4DZOA

Structure of human mad1 c-terminal domain reveals its involvement in kinetochore targeting
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
117
Chain Sequence
SKEVAELKKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKATSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of human Mad1 C-terminal domain reveals its involvement in kinetochore targeting.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Mitotic spindle assembly checkpoint protein MAD1
total genus 41
structure length 117
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4dzoA01
3.30.457.60 Alpha Beta 2-Layer Sandwich Copper Amine Oxidase; Chain A, domain 1 Copper Amine Oxidase; Chain A, domain 1 4dzoA02
2Q3IA 1JNMA 5AVWB 5APSA 2YO2A 3V4QA 5AVQB 1DH3A 3VN0A 1NWQA 3HE5B 3LIEA 5AW7B 3P32A 1CZQA 2JJLA 4JYCA 1S9KD 5AVRB 2W6AA 1CI6A 4M3LA 3LIDA 2C9NY 3A2AA 2YNYA 2WWWA 2WPSA 3M0DA 3P7KA 3UIAA 2E43A 2KP8A 3MGNA 2WT7A 1CI6B 3HTKA 4GKGA 2Q7CA 1GTWA 3M9BA 5AW1B 1KQLA 1H89A 1HWTC 4RESB 3HE4A 2YO3A 4KHXA 5AVZB 3I5CA 1GU4A 3NMDA 2H7HA 3L37A 4LC1A 3M9HA 2W27A 3OAKA 4HYTB 2P2UA 2BASA 3MD0A 3KDPB 2XU6A 5AW3B 2WTYA 4AQRD 1FOSE 1YYCA 1JUNA 2R5DA 1IO4A 3M06A 5AW2B 2Z5IA 4EOTA 3M91A 5CMZA 5APVA 2N9BA 3VTPC 5APXA 2R3CA 2R32A 3HE4B 5AW8B 3TK1A 3NFQA 3IR9A 2QM7A 1CSBA 3TYYA 4XE5B 3SWFA 2XZRA 1A02F 1X8YA 2VRSA 1HUCA 2ZXEB 2WPRA 1GZLA 5APWA 1MFZA 5APYA 5AW0B 5AVVB 2XV5A 1HBWA 3A7OA 3NXSA 3VYIA 1GK4A 2ZFCA 4B86A 2R5BA 1OWAA 1GU5A 3A3YB 2QM8A 3NTNA 5AW4B 4DZOA 3HE5A 2WT7B 1T2KC 3T97A 2E42A 2C9LY 1A02J 3TNUA 2WPQA 5AVYB 1MV8A 3V4WA 3VMXA 1MUUA 3B8EB 3L35A 3P8MC 5AVSB 2IPPA 3KQGA 4C7NB 3A5TA 4GT1A 2Q5UA 1NAFA 5AVXB 3VMYA 5AVTB 2P7JA 4AYCA 4C46A 3VMZA 1J2JB 1OXZA 5APUA 1SLQA 1FOSF 3M0AA 3TNUB 1HJBA 5AW5B 5APTA 1H88A 1H8AA 1T2KD 1GK6A 3L36A 3O8ZA 1FAVA 2P67A 5AVUB 1S9KE 5AW6B 2Z5HA 4AUWA 4I6MC 4C7NA 1SP4A 4I2LC 1GD2E 4JYBA 1G2CB 3V5BA 5APQA 5AW9B
chains in the Genus database with same CATH superfamily
4H44B 3CWBJ 1PGPA 5KJ7C 5KTBA 5AVWB 3B5NC 5APSA 3CXHD 4JPZB 2AXTE 2YO2A 2GM4A 1RQVA 3GF3A 3H1ID 2K37A 3G4SP 2QA4P 3LIEA 5AW7B 2WOFA 2XDJA 2KS1B 1GL2C 3H1LJ 1CZQA 2JJLA 1L2PA 2JKVA 3D71A 2E76C 4JYCA 3AEAC 2OYOA 3II6A 1NTMD 4PV1C 3TGUJ 3HTKB 2W6AA 3BCCJ 1K8AQ 3FXDA 2KYVA 2WSSH 4D6TJ 2QJKC 4NPEA 1YQ4C 1QL1A 3QWOC 2QRXA 1S5LH 1RE4A 1W2BO 4LLHA 1DEBA 2WITA 2ZVNB 3K1LA 1JY3P 2FXMA 1BGYD 2RMZA 4ZMDA 2W6JH 1FS0E 2I1JA 3JC22 1SFCB 1H0TA 3UIAA 1FE6A 1JTHA 2E43A 2KP8A 4KT0J 1YITP 3P8CD 2OGUA 1SQVK 1QGKB 1PPJD 3SWKA 1SQQE 1K04A 2PP6A 1TU3F 1HWTC 4U3FD 3WUVA 3CC4P 5KLVE 3D6ZA 3CCUP 5AVZB 1LTTC 3CC2P 1J1DC 1BCCJ 3L71D 3L70E 4OVNF 2JDIH 3HUSA 2KLUA 1S4XA 2LR2A 1MKMA 2W27A 3A0HE 3PLNA 3HUSC 4HYTB 2P2UA 3MD0A 3Q2YA 1XTCC 3KDPB 5L8RJ 1NTKD 1RQUA 3KPEA 5AW3B 1QLED 1L0NK 3FWNA 3IN6A 5BU8B 2WTYA 3CCQP 1IO4A 1JO5A 1X9VA 3BATA 4HB1A 4OGQC 1K73Q 2AXCA 1DYUA 4H0LB 3M91A 4GOEA 1FZFA 2P58A 2C0WA 3H1JJ 3VTPC 2YKOA 1AVYA 1HTLC 1SQXD 4PJ0H 2E76D 2GA1A 1L0NE 2FFDC 1P84E 1SQBG 3AEDC 3TYYA 1KQFB 2WO0A 2CPSA 2N1TB 3SFEC 1GW3A 2JR8A 1LTAC 2YMKA 2XZRA 1RE4C 3H32B 1VQKP 2IZ0A 1ZOYC 1OW6A 3N7NA 1M1KQ 1CW5A 3ZDMA 2HPCA 1IJDB 3RK3B 1SQVG 3RK2D 1HGZA 2C0XA 3GW6A 2BCCJ 5APYA 5AW0B 1YIJP 4WY4C 3L75E 1S2EA 3RK2C 3GF7A 1GL2A 3GHGB 4Y28J 4PV1D 1LTBC 1NKZB 1GK4A 3OJAB 4H13D 1NTZE 5KJ7A 1FOSE 1N8RQ 1L0LK 2R5BA 3HD7C 1GL2D 3S9OA 2CPBA 2FXOA 1OW7A 2ITAA 3M9QA 4IFFA 2OYHA 4UB6E 2NZ2A 3G3ZA 1QEXA 4DZOA 1BE3G 3HE5A 3MHVA 1T2KC 1BE3J 3VOPA 1DIPA 1A02J 3R2PA 3ITKA 3H1JD 2KZJA 1L0LE 2Q3EA 3B5ND 4EIJA 3VMXA 1MUUA 3B8EB 1SS1A 1OMIA 2K9JA 4NPDA 5CJ0A 3H1KE 3V2PA 4YXWH 1RF1C 2YIUB 1PP9D 2QVAA 2IPPA 1AJYA 3AECC 1VL2A 1NTKJ 3RL0B 1EDIA 2JO1A 5AVXB 1NAFA 2PAJA 1KILC 4YTPC 3L70J 3VMYA 4AYCA 2B89A 4C46A 1VQNP 1KB9E 2V7QJ 1SLQA 1T3UA 1EZVE 3IF4A 2LXBA 4IFMA 3PHLA 3E1RA 1R5LA 1RH5B 3VP9A 3AE5C 5CCGD 1YTZT 2K3RA 1RF0A 3RBZA 3H25A 2IYPA 2WSEH 2P67A 4I7ZB 3MZWB 2QE7H 2OTJP 5CCGA 2E75D 2ZT9B 3L73G 4H44C 4EDFA 1VQ7P 1URQB 5B66E 1OX3A 4AUWA 2PFXA 3GHGA 1HGVA 1USEA 3O6QA 4C7NA 1GD2E 5C39A 4JYBA 4D6TD 3TGUD 3QH9A 3O6QB 4GOFA 3V5BA 2OYIB 1NTKG 3AEFC 1X79B 1JNMA 1PIXA 2E5YA 3H1HE 2M5AA 1NTMJ 5H2FE 4DT0A 2P1JA 2I8DA 1MZ9A 5KLIB 3VN0A 1M57D 2R44A 2W83C 1PL5A 3TGUE 1KD1Q 1SPUA 1KYOH 1N2DC 2Y9ZA 