4DZOA

Structure of human mad1 c-terminal domain reveals its involvement in kinetochore targeting
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
117
Chain Sequence
SKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitotic spindle assembly checkpoint protein MAD1
publication title Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 41
structure length 117
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4dzoA01
3.30.457.60 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 4dzoA02
1S9KE 3M9HA 5AVSB 3V4QA 1CZQA 1HWTC 2QM8A 2E42A 4I2LC 3NTNA 2N9BA 4AYCA 1T2KD 2YO3A 3P32A 1MV8A 4AQRD 2Q3IA 3M06A 3LIEA 2VRSA 5AVTB 3UIAA 2C9LY 4DZOA 1DH3A 2P7JA 1OWAA 3T97A 5AW5B 2ZFCA 5AVQB 4EOTA 4AUWA 3KQGA 5AW6B 2XU6A 3V4WA 3B8EB 5AW8B 5AW0B 3TYYA 2WT7A 3M0AA 3OAKA 5APVA 1GD2E 2QM7A 3TK1A 5AVVB 1T2KC 1OXZA 1A02J 2R5BA 4B86A 3HE4B 3VMXA 1HUCA 2WPRA 2JJLA 2W6AA 1X8YA 3A3YB 3I5CA 3O8ZA 3A2AA 1MFZA 4HYTB 3VMZA 5AW3B 3NFQA 2IPPA 2WTYA 3NMDA 3L37A 2R3CA 3M9BA 5AVWB 1S9KD 5AW7B 2YNYA 1H88A 3KDPB 5AW2B 2WPSA 3HE5B 5AW9B 1JUNA 3P8MC 2R32A 4GKGA 3P7KA 2XZRA 3M91A 1CI6B 1SLQA 3NXSA 2WPQA 5APQA 3TNUB 3IR9A 3MD0A 1G2CB 3A7OA 5AVRB 1GTWA 2ZXEB 4KHXA 2Z5HA 5APWA 1FOSE 1SP4A 1NAFA 1GZLA 3L35A 3VMYA 1HBWA 4M3LA 3HE4A 3HTKA 5APUA 1GU4A 1A02F 3VTPC 3M0DA 2Q7CA 2KP8A 4C46A 2W27A 1GK4A 1JNMA 1H89A 1FAVA 1GK6A 4LC1A 2Z5IA 2P2UA 2Q5UA 2C9NY 4JYBA 1MUUA 4JYCA 1J2JB 2H7HA 3V5BA 4RESB 2XV5A 5APTA 4XE5B 5AVZB 1NWQA 3A5TA 2P67A 5AW1B 5APSA 1CSBA 5AVXB 4GT1A 1KQLA 3HE5A 3VYIA 1FOSF 3LIDA 5CMZA 3TNUA 1CI6A 2R5DA 5AVUB 1GU5A 3L36A 4C7NB 1H8AA 1IO4A 2BASA 3VN0A 2WT7B 3SWFA 5AW4B 2YO2A 5APXA 4I6MC 2E43A 1HJBA 2WWWA 3MGNA 4C7NA 5APYA 5AVYB 1YYCA
chains in the Genus database with same CATH superfamily
1CZQA 3KZIH 1KILC 2R44A 1W2EA 1S3JA 3PTZA 1PGPA 1OX3A 2NPSA 1LT9B 1T3JA 2FYUE 4DZOA 1JTHA 4ASWA 4PD4I 3I55P 3CXHH 1J1EC 3KQGA 2HODB 1HGVA 2FY8A 4IL6H 1SQBE 1KB9H 2V4HA 4B86A 1H0TB 2KNCB 2WTYA 3B4SA 3NMDA 1NU1J 3RK3E 1LT9A 2UWJE 2POHA 3E1RA 5H2FH 2O3JA 3WMM0 2AEFA 2R32A 1CI6B 3ABVC 2HODA 3S1KA 2PGDA 2HYNA 2FYUG 2L5GB 2QEXP 1NTZK 1H0TA 3H1KJ 2A06D 4H0LB 1PP9G 2WITA 3BCCD 2KNCA 1LWUC 2OYIC 1GL2D 4EDFA 1SQBG 4W7YA 1CI6A 3T97B 5GTHE 1JEKA 1LP1B 1RE3C 1GL2C 4D6TE 2R3SA 3CX5D 1FZAA 1BCCE 4WB4A 2YIUC 2OTKE 1QAFA 2YXQB 3QH9A 3Q2YA 1YTZI 2Q3IA 2Q6QA 1IFJA 4NPEA 3T97A 1NO4A 4AUWA 3B8EB 3TYYA 2M5AA 2OYOA 3CXHI 1N7LA 4XFJA 3CCJP 1LNQA 1QALA 5CBNA 1QL1A 1KB9I 1S9KD 2A06G 1H88A 1BCCG 1FE6A 3MD0A 2FXOA 4KHXA 4D6TJ 2NPSC 1KYOE 1M1KQ 1IFPA 2HR3A 2I8DA 2KLUA 4PJ0E 4OVNF 4L73A 1W5CE 3H1HE 5CHXA 1ZR4A 1SQQE 1FAVA 1KC8Q 2Q5UA 3OW2O 3L75E 1S72P 1JOCA 3HD7A 2W6BA 3BRTB 1GU5A 3MUDA 1YIJP 1OMIA 4EI2A 1QL2A 2BASA 3CWBE 1LT9C 3CCMP 2E5TA 1X9VA 2ZVNB 5GTHH 5KLVD 1YQ3C 3H1JD 1L4AB 1R5SA 2QM8A 1Q7YQ 1OACA 2BCCJ 4AYCA 1Q82Q 2JR8A 2NRGA 2Y0DA 1R8EA 1Z56A 2LKMA 2P1JA 1OFCX 3H25A 3AE1C 3H1HG 2ZFCA 1YHQP 1SQQG 2RN0A 3L72J 2KB7P 1SQVD 2K88A 2WVRA 4H0LD 5KAIE 3L75G 1JM0A 2IYOA 3I5CA 1L4AA 1FC2C 1FBMA 5CCHD 1LGHB 2RH0A 1KN7A 2WPSA 1N7SA 4U7JA 2WZ7A 2HLOA 3FX0A 1FJKA 2IZ1A 3A7OA 2WPVB 2Z5HA 3AE8C 3AEAC 2IDBA 1BGYE 1KORA 1GU4A 1KYOH 1DD4A 1PPJE 2MJZA 3B5NB 2QG4A 5KLVG 5KLVK 3L74D 1SPUA 3H1JG 4YXDC 3VZ9B 3JC22 3AECC 4R4MA 2E76B 3G71P 5B5EE 1PZQA 1YYCA 3G9RA 1SQXJ 3H32B 1SQVG 3L74E 1SQVK 1NTKE 5KLIB 1NVOA 1DEBA 4U3FJ 1M56D 1YQ4C 1BGYG 2M8RA 3RBXA 2ZXXA 3L71J 1CW5A 4EOTA 1PPJG 2FFDA 1YJWP 1SQPJ 5AW0B 3Q5SA 3LW5H 1GD2E 4WWIA 1HVVA 1LTSC 1HUCA 3HD7C 1FS0E 3MUDC 2O01J 1JB0J 5KAIH 3B71A 1G1IA 2N1TB 2N9YB 3TF5A 1AA0A 1KILB 3H1LJ 1K04A 3CCLP 4L74A 1FOSE 3L74G 4GDOA 1L4AD 1J1EB 3WUTA 1YJ9P 4TT3H 2WMMA 4C46A 1PGOA 1NTKJ 5KJ7A 1RF0A 2N1TA 2H89C 1J2JB 1NWQA 4XE5B 3A5TA 1CSBA 2JKVA 2O01H 1L4AC 3AEGC 2FYNB 1L0LD 2JO1A 4C7NA 3AE3C 4ASVA 1N7SC 4IL6X 1AV1A 1HWTC 1IJDB 2LXBA 1NHLA 3TDKA 3P32A 2ZYGA 4CPGA 1YJNP 2QJPC 2Y9ZA 4DJGA 4QMAA 2GA1A 2QA4P 1VQ9P 5AW5B 1QAKA 5AW6B 1OW8A 2KIKA 4ZKUA 3RBZA 1MKMA 3B5ND 3GF7A 1GDTA 5AW3B 2SPZA 1VPCA 2YMYA 2W6JH 3QWOC 2AEJA 4UB8E 4I1LA 5AW9B 2D2CD 1Q86Q 3TNUB 2E76D 1G2CB 1S4XA 3FXDA 1FJPA 1VQ5P 4EIJA 1L0LG 1DYUA 2D2CC 2KZJA 2W83C 1L0LK 2Y0CA 2FFDC 3RL0g 2E76C 1L0NJ 4NPDA 3SFEC 4N78E 3N7NA 5CMZA 3TNUA 1KQSO 