4E03A

Structure of parf-adp form 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
206
structure length
204
Chain Sequence
b'MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partitioning protein ParF
molecule tags Unknown function
source organism Escherichia coli
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
total genus 69
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e03A00
2Z0MA 1W0KD 1SKYB 1DG3A 4XSHA 3QSYA 1SZPA 5AJWA 5GADl 2PJRA 2ZETA 1OXVA 1N6OA 2XOKA 3ZVLA 1GKIA 1Z07A 5M04A 2ZRDA 2G0NA 1KI7A 1UKZA 2PX0A 3LX8A 4K8OA 1KJYA 2XZPA 1U0HC 3KUCA 2C98A 3MRSA 4IRUB 5C4MA 3CRW1 2P5SA 3BJIC 4ITRC 1NNEA 1U9IC 1JQJC 2PZEA 2DFKB 2IYLD 2PL3A 5KO2A 1G9XA 4IKEA 4KSBA 4Q00A 2ZIAA 3SHFA 5KOYA 3KQHA 1EFRD 4A36A 3FHCB 3KQUA 2VP9A 4N1AA 1SKQA 3RANA 4CEHB 3E5HA 3B9PA 1NG9A 3G5UA 2XGJA 2KBFA 1VHLA 2NO0A 1KJZA 1QHGA 4UNPA 1RRCA 4TYYA 2YWGA 2GJ9A 3KKNA 3WYGA 2W00A 3FE2A 1ZJ6A 5JJIA 2IEZA 2D2FA 1XTJA 2F1HA 2WKPA 2PEYA 4Q48A 4ZIRB 1E4VA 3BFXA 1N0UA 5D3MB 4X8OA 1UDXA 1TU4A 1RE0A 4MRVA 2HYIC 2GRJA 3IILA 3U3MA 2P2LA 3TRFA 2Q21A 1QF9A 1MO3A 3PUZA 3GJXC 3L8ZA 3QE0A 4I1OA 1B23P 2VRWA 3SJBA 4ILEA 3B60A 2FSIA 2QBYA 2CLDX 3CX7A 1NIPA 1WRBA 2YWFA 3CZPA 4BEJA 4XVUA 1DARA 3EARA 2OUKA 3VAAA 1G6OA 1AKYA 2IXFA 3DM5A 3PUXA 4AK9A 4PO8A 1VYTA 3BC1A 2J9RA 1KY2A 1C9KA 2G0TA 3UG7A 1Q22A 4MITA 5K8TA 3E1SA 4GI7A 5H70A 1D9XA 3KL4A 1XD9A 4A1FA 4B3BA 4PX9A 1FX0B 4FMCF 1T8TA 4TT3D 5FTJA 4LI0A 3CX6A 4RFVA 3ZZ0A 4LCBA 2J59A 1SXJC 1ZUHA 1FNNA 1II0A 2GKSA 2NPIA 1ZM3A 2ONJA 3VHXA 3RVBA 5EZ5A 1NG1A 3SNHA 1KI6B 4E09A 5CITA 2WHXA 1HA3A 1KY3A 4PPNA 3PFIA 4LZZA 1E0KA 2EFGA 4OBEA 5K8IA 4Q9HA 1CP2A 3W34A 1VYVA 1AS0A 1PLKA 2R2AA 4DWJA 4M9ZA 3K09A 1KI8A 4LHXA 1BKDR 2WSMA 4PHGA 4C0AC 1BS1A 3KDSE 4Q9KA 1IN5A 2CLSA 1HUQA 1LY1A 3RWOA 4D25A 2OBMA 2J0UA 3SS8A 1J7KA 1Z0DA 1EFTA 1UJ2A 2GK6A 2IWHA 3SHWA 3M1IA 4ACAA 1KO7A 3TR0A 1G17A 2O8EA 3FB4A 4NCHA 1GAJA 1YR8A 4FW9A 4G0NA 4L5BA 3L0SA 3R20A 1Q0UA 2ZRJA 1XJ0A 2J0SA 4GZLA 1E9FA 5HE9A 2ZS9A 3R7WB 2WJGA 4FWIB 3FKSA 2KBEA 1YZQA 1FUUA 1EGAA 1SVMA 2VPPA 4RVCA 1GL6A 1L2TA 2D74A 1Z22A 1KSJA 3QBTA 4KCGA 2O8FA 2C95A 3BH7A 3BE4A 3RSLA 2CK3D 5DHAA 1WMSA 2CCJA 2GAAA 2NG1A 2RGGA 3I32A 3LVRE 3L0IB 4CEJA 2NQ2C 1P9NA 3SYNA 2HDNB 3LRPA 1HEIA 1JECA 3IQWA 5GVRA 4K81B 4F92B 3I5XA 4XH9B 1II8A 3M4YA 2BMJA 1S2MA 1E2IA 2C78A 2Z4RA 3T5DA 1GUAA 4LHYA 2A5JA 4Q5IA 3IIMA 2NGRA 2ZM5A 3U7GA 1SHZA 4I1UA 5F3WB 3NDBB 4DCVA 2ZI5A 2AFIE 3AF2A 2JLYA 3ZS8A 5HCNA 1R8QA 4DEYA 2GF9A 4NZYA 4JLBA 2Y8EA 5EE9A 4URWR 1NI3A 4O2LA 1ONBA 4AD8A 3LX5A 3CRMA 2OE2A 4BFZA 2BV3A 4AIIA 1OIXA 3R9WA 4XOIA 4B71A 3C15C 4ABYA 5AUNB 5FBVB 1ZUIA 1I2MA 2OXCA 1G21E 3SBDA 4BECA 2I3BA 1TADA 5ELXA 4PQRA 1S9DA 2H1LA 3PITA 4C9BA 4Q4HA 4B6EA 2O8BB 2X2EA 3SJCA 2ZYTX 2QRZA 1ZVQA 4PAOA 4RCYA 3A37A 3LBIA 3PIRA 4HAYA 4QGAA 1G18A 5C1BA 1VHTA 2PZGA 4M9QA 3K0CA 2H8KA 3RLFA 2AKAB 1OKKA 1LNZA 2R62A 1LS6A 2AL7A 1VMAA 2P6NA 2VSOA 4EJSB 3BB4A 1AZTA 4Q7LA 3KTAA 1N5JA 5GVSA 4BLRA 3U3JA 1IY1A 3TE6A 4MGYR 1CJUC 1U99A 2HV8A 1YKSA 2O8CB 3ZVMA 1OLOA 3OF5A 3Q9LA 1NY5A 1PJRA 5J4KA 3MAAC 5E7IA 1E1QA 1UF9A 2GEDA 3O8BA 3W5IA 3NTUA 5KPDA 3FYHA 1R6BX 1WBBA 4M8NE 4PANA 4B35A 3N2IA 5L3SB 2QPOA 1JALA 1KK1A 1QHHB 2A9KA 3EG5A 3ICEA 4UXIA 1DADA 1T3LA 4Q21A 3ZH9B 2UKDA 3BXZA 4A6XA 4LJAA 4MKGA 3IQXA 5DSZA 2ZSFA 2ZRKA 1TX4B 3CF2A 3FKSD 4RD0A 1Z6YA 3GLGB 3ONWA 1E2PA 2EVWX 3D3QA 2QAGC 3V00A 4DUGA 1W0JD 1R0ZA 2XJ9A 2WOJA 3B13B 1QHNA 4Z1MD 3TMKA 5DYIA 4KYUA 5JI3E 1XCMA 1XBTA 4DIDA 3EAQA 3GFPA 3PEWA 2MSDB 4KJZA 2Z43A 3B9QA 3VMFA 1XB2A 2W6JA 3QBVA 4MKFA 5JEEA 1OE0A 1GWNA 4TSFA 5EXXA 1G8PA 4W5HA 4R2IA 2GZHA 4H1VA 1FQJA 2Q9CA 3ZVNA 1CULC 1KIMA 1DS6A 1JJ7A 4G01B 3UG6A 4MDFA 1FUKA 1KI6A 621PA 2RB4A 4G5GA 3QI2A 1PZNA 1JPJA 1SVOA 3NH9A 4DUGD 3THOA 4NU0A 4IDQA 2ZVQX 4QFMA 2ZJBA 1RRPA 4ESVA 2RGNC 3F3YA 4KFRA 4X8HA 1LF0A 4DDTA 1E98A 2ZR9A 4NPHA 4RJLA 4Z51A 3U7FB 1W48A 2NZJA 2VEDA 1R2QA 2UZIR 1KDTA 1QG2A 5JZVA 4BQSA 3EZFA 1YZGA 4ZDJA 2NTYC 3CONA 2IX3A 1P9WA 1CRPA 3MWJA 2O8DB 4AKGA 4HATA 3TAHA 4TTQA 5C46F 1T5IA 3DHWC 3THXA 1R4AA 5AUQA 5IK2A 1SXJB 5A4JA 2HCBA 1E94E 3H2YA 4AC9A 4B3DA 2GXUA 2R6FA 3AGPA 4JBXA 2X8AA 1GRRA 1RFLA 5JWHA 3WP1B 4JYCA 1AM4D 5DLQC 1UKVY 2IF2A 2KSQA 2PH1A 4PO1A 5DI3B 1N5KA 1US8A 1NIJA 3H4MA 3SR0A 1ZM4A 3U4QB 1KOFA 1L4YA 5CJPA 1Z2CA 3X1WA 1WB9A 4IDHA 1QBKC 1UAAA 3WYAA 4KLNA 2CVHA 5GJWC 2XZLA 4Q4JB 1CU1A 3PQCA 3QUSA 5JI2E 2CDNA 3Q5EA 3CO5A 5FBLB 3AVWA 1WE2A 2D3WA 3I1FA 3RRMA 4MKIA 3DO6A 2D2EA 4QL3A 3TSWA 4TYWA 5AJVB 3R8FA 1NVVQ 3ASZA 2J3EA 1L8QA 3A1SA 4LWZA 2IS2A 1F2TB 3GJ7A 4OK5A 4GFDA 3EA0A 4D81A 3ADBA 1E0AA 3AM1A 1AA9A 3CRVA 1OW3B 3KFXA 2Z6VA 2FH5B 1NMYA 3KFVA 1Q21A 1P2UA 3ADCA 3ZIAA 2WAYA 1JB1A 4YMWA 4E03A 4LYAA 1J8MF 1WXQA 1CIPA 2AR7A 3K9LA 3ZQJA 5JCPA 3I8XA 3DKVA 2ECKA 4YMTA 4V02A 4QM7A 4I99A 4AG5A 1YZUA 3KX2A 1MR3F 1Z06A 1R5OA 1E9AA 1E1RD 3BORA 4BFWA 1GNPA 2AX4A 3B1VA 1CR1A 3MD0A 1KO5A 1KDOA 3NHBA 1KO8A 1JJVA 4HB3A 1ZIOA 2GVZC 4MGKR 2WTUA 1ZD9A 1SQ5A 2ZRIA 3K8YA 3VR6A 2VHUA 4BFXA 4F4JA 2QP9X 4UKDA 2AHOA 