1EQ7A 1L0LG 2QJPC 3P32A 3Q5SA 3RK3E 4DJGA 1IFMA 1T8ZA 3JCUE 1UIXA 3LW5J 2Y0EA 1K9MQ 3VZ9B 5DJTB 3CWBD 1LTJB 1S5LE 3OW2O 1Z56A 3CX5H 4JQ0D 3A2AA 1N73C 4U7JA 1IFJA 1IFPA 2YNYA 3GG2A 1VF5C 1LWUC 2ZJSE 2M3EA 2Q6QA 2WWWA 1D6ZA 3G9RA 1KORA 1SQBE 4WB4A 1L4AB 1L4AD 1J1EC 4UB8E 3P7KA 1U7MA 1FDIA 1IFIA 3AE6C 5E79H 1M56D 3H1IE 1SQVE 1CI6B 4A7PA 1SQXK 1LWUA 2E74C 3C1LA 4GKGA 2AXTH 1FZGA 1E79H 1BSNA 5AW1B 1VQPP 1Q2NA 5GTIE 3HE4A 3CCLP 2YO3A 4KHXA 1IFNA 1M1JC 1SFCD 3V2QA 1YQ3C 1NO4A 3NMDA 1USDA 1WT6A 3H1JG 3RK3D 4DCKA 1L0NG 1VQMP 3CCSP 2H7HA 2NRGA 1SFCA 1H0TB 1RHZB 2O3JA 1N7SA 1OZHA 2AEFA 3KZIH 1SQQJ 1Y9BA 1BCCG 2IFNA 2R3SA 3L73J 2OTLP 2HLOA 2J58A 2XU6A 3CLQA 2A45H 3MUDA 5KAIE 5TCSD 3K5BA 1LT9C 1N7SD 5KAIH 3A5TA 2E76B 2FYUG 2HYNA 3H1KJ 1NTKK 1LP1B 1VQ6P 2Z5IA 1FZEA 4ASWA 1SQVJ 5CBOA 5K5GB 4RJTA 5APXA 1LTGC 2R32A 1GW4A 3MTUE 5AW8B 4PD4I 3IR9A 2KS1A 1LNQA 2QM7A 3L70G 5KJ7D 4XE5B 1P84I 2O1JA 3AEBC 4W7YA 2FYNB 2HODA 5GTIH 3SWFA 1NAYA 3L73D 4TT3H 1PP9J 2ZXEB 1SQQG 1BDCA 1M7LA 5E79E 1U7JA 1SVFA 2RN0A 1EZVD 2KLVA 1MFZA 1URQD 3PH0A 1Y8AA 1G2CA 1YTZI 2ZT9D 3ABVC 3EFGA 2O1KA 3GMAA 2WZ7A 3CCJP 4K3AA 1SQXJ 3F5HA 1VPCA 1KILA 1PP9E 1NTZD 2QEXP 1LGHB 2YMYA 3CX5E 2MJZA 3KXDA 1ZR4A 2IYOA 3AE4C 3RL0g 1L0LD 3B5NA 4L73A 1SQXG 2H88C 1UIIA 2WSCJ 3JCUH 3V6IA 1SQBD 3VP8A 1VQ5P 1KQSO 2WOHA 4WWIA 4GEQA 2V7QH 3MIWA 5AVYB 3RL0D 3V4WA 1SQQK 1X0TA 2NPSC 4DOJA 1KILB 1PV3A 2OARA 1VQ9P 5B5EE 2FTXA 5CCHC 2OYHC 3L35A 4L75A 1K05A 2OQQA 4Y99B 2HR3A 1PGOA 5AVSB 1SQVD 4LGDE 5H2FH 2WSEJ 1NHLA 1P84D 2Q5UA 4GT1A 2QSIA 2W6BA 3VMZA 2WQYC 1KB9D 1OXZA 2J5UA 2KOGA 4UB6H 3M0AA 3V2RA 1KQGB 3PP5A 5AW5B 3T97B 1H8AA 1KMIZ 3U1CA 2P10A 4H13B 1JMBA 4W80A 4IFDK 3FX0A 3H1KD 3O8ZA 1FAVA 2ZYAA 1AV1A 5AVUB 5M1BA 3KYQA 3AE7C 1L0ND 2YKQA 2Z5HA 1NJIQ 3H1IJ 1LP1A 2BEZF 1S5LX 4I6MC 1EXJA 3AE1C 2IFMA 4YPCA 1KB9H 2B9BA 3BCCD 3SSUA 3WUUA 2M3BA 1PP9G 5APQA 1JY2N 5AW9B 4ZKUA 5GTHH 3CCEP 1PZQA 1VQ8P 2FYUD 3H1HD 1N7SB 4BRYA 4BXLA 4O9BA 3P8CE 1DH3A 1DEEG 5AVQB 3SFDC 2L5GB 1NWQA 3L75D 2POHA 3BCCE 3D70A 2FKWB 3B5NB 2QJYC 1LTJC 1EXIA 1ZLLA 5BVZA 5KLVK 2NPSD 3L70D 1N73B 3L71E 3RL0C 4YXDC 1RF1A 1JEKA 5AVRB 1LWUB 3AEGC 3BVHA 1CI6A 4H0LC 4M3LA 1YI2P 1HJ0A 3CWBE 3H6PA 3EQ2A 1HH0A 1JY2P 2C9NY 2W0QA 1FZBA 3L74G 2FFDB 1L4AA 1NVOA 3H1HJ 2DW3A 3H1JE 1XTGB 3PJSK 3TGUG 1L0NJ 2N1TC 1GDTA 2B87A 4L74A 5TJHA 1AA0A 1NTZG 2HODB 2LXCB 2L91A 1EDKA 2ZT9C 3E7KA 3MUDC 4R4LA 2Q7CA 2WT7A 1Q82Q 4HH2A 1GTWA 1KILE 2KNCB 1H89A 1KQLA 2O01H 1FZCA 4RESB 3CD6P 2PGDA 1OW8A 3I56P 2H89C 1FJKA 1N7LA 2ZVOB 4I1LA 1R8EA 3I5CA 4BWNA 4IL6X 1Q81Q 1KB9I 4L76A 4EYYQ 1M1JA 4XFJA 1GU4A 3L37A 1EZVI 2KXPB 2WGQA 1FJPA 1D6UA 3M9HA 1RY3A 3OAKA 1ZRTE 1FZCC 3Q1MA 2UWJE 1IK7A 3AE3C 4ZKPA 2V4HA 2N1TD 1FC2C 3CX5D 3WU2H 2KK7A 3PRJA 2O01J 2OYIA 1QALA 1NH4A 3JSVC 1JUNA 1KV4A 3CXHH 5TISH 1Y47A 5AW2B 2QG4A 1VQOP 4PD4D 3U59A 2D2CC 3AEEC 1URQA 2W90A 1YJWP 4ASVA 1L0LJ 1OIPA 2FYNC 2GUSA 2QJKB 5APVA 3WUTA 2H8PD 1BGYE 2R3CA 1NU1J 1LT9A 1T3JA 3FGAD 2B88A 3HE4B 3TK1A 4OGQB 5BU5A 1CSBA 2E75B 2FBWC 5KLVG 1ZR2A 1SFCC 1A02F 4EI2A 2J59M 1PFIA 2VRSA 1HUCA 2A06D 1NTZJ 5EFWB 1VQLP 3OA7A 2WMMA 1FBMA 2G3AA 1S1CX 3BASA 1SQXE 3FXEA 3BCCG 4OWFA 4N6JA 5APWA 2IDBA 2KB7P 1YJ9P 1M90Q 4IOIH 1BCCD 3L71J 3HD7B 5AVVB 1S72P 4I7ZC 1HBWA 3A7OA 1LTJA 3H1HG 2K9JB 3CXHI 1NU1D 3E1IA 2LKMA 3U1AA 1LJ2A 1GMJA 4WY4B 3L75G 4OH8B 1BDDA 4MN4C 2AEMA 5CJ4A 1NU1E 3CPWO 3VZAA 2K88A 1JY3O 5AW4B 1FZAA 3NTNA 1AQTA 1Q86Q 1R5SA 1X22A 2E5TA 3TNUA 1KYOD 1BGYJ 2WPQA 4IL6E 1RF0C 2BCCD 2M5AB 1LTIC 4QMAA 1SQQD 1W2EA 1GL2B 4D6TG 3Q3DA 1EZVG 3WMM0 1AQ5A 1D7MA 4C7NB 2IBZI 2ZAEB 1JY2O 2W8ZA 2Y0DA 2WPVB 4PV1B 1IC2A 2P7JA 1NKNA 1NYHA 4UB8H 2KI7B 4WVZA 5CCHD 2HPCB 4N78D 4NPFX 2IBZD 1D6YA 3TNUB 1SQPK 5CCHA 3A0BH 3AE9C 4WBAA 5APTA 3W67A 1YJNP 4HKZH 1H88A 3CXHE 5TISE 1NTKE 1N86A 1GK6A 2A45I 1NTMG 3RK2B 3WU2E 2O01N 3G71P 3EWKA 3GHGC 2KIKA 1W5CE 1BE3E 4TLFA 1YBKA 1ZMEC 1FDMA 1KYOE 5CCGC 1SP4A 3Q5PA 5CBNA 1BGYG 2IZ1A 2WSFH 3HD7A 2ZXXA 5KKZC 2Q3IA 3IFMA 1OVRA 1URQC 2YXRB 1NOHA 3CMAP 2KZIA 2FYZA 1OACA 2AEJA 2QJPB 4W7ZA 3L75J 3V4QA 4D6TE 1QAFA 1PPJG 2MKVA 2XNXA 2JWDA 2D2CD 3HE5B 3RGUA 2IBZE 5CHXA 4N78E 2RKLA 3L72J 4U3FG 4GIFA 5B66H 2N9YB 2YIUC 3L4FA 2OYHB 1BSHA 4N3YB 1KC8Q 2KUBA 1WMKA 5DJUB 