2KZIA 1S5LE 3L36A 1S2EA 5KLIC 3A0HE 3F89A 3CCRP 1AJYA 2WQYC 5KJ7D 2A45G 2NPSB 1M7LA 2N1TD 3L70E 1KILD 3U1AA 3CCEP 1ZV8A 2K37A 4W80A 3CCQP 5KJ7C 1RF0C 3H1KD 2N1TC 3AE5C 1JCDA 2WPRA 2JJLA 3A3YB 1AFOA 1NTZE 3V6IA 2XKMA 1PP9E 1M57D 2H8PD 3TGUD 1P84D 2M3EA 5AW2B 3S4RA 1JUNA 2XNXA 1VQOP 1ZMEC 4JPZB 3L70G 2A45H 2ITAA 1GZLA 3VMYA 3VP8A 1YI2P 5APUA 4WY4B 1OW7A 1ZLLA 5M1BA 1H89A 2FYNC 1GK6A 3WUUA 3TGUE 3ITKA 2IBZI 4JYCA 1OVVA 2K1AA 1GW3A 2RMZA 1NU1K 3VZAA 3V2NA 1VL2A 1VQPP 2WSSH 1NTZG 4DOJA 1RH5B 1KV4A 1OW6A 4H44C 3IF4A 4OGQC 3U1CA 1HTLC 1S5LH 2QVAA 2FYUJ 4HH2A 3CCUP 4Y99B 2B88A 4WY4A 1U7MA 1W2BO 1JY2O 4BRYB 1SQBJ 2M5AB 2A06E 1VQMP 1JY3O 3BCCE 3TGUG 5TISH 1LVNA 2QM7A 3JCUE 3H1ID 3L4FA 3VMXA 2ZYDA 1OZHA 2OTLP 1OVUA 5BU8B 4H13B 5AW7B 4BRYA 2WOFA 4PV1B 3MTUE 3M91A 3CX5E 2WPQA 1EZVD 1Q90D 1VQKP 1X0TA 1WRGA 4OWFA 4L76A 1NAFA 3H1IE 4Z1MH 3SSUA 2YMKA 2BCCD 1N2DC 1BSHA 2NPSD 5KTBA 1USEA 1K05A 2OYHB 1Y47A 2C9NY 3BCCG 1Y8AA 2GM4A 3HD7B 4UB6E 2AXTE 2P67A 5APSA 1IFMA 1PIXA 1YITP 1EZVE 3L72D 2V7QH 1OIPA 2JWAA 5AVUB 3CL3D 1BCCJ 4HB1A 4ZMDA 2HPCA 3AE9C 4RKUJ 1VQ8P 3A0BE 1S9KE 5E79E 1KQFB 4Y28J 2E42A 1N73A 2OYHA 3H1IG 2PP6A 2VRSA 3II6A 2WSFJ 1DH3A 5KKZB 5AVQB 4HJGH 3PP5A 3HUSB 4WY4D 3EFGA 1EZVG 1X8YA 5CJ0A 2Y0EA 2ZYAA 3JCUH 3SFDC 1JO5A 2QJYC 3G6EP 1N7SB 4DCKA 1PFIA 1D6UA 2YNYA 2HFED 1ZW0A 1GW4A 2KS1A 3JSVC 3NXSA 3H6PA 4WY4C 2I1JA 5KLVE 2AXCA 1FDIA 4N6JA 3H1JE 1GTWA 3H1HJ 2QJPB 1KD1Q 1SQQJ 3L35A 3CX5H 2WSFH 3L72G 1JRQA 3HUSA 4EYYQ 3L75J 3VMAA 4U3FD 2KP8A 2QIWA 2W27A 1GK4A 2WSCH 1XTCC 3L71D 2H7HA 5AVZB 1FZEA 1NYHA 3IN6A 3CWBJ 1URQB 4IFDK 1JMMA 1BE3D 1SQVE 3VYIA 3PJSK 1FOSF 4Y99C 2ZAEB 2R5DA 1M8OB 2AXTH 4GIFA 3VN0A 2GUSA 1PGQA 5APXA 4I6MC 1YTZT 3L73D 1SFCB 2Y9YA 4PJ0H 2J59M 1MFTA 1USDA 2JP3A 3LW5J 4H13D 1NAYA 3A0BH 5E79H 4PV1D 1BE3E 3CD6P 1NH4A 1URQA 2D2CB 2FFDB 2HG5D 1BDDA 2E75B 3V4WA 2XU6A 1NOHA 4H13C 4PV1C 2R5BA 3GG2A 1SFCA 1IFNA 1FZGA 1WMKA 4L75A 3HD7D 3NFQA 1RF1B 1SQXK 4PD4D 4K35A 1LT1A 3GF3A 4U3FG 1EC5A 1BGYJ 3Q5PA 2FXPA 2FXMA 1N73C 2DW3A 2OYHC 5TCSD 1HGZA 1AQTA 3CCSP 1SQPK 1BE3G 4M3LA 2PRRA 3MIWA 3VTPC 2FBWC 3WUVA 3VP9A 2Q7CA 4PD4E 4LLHA 3VOPA 1D6YA 3ZDMA 1RF1A 3CX5I 4YXWH 3L73G 1SVFA 3PLNA 1KFNA 5DJTB 3EQ2A 4C7NB 4DT0A 4BXLA 3L74J 5KKZC 1IK9A 3C8VA 5C39A 2O1JA 3K5BA 1N7SD 2IFMA 3PRJA 5CCGA 3IAOA 1KYOI 1LTTC 1VDFA 1UIXA 4AQRD 3LIEA 3WU2E 4ZKPA 3HUSC 1RQUA 1JCCA 1JY2N 1OWAA 1NTMD 2K9JA 3G4SP 3D71A 1XTGB 4N3YB 2FKWB 5B5EH 1L0ND 2IX7C 4H44B 4OGQB 2GUVA 2LR2A 3RGUA 2R3CA 2QSIA 1URQD 1QVGO 2CK3H 1L0LE 2CPBA 1NTME 2YKOA 4KJMA 3CLQA 4RJTA 3W68A 3CXHD 1VQ4P 3PHLA 1FZCB 1DX7A 1SFCD 1URQC 1KB9D 3KZIE 2KI7B 2OARA 1RE4A 1S5LX 1T3UA 4MN4C 3W67A 1SFCC 1BSNA 2CPSA 3LIDA 2MKVA 2E75D 2BEQD 5BU5A 1RY3A 4IL6E 2WT7B 1FZCA 2QE7H 3SWFA 4GOFA 4IFMA 2IZ0A 2QJKB 2XNDH 1NTMG 3CMAP 1M90Q 1NTMK 4JF7A 1EXIA 1LTBC 2J58A 2E75C 4GOEA 2E5YA 3AEFC 1MV8A 2C9LY 1L0NK 2P7JA 1J1DB 3F5HA 3WU2H 1RF1C 2WT7A 1NU1D 5APVA 3TK1A 4YTPC 1OXZA 3HE4B 2W6AA 3IFMA 3GW6A 3CC2P 2ZT9B 5CCGD 2E74C 1ZOYC 2C0XA 1Q2NA 4OH8B 1ZXGA 1LTJA 1JY2P 3V2QA 2KSEA 2OTJP 2BEZF 3P7KA 1QX8A 1SLQA 1M1JB 1NGMB 3C1LA 2KOGA 1NU1E 1FU1A 5B66E 1X79B 5CCGC 2FYUD 5APWA 1JY3P 1KILE 1DIPA 1SS1A 3HE4A 1ZP0C 3RK2B 5L8RJ 2J5UA 5EFWB 4LC1A 2Z5IA 1SQBD 1VF5C 4JYBA 3V5BA 3H1KE 5GTIE 3AE6C 4UB8H 2IYPA 2QJYB 1M1JA 1KMIZ 2YKPA 3RK3D 2QRXA 3D6YA 3EWKA 1H8AA 1IO4A 1HH0A 4IOIH 3L70J 1AQ5A 1E79H 1RQVA 5AVYB 3M9HA 4H44D 1P84E 3V4QA 4OGQD 3O6QA 2IFNA 1NU1G 4I2LC 2N9BA 3RK3C 2FTXA 3M06A 5AVTB 5BVZA 2G8YA 3SWYA 1FZFA 1RE4C 3KYQA 2JDIH 5AW8B 2B89A 2JWDA 3BATA 1NTZJ 3A0HH 3H1KG 1PP9J 1TU3F 3EFFK 3KHUA 2YKQA 3O8ZA 2Z4EA 3VMZA 2FYUK 3S9OA 1FZCC 4D6TD 3FWNA 1BCCD 5AVWB 3FGAD 3RL0B 2WO0A 2ZVOB 1FDMA 3P8MC 1LJ2A 1SQBK 2NZ2A 2V7QJ 3TGUJ 2OQQA 4C7RA 5B66H 3CCVP 1A02F 1D7MA 3USSA 5T6JB 2KSJA 2LXCB 4W7ZA 4RESB 5APTA 1HJ0A 2QJKC 2HPCB 1KQLA 3U59A 5CCHA 1R5LA 1X22A 1NKNA 5GTIH 3MZWB 3AE7C 2KLVA 1LTJC 2WWWA 2ZT9D 1T6AA 1N73B 2A45I 1AVYA 1LP1A 4NPFX 3AEDC 1N8RQ 5AVSB 3Q1MA 3CC7P 1J1DC 1KYOD 2L91A 2W90A 3V2RA 1P84H 3BCCJ 3H1HD 1SQQD 2BCCE 2ZT9C 4KT0J 1RHZB 4D6TG 3L75D 1G1JA 3TSIA 3I56P 3RK2D 1KFMA 1LTIC 2KXPB 4JBZA 1M1JC 3L72E 3CWBD 2IPPA 1WT6A 3L37A 2KS1B 1VQ7P 2K3RA 3H1IJ 3RK2C 