2YV5A 3K0FA 4AKIA 4HYYA 2D7CA 1P4SA 2ODEA 3ZYCA 2XNSA 1ZNWA 3AH8A 1I4LD 2WJYA 1NLYA 4PSAA 1G64A 3FMPB 2E9SA 3GJ6A 4PXAA 1YU9A 4V0KA 4AKHA 1Z83A 3NBFA 3TW4A 2RHMA 3HPQA 3GMTA 1R5NA 3I4LA 2BDTA 4I1SA 1NKTA 1MT0A 1VDZA 4M1OA 4DJTA 1NRJB 4EFMA 1MV5A 5B57C 1R0YA 1ZU4A 1M6NA 2XJ4A 4Q4LA 4Y0VA 1VCNA 2CHGA 1SULA 3QXJA 3W6NA 4QG7A 1NLZA 1WA5A 2IC5A 5JBQA 4M0LA 2OSBA 3H1TA 4JLMA 2KWIA 2OCBA 5CM8B 4MUBA 3AGQA 3QKRB 4B74A 1Z6AA 521PA 4O0MA 1N6RA 1SHKA 1NP6A 1C4OA 3LFUA 3TKLA 4AY2A 1E2FA 4IDOA 5LB2A 3MUFA 1KSFX 2ATVA 1CJTC 1XD2A 1LFDB 2WKQA 4LX0A 5G3ZA 3SI7A 4Q4HB 4D80A 4MYTA 1LW7A 3U5ZB 1V43A 3R7WA 1Q3HA 4DLRA 3OIYA 1X86B 1CEEA 1SGWA 4N0EA 2XAUA 1IHUA 4LV8B 3AQ4A 1U2RA 1E2MA 2VL7A 1G3UA 1J70A 5J5CA 3X1ZA 4PC2A 2JCSA 1Y3AA 4ZDIA 1KHTA 1NN0A 2H5EA 5LBIA 5KU1A 2EFCB 3GFOA 4PSVA 2VQSA 3A1WA 5H68A 4XTRA 1OXUA 3KKPA 1EESA 3S1AA 1X6VA 3L0PA 3BERA 4JJKA 2D4HA 4TLCA 3PEVA 1KZGB 4NYJR 5C4GB 1OFTA 3HDTA 4BEBA 4JL5A 3R9IA 2DBYA 5DN6A 3TUJC 1BIFA 4TWZA 1ZINA 4WAUA 4KSCA 2OXRA 1M2OB 3GFTA 1E2QA 2YNMA 5IK2D 3PJRA 1DG1G 2WJJA 2HT6A 3KTAB 1A2KC 2ANBA 3I92A 2ATXA 3EX7C 2X19A 2VIIA 2ASEA 4JKYA 4P0TA 4A4DA 3MMPA 5CIWA 3ETLA 5J40A 1I2DA 2CCGA 1G5TA 4HB4A 3B7GA 1CKEA 1SVWA 4P3YA 4AG6A 2XEXA 1FZQA 3DVLA 3H86A 1Q44A 3WBJA 2J5XA 4NTZA 5DI3A 4GZMA 4DZZA 3FFBA 5TY0A 1W4AA 2PBRA 1VIAA 1P60A 1S1CA 3AF0A 1E6CA 4RKFA 3VR5A 2G3YA 3KKMA 1SXJA 3T12A 2ZE5A 5AR1A 4RZXA 2ZSAA 3V4FA 3VU9A 4HB2A 4A92A 1A2BA 1OYYA 1YZNA 2B6HA 2F43B 1J2JA 5DISB 4PSKA 3ZDQA 2P3SA 3PV0A 4MH0R 2RGBA 4XTCS 2GJ8A 1GKYA 4JVSB 5IF9A 2ZQ5A 3MSXA 2BC9A 1D2EA 1OXXK 1WQ1R 3QY0A 2HF9A 4Q7JB 1E2KA 4AKEA 2R6CA 1W0JA 3P4XA 2AWNA 5DI9A 3PVSA 1O3YA 3L8YA 5DGXA 2W0MA 1BMFD 4BLSA 5HKKA 1S4QA 1YJ5A 1XP8A 4B47A 1DAMA 1S3SA 4LBVA 3D6TB 3HYTA 5KNDA 5H8WA 4EAQA 2DFTA 1OFHA 1R10A 5ANRB 3W6PA 1EFHA 3QXCA 3B78A 3TAUA 1ZC3A 2RKOA 3VHLB 4GPTA 1QHSA 3N5CA 2CNWA 1NY6A 2A7QA 2OV2A 4G5RA 2YHSA 2WMOB 2QT0A 4FXPA 2C8VA 4PHTA 4EKDA 4PR0A 2IYZA 1U94A 3SOPA 2B7BA 4EFNA 3SYKA 1BH2A 2P5TB 2ONKA 2ZJ2A 3DPUA 3NVAA 4TYPA 2J7PA 2JLQA 1ZU5A 4QBGB 1FMJA 1S8FA 4IJMA 5EP1A 3W3ZB 4EQ6B 1R0WA 1T4GA 3O8RA 2ZE8A 2CHQA 2IUUA 1F6BA 1NKSA 1ZIPA 1JAHA 4BRUA 5FPSA 5E4FA 2IA5A 5TVKA 4MUAA 2V3CC 1N5LA 1KDRA 1M74A 4DLUA 4IOJA 1IXRC 4KFTA 3QNUA 4LBZA 1UEJA 4NBSA 1EX7A 4ON9A 4WZ6A 4DB2A 5JLJA 3CRQA 4RCZA 4OHZA 1N3BA 4Q1BA 4GRAA 3QVVA 4FMDF 3CW2A 4TYNA 2ERXA 1G7RA 3THYA 3A36A 2BMEA 2CL6X 4G5SA 3VX4A 5CK4A 4DCSA 1JQLB 1JNYA 4M53A 3T34A 4BWYA 1Z29A 4OHYA 2ZRAA 4ZI3A 5KSPA 4JL6A 4QHYA 2IS4A 1OKKD 4A15A 3LW7A 3RRNA 1U9IA 2HXYA 3AP1A 4B3FX 4E07A 2WZQA 3K0AB 1XRJA 3LWNA 4P4SA 1E3MA 3BWDD 4A9AA 3KXLA 4P4SB 5KPJA 3KXKA 1BMFA 3U6BA 3K0SA 4ZKEA 4YDHB 5FOTA 3RRYA 5DYGA 1S0UA 4C0HA 4DXAA 5BN3A 3OEHD 2OAP1 4DLZA 3QXXA 1HE8B 3BD9A 3AVUA 4Q1EA 1AQUA 1J99A 5JS7A 3LV8A 3CX8A 2H16A 4R9UC 1GG2A 4LSGA 4BFYA 4Q9JA 1S9HA 4Q1DA 5HZHA 2H7VA 5DNYB 2X2FA 3Q7PA 4TT3A 2GEVA 1BOFA 4D6PA 2NO7A 2W0SA 3HYRA 3JZAA 1A4RA 3K9HA 5D3QA 3T61A 4GBMA 1CR4A 1G7SA 2BBWA 2QMHA 2ZEJA 3HWSA 4PZYA 4BFUA 1W1WA 1ZRHA 2V1UA 4DLVA 1GZSA 1XMSA 2PCJA 2WJIA 1I4TD 2Z4SA 3CRRA 1E2LA 1IAQA 1T5LA 4LOAA 3AUYA 4V03A 1U8YA 3QVUA 1NVWQ 1UEIA 1NBMD 1K6MA 4AWXA 2P6UA 2HUPA 3WMEA 2AD5A 4JLAA 1M7BA 2V6IA 3O8DA 2Z5FA 2RGEA 1N6IA 1KGDA 3EXAA 4FMDB 1K8RA 4B44A 3RS7A 1Z28A 3EA5A 4R7ZA 2F43A 4JKIA 2JIZA 4HLUC 3TSOA 4BZPA 1UM8A 3QKTA 1G41A 4TLBA 1WBDA 2OCPA 4J0QA 1UFQA 1E2DA 4FD2A 4Q1FA 1IN8A 2OLJA 4JSTA 5L3VA 1AN0A 4XSGA 1U81A 3W5JA 2WJVA 4F7WA 1G3MA 2WM9B 2CMKA 1ELOA 3KZ1E 3R8CA 2WOOA 2GHIA 3AVXA 2IYYA 1VCIA 1KKLA 1AZSC 1P2VA 4OJKA 1DO2A 1Z08A 4WZBE 8OHMA 1DOAA 4L9WA 3VQTA 3NEYA 2QENA 4G5OA 3LBNA 4K46A 5L3QB 1XPUA 2CE7A 2R9VA 2J46A 3EW9A 4TN1A 4PAQA 4I4LA 1YRBA 5F98A 1XEXA 3KKQA 3KJHA 3NDPA 2A5FA 1OXTA 2F7SA 3BB1A 2QEQA 2YVUA 1IXZA 4D2IA 5GJVC 3BS4A 2FZ4A 2OFXA 4AYTA 4HLQB 2I1VB 1W47A 5KUTA 1TUIA 1E9DA 3X2SA 3OFNA 2NO1A 3CNLA 3ICQB 1P73A 2QUZA 4M9SA 2BJWA 1KNXA 2EU8A 3GQBA 1GSIA 2C9OA 3CR8A 3U60B 2IYTA 3B6EA 4KVGA 4IXNA 1F2UB 3QPWA 2ZS7A 4Q4AA 3B82A 2MSCB 5KSZA 1G8HA 4FMBB 4CGZA 2EFHB 2FSFA 2LCFA 2OZEA 1G20E 1W4RA 1JAIA 5HE8A 4ZCIA 5B64A 2QTHA 1EX6A 4BFVA 5HPYB 1Q57A 1Z5ZA 1ZC4A 1N0WA 3G0HA 4YC7A 4EJSC 2D7DA 1NN1A 2VHTA 3AF1A 1HH4A 3U3OA 4OQMA 2GNOA 5CB8A 4A82A 1H8HD 2NOAA 2PT7A 5HCIA 3LY5A 3W9YA 3FOZA 1W36C 5SZIA 4JS0A 5FPKA 4U5XA 3CF0A 4R2HA 1EG7A 2Q3HA 4DCUA 3I62A 2IUTA 4QHSA 3THWA 2E1RA 4TL7A 2Z83A 4UJ3A 3UWKA 2EW1A 4NYIR 4IEEA 3OEHA 1E79D 1Z6TA 4LYHA 5CYPA 3ZZUA 4XWOA 4DC9A 4TZ6A 4URVR 3ECCA 2ODWA 5EXTA 3ZD7A 4CEIB 1KMHB 3UWOA 5KHOC 4TLEA 1EXMA 1DO0A 3CR7A 4CEIA 4DBLC 4M1YA 4CIDA 3ND9A 1KTVA 4P31A 4O2RA 5BXQC 1GOTA 3PEYA 1ZYUA 2A5DA 5L3RA 4C0LA 4AYWA 2A30A 2WWGA 4PPQA 4TL6A 1ZM2A 4A8JB 1IY2A 4YMUA 1E0JA 4UNQA 3D8BA 3QF4A 4OHXA 2DY1A 1GILA 3REGA 5AK0A 4US1R 5FBRB 5GJCA 4HAZA 4L9SA 2OILA 2YINC 2ZRHA 1KI4A 2FSGA 3B1XA 1R0XA 3K0CC 3OEEA 2GEUA 2NMVA 2VHJA 4KODA 2IYVA 2QGZA 4W5WA 2JLRA 4OJQA 2CEAA 2QMEA 1G1MA 2FA9A 2YOGA 1M34E 1UBCA 5FOVA 4RD2A 5CM9C 5EUQB 1ZD1A 2EYUA 3WRYC 4M1SA 2CVFA 2V1XA 1Z6XA 2VP0A 3AVPA 