1S9KD 1SQPJ 1VF5B 3H1KG 3L72E 5KLVD 2M0BA 4GODA 2FXPA 1OVVA 3CX5I 2A06G 3LIDA 3R4YA 1S3JA 1NTME 4C7RA 1NTZK 1WRGA 3W68A 1YHQP 3C8VA 1MFTA 2WPSA 1QVGO 2Q9IA 4JF7A 1DX7A 1IFDA 3M0DA 3H1LG 1KFMA 3H32A 1JCCA 3LW5H 2N1TA 3MGNA 4PD4E 4WY4D 4Z1MH 1HF9A 1PGQA 1T6AA 3HTKA 3RK3C 3M9BA 1ZXGA 2HFED 3FWLA 3L74E 2ZYDA 4CPGA 4WY4A 1SQPG 3VMAA 1G1IA 1ZV8A 1ZW0A 2KNCA 3N4XA 4R4MA 5GTHE 3CCMP 2OYIC 1BCCE 2E74B 5KAFE 3L72G 1N7SC 1JCDA 2JP3A 4LC1A 2A45G 2B87B 2WSCH 4H0LD 4HJGH 2A06E 2HG5D 5KLIC 3IAOA 1E5WA 2BASA 2D2CB 3CL3D 3L74D 1VQ4P 1J1DB 1JB0J 2FV4A 4GDOA 1PPJE 4AQRD 2K1AA 2Y0CA 1YYCA 3S4RA 2FFDA 1VF5D 2R5DA 4OGQD 1IZNB 1PGJA 1SQBK 3M06A 3HUSB 4K35A 3CCVP 2NPSB 1QAKA 1SQBJ 1KZUB 2IBZG 4EOTA 1U57A 2BEQD 3GLMA 3H1IG 5CMZA 2N9BA 3D6YA 3TDKA 4Y99C 3HRNA 1LT9B 5KAFH 2QIWA 1N73A 2E74D 1BE3D 3NFQA 3B71A 3BRVB 1FU1A 4RKUJ 3EFFK 1JTHB 1SQPE 1L4AC 1J1EB 1DD3A 1X8YA 1P84H 1QX8A 5B5EH 1G1JA 2WPRA 3F89A 2BCCE 4PD4H 1EC5A 1GZLA 3KHUA 4PJ0E 3G6EP 1LTSC 2Y9YA 3C9IA 2OTKE 2YXQB 3MP7B 3SWYA 1EDLA 3H1LE 2XV5A 1JOCA 3NXSA 3TSIA 1M1JB 1OFCX 2XKMA 3AE2C 3VYIA 2ZFCA 1JRQA 1LVNA 2WSFJ 3PTZA 1Q90D 4B86A 2FYUE 1NU1K 1OWAA 3A0BE 3M0DC 1FZCB 3A0HH 1GU5A 2I1KA 3A3YB 1FDOA 2QM8A 1HVVA 1KTMA 2XNDH 3BRTB 3CMEP 4RO0A 1AVOA 2WVRA 2WT7B 2PRRA 3T97A 2E42A 3USSA 2C9LY 1QL2A 4KJMA 1RE3C 3L71G 1MV8A 2GUVA 2FYUK 2SPZA 4U3FE 2H43A 1JM0A 2JWAA 2RH0A 2YKPA 1Q7YQ 2QJYB 1JMMA 3L73E 3Q5RA 3CC7P 1KFNA 1KILD 3TF5A 3P8MC 2M8RA 2G8YA 3KQGA 4IL6H 2ZYGA 4H44D 2E75C 5AVTB 3H1LD 1J2JB 1ZN5A 1VDFA 5APUA 3RBXA 1NTMK 1RF1B 1NU1G 1EDJA 1FOSF 3S1KA 1HJBA 3L74J 1QVFO 3AE8C 1JY3N 4JBZA 1AFOA 3B4SA 3CCRP 4ZNCA 5KLVJ 1T2KD 1LT1A 1SQPD 2KSEA 1NGMB 4XA4A 3L36A 1DD4A 5T6JB 1M8OB 1RE3A 2Z4EA 5KKZB 1S9KE 3CWBG 4BRYB 3HD7D 3KZIE 1OVUA 3L72D 5AW6B 3V2NA 1ZRTD 4U3FJ 3I55P 4H13C 2IX7C 2BCCG 2NPSA 2KSJA 2Q1KA 2FY8A 1KYOI 2CK3H 2JEEA 3CI9A 4I2LC 1G2CB 1ZP0C 1KN7A 1IK9A 2FYUJ 2K9YA
chains in the Genus database with same CATH topology
5KJ7C 5KTBA 5AVWB 3B5NC 5APSA 2YO2A 2GM4A 3LIEA 5AW7B 2XDJA 1GL2C 1CZQA 2JJLA 4JYCA 3II6A 3HTKB 2W6AA 2KYVA 1QL1A 1RE4A 4LLHA 1DEBA 2WITA 3K1LA 1JY3P 2FXMA 2I1JA 1SFCB 3UIAA 1JTHA 2E43A 2KP8A 3P8CD 1SQVK 2PP6A 1HWTC 5AVZB 1LTTC 1J1DC 3HUSA 2W27A 3HUSC 4HYTB 2P2UA 3MD0A 1XTCC 3KDPB 5AW3B 2WTYA 3KPEA 5BU8B 1JO5A 1L0NK 1IO4A 1X9VA 3BATA 3M91A 1FZFA 2C0WA 3VTPC 2YKOA 1HTLC 2FFDC 3TYYA 2CPSA 2N1TB 1GW3A 1LTAC 3H32B 2XZRA 1RE4C 1CW5A 3N7NA 2HPCA 1IJDB 3RK3B 3RK2D 1HGZA 2C0XA 5APYA 5AW0B 4WY4C 3RK2C 1GL2A 3GHGB 1LTBC 1NKZB 1GK4A 3OJAB 5KJ7A 1L0LK 2R5BA 3HD7C 1GL2D 2CPBA 3M9QA 4IFFA 2OYHA 3G3ZA 4DZOA 3HE5A 1T2KC 3VOPA 1A02J 3R2PA 3B5ND 4EIJA 3VMXA 1MUUA 3B8EB 5CJ0A 3V2PA 1RF1C 2IPPA 3RL0B 3A5TA 5AVXB 1NAFA 2PAJA 1KILC 3VMYA 4AYCA 4C46A 1SLQA 1T3UA 4IFMA 3VP9A 5CCGD 1YTZT 1RF0A 2WSEH 2P67A 5CCGA 1URQB 4AUWA 3GHGA 1HGVA 4C7NA 1GD2E 4JYBA 3V5BA 2OYIB 1X79B 1JNMA 2P1JA 1MZ9A 3VN0A 1N2DC 1EQ7A 3P32A 1IFMA 1T8ZA 1LTJB 1Z56A 3A2AA 1N73C 1IFJA 2YNYA 1LWUC 2WWWA 4WB4A 1L4AB 1L4AD 1J1EC 3P7KA 1IFIA 1CI6B 1SQXK 1LWUA 4GKGA 1FZGA 5AW1B 3HE4A 2YO3A 4KHXA 1IFNA 1M1JC 1SFCD 3V2QA 1NO4A 3NMDA 3RK3D 1WT6A 2H7HA 1SFCA 1N7SA 2IFNA 5TCSD 2HLOA 2J58A 2XU6A 3CLQA 2A45H 3MUDA 1LT9C 1N7SD 2HYNA 1NTKK 2Z5IA 1FZEA 5APXA 1LTGC 2R32A 1GW4A 3MTUE 5AW8B 3IR9A 2QM7A 5KJ7D 4XE5B 2O1JA 4W7YA 2HODA 3SWFA 2ZXEB 1M7LA 1SVFA 2KLVA 1MFZA 1URQD 1YTZI 1G2CA 3EFGA 2O1KA 2WZ7A 1VPCA 1KILA 1LGHB 2YMYA 2MJZA 1ZR4A 3B5NA 3VP8A 4GEQA 3MIWA 5AVYB 3RL0D 3V4WA 1SQQK 2NPSC 4DOJA 1KILB 2OARA 2FTXA 5CCHC 2OYHC 3L35A 4Y99B 5AVSB 4LGDE 1NHLA 2Q5UA 4GT1A 2W6BA 3VMZA 1OXZA 2KOGA 3M0AA 3V2RA 3PP5A 5AW5B 1H8AA 3U1CA 4IFDK 4W80A 3O8ZA 1FAVA 5AVUB 3KYQA 2YKQA 2Z5HA 4I6MC 2IFMA 2M3BA 5APQA 5AW9B 1JY2N 4ZKUA 1N7SB 4O9BA 3P8CE 1DH3A 5AVQB 2L5GB 1NWQA 2POHA 2FKWB 3B5NB 1LTJC 1ZLLA 5BVZA 5KLVK 2NPSD 1N73B 3RL0C 1RF1A 5AVRB 1LWUB 3BVHA 1CI6A 4M3LA 3H6PA 3EQ2A 1HH0A 1JY2P 2C9NY 1FZBA 2FFDB 1L4AA 1XTGB 2N1TC 1GDTA 2HODB 2WT7A 2Q7CA 4HH2A 1GTWA 1H89A 1KQLA 2O01H 1FZCA 4RESB 1FJKA 1N7LA 4I1LA 3I5CA 1GU4A 1M1JA 3L37A 1FJPA 3M9HA 1RY3A 3OAKA 1FZCC 4ZKPA 2N1TD 2OYIA 1NH4A 1JUNA 5AW2B 3U59A 1URQA 2GUSA 5APVA 2H8PD 2R3CA 3HE4B 1LT9A 1T3JA 3TK1A 5BU5A 1CSBA 1ZR2A 1SFCC 1A02F 2J59M 1PFIA 2VRSA 1HUCA 3OA7A 