1N86A 2WSCJ 1PGJA 1VQNP 3BVHA 4I7ZB 3GHGB 1D6ZA 1OVRA 2BCCG 2P10A 3M0DA 3OA7A 2WGQA 3SWKA 1PV3A 5AVXB 2Q9IA 1DEEG 1K9MQ 4R4LA 1SQXD 2G3AA 1EDIA 1JMBA 2RKLA 3GHGA 2E43A 4HKZH 1SQQK 1Q81Q 2M0BA 1SQPD 3CI9A 3RL0D 1BGYD 3AE4C 4UB6H 1SQXE 1QLED 1PPJD 3CWBG 4IFFA 2XDJA 1QEXA 2PFXA 1BDCA 1U57A 3P8CD 1P84I 4U3FE 4H0LC 3GLMA 5AVVB 3RL0C 1A02J 3H1LD 3HTKB 3L71E 2KK7A 5CCHC 1SQPE 3KXDA 5KLVJ 4A7PA 3H1JJ 2W8ZA 5TJHA 2XZRA 2KUBA 3L73E 3P8CE 1EDLA 2M3BA 1NTKD 5AVRB 2ZXEB 3Q5RA 2Q1KA 3H1LE 4RO0A 3E7KA 3GMAA 1HBWA 3HRNA 3HTKA 4TLFA 1SQXG 3E1IA 2FV4A 1NJIQ 1SQVJ 3N4XA 1JNMA 1YBKA 2JEEA 3V2PA 1MUUA 1Y9BA 1ZRTD 3B5NA 4GT1A 3L71G 3CC4P 2E74B 1SQPG 1EDKA 1L2PA 1K8AQ 2YO2A 1EXJA 3G3ZA 1QGKB 1E5WA 2PAJA 2IBZD 1BE3J 1IC2A 1AVOA 1HF9A 4BWNA 1DD3A 2FYZA 1FZBA 1EDJA 1T2KD 1ZRTE 2YO3A 3H1LG 3H32A 3PH0A 3M9QA 3L73J 2K9JB 5KAFE 3M0DC 1VF5B 1MZ9A 3R4YA 4LGDE 3Q3DA 1ZR2A 2B9BA 4WVZA 3M0AA 3OAKA 1GMJA 2KYVA 2IBZE 4WBAA 1T2KC 3D70A 1EZVI 3AE2C 1NTKG 1NTKK 4HYTB 2P58A 4I7ZC 3M9BA 3GHGC 1LTGC 3C9IA 3KDPB 1KZUB 4GKGA 3RK3B 1KILA 2B87B 3IR9A 1VQLP 4JQ0D 1JY3N 2H43A 1IK7A 1SP4A 3KPEA 3R2PA 4O9BA 4GEQA 1LTAC 3BRVB 1UIIA 2P2UA 2IBZG 5AW1B 4K3AA 1FDOA 3FXEA 2B87A 1L0NE 1NKZB 1LWUB 2OYIB 2ZJSE 1HJBA 3MGNA 1EQ7A 3AEBC 1S1CX 2WOHA 4PD4H 3NTNA 2I1KA 3CXHE 1GL2B 1IFIA 4XA4A 2W0QA 3UIAA 5CBOA 3D6ZA 1U7JA 1KB9E 2YIUB 2H88C 3CMEP 1KQGB 5KAFH 2K9YA 1LWUA 2OYIA 4N78D 1K73Q 3B5NC 1T8ZA 1KTMA 1L0LJ 1LTJB 1MFZA 3A2AA 1NTMJ 2Q3EA 5H2FE 1L0NG 3CPWO 1RE3A 3K1LA 2E74D 2OGUA 1GL2A 2WSEJ 3HE5B 3L70D 5APQA 2O01N 5CJ4A 1G2CA 5K5GB 3MP7B 2AEMA 3MHVA 3FWLA 1QVFO 3AEEC 2O1KA 4GODA 5DJUB 1PL5A 2XV5A 1IFDA 1JTHB 4YPCA 1VF5D 2C0WA 3HE5A 1NTZD 3OJAB 1ZN5A 1PP9D 5TISE 5AW4B 1VQ6P 2WSEH 4ZNCA 1IZNB 3BASA 3O6QB 5APYA 2YXRB
chains in the Genus database with same CATH topology
1N7SC 1SFCB 5AVSB 1CZQA 2J59M 1KILC 1J1DC 1HWTC 1IJDB 1W2EA 1NHLA 3P32A 2NPSA 1LT9B 3V2RA 1T3JA 1NH4A 4DZOA 1JTHA 1URQA 2FFDB 2HG5D 5AW5B 1J1EC 3KQGA 5AW6B 2XU6A 3V4WA 1G1JA 2HODB 1NOHA 1HGVA 3TSIA 3RK2D 2R5BA 4B86A 1KFMA 1LTIC 4ZKUA 1SFCA 1IFNA 1M1JC 3B5ND 1FZGA 1GDTA 5AW3B 3HD7D 1VPCA 2IPPA 3NFQA 1WT6A 3NMDA 2WTYA 1RF1B 2YMYA 1SQXK 3L37A 1LT9A 2POHA 4I1LA 5AW9B 3WMM0 2R32A 3RK2C 1N86A 3TNUB 1CI6B 1G2CB 2FXMA 1N73C 2OYHC 5TCSD 1HGZA 2HODA 3BVHA 1FJPA 3GHGB 1SQPK 2HYNA 4M3LA 2L5GB 1NTZK 3MIWA 3VTPC 4EIJA 3M0DA 2WITA 3VP9A 2Q7CA 3OA7A 4LLHA 3VOPA 2FFDC 1L0LK 1RF1A 1LWUC 2OYIC 1GL2D 1SVFA 5AVXB 2Q9IA 4N78E 1KFNA 3N7NA 3EQ2A 4W7YA 5CMZA 3TNUA 1CI6A 3L36A 4C7NB 1RE3C 3GHGA 2E43A 1GL2C 1FZAA 1SQQK 1IK9A 5KJ7D 2A45G 4WB4A 2NPSB 1M7LA 2N1TD 2O1JA 1N7SD 2IFMA 1KILD 5CCGA 3CI9A 3RL0D 1LTTC 1VDFA 1YTZI 4AQRD 2Q3IA 3LIEA 4ZKPA 3HUSC 1JCCA 3U1AA 1ZV8A 1JY2N 4IFFA 4W80A 2XDJA 1IFJA 1OWAA 3T97A 1NO4A 5KJ7C 1RF0C 4AUWA 3P8CD 2N1TC 3B8EB 3TYYA 1XTGB 5AVVB 3RL0C 4N3YB 2FKWB 1A02J 3HTKB 1JCDA 2WPRA 5CCHC 2JJLA 3A3YB 2IX7C 1AFOA 1N7LA 2GUVA 2R3CA 2XKMA 1URQD 1QL1A 2H8PD 1S9KD 1H88A 5AW2B 2CPBA 1JUNA 2XNXA 2YKOA 2XZRA 3P8CE 3MD0A 2M3BA 3CLQA 5AVRB 2ZXEB 4KHXA 1FZCB 2A45H 2NPSC 1DX7A 1GZLA 3VMYA 3VP8A 1SFCD 1HBWA 1URQC 3HRNA 3HTKA 5APUA 3E1IA 4WY4B 2FV4A 1ZLLA 2OARA 5CHXA 1RE4A 3N4XA 1ZR4A 1JNMA 1H89A 1GK6A 1FAVA 1T3UA 2JEEA 2Q5UA 3V2PA 1MUUA 4JYCA 1GW3A 3B5NA 1NU1K 1JOCA 4GT1A 1SFCC 3VZAA 2CPSA 3HD7A 3LIDA 2W6BA 3BRTB 3V2NA 1GU5A 3MUDA 5BU5A 1QL2A 4DOJA 2BASA 1RY3A 2WT7B 1FZCA 1LT9C 3SWFA 4IFMA 2YO2A 1X9VA 3G3ZA 1E5WA 2PAJA 3U1CA 1HTLC 1IC2A 4HH2A 1L4AB 4Y99B 1NTMK 4JF7A 4WY4A 2QM8A 1LTBC 2FYZA 2J58A 4AYCA 1FZBA 1T2KD 2YO3A 1JY2O 1MV8A 3H32A 1Z56A 2LKMA 2P1JA 2C9LY 3M9QA 1L0NK 2P7JA 3M0DC 1MZ9A 1J1DB 4LGDE 2ZFCA 1RF1C 1JY3O 1ZR2A 2WT7A 3M0AA 2KB7P 3OAKA 5APVA 2KYVA 4WBAA 2QM7A 3TK1A 1T2KC 1OXZA 3HE4B 3L4FA 3VMXA 2W6AA 3IFMA 3I5CA 1L4AA 1NTKK 5CCGD 4HYTB 1FBMA 5CCHD 1LGHB 2C0XA 5BU8B 3M9BA 4OH8B 3GHGC 1LTJA 5AW7B 1JY2P 1LTGC 3C9IA 3V2QA 3KDPB 2WPSA 1KZUB 1N7SA 3MTUE 3P7KA 2WZ7A 3M91A 4GKGA 1SLQA 2HLOA 2WPQA 3RK3B 1M1JB 1KILA 3IR9A 2KOGA 1FJKA 1FU1A 3A7OA 1X79B 1WRGA 1JY3N 5CCGC 2H43A 2Z5HA 5APWA 1SP4A 3KPEA 1NAFA 3R2PA 1JY3P 4O9BA 1N2DC 4GEQA 1LTAC 2NPSD 3HE4A 1GU4A 5KTBA 3RK2B 2MJZA 3BRVB 3B5NB 4LC1A 2Z5IA 2P2UA 2OYHB 2C9NY 4JYBA 2GM4A 3HD7B 3V5BA 5KLVK 2P67A 5AW1B 