1H8EA 1ESNA 1ESMA 1ZAKA 4QGHA 4OQNA 4QKQA 4M1TA 2JJ2A 3M6AA 4S35A 4MA4A 4QNMA 3KB2A 5KNCA 3IKJA 1XTSA 3KB1A 1RYHA 1G5RA 2QMUA 4JVLA 5D3MA 2J7PD 1SVKA 3SYLA 3TIFA 4XVRA 1B0UA 1F2TA 5LD2B 3AVVA 1IONA 1E1RA 2DYKA 2IHBA 3JVUA 4YLGA 5B2ZA 1KO4A 3SJAA 2WBLC 5FUXA 4OL0A 3U7EB 2QP4A 3UMSA 3TVTA 3THYB 1F3OA 2ZSDA 1WF3A 5EXSA 1M1YE 2E87A 3DMNA 3L0OA 3FWYA 4UNSA 1E99A 3IO5A 4B6FA 3LD9A 3O8CA 4H9GA 2EQBA 4D4KA 1HE1C 2H92A 1XF9A 1A82A 1NLFA 4EPTA 1E96A 1HQCA 4TMVA 2TMKA 3LO5A 4Q02A 3WXMA 4TYQA 1N2CE 2IYSA 2QMOA 3UANA 2OG2A 1W0KA 3UK6A 2N46A 2REBA 2O8BA 3L2OB 4PQYA 2LKDA 4BLOA 2FN4A 4V0LA 2VSXA 4HAWA 4NHOA 4LHZA 1OFUX 1N6NA 3BOSA 3P32A 4W7SA 4GMXA 3TSZA 3GLHE 5L3SA 5F9FA 1CS4C 4HB0A 2X77A 4RZUA 4BZXA 1GKUB 1ANKA 2LKCA 1XXHE 5CLQA 4KV9A 1P6XA 2J45A 3NC1C 2GK7A 3X1XA 4A0HA 4QBIA 1Z6GA 3B5JA 1NN5A 3VTKA 2QP3A 4URYR 4LC1A 3VR1A 2JEOA 4HLUA 2VHCA 5E95A 3WY9A 2BKUA 1L4UA 1XJQA 3L82B 3BFVA 4TMTA 3QF7A 2GA8A 4F4CA 3GLFA 4HZUA 1G3QA 4KI0A 1XXHA 3A58B 4URZR 3Q72A 4HZIA 4NCKA 1JEDA 2IK8A 3DKPA 3QQ5A 1HTWA 1AGRA 2ZJZA 1LB1B 3NEJA 2JLUA 1OH8A 2IT1A 5HZKA 1EWRA 2OO7A 4EPRA 4CF7A 5K8UA 2F3TA 2UVQA 3CWQA 2XZOA 3FMFA 1CRQA 2ZRBA 1RZ3A 1YZLA 2JLZA 2P65A 4KITB 4B2PA 2W6IA 3GP8A 3PUVA 4CZ2A 1W46A 3RAPR 4R71A 2Q0HA 3LH5A 3AVTA 1IQPA 1E1QD 3NG1A 1JR3E 3EWAA 2RGNA 2R65A 3WHKA 1A1VA 4NYMQ 2IYUA 3KJGA 1RJ9B 2OFWA 1IY0A 5G41A 2VLIA 1DBSA 1NMXA 2X1VA 5KYKA 1MRNA 2O0JA 4MDEA 1ZM9A 2D62A 1R8SA 4LYJA 2W6ID 1OB2A 1T0JB 4KXFB 2OM2A 4V0ME 1NJGA 1JBKA 2IUSA 1N6PA 4HAXA 2NPFA 3PUYA 3T1TA 2G88A 3PR1A 4I81A 4B75A 3TNFA 4Q9LA 4HZUB 5L8VA 2H57A 3T35A 4RZ2A 5FOUA 5TMPA 1XTKA 2WWHA 3HJNA 4IHQA 4URXR 3KJEA 1YZTA 4P4UA 1T8UA 2NO6A 5JSZB 1KO1A 5JFGA 1YR9A 2BHRA 2R6DA 3DL0A 5DH9A 2RH5A 2IEYA 3ZZTA 1NBME 2BEJA 1T0HB 5FPTA 2MSEB 5EP3A 3A4NA 2CE2X 1HYQA 3LW8A 2VP4A 3WHLA 1G8YA 4MRRA 4TMWA 3RWMB 3U4QA 2DCUA 4D0LB 5KDOA 4MYCA 4B3CA 4ZPXA 3K70C 1HURA 2B7CA 1ZUNB 3NIBA 2DHRA 1QVRA 1ZBDA 1MO6A 1K5DA 3EIEA 1KMQA 1U0LA 4HDQB 1W4BA 5FPHA 5B58C 1M7GA 3UMFA 1UBGA 3KKOA 3QXSA 1PLJA 1X8KA 4BASA 2GWHA 2VF8A 5AJYA 2WVJA 1Q1EA 2FWRA 2XITA 3IEUA 3UXMA 1EFUA 4GMDA 3IBYA 1WP9A 1P2SA 1KDPA 3K9NA 1YR6A 2ZAMA 1XTRA 3QOFA 5P21A 3PUWA 3U3RA 4D4MA 1CTQA 2ORVA 2KE5A 3AF4A 2YZ2A 4OI1A 1HT1E 2FF7A 2ZI7A 1T6NA 3O47A 5FH9A 5J4VA 3TQCA 1GDDA 4U02A 1TL7C 1TMKA 2OAQ1 4GOJA 4C2UA 3BFKA 4EIWA 1W2HA 1E9SA 3GLIB 1XEFA 4LJ7A 4F4IA 4XD7D 2PLRA 1VG1A 4A2WA 2C96A 2RAPA 3RHFA 4JT4A 3LBHA 3TLXA 3D31A 2JLWA 2YJTD 2MMGA 5FOXA 5BYJA 4M4SA 2GESA 4POAA 3I73A 3VU9B 3EASA 4IOLA 4KHZA 421PA 1OPXA 1SKYE 3GCGA 1E79A 2FPMA 1GVNB 2YWHA 3KXIA 821PA 2XSZA 5EQTA 1YHNA 3LQQA 4BPBA 3C5HA 2WICA 3SBEA 2GDJA 3W6OA 4LPKA 4LYFA 4M1KA 3HR8A 3FGNA 4C3ZA 2JLVA 3SN6A 5CIQA 2IS1A 3VKGA 2V6JA 3U44B 4HAUA 2QL6A 3K53A 2QU8A 2VHQA 4IW3B 3NWJA 4HLDA 4RKEA 5K8LA 5CDFE 3GJ8A 1X8LA 4Z54A 3GEHA 2A78A 2WWWA 1KMHA 3FVQA 4Q66C 2DWQA 2FFQA 1NF3A 3IPYA 5JJKA 4JLOA 2VF7A 2HLDA 5UKDA 2RGCA 3RSOA 3BH0A 4H1UA 2CJWA 4DRZA 3C5CA 1ZNXA 1E9BA 1FPMA 1Z0FA 2CHVA 3AKCA 2GF0A 3TW8B 4A2QA 3TR5A 3ND8A 4D0GA 3CPHA 4P4TA 1IN7A 1RC8A 1EFCA 1DAGA 2DFNA 4NCIA 1FX0A 1OYWA 4M9XA 2ZI6A 2VP5A 5JMTA 3CWZA 4Q4JA 1VKJA 1QRAA 1RKBA 2HYDA 2JDIA 2XB4A 4FCWA 4WBSA 4A0FA 1AGPA 2QZ4A 4AYXA 4BUJA 4QBFA 3RC8A 2RGAA 2QT1A 4PZZA 4BRWA 3NXSA 1TQ2A 2FV8A 1XTQA 3MWYW 4ZCLA 4R98A 2FEMA 1KK0A 3LVQE 3SEAA 2GJAA 2AFHE 2ZROA 3NC0C 4KFUA 2C99A 1VG0B 1FTSA 1CLUA 4C0JA 1P5ZB 5LB4A 2ZE7A 1IM2A 2J7KA 4HI0E 2F9LA 4OYHA 3Q8XB 4RY2A 1COWD 4L15A 2Q6TA 4MQBA 5FL7A 1U90A 4W5JA 3LXXA 1XPRA 5BN5A 4ZDKA 3FPAA 4UNRA 4NKRA 5JWOA 2FU5C 2C2HA 3CUEF 1ZCBA 2G83A 4JLNA 3RS2A 1DAHA 1OIVA 2GCNA 3WMFA 2V7QA 4ACBA 2FOLA 2I1QA 4EDHA 4Z1MA 3C4JA 3ZS9A 1KKMA 3SQXA 4XJXA 2XSZD 1S3GA 1G5PA 5HTKA 1GL9B 2ZI3A 3AEZA 3DEFA 4NMMA 3B85A 4V0MA 4MKHA 3FMIA 1CJMA 4JSYA 4B34A 3EZ7A 2HEIA 2ZR0A 1ZD8A 2GJKA 2WIAA 5FL7D 3AVQA 4HDOB 2QORA 4FWTA 5E7JA 5EP4A 4DLTA 1G3IA 5CYOA 3W8RA 1XFAA 3JVVA 2C04A 3A4MA 4U7DA 4E5UA 4PTLA 4LRWA 4TQAA 2FFAA 4JVMA 3HR7A 1FP7A 5DIFA 4TTPA 2G1JA 4LGMA 5FR2A 1Z0JA 1C1YA 1X8JA 2IYQA 2QSZA 3MCAA 1KI2A 1P62B 2SHKA 2WSSA 4ARZB 1T3HA 1KSGA 1H65A 3GJ0A 5FUVA 1VIYA 2ERYA 4OHWA 4F38A 2EWWA 4WOPA 1SXJD 3CH5A 1TTTA 4ZIRA 4TQ9A 5EZ6B 1ZMXA 4JLKA 3QKRA 4YXWA 2OFOA 1XXHB 3BGWA 1Z2AA 2NO9A 1BYUA 4OKSA 1IBRA 1QZXA 1E9CA 4CRWB 4U00A 4QJ3A 2QNRA 3T15A 5AJXA 1MABA 1ETUA 3EZ9A 4MRPA 4IVRA 3B1YA 2J0VA 1E9EA 2QPTA 4TMKA 3T1QA 3SQWA 221PA 2C9YA 2O0HA 3DOFA 4C7OB 3A8TA 3T06B 4IVPA 4KFSA 3BRWD 3U3KA 3S1AB 2FDCA 1P7CA 1U0JA 4LJ4A 4X8LA 3SZRA 4CDGA 3ZLJA 2GBLA 2ZREA 3IHWA 3IBGA 1HQYE 5BYKA 2QE7D 5FBQB 3ZQ6A 1KJWA 4B48A 3C7KA 4WVFA 4Q18A 3KQKA 3K9GA 1OF1A 2BOVA 2CLCX 3FDIA 3NKVA 4MYUA 4OK6A 3WYFA 1OH7A 1D9ZA 4PO9A 4D82A 4C0SA 2OCYC 2GCOB 1Z8FA 2CK3A 3C8UA 3P1JA 3A6PC 2J0UB 1XD8A 4NYJQ 4BFTA 3UIEA 2QGNA 4NL4H 2YWEA 3Q85A 1QG4A 1RYFA 2ZRMA 4C4PA 4FINA 4C30A 3N2EA 4KYIB 2B8WA 2BBSA 4KAXA 4LY6A 2YKGA 5BWMA 2FFBA 5FTMA 2G9NA 4YMVA 3K1JA 4QBHA 1JI0A 4JL8A 3N70A 2CNWD 4WZAE 2QN6A 2FGJA 3OESA 5FTKA 2A2ZA 3REFA 4D0NA 3RS5A 3A4LA 2RHDA 1VTKA 1TQ4A 