1FBMA 3BASA 4N6JA 5APWA 2KB7P 5AVVB 3HD7B 1HBWA 3A7OA 1LTJA 3E1IA 2LKMA 3U1AA 4WY4B 4OH8B 5CJ4A 3VZAA 1JY3O 5AW4B 1FZAA 3NTNA 3TNUA 2WPQA 1RF0C 1LTIC 1W2EA 1GL2B 3WMM0 1AQ5A 4C7NB 1JY2O 1IC2A 2P7JA 1NKNA 5CCHD 2HPCB 4N78D 3TNUB 1SQPK 5CCHA 4WBAA 5APTA 1H88A 1N86A 1GK6A 2A45I 3RK2B 3GHGC 1FDMA 5CCGC 1SP4A 3HD7A 2WSFH 2Q3IA 3IFMA 1URQC 1NOHA 2FYZA 4W7ZA 3V4QA 2XNXA 3HE5B 5CHXA 4N78E 4GIFA 2OYHB 3L4FA 4N3YB 1S9KD 3LIDA 4C7RA 1NTZK 1WRGA 2WPSA 2Q9IA 4JF7A 1DX7A 1IFDA 3M0DA 1KFMA 3H32A 1JCCA 3LW5H 2N1TA 3MGNA 4WY4D 3HTKA 3RK3C 3M9BA 2HFED 4WY4A 1G1IA 1ZV8A 2OYIC 3N4XA 1N7SC 1JCDA 4LC1A 2A45G 2WSCH 5T6JB 2HG5D 1E5WA 2BASA 3CL3D 2FV4A 1J1DB 4AQRD 1FOSE 1YYCA 2FFDA 2R5DA 3M06A 1SQBK 3HUSB 2NPSB 1KZUB 4EOTA 5CMZA 2N9BA 4Y99C 3HRNA 1LT9B 1N73A 3NFQA 3BRVB 1FU1A 1JTHB 1L4AC 1J1EB 1X8YA 1G1JA 2WPRA 1GZLA 1LTSC 3C9IA 3SWYA 2XV5A 1JOCA 3NXSA 3TSIA 1M1JB 2XKMA 3VYIA 2ZFCA 4B86A 1NU1K 1OWAA 3M0DC 1FZCB 1GU5A 2I1KA 3A3YB 2QM8A 1HVVA 3BRTB 2WT7B 3T97A 2E42A 2C9LY 1QL2A 1RE3C 1MV8A 2GUVA 2FYUK 2H43A 2YKPA 1JMMA 1KFNA 1KILD 3P8MC 2M8RA 3KQGA 5AVTB 1J2JB 1ZN5A 1VDFA 5APUA 1NTMK 1RF1B 1FOSF 1HJBA 1JY3N 1AFOA 1T2KD 4XA4A 3L36A 1RE3A 2Z4EA 3VZ9B 1S9KE 3HD7D 5AW6B 3V2NA 2IX7C 2NPSA 2KSJA 3CI9A 2JEEA 4I2LC 1G2CB 1IK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3I A;  1JNM A;  5AVW B;  5APS A;  2YO2 A;  3V4Q A;  5AVQ B;  1DH3 A;  3VN0 A;  1NWQ A;  3HE5 B;  3LIE A;  5AW7 B;  3P32 A;  1CZQ A;  2JJL A;  4JYC A;  1S9K D;  5AVR B;  2W6A A;  1CI6 A;  4M3L A;  3LID A;  2C9N Y;  3A2A A;  2YNY A;  2WWW A;  2WPS A;  3M0D A;  3P7K A;  3UIA A;  2E43 A;  2KP8 A;  3MGN A;  2WT7 A;  1CI6 B;  3HTK A;  4GKG A;  2Q7C A;  1GTW A;  3M9B A;  5AW1 B;  1KQL A;  1H89 A;  1HWT C;  4RES B;  3HE4 A;  2YO3 A;  4KHX A;  5AVZ B;  3I5C A;  1GU4 A;  3NMD A;  2H7H A;  3L37 A;  4LC1 A;  3M9H A;  2W27 A;  3OAK A;  4HYT B;  2P2U A;  2BAS A;  3MD0 A;  3KDP B;  2XU6 A;  5AW3 B;  2WTY A;  4AQR D;  1FOS E;  1YYC A;  1JUN A;  2R5D A;  1IO4 A;  3M06 A;  5AW2 B;  2Z5I A;  4EOT A;  3M91 A;  5CMZ A;  5APV A;  2N9B A;  3VTP C;  5APX A;  2R3C A;  2R32 A;  3HE4 B;  5AW8 B;  3TK1 A;  3NFQ A;  3IR9 A;  2QM7 A;  1CSB A;  3TYY A;  4XE5 B;  3SWF A;  2XZR A;  1A02 F;  1X8Y A;  2VRS A;  1HUC A;  2ZXE B;  2WPR A;  1GZL A;  5APW A;  1MFZ A;  5APY A;  5AW0 B;  5AVV B;  2XV5 A;  1HBW A;  3A7O A;  3NXS A;  3VYI A;  1GK4 A;  2ZFC A;  4B86 A;  2R5B A;  1OWA A;  1GU5 A;  3A3Y B;  2QM8 A;  3NTN A;  5AW4 B;  4DZO A;  3HE5 A;  2WT7 B;  1T2K C;  3T97 A;  2E42 A;  2C9L Y;  1A02 J;  3TNU A;  2WPQ A;  5AVY B;  1MV8 A;  3V4W A;  3VMX A;  1MUU A;  3B8E B;  3L35 A;  3P8M C;  5AVS B;  2IPP A;  3KQG A;  4C7N B;  3A5T A;  4GT1 A;  2Q5U A;  1NAF A;  5AVX B;  3VMY A;  5AVT B;  2P7J A;  4AYC A;  4C46 A;  3VMZ A;  1J2J B;  1OXZ A;  5APU A;  1SLQ A;  1FOS F;  3M0A A;  3TNU B;  1HJB A;  5AW5 B;  5APT A;  1H88 A;  1H8A A;  1T2K D;  1GK6 A;  3L36 A;  3O8Z A;  1FAV A;  2P67 A;  5AVU B;  1S9K E;  5AW6 B;  2Z5H A;  4AUW A;  4I6M C;  4C7N A;  1SP4 A;  4I2L C;  1GD2 E;  4JYB A;  1G2C B;  3V5B A;  5APQ A;  5AW9 B; 
#chains in the Genus database with same CATH topology
 4H44 B;  3CWB J;  1PGP A;  5KJ7 C;  5KTB A;  5AVW B;  3B5N C;  5APS A;  3CXH D;  4JPZ B;  2AXT E;  2YO2 A;  2GM4 A;  1RQV A;  3GF3 A;  3H1I D;  2K37 A;  3G4S P;  2QA4 P;  3LIE A;  5AW7 B;  2WOF A;  2XDJ A;  2KS1 B;  1GL2 C;  3H1L J;  1CZQ A;  2JJL A;  1L2P A;  2JKV A;  3D71 A;  2E76 C;  4JYC A;  3AEA C;  2OYO A;  3II6 A;  1NTM D;  4PV1 C;  3TGU J;  3HTK B;  2W6A A;  3BCC J;  1K8A Q;  3FXD A;  2KYV A;  2WSS H;  4D6T J;  2QJK C;  4NPE A;  1YQ4 C;  1QL1 A;  3QWO C;  2QRX A;  1S5L H;  1RE4 A;  1W2B O;  4LLH A;  1DEB A;  2WIT A;  2ZVN B;  3K1L A;  1JY3 P;  2FXM A;  1BGY D;  2RMZ A;  4ZMD A;  2W6J H;  1FS0 E;  2I1J A;  3JC2 2;  1SFC B;  1H0T A;  3UIA A;  1FE6 A;  1JTH A;  2E43 A;  2KP8 A;  4KT0 J;  1YIT P;  3P8C D;  2OGU A;  1SQV K;  1QGK B;  1PPJ D;  3SWK A;  1SQQ E;  1K04 A;  2PP6 A;  1TU3 F;  1HWT C;  4U3F D;  3WUV A;  3CC4 P;  5KLV E;  3D6Z A;  3CCU P;  5AVZ B;  1LTT C;  3CC2 P;  1J1D C;  1BCC J;  3L71 D;  3L70 E;  4OVN F;  2JDI H;  3HUS A;  2KLU A;  1S4X A;  2LR2 A;  1MKM A;  2W27 A;  3A0H E;  3PLN A;  3HUS C;  