5APSA 1IFMA 3VZ9B 5AVUB 1M1JA 3CL3D 2YKPA 3RK3D 2HPCA 1NKZB 1H8AA 1IO4A 1LWUB 2OYIB 1HH0A 1AQ5A 1HJBA 3MGNA 1EQ7A 5AVYB 1YYCA 1S9KE 3M9HA 3V4QA 3H32B 2IFNA 1N73A 4I2LC 2E42A 3NTNA 2N9BA 2I1KA 2OYHA 3RK3C 1SQVK 2FTXA 1DEBA 2PP6A 3M06A 1GL2B 1IFIA 2VRSA 4XA4A 3II6A 5AVTB 3UIAA 2M8RA 5BVZA 1DH3A 3SWYA 1FZFA 1RE4C 3KYQA 1CW5A 5AVQB 4EOTA 2FFDA 1LWUA 5AW0B 5AW8B 2OYIA 3BATA 3LW5H 1GD2E 4N78D 3B5NC 3PP5A 1HVVA 1LTSC 3HUSB 1T8ZA 4WY4D 3EFGA 1HUCA 3HD7C 1X8YA 5CJ0A 2YKQA 3O8ZA 1LTJB 1MFZA 3A2AA 2Z4EA 3VMZA 2FYUK 1JO5A 1FZCC 1G1IA 2N1TB 1RE3A 3K1LA 1N7SB 1PFIA 5AVWB 1KILB 3RL0B 2YNYA 1GL2A 2HFED 3HE5B 1GW4A 1FDMA 3P8MC 3NXSA 3H6PA 4WY4C 2I1JA 5APQA 5CJ4A 4N6JA 1SQBK 1GTWA 1FOSE 3L35A 2WSFH 1G2CA 1L4AD 4C7RA 3HUSA 1J1EB 1A02F 2KP8A 4C46A 2W27A 1GK4A 2WSCH 5T6JB 2KSJA 5KJ7A 1RF0A 1XTCC 2N1TA 4W7ZA 2O1KA 1J2JB 2H7HA 1NWQA 4RESB 2XV5A 5APTA 1FZEA 4XE5B 5AVZB 3A5TA 1CSBA 1IFDA 1JTHB 1URQB 2C0WA 2HPCB 4IFDK 1JMMA 1KQLA 3HE5A 3U59A 3VYIA 5CCHA 2O01H 1FOSF 1L4AC 4Y99C 2R5DA 3OJAB 1ZN5A 1NKNA 4GIFA 3VN0A 2GUSA 2KLVA 5AW4B 1LTJC 2WSEH 4I6MC 5APXA 2WWWA 1YTZT 3BASA 4C7NA 5APYA 1N73B 2A45I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S9K E;  3M9H A;  5AVS B;  3V4Q A;  1CZQ A;  1HWT C;  2QM8 A;  2E42 A;  4I2L C;  3NTN A;  2N9B A;  4AYC A;  1T2K D;  2YO3 A;  3P32 A;  1MV8 A;  4AQR D;  2Q3I A;  3M06 A;  3LIE A;  2VRS A;  5AVT B;  3UIA A;  2C9L Y;  4DZO A;  1DH3 A;  2P7J A;  1OWA A;  3T97 A;  5AW5 B;  2ZFC A;  5AVQ B;  4EOT A;  4AUW A;  3KQG A;  5AW6 B;  2XU6 A;  3V4W A;  3B8E B;  5AW8 B;  5AW0 B;  3TYY A;  2WT7 A;  3M0A A;  3OAK A;  5APV A;  1GD2 E;  2QM7 A;  3TK1 A;  5AVV B;  1T2K C;  1OXZ A;  1A02 J;  2R5B A;  4B86 A;  3HE4 B;  3VMX A;  1HUC A;  2WPR A;  2JJL A;  2W6A A;  1X8Y A;  3A3Y B;  3I5C A;  3O8Z A;  3A2A A;  1MFZ A;  4HYT B;  3VMZ A;  5AW3 B;  3NFQ A;  2IPP A;  2WTY A;  3NMD A;  3L37 A;  2R3C A;  3M9B A;  5AVW B;  1S9K D;  5AW7 B;  2YNY A;  1H88 A;  3KDP B;  5AW2 B;  2WPS A;  3HE5 B;  5AW9 B;  1JUN A;  3P8M C;  2R32 A;  4GKG A;  3P7K A;  2XZR A;  3M91 A;  1CI6 B;  1SLQ A;  3NXS A;  2WPQ A;  5APQ A;  3TNU B;  3IR9 A;  3MD0 A;  1G2C B;  3A7O A;  5AVR B;  1GTW A;  2ZXE B;  4KHX A;  2Z5H A;  5APW A;  1FOS E;  1SP4 A;  1NAF A;  1GZL A;  3L35 A;  3VMY A;  1HBW A;  4M3L A;  3HE4 A;  3HTK A;  5APU A;  1GU4 A;  1A02 F;  3VTP C;  3M0D A;  2Q7C A;  2KP8 A;  4C46 A;  2W27 A;  1GK4 A;  1JNM A;  1H89 A;  1FAV A;  1GK6 A;  4LC1 A;  2Z5I A;  2P2U A;  2Q5U A;  2C9N Y;  4JYB A;  1MUU A;  4JYC A;  1J2J B;  2H7H A;  3V5B A;  4RES B;  2XV5 A;  5APT A;  4XE5 B;  5AVZ B;  1NWQ A;  3A5T A;  2P67 A;  5AW1 B;  5APS A;  1CSB A;  5AVX B;  4GT1 A;  1KQL A;  3HE5 A;  3VYI A;  1FOS F;  3LID A;  5CMZ A;  3TNU A;  1CI6 A;  2R5D A;  5AVU B;  1GU5 A;  3L36 A;  4C7N B;  1H8A A;  1IO4 A;  2BAS A;  3VN0 A;  2WT7 B;  3SWF A;  5AW4 B;  2YO2 A;  5APX A;  4I6M C;  2E43 A;  1HJB A;  2WWW A;  3MGN A;  4C7N A;  5APY A;  5AVY B;  1YYC A; 
#chains in the Genus database with same CATH topology
 1CZQ A;  3KZI H;  1KIL C;  2R44 A;  1W2E A;  1S3J A;  3PTZ A;  1PGP A;  1OX3 A;  2NPS A;  1LT9 B;  1T3J A;  2FYU E;  4DZO A;  1JTH A;  4ASW A;  4PD4 I;  3I55 P;  3CXH H;  1J1E C;  3KQG A;  2HOD B;  1HGV A;  2FY8 A;  4IL6 H;  1SQB E;  1KB9 H;  2V4H A;  4B86 A;  1H0T B;  2KNC B;  2WTY A;  3B4S A;  3NMD A;  1NU1 J;  3RK3 E;  1LT9 A;  2UWJ E;  2POH A;  3E1R A;  5H2F H;  2O3J A;  3WMM 0;  2AEF A;  2R32 A;  1CI6 B;  3ABV C;  2HOD A;  3S1K A;  2PGD A;  2HYN A;  2FYU G;  2L5G B;  2QEX P;  1NTZ K;  1H0T A;  3H1K J;  2A06 D;  4H0L B;  1PP9 G;  2WIT A;  3BCC D;  2KNC A;  1LWU C;  2OYI C;  1GL2 D;  4EDF A;  1SQB G;  4W7Y A;  1CI6 A;  3T97 B;  5GTH E;  1JEK A;  1LP1 B;  1RE3 C;  1GL2 C;  4D6T E;  2R3S A;  3CX5 D;  1FZA A;  1BCC E;  4WB4 A;  2YIU C;  2OTK E;  1QAF A;  2YXQ B;  3QH9 A;  3Q2Y A;  1YTZ I;  2Q3I A;  2Q6Q A;  1IFJ A;  4NPE A;  3T97 A;  1NO4 A;  4AUW A;  3B8E B;  3TYY A;  2M5A A;  2OYO A;  3CXH I;  1N7L A;  4XFJ A;  3CCJ P;  1LNQ A;  1QAL A;  5CBN A;  1QL1 A;  1KB9 I;  1S9K D;  2A06 G;  1H88 A;  1BCC G;  1FE6 A;  3MD0 A;  2FXO A;  4KHX A;  4D6T J;  2NPS C;  1KYO E;  1M1K Q;  1IFP A;  2HR3 A;  2I8D A;  2KLU A;  