1TNDA 2R6GA 4NE2A 3A1UA 2QA5A 4IXMA 1IN6A 3CH4B 2QM8A 4A6PA 4IDPA 1IXSB 3IGFA 1G7CA 3LAWA 1OHHA 1TF2A 3PCRB 5JHHB 3PENA 2NIPA 3RS0A 1CBUA 2BM0A 3JZMA 4QC2A 4QXAA 5JWRA 1DAIA 5FL3A 4LHWA 1ZW6A 3MWKA 5IHPA 4L16A 3A1VA 2C9CA 3QKSA 4RD6A 3WMGA 1H8ED 3WRXC 1P3JA 2HT1A 1PUJA 5SZKB 2PZFA 3QKSB 1GNQA 2VBCA 1XCPA 4DDUA 4JLPA 4PHHA 1RRGA 4MRNA 2BEKA 4TMXA 1T3SA 1F5NA 3AP3A 2BKEA 1XEWY 4JT2A 1YRAA 2BCJQ 4US0R 4WXRA 2WWXA 1UPTA 4LJ9A 5KTYA 1DVRA 4NH0A 4XD7A 3VKWA 2P0EA 3KJIA 2WSSD 1Q12A 2WKRA 1CXZA 2YOHA 2ZYUX 4DKXA 3X1DA 5LD2C 1XZPA 4RD1A 3GJ3A 3AKDA 1LV7A 4ESHA 2VP6A 3OIUA 2HJGA 2WJHA 1GP2A 3OAAD 2CBZA 4QOSA 4QNRA 3KQLA 2G1KA 1UDWA 4LHVA 1MABB 3WNCA 2WWYA 5CK5A 3WNDA 1Q1ZA 2ZANA 2F1JA 2QAGA 4HEJA 4BLTA 4LV5B 2Q3FA 3CNOA 5CDFA 3AUXA 1GITA 4DVGA 1XX6A 1UKEA 2WWFA 1QHYA 2EYQA 2YYZA 2QTFA 3Q7QA 5FPYA 5HKKD 2P6RA 3EC2A 3BIFA 1JXMA 5CJ2A 2QSYA 5FOSA 1OIWA 3R9XA 3CPEA 4KBGA 1W44A 5FTNA 3WNBA 5G53C 1P61B 5J4YA 1OFIA 2OBNA 5EE3A 3UATA 1MH1A 4OI4A 2WV9A 4ASUA 4DLXA 2BJVA 4DEXA 3IHLA 1NVVR 5H1YA 4O25A 4V0NA 4GOXA 4D4JA 5EP2A 2K5UA 4CT4B 3TJZA 4N0DA 3C16C 4ZDWA 4PHFA 1XU4A 2XNDA 1XD2B 3NBYC 5EUMA 1VCOA 4V0OA 1TEXA 3BH6A 4WXPA 1XCGB 3U7HB 4DDVA 1S1MA 5BN4A 1W36B 4DSTA 3D7MA 4LJ5A 4BLQA 1E4YA 4RD3A 1G3RA 2VSFA 4JIMA 5AUOB 3WP0A 2PCLA 3Q5DA 4UXJA 4FN5A 1G19A 4A0RA 4QJ5A 2J0QA 2QROA 4IVQA 2VA8A 3TH5A 3OE7D 1JR3D 4Q01A 1E2JA 4TQUS 3GEIA 4L8GA 3ZGXA 1KAOA 1CF4A 1W49A 5LPNA 4NDZA 5FI0B 3GPLA 3F0TA 4CW7A 4KU4A 1OHHD 2XNDD 2FE4A 5L3QA 1Z0AA 2ORIA 4UNNA 1TQDA 1VPLA 2FG5A 2PEZA 3DMDA 4FCVA 3MGCA 4C0QC 1XPOA 3OEED 1K5GA 2B21A 4ARZA 1FMLA 3EIQA 2DB3A 3EPJA 1XMVA 1OB5A 2B8TA 1XWIA 1OSNA 1TUEA 2GTPA 1CR2A 2GETA 2GCOA 4JLJA 2PMDA 2ZJ8A 3AP2A 2FZLA 4MGZR 5AJZA 1RRFA 3SE0A 4C2TA 4TZ0A 3NBXX 4Z8XA 3DZDA 1LVGA 4DLSA 2RGXA 1AS3A 2DWPA 4GDFA 4M2LA 4LBWA 5EE1A 4P33A 4FI3C 4XWKA 4D26A 1KK3A 4QM6A 4KO8A 3MLEA 1U8AA 4OQFA 3SDZA 4DT1A 3FFAA 2QQEA 1UBEA 2ANCA 1VCMA 2ZUCA 3AV0B 5SZHB 1DELA 2O8DA 2AD1A 3G82C 1SVIA 3KQNA 1CJVC 5KNBA 1E9RA 1D2MA 4FIDA 4QJ4A 5JCZA 3HPRA 2ZI9A 3ZD6A 1F2UA 1NVXQ 1Z63A 3OIWA 1W7AA 1A5TA 2J41A 1AS2A 1S96A 4M21A 1FOEB 1N6HA 1XZQA 2FFHA 3GEEA 1FTNA 1KNQA 3V9PA 1D2NA 2DR3A 2J87A 1Z0IA 2QG6A 2WMNB 2VTKA 4GSYA 5J47A 2OCAA 2W83A 2XB2A 1R7RA 1X1SA 1RIFA 4M22A 2KI5A 3RABA 4TLDA 1GL7A 5F9HA 3VR4A 2O5VA 2QM7A 5BQ5A 2ZUBA 4NCNA 4OK3A 1LS1A 5G40A 5F2EA 1LF5A 2ZUDA 5JHGB 2ORWA 4Q7KA 3F8TA 2O0KA 5TB5A 2QBYB 3EPHA 2F3RA 4ZO4A 3P20A 2XXAB 3RDPA 2VP2A 4Q7MB 2YC4C 3F5FA 1ZM7A 2W2VA 3LA6A 3OIVA 4I1VA 1R5BA 4JLDA 1W36D 3FHTA 2O52A 1W2GA 1W5TA 3E2IA 4KBFA 4ERNA 4JBWA 3SFVA 2IYRA 1M7HA 1GRNA 2W2TA 2RGDA 3LXRA 3UMRA 2ZTSA 4S2EA 4Z8YA 3CIOA 2GBLC 2GXAA 4OHVA 2BWJA 5JECA 3FMOB 4PZLA 5IDVA 5JS8A 2LWIA 4TL8A 2G77B 1P9RA 2IWRA 3GLFB 1YE8A 1Z3IX 3H0KA 3PEUA 4HUQA 1U98A 2IHYA 5JSZA 3UPUA 3QJYA 4YDSA 3IEVA 4FCTA 3FKQA 2V4ZA 3LNCA 1GRQA 4IFBA 4TMZA 4TSFD 1F48A 5A5GA 5AUPB 4X8MA 1PLLA 2AWOA 5TDHA 4RFSA 2IXGA 2ZJYA 1JR6A 3QG1A 3TQFA 2GXSA 1VG9B 2DWOA 5EE0A 3I3SR 4DSNA 2C5LA 4EPVA 2O8FB 1KYIA 4EFLA 1DE0A 3W90A 3RNLA 2AXNA 1BYIA 3LLMA 3OHMA 3TBKA 2JJ1D 4EPWA 4WA7A 3GJ5A 3P26A 2ZITA 4LUCA 1YQTA 5FR1A 2QI9C 1N0VC 2BMDA 1OXSC 2BIFA 1ZP6A 5AWFC 1H8HA 4A2PA 1Q3TA 4CVNA 3WBKA 2RMKA 3J81k 1VG8A 2AKYA 1VYUA 3IPXA 4US2R 3TK1A 1II9A 3AVYA 2H17A 4IEIA 5LDDC 4KVAA 4DHEA 4Y0AA 1CJKC 2QY9A 2XTNA 5FOWA 1E2NA 3T5GA 1KAGA 2ZJAA 1UKYA 5DN6D 3I61A 4JZKA 4BGDA 1P72A 4LDJA 5EXPA 5J4LA 2OBLA 4W9MC 1IJEA 1GM5A 4PC1A 3QIAA 4AURA 1QHXA 2JASA 2D06A 4NCJA 2CL0X 2ZXUA 4C7OA 1GNRA 4Q19A 3RS4A 2A5YB 4WIAA 5JRJA 2JIZD 4HAVA 4OQXA 1OH5A 3EIHA 1XTIA 2IF0A 3OFND 4LBYA 2ZU6A 3VNVA 1KI9A 2BBOA 1M8PA 2G6BA 3MWLA 5JRZA 1KSHA 1DEKA 3BAFA 2N1BA 4NONA 4NYIQ 3K0FB 4AI6A 1E2HA 1L7VC 3P4YA 4EUNA 3I5YA 2A3RA 3AKYA 4GP7A 3SU8A 3P27A 1MKYA 1HV8A 1NMZA 2J1LA 4KLZA 1NSTA 4LJ6A 2OT3B 4DSOA 4F93B 1QDEA 3W3AA 3GLHA 1NJFA 2GXQA 3GD7A 4NYMR 1U8ZA 4YMSA 3IUYA 4A0GA 4BFSA 2RCNA 3HU1A 1AIPA 3E70C 4DCTA 5DE3A 4OI0A 4DIEA 4XVQA 5E3HA 4GL2A 3PXGA 3AB3A 1QHHA 5DHFA 3H84A 5EE5B 2PX3A 1J90A 2V8OA 3CLVA 5KSYA 4XWAA 3U2QA 1G291 4FMCB 3U61B 1YZKA 2IYWA 4A8JA 4Q4AB 3IO3A 2QPAA 4II7A 5IRCD 2FX3A 4B3GA 2CJWB 1RW4A 1SVSA 2HF8A 5FUYA 4IOKA 1G16A 2FMXA 4IOMA 2OESA 4HLCA 4UJ5A 2FGKA 1TPZA 1TF5A 3AKEA 2REXB 4GNKA 4HDCA 4JJZA 4ZV4A 5BW8A 2JJ8A 2A5GA 3VNUA 5B30A 2QAGB 1II8B 2R8RA 4LJ8A 3EPLA 4HUQB 1KZ7B 1UADA 4HSEA 3CNNA 4CT5A 3K0EA 4RZ3A 3MG9A 2HLDD 3T1VA 1O87A 2AK3A 4RSGA 3NBZC 1PVOA 1ZNZA 1N25A 3SC3A 3C14C 5HR5A 1JEEA 1LTQA 1T91A 1Z0KA 3KUDA 2REOA 1KK2A 2W58A 3NHAA 1AQYA 2ZRCA 4DT1B 5CB6A 2WAXA 3CB4A 2ZJ5A 3Q3JB 4DDWA 4JYBA 3X1YA 1ZCAA 1P75A 2ODNA 3EZ2A 3MJHA 3B1WA 1V5WA 2ZJOA 4JBYA 1KI3A 2OEPA 3GJ4A 2IYXA 4P32A 1JR3A 2EWVA 1WDTA 3L43A 4OQLA 2JJ1A 2MMCA 4IFEA 4HUTA 3CZQA 2HJVA 3B1ZA 1AKEA 2AK2A 5J4HA 1PV4A 3HP1A 2JAQA 5FUWA 4D4LA 4Q1CA 2F55A 4PQFA 1UBFA 1Z47A 1AJEA 2JLSA 2EFEB 2Q9AA 4O3MA 1NBMA 2KJQA 3ZJYA 3M0EA 2CXXA 1OJLA 2Q3MA 3BB3A 1NN3A 4IDNA 5DO9A 3I72A 1NSFA 2ODBA 3QF4B 2JATA 1G4UR 2ZR7A 3W8NA 3EPKA 1CR0A 3UKDA 1XEWX 2GVDC 4QGFA 4LPSA 