA 4M6UA 3EYPA 4FK9A 4OUEA 4ZEPA 4Q6XA 2AAMA 1V6VA 3ZLGA 5KINA 5C6MA 1CENA 3A23A 1F2JA 1BYBA 2Z0IA 1C9DA 4AD1A 3LMZA 1XYZA 1S1RA 2WWDA 1QOXA 2OLAA 3EWWA 5AHFA 1WBJA 5D30A 1JYVA 4ADUA 3T07A 1LOSA 1ZAJA 3UGVA 4QNWA 3ENLA 3KCLA 1AL8A 2FDSA 4IP7A 4IIFA 1LRTA 1ODUA 3AHVA 2C15A 1HL2A 3KRUA 4FEZA 1Q8JA 2V5JA 6A3HA 3TCSA 3VE9A 3ELFA 4ZQCA 2PDJA 1M6JA 2NUWA 3WD3A 4B5WA 4C6CA 3DAQA 3GVRA 2UY5A 3S4TA 2Y8KA 3PAJA 2WHJA 4IT1A 2OU4A 3IAPA 1PIIA 4WDTA 5CPTA 4D6IA 2W4XA 2WMIB 5TD4A 2PGFA 1MUCA 3KRBA 2CXGA 2P53A 4JKLA 3L5AA 1T40A 1D2KA 2E9MA 2QCGA 1Q6CA 4JTRA 1JUKA 1ZAIA 1HFBA 5AOUA 2YXOA 1N2VA 2PTYA 1VPXA 3LI1A 1K02A 2CWNA 3IJ9A 5AVNA 2ZE0A 3QR0A 3UF9A 4R3UA 1FHLA 3T4CA 3VFCA 4R34A 4QQ3A 3TQPA 2XFFA 4ZOEA 3GG8A 1OCJA 1UR8A 3M0IA 4AY7A 4L4OA 2DU2A 3U7VA 2PSNA 3CB8A 1UB3A 4UOJA 4W93A 1GOWA 3EKLA 4W5ZA 4C6DA 1FY6A 4GX8A 3ARRA 1EJUC 3GKFA 4HTYA 3ATZA 4QEEA 5I3IA 2E28A 1R86A 4GO8A 4K2SA 4DX3A 1E72M 4NZ4A 1W5MA 4UFIA 4US5A 1UZHA 2FZ8A 1RA5A 1CGVA 4YXGA 3QLDA 4AZ6A 1Q6RA 4TV5A 3W29A 2HE5A 5MKGB 4AEOA 2VEKA 3L4VA 4FNPA 4PODA 4Z2HA 3KOYA 2EPOA 4QLJA 3T09A 2PTDA 5KMYA 3PZMA 1LZOA 3SIMA 3HG3A 3AJ7A 4F0KA 1KM3A 3B0YA 1XUUA 1UWRA 3VK5A 1TWSA 2PCEA 4F2BA 4CN6A 2I9EA 3I6EA 2Y2WA 4REQA 3UD6A 4C6KA 3AS2A 1GJWA 3CL8A 3BH4A 3V5CA 1VD6A 2JKEA 1VJIA 4FS9A 1W3JA 1RBOB 2ZTKA 4GZJA 3RMEA 2IKHA 4CNOA 4OBSA 4O28A 1QW7A 5D9NA 1KWKA 1W1YA 2BP1A 1KFWA 3S1VA 4TX8A 4QG8A 2J78A 3WLOA 1S2VA 4CD6A 1DJQA 3AXMA 3SCSA 3LNPA 5GNYA 3S46A 1HL9A 3UXAA 5ABEA 5A2CA 3D6NA 4CCEA 2W0UA 3QJAA 3TJXA 1TB3A 1TX0A 2DZVA 2X42A 4ZVJA 3O63A 2C1IA 1AJ0A 2G5WA 2ACSA 5HJYA 3QZAA 1I45A 2W27A 3SJ3A 2EAWA 2CLHA 2UY3A 2D0FA 2DT0A 1S3HA 3W73A 2R24A 1H7RA 4CUCA 2YCIX 5LNRA 3CO8A 3ZXWA 4QJ4B 1TG7A 5A8NA 3O8AA 1VGAA 3BAIA 1OSEA 4YYCA 3SY1A 4OBRA 3RM8A 1IE7C 3TR2A 4H2CA 1W9UA 1VLWA 1PO9A 3M41A 1OYCA 1ONEA 2QGHA 4R9OA 3FDGA 2DJLA 5C9XA 4YTSA 1A4LA 4IIHA 2DT1A 3R0KA 4WX2A 4C6FA 3EWCA 3TAKA 3W27A 4DXKA 1TX2A 1RJQA 