4PJ0 E;  4OVN F;  4L73 A;  1W5C E;  3H1H E;  5CHX A;  1ZR4 A;  1SQQ E;  1FAV A;  1KC8 Q;  2Q5U A;  3OW2 O;  3L75 E;  1S72 P;  1JOC A;  3HD7 A;  2W6B A;  3BRT B;  1GU5 A;  3MUD A;  1YIJ P;  1OMI A;  4EI2 A;  1QL2 A;  2BAS A;  3CWB E;  1LT9 C;  3CCM P;  2E5T A;  1X9V A;  2ZVN B;  5GTH H;  5KLV D;  1YQ3 C;  3H1J D;  1L4A B;  1R5S A;  2QM8 A;  1Q7Y Q;  1OAC A;  2BCC J;  4AYC A;  1Q82 Q;  2JR8 A;  2NRG A;  2Y0D A;  1R8E A;  1Z56 A;  2LKM A;  2P1J A;  1OFC X;  3H25 A;  3AE1 C;  3H1H G;  2ZFC A;  1YHQ P;  1SQQ G;  2RN0 A;  3L72 J;  2KB7 P;  1SQV D;  2K88 A;  2WVR A;  4H0L D;  5KAI E;  3L75 G;  1JM0 A;  2IYO A;  3I5C A;  1L4A A;  1FC2 C;  1FBM A;  5CCH D;  1LGH B;  2RH0 A;  1KN7 A;  2WPS A;  1N7S A;  4U7J A;  2WZ7 A;  2HLO A;  3FX0 A;  1FJK A;  2IZ1 A;  3A7O A;  2WPV B;  2Z5H A;  3AE8 C;  3AEA C;  2IDB A;  1BGY E;  1KOR A;  1GU4 A;  1KYO H;  1DD4 A;  1PPJ E;  2MJZ A;  3B5N B;  2QG4 A;  5KLV G;  5KLV K;  3L74 D;  1SPU A;  3H1J G;  4YXD C;  3VZ9 B;  3JC2 2;  3AEC C;  4R4M A;  2E76 B;  3G71 P;  5B5E E;  1PZQ A;  1YYC A;  3G9R A;  1SQX J;  3H32 B;  1SQV G;  3L74 E;  1SQV K;  1NTK E;  5KLI B;  1NVO A;  1DEB A;  4U3F J;  1M56 D;  1YQ4 C;  1BGY G;  2M8R A;  3RBX A;  2ZXX A;  3L71 J;  1CW5 A;  4EOT A;  1PPJ G;  2FFD A;  1YJW P;  1SQP J;  5AW0 B;  3Q5S A;  3LW5 H;  1GD2 E;  4WWI A;  1HVV A;  1LTS C;  1HUC A;  3HD7 C;  1FS0 E;  3MUD C;  2O01 J;  1JB0 J;  5KAI H;  3B71 A;  1G1I A;  2N1T B;  2N9Y B;  3TF5 A;  1AA0 A;  1KIL B;  3H1L J;  1K04 A;  3CCL P;  4L74 A;  1FOS E;  3L74 G;  4GDO A;  1L4A D;  1J1E B;  3WUT A;  1YJ9 P;  4TT3 H;  2WMM A;  4C46 A;  1PGO A;  1NTK J;  5KJ7 A;  1RF0 A;  2N1T A;  2H89 C;  1J2J B;  1NWQ A;  4XE5 B;  3A5T A;  1CSB A;  2JKV A;  2O01 H;  1L4A C;  3AEG C;  2FYN B;  1L0L D;  2JO1 A;  4C7N A;  3AE3 C;  4ASV A;  1N7S C;  4IL6 X;  1AV1 A;  1HWT C;  1IJD B;  2LXB A;  1NHL A;  3TDK A;  3P32 A;  2ZYG A;  4CPG A;  1YJN P;  2QJP C;  2Y9Z A;  4DJG A;  4QMA A;  2GA1 A;  2QA4 P;  1VQ9 P;  5AW5 B;  1QAK A;  5AW6 B;  1OW8 A;  2KIK A;  4ZKU A;  3RBZ A;  1MKM A;  3B5N D;  3GF7 A;  1GDT A;  5AW3 B;  2SPZ A;  1VPC A;  2YMY A;  2W6J H;  3QWO C;  2AEJ A;  4UB8 E;  4I1L A;  5AW9 B;  2D2C D;  1Q86 Q;  3TNU B;  2E76 D;  1G2C B;  1S4X A;  3FXD A;  1FJP A;  1VQ5 P;  4EIJ A;  1L0L G;  1DYU A;  2D2C C;  2KZJ A;  2W83 C;  1L0L K;  2Y0C A;  2FFD C;  3RL0 g;  2E76 C;  1L0N J;  4NPD A;  3SFE C;  4N78 E;  3N7N A;  5CMZ A;  3TNU A;  1KQS O;  2KZI A;  1S5L E;  3L36 A;  1S2E A;  5KLI C;  3A0H E;  3F89 A;  3CCR P;  1AJY A;  2WQY C;  5KJ7 D;  2A45 G;  2NPS B;  1M7L A;  2N1T D;  3L70 E;  1KIL D;  3U1A A;  3CCE P;  1ZV8 A;  2K37 A;  4W80 A;  3CCQ P;  5KJ7 C;  1RF0 C;  3H1K D;  2N1T C;  3AE5 C;  1JCD A;  2WPR A;  2JJL A;  3A3Y B;  1AFO A;  1NTZ E;  3V6I A;  2XKM A;  1PP9 E;  1M57 D;  2H8P D;  3TGU D;  1P84 D;  2M3E A;  5AW2 B;  3S4R A;  1JUN A;  2XNX A;  1VQO P;  1ZME C;  4JPZ B;  3L70 G;  2A45 H;  2ITA A;  1GZL A;  3VMY A;  3VP8 A;  1YI2 P;  5APU A;  4WY4 B;  1OW7 A;  1ZLL A;  5M1B A;  1H89 A;  2FYN C;  1GK6 A;  3WUU A;  3TGU E;  3ITK A;  2IBZ I;  4JYC A;  1OVV A;  2K1A A;  1GW3 A;  2RMZ A;  1NU1 K;  3VZA A;  3V2N A;  1VL2 A;  1VQP P;  2WSS H;  1NTZ G;  4DOJ A;  1RH5 B;  1KV4 A;  1OW6 A;  4H44 C;  3IF4 A;  4OGQ C;  3U1C A;  1HTL C;  1S5L H;  2QVA A;  2FYU J;  4HH2 A;  3CCU P;  4Y99 B;  2B88 A;  4WY4 A;  1U7M A;  1W2B O;  1JY2 O;  4BRY B;  1SQB J;  2M5A B;  2A06 E;  1VQM P;  1JY3 O;  3BCC E;  3TGU G;  5TIS H;  1LVN A;  2QM7 A;  3JCU E;  3H1I D;  3L4F A;  3VMX A;  2ZYD A;  1OZH A;  2OTL P;  1OVU A;  5BU8 B;  4H13 B;  5AW7 B;  4BRY A;  2WOF A;  4PV1 B;  3MTU E;  3M91 A;  3CX5 E;  2WPQ A;  1EZV D;  1Q90 D;  1VQK P;  1X0T A;  1WRG A;  4OWF A;  4L76 A;  1NAF A;  3H1I E;  4Z1M H;  3SSU A;  2YMK A;  2BCC D;  1N2D C;  1BSH A;  2NPS D;  5KTB A;  1USE A;  1K05 A;  2OYH B;  1Y47 A;  2C9N Y;  3BCC G;  1Y8A A;  2GM4 A;  3HD7 B;  4UB6 E;  2AXT E;  2P67 A;  5APS A;  1IFM A;  1PIX A;  1YIT P;  1EZV E;  3L72 D;  2V7Q H;  1OIP A;  2JWA A;  5AVU B;  3CL3 D;  1BCC J;  4HB1 A;  4ZMD A;  2HPC A;  3AE9 C;  4RKU J;  1VQ8 P;  3A0B E;  1S9K E;  5E79 E;  1KQF B;  4Y28 J;  2E42 A;  1N73 A;  2OYH A;  3H1I