4RFSB 2FEOA 1WCV1 3QENA 1EK0A 3C41J 1DAKA 1G8FA 1E32A 2W6JD 1SVLA 1XNJA 1XMJA 2ZE6A 3EWSA 4WW0A 4URUR 4MGIR 4G1UC 5KDLA 4B32A 2YC2C 4CEHA 1BO6A 1W4CA 2GCPA 2OHFA 1TU3A 3EC1A 4CEJB 1OT3A 3CM0A 3BBPA 1OV4A 3RC3A 4B2IA 4TLAA 4YXWD 4TTRA 1T9HA 4L4UA 4C0BA 3FTQA 5KDDA 2DPXA 5FFMA 2O8EB 3OE7A 4EPYA 3NH6A 1Q1QA 1E0SA 1TF7A 3RS3A 2ZYVX 2F6RA 3EZ6A 1W5SA 5C2JB 3TUIC 4B43A 2V54A 2XXAA 5G3YA 5E7MA 1GIAA 3GLHB 1D8TA 1F60A 2BVNA 2QQ0A 2QE7A 1FP6A 3CPJB 3MFYA 1EWQA 2NZ8A 2BBTA 2VO1A 4MRSA 2ZRFA 3IDQA 1G8GA 2C77A 2WWIA 2EFDB 1QVAA 3VR3A 2ZI4A 2IW3A 2JGNA 3TGPA 4XIGS 5JJLA 4G3XA 721PA 2ZRGA 4LC0A 1MRSA 4DSUA 1Y63A 5A0FA 4UQOA 4RD4A 1I4DD 4E22A 4G5QA 3DDCA 3SFZA 3CKLA 1HT2E 5SZJA 4M1MA 1E2EA 3K70D 1G6HA 3HU2A 3OZXA 3VFDA 4EJSA 1KI1A 1JPNA 4QRHA 2WIBA 2YOFA 2UZ3A 5TV2A 2XOKD 1TEVA 4ZKDA 1D5CA 2L0XA 2V7QD 1GTVA 3BK7A 3CF6R 2PT5A 1HY3A 3SJZA 1G7TA 2HXSA 3T1OA 4DLWA 2OLKA 4GT1A 2PLFA 4PPFA 1MO5A 3ASYA 5KSOA 2BCGY 2N42A 1X1RA 3QG5A 6Q21A 2ZRNA 4LK2A 1EFRA 2WPDA 2Q9BA 2FPLA 3RYTC 1Q1BA 4GOKA 3K0AA 2CL7X 5C18A 3IIJA 1D6JA 4JMPA 4QGGA 5JEDA 3THXB 1NL3A 4QHTA 1E2GA 1GFIA 4JLVA 2C03A 3A1TA 4MYHA 4UXHA 4CYMA 3QKUA 3GLGA 4ZI2A 3QEOA 4YQFA 1N6LA 1NVUQ 3ZIAD 3QEJA 5CLLA 2I4IA 1E69A 2AXPA 3GLIA 3DOEA 4F91B 3AF3A 1A7JA 4PPGA 2JDID 2IXEA 2QRNA 3CBQA 1FQKA 1MO4A 1MOZA 4BZQA 3VX3A 2IL1A 2V9PA 1FL9A 3B8HA 3GLFE 2ZSEA 3V4RA 2DFLA 2ZYWX 1VECA 2ZVPX 5GJBA 3QPVA 2ZRLA 2JLXA 2ZSBA 4B33A 2KB0A 3MJRA 1DAEA 5FTLA 1XDBA 2BM1A 3VR2A 4B76A 2R44A 1FW6A 2O8CA 1XEXB 4GP6A 3AVOA 4Q47A 1AK2A 1FNMA 4PAMA 121PA 3DZ8A 4NP6A 3THWB 2CCKA 2GZDA 4EQ6A 2JA1A 2AN9A 1DTSA 2QAJA 4LV6A 4DLYA 2PJZA 4A8JC 1DAFA 3DM9B 4OI2A 1RVDA 1COWA 2W2XA 3VKHA 3GLGE 2XTZA 1N5IA 2F9MA 5FI1B 4YONB 2GILA 2GJSA 2F1RA 1JXOA 2XX3A 3K09C 5IT5A 4ASUD 2R6AA 4DB4A 2GZAA 1PUIA 1US8B 2FPKA 2B92A 2HCJB 3HU3A 2FNAA 5FBWB 4BE7B 1RPZA 2PMKA 3ADDA 3RRZA 2JJ2D 3B2EA 4BLPA 4Q03A 4B73A 2XTMA 5TXGA 4B2LA 3LLUA 4LJYA 2V55B 1XMIA 1OH6A 3ADKA 4PC3A 2ZU0C 3K70B 3I8SA 3U6KA 2IS6A 4PFSA 2P67A 3IIKA 3TUZC 4DCNA 3FHOA 4JVNA 4ZCMA 1IJFA 1IN4A 1X3SA 4Q1AA 1ZNYA 3LQRA 2ZS8A 1YVDA 2BMFA 2GAOA 5EJEA 1P2TA 1ODFA 2ZAOA 3LDAA 1QHIA 2VYFA 3QPUA 3OAAA 4Q9IA 1DPFA 3TVDA 4TL9A 2ZPTX 2H18A 4M1WA 2VH5R 3ZVRA 1XJCA 4N3NA 1Q20A 2FSHA 2FJUA 3PG5A 3GLIE 3QXHA 2IBMA 2WPDD 4EPXA 1TAGA 5TARA 4PC7A 1G4AE 4B3XA 4PC6A 1FFHA 1N6KA 1J8YF 1TQ6A 1YR7A 2ZRPA 4C0KA 3U44A 2QTVB 1RJ9A 1IOZA 1SXJE 2F1IA
chains in the Genus database with same CATH superfamily
3LUHA 1SKYB 1YE5A 4UUAA 2QD4A 3DJFA 5A3SA 1WSDA 5B7GA 2QLJA 2QB5A 2APJA 2LE0A 4JYMA 3ZCSA 3EZNA 1C30A 3JD4A 1I24A 2WR8A 4H08A 2ZRDA 3ZWQA 5ALPA 4C7VA 1KI7A 1OR8A 3PTLA 2ATCA 5A6SA 1X1QA 2NQTA 2RG7A 1M2NA 3GG9A 1KJYA 2XZPA 3ZTTA 2JKZA 2IOFK 1FFYA 3KUCA 4EVSA 1ZBQA 3GDOA 5CLGA 1PYGA 4G0YA 4JQOA 4XLTA 3QUTA 3FPCA 3MM4A 4H17A 1XU7A 1EBUA 4BGIA 1ZCJA 1JQJC 3B6MA 2NXJA 2DFKB 3AU8A 2YXPX 4XOUA 4KSBA 3PDWA 1H4QA 3ELBA 1EFRD 4ZAYA 4GE3A 1V6CA 1U4OA 3B9PA 4OH1A 3L1IA 3QITA 1PEDA 2NYVA 3ZWNA 1PFUA 4P3KA 5JZBA 5K45A 1DQZA 2FKAA 1GRVA 2NO0A 4NARA 1PWXA 5BR8B 1QHGA 4RF3A 1RRCA 1L8LA 2YWGA 2CUTA 1VKOA 3MJ4A 5EQJB 1QOPB 1LA2A 5DTMA 4TLMB 4BQNA 5ITVA 2B94A 2PUBA 1N33B 3IERA 1RQ2A 2W00A 2Y2VA 4M46A 1XKTA 2AG8A 4YAFA 4CMIA 4GF5A 4GR9A 3KJQA 4FKMA 3QEBZ 2AC4A 4M7RA 1F06A 1ZK4A 3E82A 4U7PB 2D1SA 3H5LA 4MW5A 5CNKA 5F2NA 3RVRA 3EW7A 3ZU3A 4UTOA 2HYIC 4KDRA 3U3MA 5EEHA 4EI2A 3QVLA 3GX1A 3TZHA 4Z4GA 1U63A 3L8ZA 3UJPA 2WUVA 3LQ2A 2XYPA 1BA2A 5ILOA 2VRWA 4ER5A 3SJBA 1J5PA 3JAWB 3A6JA 2LNDA 2FSIA 3VHRA 2G08A 4F72A 2JHPA 1KPIA 2PUFA 2CJXA 2HJRA 2NUBA 2XR1A 4B6GA 4BEJA 4I2VA 1VBFA 1FFAA 2ZT8A 4NS1A 4R54A 4RL6A 3Q1KA 4AP6A 4BDTA 2IH2A 2PV0A 1AKYA 2VS1A 3PUXA 5LQNA 2Q5OA 2X5NA 4KQGA 4MWCA 4UDYX 2Q5QA 3KJZA 3VU8A 5JNWA 1LBQA 1C9KA 4X7RA 2UYGA 3VYRB 3E1SA 4GI7A 3RIXA 1IBCA 4P9NA 1B00A 1V5FA 4CF5A 1D9XA 3KL4A 4U7JA 3I5UA 1RE1A 4A1FA 4PX9A 2EIXA 3D3KA 4WA8A 2BGNA 4MWBA 4B3BA 4HV4A 1FBNA 4I50A 2YY6A 2Y0CA 1MNAA 4LI0A 1RI3A 4RFVA 2YYSA 4FDUA 2JRLA 1T0PA 1H1LA 1ZUHA 4L5AA 1FNNA 3K1YA 5EUBA 1EA5A 1ZQ1A 4ZT2A 2DFVA 3CQ9A 3C45A 5DHRA 3RVBA 3VHXA 3ODGA 4F3NA 1RWBA 1AXGA 1CETA 3DAOA 3G0IA 3E7XA 5ECGC 4CM1A 4KO3S 1M0TA 1U2GA 1YQGA 2WHXA 4FN4A 3OICA 4Z7JA 1Q7TA 4PPNA 5KYUB 2EZTA 4HDMA 3H04A 1E0KA 2PS3A 3MUOA 4WBNF 3G0GA 2I0FA 4OBEA 3V3KA 1WQ4A 5M5BA 1CP2A 3W34A 1Y81A 1Z6ZA 3CUSA 2B1IA 1VYVA 2A3NA 2J07A 4DYHA 5A3RA 3C43A 4WI1A 3E2PA 4IIVA 1BKDR 3S3TA 4L1KA 5KYWB 1UWVA 1CVLA 1PYDA 1BS1A 3PX7A 2HMTA 4EF5A 1LY1A 3JAMA 3RWOA 4D25A 2J0UA 3KBBA 5F7JA 2GK4A 1RR6A 3WAGA 1UJ2A 4NV3A 4P3XA 4KOEC 3M1IA 1SG9A 3FGPA 1O97D 4P4LA 4ACAA 5BVHA 3UMYA 3DV2A 3EC7A 3FB4A 2O8EA 2FTKE 4P80A 2JAXA 4IJ5A 2A9RA 2HX1A 4FFPA 2HQ1A 1HLPA 4Y2QA 5IM5A 4QUBA 4GPIB 4Z0TA 2J0SA 4NFHA 3G0BA 1B2RA 3ADOA 2WJGA 2VDRB 4FWIB 2WU3A 3FKSA 5JVDA 2JGKA 1AF7A 5IVIA 2VPPA 2Q50A 2QVBA 3SZGA 3TX6A 4CLXA 2PYDA 2AJBA 2GSDA 1B8NA 3S5JA 1Z0UA 4MP3A 4EZIA 4HDSA 3JWGA 1L3IA 3F6PA 2BSAA 4UM9D 5F3DA 5EJ4A 4RESA 2XMPA 1DWPA 1H1TA 5FHRA 3IP1A 1KS9A 2A1UB 3FRIA 5CNMA 4F92B 4KRYA 5KAPA 4F9GA 1UXGA 4XH9B 