4HYT B;  2P2U A;  3MD0 A;  3Q2Y A;  1XTC C;  3KDP B;  5L8R J;  1NTK D;  1RQU A;  3KPE A;  5AW3 B;  1QLE D;  1L0N K;  3FWN A;  3IN6 A;  5BU8 B;  2WTY A;  3CCQ P;  1IO4 A;  1JO5 A;  1X9V A;  3BAT A;  4HB1 A;  4OGQ C;  1K73 Q;  2AXC A;  1DYU A;  4H0L B;  3M91 A;  4GOE A;  1FZF A;  2P58 A;  2C0W A;  3H1J J;  3VTP C;  2YKO A;  1AVY A;  1HTL C;  1SQX D;  4PJ0 H;  2E76 D;  2GA1 A;  1L0N E;  2FFD C;  1P84 E;  1SQB G;  3AED C;  3TYY A;  1KQF B;  2WO0 A;  2CPS A;  2N1T B;  3SFE C;  1GW3 A;  2JR8 A;  1LTA C;  2YMK A;  2XZR A;  1RE4 C;  3H32 B;  1VQK P;  2IZ0 A;  1ZOY C;  1OW6 A;  3N7N A;  1M1K Q;  1CW5 A;  3ZDM A;  2HPC A;  1IJD B;  3RK3 B;  1SQV G;  3RK2 D;  1HGZ A;  2C0X A;  3GW6 A;  2BCC J;  5APY A;  5AW0 B;  1YIJ P;  4WY4 C;  3L75 E;  1S2E A;  3RK2 C;  3GF7 A;  1GL2 A;  3GHG B;  4Y28 J;  4PV1 D;  1LTB C;  1NKZ B;  1GK4 A;  3OJA B;  4H13 D;  1NTZ E;  5KJ7 A;  1FOS E;  1N8R Q;  1L0L K;  2R5B A;  3HD7 C;  1GL2 D;  3S9O A;  2CPB A;  2FXO A;  1OW7 A;  2ITA A;  3M9Q A;  4IFF A;  2OYH A;  4UB6 E;  2NZ2 A;  3G3Z A;  1QEX A;  4DZO A;  1BE3 G;  3HE5 A;  3MHV A;  1T2K C;  1BE3 J;  3VOP A;  1DIP A;  1A02 J;  3R2P A;  3ITK A;  3H1J D;  2KZJ A;  1L0L E;  2Q3E A;  3B5N D;  4EIJ A;  3VMX A;  1MUU A;  3B8E B;  1SS1 A;  1OMI A;  2K9J A;  4NPD A;  5CJ0 A;  3H1K E;  3V2P A;  4YXW H;  1RF1 C;  2YIU B;  1PP9 D;  2QVA A;  2IPP A;  1AJY A;  3AEC C;  1VL2 A;  1NTK J;  3RL0 B;  1EDI A;  2JO1 A;  5AVX B;  1NAF A;  2PAJ A;  1KIL C;  4YTP C;  3L70 J;  3VMY A;  4AYC A;  2B89 A;  4C46 A;  1VQN P;  1KB9 E;  2V7Q J;  1SLQ A;  1T3U A;  1EZV E;  3IF4 A;  2LXB A;  4IFM A;  3PHL A;  3E1R A;  1R5L A;  1RH5 B;  3VP9 A;  3AE5 C;  5CCG D;  1YTZ T;  2K3R A;  1RF0 A;  3RBZ A;  3H25 A;  2IYP A;  2WSE H;  2P67 A;  4I7Z B;  3MZW B;  2QE7 H;  2OTJ P;  5CCG A;  2E75 D;  2ZT9 B;  3L73 G;  4H44 C;  4EDF A;  1VQ7 P;  1URQ B;  5B66 E;  1OX3 A;  4AUW A;  2PFX A;  3GHG A;  1HGV A;  1USE A;  3O6Q A;  4C7N A;  1GD2 E;  5C39 A;  4JYB A;  4D6T D;  3TGU D;  3QH9 A;  3O6Q B;  4GOF A;  3V5B A;  2OYI B;  1NTK G;  3AEF C;  1X79 B;  1JNM A;  1PIX A;  2E5Y A;  3H1H E;  2M5A A;  1NTM J;  5H2F E;  4DT0 A;  2P1J A;  2I8D A;  1MZ9 A;  5KLI B;  3VN0 A;  1M57 D;  2R44 A;  2W83 C;  1PL5 A;  3TGU E;  1KD1 Q;  1SPU A;  1KYO H;  1N2D C;  2Y9Z A;  1EQ7 A;  1L0L G;  2QJP C;  3P32 A;  3Q5S A;  3RK3 E;  4DJG A;  1IFM A;  1T8Z A;  3JCU E;  1UIX A;  3LW5 J;  2Y0E A;  1K9M Q;  3VZ9 B;  5DJT B;  3CWB D;  1LTJ B;  1S5L E;  3OW2 O;  1Z56 A;  3CX5 H;  4JQ0 D;  3A2A A;  1N73 C;  4U7J A;  1IFJ A;  1IFP A;  2YNY A;  3GG2 A;  1VF5 C;  1LWU C;  2ZJS E;  2M3E A;  2Q6Q A;  2WWW A;  1D6Z A;  3G9R A;  1KOR A;  1SQB E;  4WB4 A;  1L4A B;  1L4A D;  1J1E C;  4UB8 E;  3P7K A;  1U7M A;  1FDI A;  1IFI A;  3AE6 C;  5E79 H;  1M56 D;  3H1I E;  1SQV E;  1CI6 B;  4A7P A;  1SQX K;  1LWU A;  2E74 C;  3C1L A;  4GKG A;  2AXT H;  1FZG A;  1E79 H;  1BSN A;  5AW1 B;  1VQP P;  1Q2N A;  5GTI E;  3HE4 A;  3CCL P;  2YO3 A;  4KHX A;  1IFN A;  1M1J C;  1SFC D;  3V2Q A;  1YQ3 C;  1NO4 A;  3NMD A;  1USD A;  1WT6 A;  3H1J G;  3RK3 D;  4DCK A;  1L0N G;  1VQM P;  3CCS P;  2H7H A;  2NRG A;  1SFC A;  1H0T B;  1RHZ B;  2O3J A;  1N7S A;  1OZH A;  2AEF A;  3KZI H;  1SQQ J;  1Y9B A;  1BCC G;  2IFN A;  2R3S A;  3L73 J;  2OTL P;  2HLO A;  2J58 A;  2XU6 A;  3CLQ A;  2A45 H;  3MUD A;  5KAI E;  5TCS D;  3K5B A;  1LT9 C;  1N7S D;  5KAI H;  3A5T A;  2E76 B;  2FYU G;  2HYN A;  3H1K J;  1NTK K;  1LP1 B;  1VQ6 P;  2Z5I A;  1FZE A;  4ASW A;  1SQV J;  5CBO A;  5K5G B;  4RJT A;  5APX A;  1LTG C;  2R32 A;  1GW4 A;  3MTU E;  5AW8 B;  4PD4 I;  3IR9 A;  2KS1 A;  1LNQ A;  2QM7 A;  3L70 G;  5KJ7 D;  4XE5 B;  1P84 I;  2O1J A;  3AEB C;  4W7Y A;  2FYN B;  2HOD A;  5GTI H;  3SWF A;  1NAY A;  3L73 D;  4TT3 H;  1PP9 J;  2ZXE B;  1SQQ G;  1BDC A;  1M7L A;  5E79 E;  1U7J A;  1SVF A;  2RN0 A;  1EZV D;  2KLV A;  1MFZ A;  1URQ D;  3PH0 A;  1Y8A A;  1G2C A;  1YTZ I;  2ZT9 D;  3ABV C;  3EFG A;  2O1K A;  3GMA A;  2WZ7 A;  3CCJ P;  4K3A A;  1SQX J;  3F5H A;  1VPC A;  1KIL A;  1PP9 E;  1NTZ D;  2QEX P;  1LGH B;  2YMY A;  3CX5 E;  2MJZ A;  3KXD A;  1ZR4 A;  2IYO A;  3AE4 C;  3RL0 g;  1L0L D;  3B5N A;  4L73 A;  1SQX G;  2H88 C;  1UII A;  2WSC