G;  2PP6 A;  2VRS A;  3II6 A;  2WSF J;  1DH3 A;  5KKZ B;  5AVQ B;  4HJG H;  3PP5 A;  3HUS B;  4WY4 D;  3EFG A;  1EZV G;  1X8Y A;  5CJ0 A;  2Y0E A;  2ZYA A;  3JCU H;  3SFD C;  1JO5 A;  2QJY C;  3G6E P;  1N7S B;  4DCK A;  1PFI A;  1D6U A;  2YNY A;  2HFE D;  1ZW0 A;  1GW4 A;  2KS1 A;  3JSV C;  3NXS A;  3H6P A;  4WY4 C;  2I1J A;  5KLV E;  2AXC A;  1FDI A;  4N6J A;  3H1J E;  1GTW A;  3H1H J;  2QJP B;  1KD1 Q;  1SQQ J;  3L35 A;  3CX5 H;  2WSF H;  3L72 G;  1JRQ A;  3HUS A;  4EYY Q;  3L75 J;  3VMA A;  4U3F D;  2KP8 A;  2QIW A;  2W27 A;  1GK4 A;  2WSC H;  1XTC C;  3L71 D;  2H7H A;  5AVZ B;  1FZE A;  1NYH A;  3IN6 A;  3CWB J;  1URQ B;  4IFD K;  1JMM A;  1BE3 D;  1SQV E;  3VYI A;  3PJS K;  1FOS F;  4Y99 C;  2ZAE B;  2R5D A;  1M8O B;  2AXT H;  4GIF A;  3VN0 A;  2GUS A;  1PGQ A;  5APX A;  4I6M C;  1YTZ T;  3L73 D;  1SFC B;  2Y9Y A;  4PJ0 H;  2J59 M;  1MFT A;  1USD A;  2JP3 A;  3LW5 J;  4H13 D;  1NAY A;  3A0B H;  5E79 H;  4PV1 D;  1BE3 E;  3CD6 P;  1NH4 A;  1URQ A;  2D2C B;  2FFD B;  2HG5 D;  1BDD A;  2E75 B;  3V4W A;  2XU6 A;  1NOH A;  4H13 C;  4PV1 C;  2R5B A;  3GG2 A;  1SFC A;  1IFN A;  1FZG A;  1WMK A;  4L75 A;  3HD7 D;  3NFQ A;  1RF1 B;  1SQX K;  4PD4 D;  4K35 A;  1LT1 A;  3GF3 A;  4U3F G;  1EC5 A;  1BGY J;  3Q5P A;  2FXP A;  2FXM A;  1N73 C;  2DW3 A;  2OYH C;  5TCS D;  1HGZ A;  1AQT A;  3CCS P;  1SQP K;  1BE3 G;  4M3L A;  2PRR A;  3MIW A;  3VTP C;  2FBW C;  3WUV A;  3VP9 A;  2Q7C A;  4PD4 E;  4LLH A;  3VOP A;  1D6Y A;  3ZDM A;  1RF1 A;  3CX5 I;  4YXW H;  3L73 G;  1SVF A;  3PLN A;  1KFN A;  5DJT B;  3EQ2 A;  4C7N B;  4DT0 A;  4BXL A;  3L74 J;  5KKZ C;  1IK9 A;  3C8V A;  5C39 A;  2O1J A;  3K5B A;  1N7S D;  2IFM A;  3PRJ A;  5CCG A;  3IAO A;  1KYO I;  1LTT C;  1VDF A;  1UIX A;  4AQR D;  3LIE A;  3WU2 E;  4ZKP A;  3HUS C;  1RQU A;  1JCC A;  1JY2 N;  1OWA A;  1NTM D;  2K9J A;  3G4S P;  3D71 A;  1XTG B;  4N3Y B;  2FKW B;  5B5E H;  1L0N D;  2IX7 C;  4H44 B;  4OGQ B;  2GUV A;  2LR2 A;  3RGU A;  2R3C A;  2QSI A;  1URQ D;  1QVG O;  2CK3 H;  1L0L E;  2CPB A;  1NTM E;  2YKO A;  4KJM A;  3CLQ A;  4RJT A;  3W68 A;  3CXH D;  1VQ4 P;  3PHL A;  1FZC B;  1DX7 A;  1SFC D;  1URQ C;  1KB9 D;  3KZI E;  2KI7 B;  2OAR A;  1RE4 A;  1S5L X;  1T3U A;  4MN4 C;  3W67 A;  1SFC C;  1BSN A;  2CPS A;  3LID A;  2MKV A;  2E75 D;  2BEQ D;  5BU5 A;  1RY3 A;  4IL6 E;  2WT7 B;  1FZC A;  2QE7 H;  3SWF A;  4GOF A;  4IFM A;  2IZ0 A;  2QJK B;  2XND H;  1NTM G;  3CMA P;  1M90 Q;  1NTM K;  4JF7 A;  1EXI A;  1LTB C;  2J58 A;  2E75 C;  4GOE A;  2E5Y A;  3AEF C;  1MV8 A;  2C9L Y;  1L0N K;  2P7J A;  1J1D B;  3F5H A;  3WU2 H;  1RF1 C;  2WT7 A;  1NU1 D;  5APV A;  3TK1 A;  4YTP C;  1OXZ A;  3HE4 B;  2W6A A;  3IFM A;  3GW6 A;  3CC2 P;  2ZT9 B;  5CCG D;  2E74 C;  1ZOY C;  2C0X A;  1Q2N A;  4OH8 B;  1ZXG A;  1LTJ A;  1JY2 P;  3V2Q A;  2KSE A;  2OTJ P;  2BEZ F;  3P7K A;  1QX8 A;  1SLQ A;  1M1J B;  1NGM B;  3C1L A;  2KOG A;  1NU1 E;  1FU1 A;  5B66 E;  1X79 B;  5CCG C;  2FYU D;  5APW A;  1JY3 P;  1KIL E;  1DIP A;  1SS1 A;  3HE4 A;  1ZP0 C;  3RK2 B;  5L8R J;  2J5U A;  5EFW B;  4LC1 A;  2Z5I A;  1SQB D;  1VF5 C;  4JYB A;  3V5B A;  3H1K E;  5GTI E;  3AE6 C;  4UB8 H;  2IYP A;  2QJY B;  1M1J A;  1KMI Z;  2YKP A;  3RK3 D;  2QRX A;  3D6Y A;  3EWK A;  1H8A A;  1IO4 A;  1HH0 A;  4IOI H;  3L70 J;  1AQ5 A;  1E79 H;  1RQV A;  5AVY B;  3M9H A;  4H44 D;  1P84 E;  3V4Q A;  4OGQ D;  3O6Q A;  2IFN A;  1NU1 G;  4I2L C;  2N9B A;  3RK3 C;  2FTX A;  3M06 A;  5AVT B;  5BVZ A;  2G8Y A;  3SWY A;  1FZF A;  1RE4 C;  3KYQ A;  2JDI H;  5AW8 B;  2B89 A;  2JWD A;  3BAT A;  1NTZ J;  3A0H H;  3H1K G;  1PP9 J;  1TU3 F;  3EFF K;  3KHU A;  2YKQ A;  3O8Z A;  2Z4E A;  3VMZ A;  2FYU K;  3S9O A;  1FZC C;  4D6T D;  3FWN A;  1BCC D;  5AVW B;  3FGA D;  3RL0 B;  2WO0 A;  2ZVO B;  1FDM A;  3P8M C;  1LJ2 A;  1SQB K;  2NZ2 A;  2V7Q J;  3TGU J;  2OQQ A;  4C7R A;  5B66 H;  3CCV P;  1A02 F;  1D7M A;  3USS A;  5T6J B;  2KSJ A;  2LXC B;  4W7Z A;  4RES B;  5APT A;  1HJ0 A;  2QJK C;  2HPC B;  1KQL A;  3U59 A;  5CCH A;  1R5L A;  1X22 A;  1NKN A;  5GTI H;  3MZW B;  3AE7 C;  2KLV A;  1LTJ C;  2WWW A;  2ZT9 D;  1T6A A;  1N73 B;  2A45 I;  1AVY A;  1LP1 A;  4NPF X;  