2DHDA 3AJAA 1NVAA 1IBMB 4JI6B 3O8NA 3AUFA 5CXXA 1S2MA 1BE0A 1J20A 1WHSA 2OXIA 5JU6A 3ZDAA 1SUPA 4JJEA 1N9GB 3T3EA 4LHYA 2CHFA 3H65A 3LQ4A 4Q05A 1BOOA 1Y0BA 2ZM5A 1SHZA 2FR8A 2XDWA 5F3WB 3NDBB 4Y9TA 1A4XA 2CNOA 2ON6A 4AJNA 4ANFA 4DCVA 3AF2A 4FGLA 2ZBDA 4GIBA 4OCZA 1L4KA 3LSYA 5HCNA 4ALJA 4DEYA 2R25B 4CCYA 5CBKA 4B3HA 1L7AA 1VJRA 2QN2A 3K8ZA 1R16A 3ZE2B 1N3LA 4O2LA 1N5DA 3QIVA 2Q3CA 3G1UA 1BEUB 4LWQA 2XE6A 4NBRA 4RHYA 5BQOA 4XOIA 2X6QA 1RYEA 4B71A 3C15C 1V16B 4ABYA 3NXKA 3TSYA 3SXPA 2OXCA 3TRHA 3ZHXA 5JAOA 2VLBA 3HB7A 2IP2A 4D4GA 5ELXA 1RQ7A 1S9DA 3FR7A 2BY4A 2BMVA 1WABA 1NVBA 2VDMB 3H5WA 4WT7A 4Q4HA 4XDYA 5JZOA 3ZGVA 3RPEA 4EUEA 4FYKA 1JMYA 2XUPA 1CZNA 1OAOC 4RCYA 3PIRA 3UCFA 3IT3A 1ZA2A 4YAEA 5KU7A 1C4WA 1LS6A 1YV9A 2AL7A 1E3EA 2RARA 2VSOA 1SHJA 1DIOB 1W75A 3I0MA 3PWZA 4JQYA 1V6SA 3HSYA 2J4FA 3L7CA 5CLIA 3S29A 4BLRA 2WD7A 1MTOA 3CRZA 3U3JA 5FWNA 3BXEA 4IWXA 4ESOA 4KQEA 4MW0A 1YKSA 4CNQA 4LGYA 1OLOA 4FLEA 4KNVA 1QGAA 3ROTA 4Z4CA 1BWQA 5E7IA 3W5IA 1OI3A 5KPDA 2QUBA 3FYHA 4DXHA 1CUVA 2J6HA 4S1OA 3Q10A 2WD7B 4B35A 1X1BA 3BKXA 2B69A 5L3SB 1U3TA 2QPOA 1JALA 2Z04A 1KK1A 4G23A 3ZKWB 3EG5A 1W9HA 3CG0A 1M1XB 1U8FO 4MW9A 1DADA 1T3LA 3ZH9B 5IKEA 4PX5A 4S2UA 3CCBA 3NTLA 1L3CA 1BQ3A 2UKDA 3DBOB 4BKPA 1Q7BA 3BDIA 3C3MA 4ND8B 4PAWA 3IQXA 1Y8QB 2GKGA 1TX4B 3FKSD 1Z7YA 5HGXA 4KE9A 4XQGA 2R97A 2XF8A 1E2PA 2EVWX 3OM8A 3RVLA 2QAGC 4CM9D 4DUGA 2XJ9A 1TE2A 4L3WA 3N1UA 3TMKA 2PR2A 2DETA 1KFCB 1P7WA 2NZ2A 4DIDA 4CMJA 3GFPA 4NFYA 3B53X 3KO8A 3H75A 2R0QC 3W2HA 2AFHB 3B9QA 4GMKA 4O4LB 3VMFA 2XE8A 1AGYA 3QBJA 4QDOA 3NQ41 4XXHA 1OE0A 4JCCA 1GWNA 2GCIA 2YJ5A 3GEGA 5EXXA 1F4LA 5IM4F 3SQNA 3BF8A 1EB8A 2PWZA 2YHUA 2GZHA 4JBIA 3RC1A 5C32A 2EF0A 4O08A 1EXVA 5CG1A 1YFLA 1J1ZA 1G59A 1LD3A 4JJ8A 4O2AA 3BFPA 3O7WA 5E6UB 1X14A 3K05A 4MWZA 1UKCA 1VMIA 3UG6A 1TK3A 3LGAA 1B0PA 1LX6A 3PDHA 5IARA 4M8KA 3VA7A 3EIWA 1V9SA 1PZNA 3DOCA 3IA7A 4RSMA 1W30A 3EH1A 5B53A 3S40A 3F6RA 1QH0A 1RNLA 2QRVA 2ZK7A 4WOCA 3THOA 3H5VA 4QFMA 1XDGA 2RBKA 3NWBA 5FP0A 1DXHA 1GZHB 2A1UA 2Z2JA 1LF0A 3FPGA 4U2GA 2NZVG 2ZR9A 3HO6A 1Q91A 4R1UA 4PLWA 3PNLA 1R2QA 1G8KA 3SJ7A 1NHWA 4YALA 3A6EA 3P4UA 1J39A 1XAJA 2E4WA 4FXOA 4ZDJA 4WOKA 3W5DA 3GGDA 3LDFA 4ER6A 3QKIA 1ORVA 5IJ9A 1RYBA 2OOSA 3M2TA 1RC0A 3P52A 1YB7A 4HATA 2QDKA 4TTQA 1J9ZA 1EP9A 2HMVA 3DHWC 3THXA 5IK2A 3TRDA 3PE6A 4P2GA 4D9KA 2B4QA 2RIPA 4PZ0A 1JFVA 4AP5A 2QZZA 2Z8XA 3EXHA 3IAUA 4FBMA 2R6FA 3TYXA 1Z4MA 1XNHA 2IP1A 1RM5A 3H9QA 3NM5A 2XWJI 1UKVY 1Z2OX 2KSQA 3QHAA 4NU8X 4UTXA 2NACA 5JALA 3H4MA 2YYAA 2V7TA 3Q7RA 1LSJA 4G0QA 3RV3A 2A14A 1AH2A 2P4EA 4ZEOA 4IHJF 4DGQA 2D5LA 4N48A 4RABA 4K2HA 1K7CA 3X1WA 4YROA 1M73E 1ZN7A 2AN5A 3ZUPA 1U2PA 2XZLA 4H6WA 4Q4JB 1CU1A 4BBAA 3PQCA 1CFJA 2OV8A 1OGIA 2EP5A 2PSFA 3AJDA 3L02A 4TV9B 3ETEA 4HPXB 3RWBA 3WGUA 3RT7A 1V3TA 3UAGA 3UHOA 4N49A 2DU8A 2CXSA 1OH5A 3DO6A 3DHEA 5DP1A 1FMFA 2YY5A 3H19A 4PN3A 3GP5A 1S5PA 5AJVB 2EXXA 1HORA 4E5KA 2J3EA 3NJRA 1L8QA 3Q40A 4PWZA 3VNVA 4LWZA 3ZZMA 4W8GA 1FYEA 1Z4KA 1SKAA 1GUZA 1G98A 4WLOA 4WXHA 3EA0A 4YEDA 2EQ5A 3H7AA 4WZAA 4Q7QA 3MIZA 3ELWA 3WICA 3SOZA 2OPHA 5DLPA 3A2KA 3MWEA 1VHDA 4QJIA 4Z4IA 3ZIAA 2D0IA 3GH3A 2IHTA 1YDHA 2OHGA 2QRGA 1FVXA 1IM5A 4MV9A 4N12A 4YMWA 4YQEA 3RRFA 4ZTZB 4DUZB 4F2WA 2AR7A 2FN7A 4RGYA 1TCVA 3O2JA 1S7CA 5LA6B 1CNFA 1Z73A 2P9BA 4WY2A 3DKVA 1U1CA 2FX5A 2ECKA 3KHSA 4YRJA 5B3KA 1W2WB 1YZUA 4BMZA 3VDQA 3KX2A 2V0NA 1K3FA 2R8OA 1CY1A 1R5OA 3IPRA 2IW1A 3F3SA 5CXUA 1CR1A 1JS1X 4Y1GA 1QIHA 4M98A 3K94A 5DBHX 1ULZA 3AI2A 4HB3A 1RBYA 4YPFA 2WTUA 1VE7A 5AOBA 2WHQA 1NVMB 2VHUA 1E9VA 1PL7A 4TV9F 2JHCA 2XB9A 3W77A 3K0FA 5K2OA 1QTNA 4G0ZA 4HYYA 3AIMA 3ZYCA 3AH8A 3O8QA 4PSAA 1NLYA 4TV8F 1G64A 2AUMA 2PZJA 3GJ6A 4Y2JA 4AKHA 3DCNA 1QGYA 2RHMA 3DW1X 3GMTA 1R5NA 4KAAA 4QOFA 1ARZA 3UA4A 2BDTA 1P1JA 1NKTA 2PR7A 3JYPA 2H0QA 4EFMA 1NF9A 4FGKA 3MMXA 5E6UA 5I48A 3BMXA 5H9WA 3VO1A 1M6NA 3A11A 5EYPB 1SY7A 2PZLA 4FTWA 3QXJA 1JT2A 2PBLA 5BV1A 3QZUA 1FTWA 3WGMA 4JLMA 1XN4A 1PW7A 2R8XA 4UOEA 1RLJA 2C2XA 2ZSJA 3MYRA 4RVDA 3ZQ4A 3NS7A 3O2SB 4FZRA 4L74A 5CVEA 4P8RA 1N6RA 1YZ3A 3LFUA 4PGAA 4PG5A 4YJ3B 5YASA 4JI8B 4Z3OA 4AY2A 5M7EA 3H8VA 3EEFA 4RH0A 2ABWA 1JP7A 3CG4A 3PZRA 4V3BA 2ATVA 4PVCA 4ZMRA 1LFDB 2WKQA 3UAVA 4Q4HB 4D80A 4YBRA 4MYTA 4EHHA 1KZ1A 4ZQGA 3U5ZB 4FE3A 1FP2A 1V43A 3OM0A 4RGBA 1NRXA 4Q15A 1Q3HA 1VXOA 3OIYA 3R7WA 4DLRA 1SGWA 3DPIA 2H4WA 3IXQA 2JAPA 3ZHYA 4TUYA 4O4LA 1ZRNA 4IQ0A 4PYLA 1SUCA 1GZ6A 1IUOA 1G3UA 1GKLA 2DE0X 4FX5A 4MICA 1JMVA 4OGWA 1KHTA 4X90A 4ZDIA 3IAS6 2H5EA 3EDOA 3CZ5A 3IVXA 2EFCB 3L84A 2VQSA 3A1WA 5LYJF 5FQOA 3KKPA 2XWSA 1X6VA 3BERA 3I9NA 4JJKA 1U0TA 4H18A 4NYJR 5C4GB 3SG0A 4JL5A 2W2KA 1CS0A 2B3TA 2DBYA 4LI3X 1T1RA 1EGHA 1CUUA 3HFGA 4WAUA 4EH1A 4KXLA 4MVJE 2YNMA 1Z75A 4HXEB 4ZU6X 2FPIB 2PIAA 3IVMA 5AJUA 3E35A 2HT6A 1A9XB 2J09A 1A2KC 4JDPA 3OKCA 1ZK1A 1JDTA 3RUDA 3FXAA 5TC4A 2RHWA 2DPGA 4PU0A 4C2UA 1O7JA 2VJPA 1R3DA 2ASEA 4JKYA 5EMKA 3MMPA 5BN4B 3RU3A 2XXBA 3AUJB 3ETLA 1G5TA 4HB4A 3PI6A 3KVNA 1JAYA 3B7GA 1CKEA 5HMMA 1KEPA 4BL5A 5BRJA 3ZCXA 4O59O 4AG6A 3REQB 3T7JA 5M34A 4J91A 3IPCA 1D1QA 1Q44A 4GWGA 3WBJA 3KNZA 3H9UA 4IVNA 5HIMA 1G5FA 1XQ6A 1I9CA 3H6HA 4UAGA 2QTWB 3D8NA 4JROA 4L6CA 2AFVA 5TY0A 3IE2A 1LUAA 2GASA 1E4EB 2PBRA 3KD3A 1P60A 2FP4A 5H3CA 2SKEA 3WL3A 1PJLA 4RKFA 5LDGA 1E62A 1UPUA 4UFOA 1GLGA 4DTIA 1SXJA 4IR7A 2F8LA 3BEDA 2ZSAA 4KNWA 4NWIA 3HA2A 4HY3A 3HJFA 4EY3A 2B6HA 4ZCRA 2F43B 4HTAA 1YBAA 4KXMA 4PSKA 5SYNA 2XBLA 4B82A 4GM0A 4ZZ0A 3I2KA 4RO0A 4XTCS 3OMXA 3ETGA 4AZ3A 2FP4B 3JATA 2ZQ5A 3L41A 4NK4A 2CMDA 2PSJA 4RU1A 3MSXA 4D8WA 4RADA 3IE1A 5JQGF 4KEAA 4A23A 1RPTA 4EL0A 1B6GA 3QA3E 3VYUB 2CNBA 3WIBA 1U5BA 1T5TA 3DDNA 1INLA 1VRVA 3IMCA 4G24A 4LDQA 1V5GA 2H1RA 4IO1A 2PDAA 1LPMA 4TV8B 5F52A 2ZIVB 3WLMA 4DNOA 5FRDA 3QP9A 3P4XA 3AI3A 2AWNA 4R4JA 4RHEA 4WWHA 2OCGA 4RLFA 3IKLA 3ZQUA 5I7RA 5BW4A 3PKIA 2W0MA 2YZNA 3MJSA 1PJ3A 4O4HA 3NAGA 1FP4A 4R7TA 1MX9A 3RUFA 4IIFA 1IIRA 1QDLB 1BNCA 5AKXA 4YRAA 4JXXA 1HT3A 4OHOA 1YJ5A 5C80A 1XP8A 3L7MA 3BJZA 5EIOA 3Q0IA 5FXMA 1S3SA 4ZFNA 5KNDA 2HZBA 4YRGA 4B8ZA 1A9XA 3K9FC 2HWWA 3ITNA 4G4IA 1R10A 3BE5A 5K0ZA 1C9JA 3KSUA 1CDDA 3D6HA 3W6PA 1WXGA 4E5YA 3AY0A 3WMWA 3B78A 4RWEA 4YYZA 3JQ8A 4GAEA 3U3ZA 2NYRA 1ZC3A 1SKUA 1Z37A 4BMPB 4CCWA 4GPTA 3FDJA 5IAGA 1LNQA 6AT1A 1REQB 2JAUA 2V5AA 1NY6A 3IUBA 4Z4FA 3KSDO 4HNHA 3KEOA 2BP7B 5AICA 2WMYA 3ZDYB 1K63A 1YMUA 2C8VA 3AHGA 4TTSA 1T4MA 4UBJA 3TAXA 5LIRA 2IH4A 4DJDC 3SYKA 1VRWA 3EGWA 1BE1A 1H69A 3K6JA 2P30A 2ZJ2A 3DPUA 4YP9A 1SCQA 4CV1A 3KTDA 1IBSA 3MINA 4IX1A 1JVNA 3AEQB 3GARA 4L02A 3UJCA 4B17A 1S8FA 1TW2A 1MAHA 4IJMA 4BC0A 1AHPA 4E7PA 1GQ2A 1L1RA 2JI7A 1I30A 4MQ6A 5J43A 2VG8A 1PFKA 4G4SP 4M86A 5TMDA 4MI3A 1QFMA 2ZLBA 3WIUA 3JARB 3HGTA 1P77A 4EHDA 1NXXA 1EVEA 3LLCA 2I54A 4N7BA 5E4FA 3BT7A 2L19A 2ZIEA 4JY7A 3A6KA 1I6MA 4L08A 5A02A 3M3HA 3ENVA 3CF4G 3PL1A 3CGWA 4HQKA 4IOJA 2AQIA 4KFTA 4LBZA 4ZAXA 3H8WA 3QNUA 4DB2A 3WGNA 5CAEA 3DEZA 4AVYA 1XZKA 1H2HA 1TA0A 1U0SY 4X7MA 4LMRA 4DMRA 3DHNA 2NYAA 4Q1BA 4A1OA 5KVAA 4C2BA 1C14A 2BF4A 1S4MA 3CLRD 1BZYA 2WTNA 3FH0A 3QVVA 4FMDF 4N82A 3SSNA 4D8XA 3R23A 4K9QA 4RA9A 4TYNA 2IHNA 3A36A 2BMEA 3G8BA 5TQVA 3O75A 2AXEA 4G5SA 4MI1A 2VOJA 1QKKA 5ISMA 1KC3A 2WV7A 2X1LA 1JQLB 1JNYA 1ORDA 1F17A 2UZAA 4IO0A 5DV9A 1D1TA 3ZDZB 4BJ6A 3QPBA 3H2JA 2XYQA 4JL6A 4MO9A 1H94A 3DMTC 4QHYA 4BBPA 5AYVA 3LW7A 1E1KA 1QOZA 4ZHQB 2VJOA 2QRHA 2VPTA 3K0AB 3PHIA 3SGLA 4DANA 4DOMA 1R0SA 2WUEA 1SQFA 2XD9A 3PFFA 5HQJA 4HL6A 1U7HA 4A9AA 1V5IA 3KXKA 3GJRA 2DMRA 3U6BA 1HF3A 1ZR2A 1GO2A 2JFFA 4ZKEA 3EHDA 3T3DA 1QYCA 5FOTA 1TAUA 4CTKA 2WE7A 4C7BA 4ZOBA 4BKUA 1ZR4A 1VPEA 1QMPA 2OAP1 4OMUA 3TF5A 3QXXA 1HE8B 3BD9A 1MIOB 2CD7A 3RV4A 2YDXA 5JS7A 3IMEA 1C3JA 2GOYA 5COQA 2DXIA 3CX8A 2H16A 4R9UC 1GG2A 5ALGA 1WDLA 3H8JA 3NNSA 1FVHA 4EITA 4Q9JA 4Q1DA 1VI5A 3RBXA 2XQFA 1KMIY 1U9YA 3C98A 4FX2A 1ZJ4A 1SU6A 4FQ8A 4JDUA 4R2WA 3WB0A 4A0SA 5HQ3B 2X2FA 4D6PA 2PTGA 4QUAA 3HYRA 5COAA 3U13A 3D3WB 3CBGA 5D3QA 3UMBA 5DULA 3QYAA 1MENA 4PZYA 4BQEA 2P9JA 1RMQA 1A8UA 4REMA 4R0NA 1H6AA 3L7AA 4OSOA 1ENPA 1VJTA 2RHCA 2W37A 3HVUA 3EMVA 3R0ZA 5ER9A 5CPFA 5FORA 4BZZA 4DCPA 4DLVA 1IAQA 5HQ3A 5ITZA 1U8YA 3MTQA 4LZOA 3ND7A 5K8CA 1UEIA 1BRTA 2V8BA 2JHAA 2HUPA 1EQUA 3E48A 4QNNA 3KE8A 5EMLA 2AD5A 3JQAD 4BC1A 3ESRA 2H1CA 3MF4A 6PFKA 1D5WA 3RYCA 1L5ZA 3O8OA 2C5FA 3O8DA 3ZIUA 1XZEA 1FUYB 1YR1A 3DE2X 1KGDA 4FMDB 3I76A 4K9DA 3SCZA 1K8RA 1Z28A 4OHMA 3GF4A 1EMDA 4GP9A 3TSOA 4AUMA 4CKEA 3QKTA 1EHIA 1G41A 1DKNA 1R6UA 2H6EA 5G1NA 4DILA 1WBDA 1UFQA 1E2DA 4FD2A 1V9LA 4XDGA 5JASA 4ZALA 1CQWA 1R18A 5A6VA 1W85A 2CHEA 5EZYF 3JALA 4PYRA 5KMGA 4F7WA 2CMKA 3TDKA 3AVXA 4HFJA 3F9IA 5KCZA 2VTBA 1T4BA 3TIVA 3W7AA 3NTOA 1KKLA 2GAJA 4RK0A 1P2VA 5EHZA 1DOAA 3VQTA 3NEYA 4EO9A 1FE8A 4RCVA 2QJTA 3K5IA 2H2DA 3U4CA 4XPIB 2R9VA 1IUKA 3B9BA 1UQUA 4U7GA 3LPNA 4CODB 4PAQA 5F3RA 4I4LA 5F98A 4FFVA 3UF0A 2E82A 3KKQA 3AERB 3BEOA 2NU9B 2GTHA 1C81A 2QEQA 3BB1A 1XLWA 3QLVC 3SS7X 4D2IA 3LPAA 1EE9A 4HKTA 5TMBA 3KKKA 5EQDA 2MU1A 1D6NA 1W47A 1K1EA 3EOAI 5I8ZA 1A7UA 1VE1A 2QM0A 3OFNA 3OPYA 4UZSA 3UHPA 3TBFA 1MAUA 3LPCA 3Q98A 1CRLA 3CY6A 3TFOA 3IUSA 5E2BA 3L07A 2PX2A 3OE4A 4UARA 3GQBA 2EU8A 1YKGA 2HU2A 4GVLA 1L5WA 2JW5A 4DLKA 2KMLA 3B6EA 4LFCB 3T1NA 4LRQA 3UC5A 4Q4AA 4RMJA 1G8HA 5JCOC 1FMTA 4XPZA 2X0FA 4QG3A 3B38A 4CGZA 2LCFA 4JYPA 3TLGB 2OZEA 3ACDA 1EFLA 1C9MA 1W4RA 3D5EA 3PRKE 1JAIA 3WDLA 5B64A 2M98A 4JITA 2AYXA 3VZQA 4BFVA 1T3GA 1G38A 2AB0A 1Z5ZA 3I34X 4KR7A 2E4YA 4YC7A 4EJSC 1K0UA 4XM0A 1P0FA 2XQVA 1HH4A 2R3SA 1R8JA 3U3OA 2GPWA 2QD1A 1A98A 2A1TR 4WLVA 2NOAA 3IX7A 4MW2A 1A95A 3V9AA 3W9YA 4RTKA 4E3ZA 1IM8A 2UUPA 4LISA 5FT9A 1JG3A 1NR1A 1YL7A 3QEKA 3R5TA 4Q3OA 3CB2A 4JC5A 4RKYA 3CZMA 4JOBA 4MI9A 4S1VA 4LG1A 2P78A 1NP7A 2IUTA 2EDAA 4OHRA 2E1RA 4TL7A 2JD1A 4O5OA 3KYJB 4JUIA 2FQYA 2P7IA 2VAVA 2EW1A 5K0EA 4YCNA 2VK2A 4IEEA 3OEHA 3LK6A 1E79D 1ZRSA 2EJTA 3ZZUA 4JSRA 5KKAA 2CT8A 5EKDA 4URVR 3ZKWA 3ECCA 4AP9A 5EXTA 4CEIB 1I4EB 3D2LA 2D00A 3GZ4A 4OQYA 4OO3A 3VAYA 3WLPA 3SEZA 1GYQA 2SKCA 3CR7A 4HQFA 3DZBA 5GV7A 4XRGA 3GB9A 2Y05A 3CVUA 1UL1X 4CIDA 2YQZA 4EB8A 4ER7A 1KTVA 2BFPA 5DTEA 1ZYUA 