J;  3JCU H;  3V6I A;  1SQB D;  3VP8 A;  1VQ5 P;  1KQS O;  2WOH A;  4WWI A;  4GEQ A;  2V7Q H;  3MIW A;  5AVY B;  3RL0 D;  3V4W A;  1SQQ K;  1X0T A;  2NPS C;  4DOJ A;  1KIL B;  1PV3 A;  2OAR A;  1VQ9 P;  5B5E E;  2FTX A;  5CCH C;  2OYH C;  3L35 A;  4L75 A;  1K05 A;  2OQQ A;  4Y99 B;  2HR3 A;  1PGO A;  5AVS B;  1SQV D;  4LGD E;  5H2F H;  2WSE J;  1NHL A;  1P84 D;  2Q5U A;  4GT1 A;  2QSI A;  2W6B A;  3VMZ A;  2WQY C;  1KB9 D;  1OXZ A;  2J5U A;  2KOG A;  4UB6 H;  3M0A A;  3V2R A;  1KQG B;  3PP5 A;  5AW5 B;  3T97 B;  1H8A A;  1KMI Z;  3U1C A;  2P10 A;  4H13 B;  1JMB A;  4W80 A;  4IFD K;  3FX0 A;  3H1K D;  3O8Z A;  1FAV A;  2ZYA A;  1AV1 A;  5AVU B;  5M1B A;  3KYQ A;  3AE7 C;  1L0N D;  2YKQ A;  2Z5H A;  1NJI Q;  3H1I J;  1LP1 A;  2BEZ F;  1S5L X;  4I6M C;  1EXJ A;  3AE1 C;  2IFM A;  4YPC A;  1KB9 H;  2B9B A;  3BCC D;  3SSU A;  3WUU A;  2M3B A;  1PP9 G;  5APQ A;  1JY2 N;  5AW9 B;  4ZKU A;  5GTH H;  3CCE P;  1PZQ A;  1VQ8 P;  2FYU D;  3H1H D;  1N7S B;  4BRY A;  4BXL A;  4O9B A;  3P8C E;  1DH3 A;  1DEE G;  5AVQ B;  3SFD C;  2L5G B;  1NWQ A;  3L75 D;  2POH A;  3BCC E;  3D70 A;  2FKW B;  3B5N B;  2QJY C;  1LTJ C;  1EXI A;  1ZLL A;  5BVZ A;  5KLV K;  2NPS D;  3L70 D;  1N73 B;  3L71 E;  3RL0 C;  4YXD C;  1RF1 A;  1JEK A;  5AVR B;  1LWU B;  3AEG C;  3BVH A;  1CI6 A;  4H0L C;  4M3L A;  1YI2 P;  1HJ0 A;  3CWB E;  3H6P A;  3EQ2 A;  1HH0 A;  1JY2 P;  2C9N Y;  2W0Q A;  1FZB A;  3L74 G;  2FFD B;  1L4A A;  1NVO A;  3H1H J;  2DW3 A;  3H1J E;  1XTG B;  3PJS K;  3TGU G;  1L0N J;  2N1T C;  1GDT A;  2B87 A;  4L74 A;  5TJH A;  1AA0 A;  1NTZ G;  2HOD B;  2LXC B;  2L91 A;  1EDK A;  2ZT9 C;  3E7K A;  3MUD C;  4R4L A;  2Q7C A;  2WT7 A;  1Q82 Q;  4HH2 A;  1GTW A;  1KIL E;  2KNC B;  1H89 A;  1KQL A;  2O01 H;  1FZC A;  4RES B;  3CD6 P;  2PGD A;  1OW8 A;  3I56 P;  2H89 C;  1FJK A;  1N7L A;  2ZVO B;  4I1L A;  1R8E A;  3I5C A;  4BWN A;  4IL6 X;  1Q81 Q;  1KB9 I;  4L76 A;  4EYY Q;  1M1J A;  4XFJ A;  1GU4 A;  3L37 A;  1EZV I;  2KXP B;  2WGQ A;  1FJP A;  1D6U A;  3M9H A;  1RY3 A;  3OAK A;  1ZRT E;  1FZC C;  3Q1M A;  2UWJ E;  1IK7 A;  3AE3 C;  4ZKP A;  2V4H A;  2N1T D;  1FC2 C;  3CX5 D;  3WU2 H;  2KK7 A;  3PRJ A;  2O01 J;  2OYI A;  1QAL A;  1NH4 A;  3JSV C;  1JUN A;  1KV4 A;  3CXH H;  5TIS H;  1Y47 A;  5AW2 B;  2QG4 A;  1VQO P;  4PD4 D;  3U59 A;  2D2C C;  3AEE C;  1URQ A;  2W90 A;  1YJW P;  4ASV A;  1L0L J;  1OIP A;  2FYN C;  2GUS A;  2QJK B;  5APV A;  3WUT A;  2H8P D;  1BGY E;  2R3C A;  1NU1 J;  1LT9 A;  1T3J A;  3FGA D;  2B88 A;  3HE4 B;  3TK1 A;  4OGQ B;  5BU5 A;  1CSB A;  2E75 B;  2FBW C;  5KLV G;  1ZR2 A;  1SFC C;  1A02 F;  4EI2 A;  2J59 M;  1PFI A;  2VRS A;  1HUC A;  2A06 D;  1NTZ J;  5EFW B;  1VQL P;  3OA7 A;  2WMM A;  1FBM A;  2G3A A;  1S1C X;  3BAS A;  1SQX E;  3FXE A;  3BCC G;  4OWF A;  4N6J A;  5APW A;  2IDB A;  2KB7 P;  1YJ9 P;  1M90 Q;  4IOI H;  1BCC D;  3L71 J;  3HD7 B;  5AVV B;  1S72 P;  4I7Z C;  1HBW A;  3A7O A;  1LTJ A;  3H1H G;  2K9J B;  3CXH I;  1NU1 D;  3E1I A;  2LKM A;  3U1A A;  1LJ2 A;  1GMJ A;  4WY4 B;  3L75 G;  4OH8 B;  1BDD A;  4MN4 C;  2AEM A;  5CJ4 A;  1NU1 E;  3CPW O;  3VZA A;  2K88 A;  1JY3 O;  5AW4 B;  1FZA A;  3NTN A;  1AQT A;  1Q86 Q;  1R5S A;  1X22 A;  2E5T A;  3TNU A;  1KYO D;  1BGY J;  2WPQ A;  4IL6 E;  1RF0 C;  2BCC D;  2M5A B;  1LTI C;  4QMA A;  1SQQ D;  1W2E A;  1GL2 B;  4D6T G;  3Q3D A;  1EZV G;  3WMM 0;  1AQ5 A;  1D7M A;  4C7N B;  2IBZ I;  2ZAE B;  1JY2 O;  2W8Z A;  2Y0D A;  2WPV B;  4PV1 B;  1IC2 A;  2P7J A;  1NKN A;  1NYH A;  4UB8 H;  2KI7 B;  4WVZ A;  5CCH D;  2HPC B;  4N78 D;  4NPF X;  2IBZ D;  1D6Y A;  3TNU B;  1SQP K;  5CCH A;  3A0B H;  3AE9 C;  4WBA A;  5APT A;  3W67 A;  1YJN P;  4HKZ H;  1H88 A;  3CXH E;  5TIS E;  1NTK E;  1N86 A;  1GK6 A;  2A45 I;  1NTM G;  3RK2 B;  3WU2 E;  2O01 N;  3G71 P;  3EWK A;  3GHG C;  2KIK A;  1W5C E;  1BE3 E;  4TLF A;  1YBK A;  1ZME C;  1FDM A;  1KYO E;  5CCG C;  1SP4 A;  3Q5P A;  5CBN A;  1BGY G;  2IZ1 A;  2WSF H;  3HD7 A;  2ZXX A;  5KKZ C;  2Q3I A;  3IFM A;  1OVR A;  1URQ C;  2YXR B;  1NOH A;  3CMA P;  2KZI A;  2FYZ A;  1OAC A;  2AEJ A;  2QJP B;  4W7Z A;  3L75 J;  3V4Q A;  4D6T E;  1QAF A;  1PPJ G;  2MKV A;  2XNX A;  2JWD A;  2D2C