3SCNA 2QF7A 1P0NA 2FH8A 2BODX 1IGSA 1X97A 3B3DA 3E1F1 4JXCA 4AZHA 4WXZA 1JCNA 2A0NA 3R8HA 3KAOA 5J5RA 5DX7A 3VUSA 2OGJA 1N8IA 3CTLA 1OF6A 2GK1A 3SM0A 2ABBA 1QNPA 4QTGA 2CXEA 2QPXA 1XPYA 1NDZA 1DV7A 1C90A 1IWBA 4WOQA 1OZMA 1PEZA 1IR1A 1G69A 1C9WA 1OC6A 3KLKA 1GW1A 2YDRA 4LWWA 4NU7A 4K39A 4A2RA 1P6WA 4H7ZA 4D72A 1NH6A 1V4YA 2QR6A 4JD4A 3PBYA 3H2NA 1CLKA 1JCXA 3VNJA 2ZUMA 4IIBA 4GACA 2CFFA 3UR5A 5E6ZA 3NAVA 1GQNA 3NZQA 5DO8A 1R3WA 1FOBA 4CU7A 3MDUA 2Y5JA 2OSXA 1Q7QA 1UZ1A 3QH2A 5CPMA 2Z1WA 4ZO7A 3OHMB 3NQBA 4ENLA 2DH3A 1LP6A 4L65A 2ZUTA 5U4NA 3B8TA 4QLLA 4CVUA 3KS5A 2VEMA 3WY1A 4MJ2A 1M5WA 3A4XA 2XN1A 2XPKA 4D2JA 5BZAA 1FWHC 3RNDA 3VGEA 2GJPA 2Y85A 1TWIA 3C2FA 3WH6A 4LANA 2BHYA 1MSSA 3BL3A 3G1FA 4KGJA 4LVBA 4HT3A 3BVJA 3WBWA 3RR1A 3WN6A 2J66A 3W9ZA 3ZR4A 4L9YA 2ZWYA 5CBBA 2PDKA 2V69A 4BWLA 4O1DA 3N18A 3BGJA 1SJBA 4Q7IA 5D2YA 3FSTA 1EPXA 5HPCA 1FQ0A 3THUA 4ZFMA 1E70M 1R46A 1VP5A 5H1WA 1EHAA 1TIWA 4WXYA 4UUIA 5KETA 1BXBA 1WDRA 2P10A 4HVXA 3REQA 2VZOA 2VFFA 3EWXA 4G7EB 1BQCA 3OYZA 3FV9A 3NM3A 4G9PA 3AO0A 5HQMA 3BGGA 1VF8A 3W1PA 2GQ3A 4A35A 1HL8A 1JZ4A 3T6CA 2CPUA 2ZC1A 1Z3NA 4JTKA 1UMLA 4G7FA 3B0PA 1Q6LA 1JPHA 4OECA 3BURA 4AHQA 2VUNA 5A6LA 1FKXA 1M03A 1QVBA 2PCQA 1SFJA 2AQVA 2XH7A 1AW5A 3KBMA 2ISDA 3RPMA 2XGBA 3A5VA 3GVVA 1U22A 3ABXA 4PTXA 3CQJA 4ATDA 1A5CA 1OBAA 3IJ7A 1HQTA 1UASA 2O9PA 4RUBA 4I6VA 1JDAA 3BG3A 3H22A 4K37A 4Y2WA 1FKWA 1FWSA 4NYYA 4KBXA 1ELSA 4D8ZA 1QAPA 3W7GA 5EMKA 3OG2A 1WOAA 1WA3A 3PJUA 4K8EA 2V3EA 2ZCGA 3VC6A 3CIVA 3PB2A 4MYAA 4QDPA 3TTOA 2ZUWA 1F61A 2GGJA 1FWWA 5TNVA 2BSLA 1RLCL 2DZAA 2ZVRA 3W83A 3HURA 1H41A 1WP6A 1XBVA 4HZ7A 4B2DA 3QTPA 1UBPC 5HNRA 1JZ2A 5FJPA 4QSFA 2Y8UA 3LENA 2HV5A 5ENLA 2FHCA 3H6OA 3RILA 5EKYA 2CZVA 3ANUA 3GR8A 1CB7B 3LHYA 3HTWA 2CITA 4DXXA 1TMHA 4QFUA 2P88A 4B4FA 3CJPA 3A64A 4GXWA 3NNTA 4RDYA 3TNBA 1EX1A 5CGTA 1JD9A 3R8GA 5ABFA 2PFHA 1JXJA 2OQYA 1SSDA 4XAPA 5HUOA 2OZ0A 5BOFA 1TREA 2CEQA 2ZUVA 