2A5DA 2HLHA 2JLCA 4C0LA 2A30A 3B12A 4PPQA 1V3VA 4A8JB 5CYFA 4D56A 1SCUB 2JH3A 4TKUB 1UK6A 2CSUA 1EFPA 4MQEB 1GILA 1J2TA 1FRNA 2HPZA 1JU4A 2WILA 1V6AA 1T0IA 1ONNA 3R0IA 5LUBA 5F78A 5JADA 4HYQA 2YINC 4XE5A 3UOWA 2ZRHA 2WK1A 3VDMA 2FSGA 2XIQA 1R0XA 4JVOA 2PQ0A 4KODA 4QBKA 4W5WA 2QGZA 2W11A 3WIEA 2ZR8A 3ILSA 1CQPA 2JLRA 2CEAA 3PJEA 4OJQA 3S2GA 4D98A 2DKFA 2TS1A 1V1RA 2LDBA 1UBCA 2Q1TA 1V11B 3EZGA 2JF0A 3LCMA 4P4GA 2CVFA 3RYHB 1BXGA 2UYHA 1AT1A 2ACVA 3D64A 5FCDA 2OGTA 4A6DA 4EB6B 1Z6XA 5FA5A 5CCBA 4KMMA 3DDZX 5GM2A 5JXJA 3PHLA 1OOEA 3F7MA 1NOJA 4BX8A 2W48A 2WU0A 5DYYA 1KU0A 1P29A 3M6AA 1MOSA 4S35A 4DM4A 4MA4A 4QNMA 3STYA 1XTSA 1AB5A 2QMUA 3N6VA 5D3MA 1J42A 4MS4A 3TL2A 4B4OA 1SVKA 1J0AA 4XVRA 3RGGA 5LWHA 5LD2B 1E1RA 1Y1TA 3JVUA 2V9CA 4YV7A 3U7EB 1KO4A 3D8UA 2WBLC 3SJAA 1FRVA 4EUFA 2P9FA 3TVTA 2PUWA 1E6UA 2UV8A 3UMSA 2A9QA 3BJRA 3ULKA 3ENZA 3I2GA 1FNDA 4DMKA 3FNRA 3R6TA 4BZWA 2VRBA 3ZY6A 4ZC8A 1W6RA 4B6FA 3LD9A 3O8CA 2O2HA 4RXUA 2EQBA 1E5XA 1HE1C 4Z9AA 2I4RA 2H92A 1IZYA 3MBOA 2ZPUA 4JOQA 2FP3A 4CLRA 4TKLA 3W2GA 3K32A 4TMVA 5K3CA 2TMKA 1JNXX 4Q02A 1WSWA 3WXMA 5C4IA 3V8NA 4TYQA 2IYSA 1UMKA 4YFVA 4TXHA 4L6AA 2BJHA 2OG2A 1W0KA 3PGMA 1NDQA 1GPLA 1SD1A 1U7UA 4WZBA 5DNUA 1Q92A 3KK0A 3W7BA 2O8BA 5HUHA 4F12A 2EDCA 4H3SA 4PQYA 3VDXA 2FW1A 3VYVA 3I37X 5A7HA 4ZI7B 1CUCA 5E1MA 5FUMA 3EFOB 3PR2B 3NT4A 5LQAA 5J5VA 5THXA 2DKNA 3QLTA 5GZ6A 3HEAA 5CH5A 2BI4A 3GLHE 1A5AB 4OQ4A 3IQFA 1QIGA 4HB0A 1N1DA 2X77A 2Q7DA 3T4EA 1ANKA 1F0NA 3PPIA 2Q4OA 2MSWA 3AXTA 5TX7A 4YJ3A 1IEVA 4IDGA 1ZSNA 4KV9A 4B7CA 2H4YA 1EQAA 4HDAA 4KIUA 5TIIA 2R7NA 3H18A 1WUJS 2QP3A 1SXHA 3ANXA 4Y6QA 1KR2A 1ZJYA 2JEOA 4KXXA 2VHCA 5A62A 1JW9B 3WY9A 2Y0PA 3N2GB 4FVTA 2BFCB 1EGMB 3L82B 4RETA 4U2BA 1CEQA 5DOZA 1V48A 5BWLA 1T15A 4HRVA 5HK9A 2B1RA 5DW0A 2FHPA 3STUA 4CM9A 2A0YA 3GLFA 1JLSA 4M7PA 4KI0A 2GN4A 3A58B 4URZR 4RHCA 5CA1F 4K6GA 2JEYA 1JEDA 4JR0A 1YTUA 2BFDB 3ZWBA 1O57A 2EGGA 3ABQB 1LB1B 1VFPA 1LVUA 3H5RA 4MMYB 5AKZA 1VSVA 1EWRA 2YASA 4EPRA 1R12A 2CVQA 4ZICA 4CF7A 2NT3A 2F3TA 3LP5A 1DTEA 2UVQA 3CWQA 1HSZA 3FMFA 3HO8A 5ETJA 2PUAA 1TIKA 2WU1A 4PX2A 1BXRB 2ENWA 1XTBA 1ZGBA 4LNHA 4Q7EA 2B20A 1GEEA 1Y9EA 4WNAB 4EG8A 1I6LA 3LY8A 3RAPR 1H22A 2IDKA 1KVSA 1RTTA 1E1QD 2WNHA 4WZZA 5AKLA 4BFCA 1ATIA 1JR3E 2I3GA 3EWAA 4J1QA 1A2OA 2J0EA 3WHKA 5F33A 4NV1A 4PAGA 5DW3A 1KPHA 5HNKA 1XI2A 2QXUA 2D13A 1P74A 1DBSA 2VLIA 3FCXA 4HLNA 2X1VA 3P2OA 4TRNA 1MRNA 3OPVA 4LE2A 4LJRA 3AOEA 3M4XA 3EISA 2W6ID 3O4FA 4FNAA 3DVAA 2IV2X 2JZNA 3SHQA 3CA8A 2FEWB 3C7AA 3WL8A 1TJ5A 4BKQA 2UUAB 1Z25A 4MPRA 1NJGA 5A5DA 1NQWA 4ZAFA 2FG6C 3CLUC 3PR1A 5A1JA 4I81A 4CM7A 1TZKA 1RTKA 2X0NA 3DOHA 4YRRA 1O6ZA 2HSZA 3PRYA 5LWQA 1NV9A 3C5EA 4WH0A 4Q9LA 3LI2A 5H81A 4RZ2A 5TMPA 3DXYA 1JDVA 3KV1A 4URXR 5JFOA 4LECA 4LDPA 1YZTA 2I62A 1D1SA 4GI2A 5LZ4A 3EIFA 3IS3A 1YR9A 3RKSA 3UQYS 2HD4A 2N1MA 2R6DA 2O1WA 1C7EA 3THSA 3AR3A 4M1ZA 1NBME 2WYUA 4MTCA 1X8XA 4A10A 5FPTA 1OFGA 4XWGA 5IVPA 3QUAA 5K0BA 4I36A 2DHCA 2CE2X 4AMBA 1F12A 4RVFA 2DRIA 3IJ5A 4MRRA 1EGVB 1VPDA 3PUJA 4E03A 2L82A 2Q8QA 3GIDA 3MRVA 5I5EA 5AHKA 3WK6A 2AI2A 2HRZA 2QX8A 1BN7A 5HRUA 1S8OA 1Z0ZA 1Z5UA 5KDOA 2C8LA 3E7WA 4MYCA 1NONA 4HNVA 3VOSA 3U09A 3F5QA 1OZ0A 2C2OA 3PWSA 3FY4A 1TGVA 3O0DA 4K9PA 1AK9A 2OTCA 3T0FA 4HDQB 4BRZA 1QX4A 1W4BA 1A9PA 5JD4A 1UBGA 2CLHB 3KKOA 3ZE6A 1GT6A 1UEXC 2OECA 3AR6A 1PLJA 4NEGA 2X1MA 2H4JA 1X13A 2JH8A 2WVJA 4J03A 3UXMA 2VWQA 2HNAA 4IJKA 1WJGA 2VCEA 4YMIA 2E4ZA 4UM7A 4KN6A 1EFVA 5B37A 3OCXA 3SR3A 1YR6A 3OIDA 2DPHA 1XTRA 3ODPA 5P21A 5CVTA 3VGJA 4ZVKA 3TQHA 2CLMB 1JDJA 1JEOA 1CTQA 5J4VA 1HT1E 3NVKI 1T6NA 3SIPA 3WIOA 5ERXA 1GDDA 5BRAA 1TMKA 4AS3A 5I4CA 4CE6A 1PNQA 1U3GA 3BCRA 3DUFA 4YASA 1UMDB 2IUYA 4EIWA 4ZYVA 3RU2A 1E9SA 2GBCA 3IAHA 3IVRA 5JMWA 2RHTA 4AZ3B 2FPUA 4LJ7A 2DVMA 4F4IA 4JJFA 1GD1O 1XRNA 2C96A 2Y93A 2X15A 2Z3ZA 3AETA 3LBHA 2QQ5A 3D31A 3R7DA 4BNXA 1UM9B 3FLAA 3EVNA 1MEJA 3VU9B 1X3LA 4Y18A 2E55A 2H7XA 3EASA 2FW9A 2CUNA 1KYWA 1T9GS 1SKYE 2H06A 2R1VB 3U37A 1E79A 5CFLA 1GVNB 3KHUA 4DIUA 4Z51A 821PA 1YI0A 4XQCA 4EG0A 4PO3X 5AOCA 2XDQA 3NHPA 1QE0A 1N8KA 1P18A 4GVXA 2WD8A 5I7WA 1L4MA 5AOVA 5A9SB 2GTIA 2VWGA 3FGNA 5M3BA 2CBXA 3SN6A 2JLVA 3WI7A 1OFVA 2Q7XA 4LHEA 1QLWA 2G5TA 4ND6A 1Y3FE 2RSLA 3G9ZA 3UB2A 4ZZ3A 3NBUA 1GU7A 5J2UF 3E3NA 1KOGA 4UAJA 3V55A 2NU8B 2WIKA 3ZEAA 4JI7B 8AT1A 2W98A 1X8LA 4H4EA 4Z54A 3ZXXA 5JO9A 5CD1A 2C3PA 3OX4A 4CDNA 3LGXA 3W8FA 1DG9A 3O9MA 3VZSA 1W9MA 3IPYA 3U9LA 1IUPA 3ZZ1A 2I99A 4R2KA 5AHRA 1T1GA 2PG3A 5REQA 2H7CA 4WLEA 3BH0A 1XPJA 1P6QA 2R6ZA 1PZXA 4DRZA 5IABA 4EHLA 3PPXA 3WQHA 1L7OA 1NAHA 1Z0FA 2CHVA 2YXNA 2GF0A 4RIEA 2OGWA 4E2YA 1D4ZA 3TR5A 2KPOA 1R0BA 2CLKB 3L3BA 1IN7A 3KPWA 2O2JA 1EUDB 1LGYA 1YFKA 3ONNA 1U5BB 2G7MC 4WXYB 3JZIA 3ZDFA 3EVCA 3I6IA 2VP5A 1I51A 1R9GA 3PB3A 4MLPA 4DRYA 4X66B 2H1WA 3QJ5A 1QX3A 2X22A 2AVNA 5EWLA 3SSOA 1FU7A 5GQSA 2RGAA 4NH4A 1UBKS 3IQHX 3EQ9A 5EZQA 3S7ZA 4KDCA 4JYAB 4PZZA 3MS4A 4R1LA 5BN3B 1CZHA 1EVYA 1QDUA 1TQ2A 1H2AS 4KO4S 5NULA 4BKOA 3OQNA 2ENUA 3MA0A 4LQCA 2FEMA 2WIGA 2VEOA 4YJGB 3ZDXB