D;  3HE5 B;  3RGU A;  2IBZ E;  5CHX A;  4N78 E;  2RKL A;  3L72 J;  4U3F G;  4GIF A;  5B66 H;  2N9Y B;  2YIU C;  3L4F A;  2OYH B;  1BSH A;  4N3Y B;  1KC8 Q;  2KUB A;  1WMK A;  5DJU B;  1S9K D;  1SQP J;  1VF5 B;  3H1K G;  3L72 E;  5KLV D;  2M0B A;  4GOD A;  2FXP A;  1OVV A;  3CX5 I;  2A06 G;  3LID A;  3R4Y A;  1S3J A;  1NTM E;  4C7R A;  1NTZ K;  1WRG A;  3W68 A;  1YHQ P;  3C8V A;  1MFT A;  2WPS A;  1QVG O;  2Q9I A;  4JF7 A;  1DX7 A;  1IFD A;  3M0D A;  3H1L G;  1KFM A;  3H32 A;  1JCC A;  3LW5 H;  2N1T A;  3MGN A;  4PD4 E;  4WY4 D;  4Z1M H;  1HF9 A;  1PGQ A;  1T6A A;  3HTK A;  3RK3 C;  3M9B A;  1ZXG A;  2HFE D;  3FWL A;  3L74 E;  2ZYD A;  4CPG A;  4WY4 A;  1SQP G;  3VMA A;  1G1I A;  1ZV8 A;  1ZW0 A;  2KNC A;  3N4X A;  4R4M A;  5GTH E;  3CCM P;  2OYI C;  1BCC E;  2E74 B;  5KAF E;  3L72 G;  1N7S C;  1JCD A;  2JP3 A;  4LC1 A;  2A45 G;  2B87 B;  2WSC H;  4H0L D;  4HJG H;  2A06 E;  2HG5 D;  5KLI C;  3IAO A;  1E5W A;  2BAS A;  2D2C B;  3CL3 D;  3L74 D;  1VQ4 P;  1J1D B;  1JB0 J;  2FV4 A;  4GDO A;  1PPJ E;  4AQR D;  2K1A A;  2Y0C A;  1YYC A;  3S4R A;  2FFD A;  1VF5 D;  2R5D A;  4OGQ D;  1IZN B;  1PGJ A;  1SQB K;  3M06 A;  3HUS B;  4K35 A;  3CCV P;  2NPS B;  1QAK A;  1SQB J;  1KZU B;  2IBZ G;  4EOT A;  1U57 A;  2BEQ D;  3GLM A;  3H1I G;  5CMZ A;  2N9B A;  3D6Y A;  3TDK A;  4Y99 C;  3HRN A;  1LT9 B;  5KAF H;  2QIW A;  1N73 A;  2E74 D;  1BE3 D;  3NFQ A;  3B71 A;  3BRV B;  1FU1 A;  4RKU J;  3EFF K;  1JTH B;  1SQP E;  1L4A C;  1J1E B;  1DD3 A;  1X8Y A;  1P84 H;  1QX8 A;  5B5E H;  1G1J A;  2WPR A;  3F89 A;  2BCC E;  4PD4 H;  1EC5 A;  1GZL A;  3KHU A;  4PJ0 E;  3G6E P;  1LTS C;  2Y9Y A;  3C9I A;  2OTK E;  2YXQ B;  3MP7 B;  3SWY A;  1EDL A;  3H1L E;  2XV5 A;  1JOC A;  3NXS A;  3TSI A;  1M1J B;  1OFC X;  2XKM A;  3AE2 C;  3VYI A;  2ZFC A;  1JRQ A;  1LVN A;  2WSF J;  3PTZ A;  1Q90 D;  4B86 A;  2FYU E;  1NU1 K;  1OWA A;  3A0B E;  3M0D C;  1FZC B;  3A0H H;  1GU5 A;  2I1K A;  3A3Y B;  1FDO A;  2QM8 A;  1HVV A;  1KTM A;  2XND H;  3BRT B;  3CME P;  4RO0 A;  1AVO A;  2WVR A;  2WT7 B;  2PRR A;  3T97 A;  2E42 A;  3USS A;  2C9L Y;  1QL2 A;  4KJM A;  1RE3 C;  3L71 G;  1MV8 A;  2GUV A;  2FYU K;  2SPZ A;  4U3F E;  2H43 A;  1JM0 A;  2JWA A;  2RH0 A;  2YKP A;  1Q7Y Q;  2QJY B;  1JMM A;  3L73 E;  3Q5R A;  3CC7 P;  1KFN A;  1KIL D;  3TF5 A;  3P8M C;  2M8R A;  2G8Y A;  3KQG A;  4IL6 H;  2ZYG A;  4H44 D;  2E75 C;  5AVT B;  3H1L D;  1J2J B;  1ZN5 A;  1VDF A;  5APU A;  3RBX A;  1NTM K;  1RF1 B;  1NU1 G;  1EDJ A;  1FOS F;  3S1K A;  1HJB A;  3L74 J;  1QVF O;  3AE8 C;  1JY3 N;  4JBZ A;  1AFO A;  3B4S A;  3CCR P;  4ZNC A;  5KLV J;  1T2K D;  1LT1 A;  1SQP D;  2KSE A;  1NGM B;  4XA4 A;  3L36 A;  1DD4 A;  5T6J B;  1M8O B;  1RE3 A;  2Z4E A;  5KKZ B;  1S9K E;  3CWB G;  4BRY B;  3HD7 D;  3KZI E;  1OVU A;  3L72 D;  5AW6 B;  3V2N A;  1ZRT D;  4U3F J;  3I55 P;  4H13 C;  2IX7 C;  2BCC G;  2NPS A;  2KSJ A;  2Q1K A;  2FY8 A;  1KYO I;  2CK3 H;  2JEE A;  3CI9 A;  4I2L C;  1G2C B;  1ZP0 C;  1KN7 A;  1IK9 A;  2FYU J;  2K9Y A; 
#chains in the Genus database with same CATH homology
 5KJ7 C;  5KTB A;  5AVW B;  3B5N C;  5APS A;  2YO2 A;  2GM4 A;  3LIE A;  5AW7 B;  2XDJ A;  1GL2 C;  1CZQ A;  2JJL A;  4JYC A;  3II6 A;  3HTK B;  2W6A A;  2KYV A;  1QL1 A;  1RE4 A;  4LLH A;  1DEB A;  2WIT A;  3K1L A;  1JY3 P;  2FXM A;  2I1J A;  1SFC B;  3UIA A;  1JTH A;  2E43 A;  2KP8 A;  3P8C D;  1SQV K;  2PP6 A;  1HWT C;  5AVZ B;  1LTT C;  1J1D C;  3HUS A;  2W27 A;  3HUS C;  4HYT B;  2P2U A;  3MD0 A;  1XTC C;  3KDP B;  5AW3 B;  2WTY A;  3KPE A;  5BU8 B;  1JO5 A;  1L0N K;  1IO4 A;  1X9V A;  3BAT A;  3M91 A;  1FZF A;  2C0W A;  3VTP C;  2YKO A;  1HTL C;  2FFD C;  3TYY A;  2CPS A;  2N1T B;  1GW3 A;  1LTA C;  3H32 B;  2XZR A;  1RE4 C;  1CW5 A;  3N7N A;  2HPC A;  1IJD B;  3RK3 B;  3RK2 D;  1HGZ A;  2C0X A;  5APY A;  5AW0 B;  4WY4 C;  3RK2 C;  1GL2 A;  3GHG B;  1LTB C;  1NKZ B;  1GK4 A;  3OJA B;  5KJ7 A;  1L0L K;  2R5B A;  3HD7 C;  1GL2 D;  2CPB A;  3M9Q A;  4IFF A;  2OYH A;  3G3Z A;  4DZO A;  3HE5 A;  1T2K C;  3VOP A;  1A02 J;  3R2P A;  3B5N D;  4EIJ A;  3VMX A;  1MUU A;  3B8E B;  5CJ0 A;  3V2P A;  1RF1 C;  2IPP A;  3RL0 B;  3A5T A;  5AVX B;  1NAF A;  2PAJ A;  1KIL C;  3VMY A;  4AYC A;  4C46 A;  1SLQ A;  1T3U A;  4IFM A;  3VP9 A;  5CCG D;  1YTZ T;  1RF0 A;  2WSE H;  2P67 A;  5CCG A;  1URQ B;  4AUW A;  3GHG A;  1HGV A;  4C7N A;  1GD2 E;  4JYB A;  3V5B A;  2OYI B;  1X79 B;  1JNM A;  2P1J A;  1MZ9 A;  3VN0 A;  1N2D C;  1EQ7 A;  3P32 A;  1IFM A;  1T8Z A;  1LTJ B;  1Z56 A;  3A2A A;  1N73 C;  1IFJ A;  2YNY A;  1LWU C;  2WWW A;  4WB4 A;  1L4A B;  1L4A D;  1J1E C;  3P7K A;  1IFI A;  1CI6 B;  1SQX K;  1LWU A;  4GKG A;  1FZG A;  5AW1 B;  3HE4 A;  2YO3 A;  4KHX A;  1IFN A;  1M1J C;  1SFC D;  3V2Q A;  1NO4 A;  3NMD A;  3RK3 D;  1WT6 A;  2H7H A;  1SFC A;  1N7S A;  2IFN A;  5TCS D;  2HLO A;  2J58 A;  2XU6 A;  3CLQ A;  2A45 H;  3MUD A;  1LT9 C;  1N7S D;  2HYN A;  1NTK K;  2Z5I A;  1FZE A;  5APX A;  1LTG C;  2R32 A;  1GW4 A;  3MTU E;  5AW8 B;  3IR9 A;  2QM7 A;  5KJ7 D;  4XE5 B;  2O1J A;  4W7Y A;  2HOD A;  3SWF A;  2ZXE B;  1M7L A;  1SVF A;  2KLV A;  1MFZ A;  1URQ D;  1YTZ I;  1G2C A;  3EFG A;  2O1K A;  2WZ7 A;  1VPC A;  1KIL A;  1LGH B;  2YMY A;  2MJZ A;  1ZR4 A;  3B5N A;  3VP8 A;  4GEQ A;  3MIW A;  5AVY B;  3RL0 D;  3V4W A;  1SQQ K;  2NPS C;  4DOJ A;  1KIL B;  2OAR A;  2FTX A;  5CCH C;  2OYH C;  3L35 A;  4Y99 B;  5AVS B;  4LGD E;  1NHL A;  2Q5U A;  4GT1 A;  2W6B A;  3VMZ A;  1OXZ A;  2KOG A;  3M0A A;  3V2R A;  3PP5 A;  5AW5 B;  1H8A A;  3U1C A;  4IFD K;  4W80 A;  3O8Z A;  1FAV A;  5AVU B;  3KYQ A;  2YKQ A;  2Z5H A;  4I6M C;  2IFM A;  2M3B A;  5APQ A;  5AW9 B;  1JY2 N;  4ZKU A;  1N7S B;  4O9B A;  3P8C E;  1DH3 A;  5AVQ B;  2L5G B;  1NWQ A;  2POH A;  2FKW B;  3B5N B;  1LTJ C;  1ZLL A;  5BVZ A;  5KLV K;  2NPS D;  1N73 B;  3RL0 C;  1RF1 A;  5AVR B;  1LWU B;  3BVH A;  1CI6 A;  4M3L A;  3H6P A;  3EQ2 A;  1HH0 A;  1JY2 P;  2C9N Y;  1FZB A;  2FFD B;  1L4A A;  1XTG B;  2N1T C;  1GDT A;  2HOD B;  2WT7 A;  2Q7C A;  4HH2 A;  1GTW A;  1H89 A;  1KQL A;  2O01 H;  1FZC A;  4RES B;  1FJK A;  1N7L A;  4I1L A;  3I5C A;  1GU4 A;  1M1J A;  3L37 A;  1FJP A;  3M9H A;  1RY3 A;  3OAK A;  1FZC C;  4ZKP A;  2N1T D;  2OYI A;  1NH4 A;  1JUN A;  5AW2 B;  3U59 A;  1URQ A;  2GUS A;  5APV A;  2H8P D;  2R3C A;  3HE4 B;  1LT9 A;  1T3J A;  3TK1 A;  5BU5 A;  1CSB A;  1ZR2 A;  1SFC C;  1A02 F;  2J59 M;  1PFI A;  2VRS A;  1HUC A;  3OA7 A;  1FBM A;  3BAS A;  4N6J A;  5APW A;  2KB7 P;  5AVV B;  3HD7 B;  1HBW A;  3A7O A;  1LTJ A;  3E1I A;  2LKM A;  3U1A A;  4WY4 B;  4OH8 B;  5CJ4 A;  3VZA A;  1JY3 O;  5AW4 B;  1FZA A;  3NTN A;  3TNU A;  2WPQ A;  1RF0 C;  1LTI C;  1W2E A;  1GL2 B;  3WMM 0;  1AQ5 A;  4C7N B;  1JY2 O;  1IC2 A;  2P7J A;  1NKN A;  5CCH D;  2HPC B;  4N78 D;  3TNU B;  1SQP K;  5CCH A;  4WBA A;  5APT A;  1H88 A;  1N86 A;  1GK6 A;  2A45 I;  3RK2 B;  3GHG C;  1FDM A;  5CCG C;  1SP4 A;  3HD7 A;  2WSF H;  2Q3I A;  3IFM A;  1URQ C;  1NOH A;  2FYZ A;  4W7Z A;  3V4Q A;  2XNX A;  3HE5 B;  5CHX A;  4N78 E;  4GIF A;  2OYH B;  3L4F A;  4N3Y B;  1S9K D;  3LID A;  4C7R A;  1NTZ K;  1WRG A;  2WPS A;  2Q9I A;  4JF7 A;  1DX7 A;  1IFD A;  3M0D A;  1KFM A;  3H32 A;  1JCC A;  3LW5 H;  2N1T A;  3MGN A;  4WY4 D;  3HTK A;  3RK3 C;  3M9B A;  2HFE D;  4WY4 A;  1G1I A;  1ZV8 A;  2OYI C;  3N4X A;  1N7S C;  1JCD A;  4LC1 A;  2A45 G;  2WSC H;  5T6J B;  2HG5 D;  1E5W A;  2BAS A;  3CL3 D;  2FV4 A;  1J1D B;  4AQR D;  1FOS E;  1YYC A;  2FFD A;  2R5D A;  3M06 A;  1SQB K;  3HUS B;  2NPS B;  1KZU B;  4EOT A;  5CMZ A;  2N9B A;  4Y99 C;  3HRN A;  1LT9 B;  1N73 A;  3NFQ A;  3BRV B;  1FU1 A;  1JTH B;  1L4A C;  1J1E B;  1X8Y A;  1G1J A;  2WPR A;  1GZL A;  1LTS C;  3C9I A;  3SWY A;  2XV5 A;  1JOC A;  3NXS A;  3TSI A;  1M1J B;  2XKM A;  3VYI A;  2ZFC A;  4B86 A;  1NU1 K;  1OWA A;  3M0D C;  1FZC B;  1GU5 A;  2I1K A;  3A3Y B;  2QM8 A;  1HVV A;  3BRT B;  2WT7 B;  3T97 A;  2E42 A;  2C9L Y;  1QL2 A;  1RE3 C;  1MV8 A;  2GUV A;  2FYU K;  2H43 A;  2YKP A;  1JMM A;  1KFN A;  1KIL D;  3P8M C;  2M8R A;  3KQG A;  5AVT B;  1J2J B;  1ZN5 A;  1VDF A;  5APU A;  1NTM K;  1RF1 B;  1FOS F;  1HJB A;  1JY3 N;  1AFO A;  1T2K D;  4XA4 A;  3L36 A;  1RE3 A;  2Z4E A;  3VZ9 B;  1S9K E;  3HD7 D;  5AW6 B;  3V2N A;  2IX7 C;  2NPS A;  2KSJ A;  3CI9 A;  2JEE A;  4I2L C;  1G2C B;  1IK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...