3AED C;  1N8R Q;  5AVS B;  3Q1M A;  3CC7 P;  1J1D C;  1KYO D;  2L91 A;  2W90 A;  3V2R A;  1P84 H;  3BCC J;  3H1H D;  1SQQ D;  2BCC E;  2ZT9 C;  4KT0 J;  1RHZ B;  4D6T G;  3L75 D;  1G1J A;  3TSI A;  3I56 P;  3RK2 D;  1KFM A;  1LTI C;  2KXP B;  4JBZ A;  1M1J C;  3L72 E;  3CWB D;  2IPP A;  1WT6 A;  3L37 A;  2KS1 B;  1VQ7 P;  2K3R A;  3H1I J;  3RK2 C;  1N86 A;  2WSC J;  1PGJ A;  1VQN P;  3BVH A;  4I7Z B;  3GHG B;  1D6Z A;  1OVR A;  2BCC G;  2P10 A;  3M0D A;  3OA7 A;  2WGQ A;  3SWK A;  1PV3 A;  5AVX B;  2Q9I A;  1DEE G;  1K9M Q;  4R4L A;  1SQX D;  2G3A A;  1EDI A;  1JMB A;  2RKL A;  3GHG A;  2E43 A;  4HKZ H;  1SQQ K;  1Q81 Q;  2M0B A;  1SQP D;  3CI9 A;  3RL0 D;  1BGY D;  3AE4 C;  4UB6 H;  1SQX E;  1QLE D;  1PPJ D;  3CWB G;  4IFF A;  2XDJ A;  1QEX A;  2PFX A;  1BDC A;  1U57 A;  3P8C D;  1P84 I;  4U3F E;  4H0L C;  3GLM A;  5AVV B;  3RL0 C;  1A02 J;  3H1L D;  3HTK B;  3L71 E;  2KK7 A;  5CCH C;  1SQP E;  3KXD A;  5KLV J;  4A7P A;  3H1J J;  2W8Z A;  5TJH A;  2XZR A;  2KUB A;  3L73 E;  3P8C E;  1EDL A;  2M3B A;  1NTK D;  5AVR B;  2ZXE B;  3Q5R A;  2Q1K A;  3H1L E;  4RO0 A;  3E7K A;  3GMA A;  1HBW A;  3HRN A;  3HTK A;  4TLF A;  1SQX G;  3E1I A;  2FV4 A;  1NJI Q;  1SQV J;  3N4X A;  1JNM A;  1YBK A;  2JEE A;  3V2P A;  1MUU A;  1Y9B A;  1ZRT D;  3B5N A;  4GT1 A;  3L71 G;  3CC4 P;  2E74 B;  1SQP G;  1EDK A;  1L2P A;  1K8A Q;  2YO2 A;  1EXJ A;  3G3Z A;  1QGK B;  1E5W A;  2PAJ A;  2IBZ D;  1BE3 J;  1IC2 A;  1AVO A;  1HF9 A;  4BWN A;  1DD3 A;  2FYZ A;  1FZB A;  1EDJ A;  1T2K D;  1ZRT E;  2YO3 A;  3H1L G;  3H32 A;  3PH0 A;  3M9Q A;  3L73 J;  2K9J B;  5KAF E;  3M0D C;  1VF5 B;  1MZ9 A;  3R4Y A;  4LGD E;  3Q3D A;  1ZR2 A;  2B9B A;  4WVZ A;  3M0A A;  3OAK A;  1GMJ A;  2KYV A;  2IBZ E;  4WBA A;  1T2K C;  3D70 A;  1EZV I;  3AE2 C;  1NTK G;  1NTK K;  4HYT B;  2P58 A;  4I7Z C;  3M9B A;  3GHG C;  1LTG C;  3C9I A;  3KDP B;  1KZU B;  4GKG A;  3RK3 B;  1KIL A;  2B87 B;  3IR9 A;  1VQL P;  4JQ0 D;  1JY3 N;  2H43 A;  1IK7 A;  1SP4 A;  3KPE A;  3R2P A;  4O9B A;  4GEQ A;  1LTA C;  3BRV B;  1UII A;  2P2U A;  2IBZ G;  5AW1 B;  4K3A A;  1FDO A;  3FXE A;  2B87 A;  1L0N E;  1NKZ B;  1LWU B;  2OYI B;  2ZJS E;  1HJB A;  3MGN A;  1EQ7 A;  3AEB C;  1S1C X;  2WOH A;  4PD4 H;  3NTN A;  2I1K A;  3CXH E;  1GL2 B;  1IFI A;  4XA4 A;  2W0Q A;  3UIA A;  5CBO A;  3D6Z A;  1U7J A;  1KB9 E;  2YIU B;  2H88 C;  3CME P;  1KQG B;  5KAF H;  2K9Y A;  1LWU A;  2OYI A;  4N78 D;  1K73 Q;  3B5N C;  1T8Z A;  1KTM A;  1L0L J;  1LTJ B;  1MFZ A;  3A2A A;  1NTM J;  2Q3E A;  5H2F E;  1L0N G;  3CPW O;  1RE3 A;  3K1L A;  2E74 D;  2OGU A;  1GL2 A;  2WSE J;  3HE5 B;  3L70 D;  5APQ A;  2O01 N;  5CJ4 A;  1G2C A;  5K5G B;  3MP7 B;  2AEM A;  3MHV A;  3FWL A;  1QVF O;  3AEE C;  2O1K A;  4GOD A;  5DJU B;  1PL5 A;  2XV5 A;  1IFD A;  1JTH B;  4YPC A;  1VF5 D;  2C0W A;  3HE5 A;  1NTZ D;  3OJA B;  1ZN5 A;  1PP9 D;  5TIS E;  5AW4 B;  1VQ6 P;  2WSE H;  4ZNC A;  1IZN B;  3BAS A;  3O6Q B;  5APY A;  2YXR B; 
#chains in the Genus database with same CATH homology
 1N7S C;  1SFC B;  5AVS B;  1CZQ A;  2J59 M;  1KIL C;  1J1D C;  1HWT C;  1IJD B;  1W2E A;  1NHL A;  3P32 A;  2NPS A;  1LT9 B;  3V2R A;  1T3J A;  1NH4 A;  4DZO A;  1JTH A;  1URQ A;  2FFD B;  2HG5 D;  5AW5 B;  1J1E C;  3KQG A;  5AW6 B;  2XU6 A;  3V4W A;  1G1J A;  2HOD B;  1NOH A;  1HGV A;  3TSI A;  3RK2 D;  2R5B A;  4B86 A;  1KFM A;  1LTI C;  4ZKU A;  1SFC A;  1IFN A;  1M1J C;  3B5N D;  1FZG A;  1GDT A;  5AW3 B;  3HD7 D;  1VPC A;  2IPP A;  3NFQ A;  1WT6 A;  3NMD A;  2WTY A;  1RF1 B;  2YMY A;  1SQX K;  3L37 A;  1LT9 A;  2POH A;  4I1L A;  5AW9 B;  3WMM 0;  2R32 A;  3RK2 C;  1N86 A;  3TNU B;  1CI6 B;  1G2C B;  2FXM A;  1N73 C;  2OYH C;  5TCS D;  1HGZ A;  2HOD A;  3BVH A;  1FJP A;  3GHG B;  1SQP K;  2HYN A;  4M3L A;  2L5G B;  1NTZ K;  3MIW A;  3VTP C;  4EIJ A;  3M0D A;  2WIT A;  3VP9 A;  2Q7C A;  3OA7 A;  4LLH A;  3VOP A;  2FFD C;  1L0L K;  1RF1 A;  1LWU C;  2OYI C;  1GL2 D;  1SVF A;  5AVX B;  2Q9I A;  4N78 E;  1KFN A;  3N7N A;  3EQ2 A;  4W7Y A;  5CMZ A;  3TNU A;  1CI6 A;  3L36 A;  4C7N B;  1RE3 C;  3GHG A;  2E43 A;  1GL2 C;  1FZA A;  1SQQ K;  1IK9 A;  5KJ7 D;  2A45 G;  4WB4 A;  2NPS