1XF0A 4DELA 3CLWA 3MPGA 2R91A 4V1YA 3SGUA 3AAMA 2JKPA 3SI9A 4Q4OA 1K4GA 4B15A 5DRCA 3N1AA 1Q2SA 4KGLA 3H12A 3N2MA 3RGTA 2XZ9A 1ITQA 3KZSA 4IPNB 1SJCA 5I07A 2WJEA 3CV7A 2VYOA 1OY0A 2GOKA 5ECVA 4NAFA 1BFNA 3AIVA 1UP0A 3KTSA 1EJ7L 2ZXAA 3P62A 1GOKA 2X7WA 3UETA 4GYJA 3H23A 4QJ3B 3W2LA 3U2OA 1OCNA 3K30A 2ZZ7A 2ZRZA 2AKZA 4GVFA 4C6LA 1A5BA 3N9SA 4EANA 1FP9A 2DDXA 2YSWA 1RUSA 1V7YA 4O17A 4RE3A 2Q09A 4LU0A 1W9XA 5E9AA 3GH7A 1C7SA 4L9ZA 4HA0A 4LVFA 1DQXA 1U1JA 1GVRA 3PB0A 4DI8A 1NP2A 1F3TA 1M7XA 2V2CA 1HX0A 5IRPA 5CH9A 1PWLA 3VIJA 1XSKA 3E0FA 3BSGA 4RZ5A 1XD1A 1A0EA 1WXYA 3SSJA 5JVLA 1WBHA 1D3CA 3OBAA 4RNJA 3VIKA 4GBUA 3RU8X 4NJHA 3WQ8A 5I24A 4AZ7A 1VQTA 2G8ZA 5BXSA 2P8BA 9XIAA 1NFBA 4KEMA 5DMLA 4KRUA 2ZZ3A 4CD4A 3FN9A 3C8FA 3WD0A 3NPWA 3W75A 2BS9A 3SRDA 3BV4A 1EEPA 4KRZA 4MY1A 3WZ0E 1ADDA 3FLUA 4XUYA 1LQ0A 3SUVA 4LBUA 4I5UA 2VFHA 4W87A 4UBPC 2WZHA 3RCYA 3N4AA 2VRJA 2REQA 3S9ZA 5M03A 4ZTYA 5CC7A 1XHGA 1LROA 2IKJA 2QGYA 4Z1DA 3AQUA 3ARVA 1YMYA 3MCMA 5EPDA 5G1TA 4GABA 2A3LA 3VE7A 2WM1A 4HSNA 1PKNA 3GDRA 1FHVA 4PCSA 1H61A 2G3IA 2WMJA 4Z1AA 1BRLB 3HGRA 4IG2A 1G6CA 3FSUA 4DJDC 1WYIA 3WX7A 1PYFA 3WNLA 2WCGA 2QVHA 3TN6A 5LSMA 4J3SA 3EXSA 2G0WA 4WUIA 4JNMA 2WHLA 9RUBA 4B5UA 1O6IA 6REQB 1W1A1 4H4IA 1S5TA 4IQDA 1ODZA 4S3JA 3WG6A 1BAGA 3NQFA 2P8CA 2QJHA 4PSPA 5AC5A 2G95A 3SCUA 5ABGA 3W7PA 4AZCB 3GVWA 4GG9A 3URNA 2DQXA 2I1OA 3K13A 3C3UA 3ARUA 3FEMA 1BKSA 1P7TA 5BU9A 4ZOAA 1NFGA 3SJNA 4IISA 5DMMA 3VMOA 2ZWZA 3WLPA 4S3BA 4PMOA 3DFTA 1V6TA 2XIJA 1TVLA 2VKZG 4LCRA 4X9SA 3O0KA 4ROPA 3IIVA 3P67A 1JVNA 3WEOA 5DN1A 4FI4A 2VD9A 3RUBL 3Q4DA 1POJA 1KFEA 4M19A 1GKRA 1GHRA 3SR7A 3E38A 3GUGA 2W79A 2LLEA 1UWSA 3UERA 2QXWA 3EXTA 4P7NA 2V63A 4NSBA 2P5NA 3VVGA 4Q4SA 3AMKA 2VFDA 4K38A 1RV8A 4UTHA 2CLKA 4JQ4A 4AW7A 3ITLA 3TXVA 3VZYA 5JH1A 3CAQA 2OZTA 4BJHA 4UTWC 2QLYA 3UJRA 1AMKA 4O10A 3GG1A 2FFCA 3WH8A 2Z00A 3G1HA 3NQ7A 1UD3A 1FHDA 4G56A 4Z2LA 3E0VA 3DXIA 4K6AA 5F1VA 1JCYA