B;  1M7L A;  2N1T D;  2O1J A;  1N7S D;  2IFM A;  1KIL D;  5CCG A;  3CI9 A;  3RL0 D;  1LTT C;  1VDF A;  1YTZ I;  4AQR D;  2Q3I A;  3LIE A;  4ZKP A;  3HUS C;  1JCC A;  3U1A A;  1ZV8 A;  1JY2 N;  4IFF A;  4W80 A;  2XDJ A;  1IFJ A;  1OWA A;  3T97 A;  1NO4 A;  5KJ7 C;  1RF0 C;  4AUW A;  3P8C D;  2N1T C;  3B8E B;  3TYY A;  1XTG B;  5AVV B;  3RL0 C;  4N3Y B;  2FKW B;  1A02 J;  3HTK B;  1JCD A;  2WPR A;  5CCH C;  2JJL A;  3A3Y B;  2IX7 C;  1AFO A;  1N7L A;  2GUV A;  2R3C A;  2XKM A;  1URQ D;  1QL1 A;  2H8P D;  1S9K D;  1H88 A;  5AW2 B;  2CPB A;  1JUN A;  2XNX A;  2YKO A;  2XZR A;  3P8C E;  3MD0 A;  2M3B A;  3CLQ A;  5AVR B;  2ZXE B;  4KHX A;  1FZC B;  2A45 H;  2NPS C;  1DX7 A;  1GZL A;  3VMY A;  3VP8 A;  1SFC D;  1HBW A;  1URQ C;  3HRN A;  3HTK A;  5APU A;  3E1I A;  4WY4 B;  2FV4 A;  1ZLL A;  2OAR A;  5CHX A;  1RE4 A;  3N4X A;  1ZR4 A;  1JNM A;  1H89 A;  1GK6 A;  1FAV A;  1T3U A;  2JEE A;  2Q5U A;  3V2P A;  1MUU A;  4JYC A;  1GW3 A;  3B5N A;  1NU1 K;  1JOC A;  4GT1 A;  1SFC C;  3VZA A;  2CPS A;  3HD7 A;  3LID A;  2W6B A;  3BRT B;  3V2N A;  1GU5 A;  3MUD A;  5BU5 A;  1QL2 A;  4DOJ A;  2BAS A;  1RY3 A;  2WT7 B;  1FZC A;  1LT9 C;  3SWF A;  4IFM A;  2YO2 A;  1X9V A;  3G3Z A;  1E5W A;  2PAJ A;  3U1C A;  1HTL C;  1IC2 A;  4HH2 A;  1L4A B;  4Y99 B;  1NTM K;  4JF7 A;  4WY4 A;  2QM8 A;  1LTB C;  2FYZ A;  2J58 A;  4AYC A;  1FZB A;  1T2K D;  2YO3 A;  1JY2 O;  1MV8 A;  3H32 A;  1Z56 A;  2LKM A;  2P1J A;  2C9L Y;  3M9Q A;  1L0N K;  2P7J A;  3M0D C;  1MZ9 A;  1J1D B;  4LGD E;  2ZFC A;  1RF1 C;  1JY3 O;  1ZR2 A;  2WT7 A;  3M0A A;  2KB7 P;  3OAK A;  5APV A;  2KYV A;  4WBA A;  2QM7 A;  3TK1 A;  1T2K C;  1OXZ A;  3HE4 B;  3L4F A;  3VMX A;  2W6A A;  3IFM A;  3I5C A;  1L4A A;  1NTK K;  5CCG D;  4HYT B;  1FBM A;  5CCH D;  1LGH B;  2C0X A;  5BU8 B;  3M9B A;  4OH8 B;  3GHG C;  1LTJ A;  5AW7 B;  1JY2 P;  1LTG C;  3C9I A;  3V2Q A;  3KDP B;  2WPS A;  1KZU B;  1N7S A;  3MTU E;  3P7K A;  2WZ7 A;  3M91 A;  4GKG A;  1SLQ A;  2HLO A;  2WPQ A;  3RK3 B;  1M1J B;  1KIL A;  3IR9 A;  2KOG A;  1FJK A;  1FU1 A;  3A7O A;  1X79 B;  1WRG A;  1JY3 N;  5CCG C;  2H43 A;  2Z5H A;  5APW A;  1SP4 A;  3KPE A;  1NAF A;  3R2P A;  1JY3 P;  4O9B A;  1N2D C;  4GEQ A;  1LTA C;  2NPS D;  3HE4 A;  1GU4 A;  5KTB A;  3RK2 B;  2MJZ A;  3BRV B;  3B5N B;  4LC1 A;  2Z5I A;  2P2U A;  2OYH B;  2C9N Y;  4JYB A;  2GM4 A;  3HD7 B;  3V5B A;  5KLV K;  2P67 A;  5AW1 B;  5APS A;  1IFM A;  3VZ9 B;  5AVU B;  1M1J A;  3CL3 D;  2YKP A;  3RK3 D;  2HPC A;  1NKZ B;  1H8A A;  1IO4 A;  1LWU B;  2OYI B;  1HH0 A;  1AQ5 A;  1HJB A;  3MGN A;  1EQ7 A;  5AVY B;  1YYC A;  1S9K E;  3M9H A;  3V4Q A;  3H32 B;  2IFN A;  1N73 A;  4I2L C;  2E42 A;  3NTN A;  2N9B A;  2I1K A;  2OYH A;  3RK3 C;  1SQV K;  2FTX A;  1DEB A;  2PP6 A;  3M06 A;  1GL2 B;  1IFI A;  2VRS A;  4XA4 A;  3II6 A;  5AVT B;  3UIA A;  2M8R A;  5BVZ A;  1DH3 A;  3SWY A;  1FZF A;  1RE4 C;  3KYQ A;  1CW5 A;  5AVQ B;  4EOT A;  2FFD A;  1LWU A;  5AW0 B;  5AW8 B;  2OYI A;  3BAT A;  3LW5 H;  1GD2 E;  4N78 D;  3B5N C;  3PP5 A;  1HVV A;  1LTS C;  3HUS B;  1T8Z A;  4WY4 D;  3EFG A;  1HUC A;  3HD7 C;  1X8Y A;  5CJ0 A;  2YKQ A;  3O8Z A;  1LTJ B;  1MFZ A;  3A2A A;  2Z4E A;  3VMZ A;  2FYU K;  1JO5 A;  1FZC C;  1G1I A;  2N1T B;  1RE3 A;  3K1L A;  1N7S B;  1PFI A;  5AVW B;  1KIL B;  3RL0 B;  2YNY A;  1GL2 A;  2HFE D;  3HE5 B;  1GW4 A;  1FDM A;  3P8M C;  3NXS A;  3H6P A;  4WY4 C;  2I1J A;  5APQ A;  5CJ4 A;  4N6J A;  1SQB K;  1GTW A;  1FOS E;  3L35 A;  2WSF H;  1G2C A;  1L4A D;  4C7R A;  3HUS A;  1J1E B;  1A02 F;  2KP8 A;  4C46 A;  2W27 A;  1GK4 A;  2WSC H;  5T6J B;  2KSJ A;  5KJ7 A;  1RF0 A;  1XTC C;  2N1T A;  4W7Z A;  2O1K A;  1J2J B;  2H7H A;  1NWQ A;  4RES B;  2XV5 A;  5APT A;  1FZE A;  4XE5 B;  5AVZ B;  3A5T A;  1CSB A;  1IFD A;  1JTH B;  1URQ B;  2C0W A;  2HPC B;  4IFD K;  1JMM A;  1KQL A;  3HE5 A;  3U59 A;  3VYI A;  5CCH A;  2O01 H;  1FOS F;  1L4A C;  4Y99 C;  2R5D A;  3OJA B;  1ZN5 A;  1NKN A;  4GIF A;  3VN0 A;  2GUS A;  2KLV A;  5AW4 B;  1LTJ C;  2WSE H;  4I6M C;  5APX A;  2WWW A;  1YTZ T;  3BAS A;  4C7N A;  5APY A;  1N73 B;  2A45 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...