4E03A

Structure of parf-adp form 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
206
structure length
204
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Plasmid partitioning protein ParF
total genus 69
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e03A00
3D31A 3RRNA 5FBQB 1I4LD 4XOIA 2ZYVX 3TRFA 4BZQA 3ZLJA 1XXHB 2CJWB 5E7JA 4D4LA 4DB4A 1T0JB 4IEEA 1IY0A 2QRNA 3K0SA 1YZTA 1TF5A 3Q7QA 1OYYA 2QMHA 4TYYA 4QXAA 1SVWA 4GI7A 4GRAA 4A92A 3ZDQA 1YZNA 1VDZA 4EPXA 1Q12A 3C5CA 3QVVA 4PO9A 3SFVA 2OFWA 2YOGA 4GDFA 1E98A 1W44A 4Z1MA 1II9A 2IEYA 1NVVR 4QC2A 2F9MA 1OH6A 1NN5A 2WWIA 4IXMA 2QP4A 1C9KA 3GLGB 4NYMQ 2AK3A 4ILEA 2R9VA 2E1RA 4AC9A 1M6NA 4RFSB 5KU1A 1OXVA 4Z1MD 2C96A 2VSFA 3KB1A 3U6KA 3BC1A 4XVRA 2IXEA 1TEVA 1R5BA 4B43A 4D4MA 1RVDA 2IWHA 1Q1EA 1P60A 1R0YA 3KKOA 3TSOA 2ZR0A 1GKUB 2P6RA 2GTPA 1VIYA 4O2RA 3KZ1E 1ZM2A 4Q4LA 4UNPA 1OB5A 1ZU4A 2RHMA 1F6BA 3IO5A 1PUIA 1CULC 2ZJAA 4NP6A 3RVBA 3U4QB 3VNUA 4FMCF 1KI6B 1AJEA 1NVWQ 4RZUA 1G7CA 1Z6XA 1FTSA 4Q5IA 1X8LA 2QRZA 4YMSA 1L7VC 4ABYA 5IRCD 4TZ6A 1Z5ZA 1Q3TA 1N5JA 1OJLA 2IK8A 1AIPA 2BKUA 4P4TA 4P32A 1BYIA 3QPUA 4RSGA 2GEDA 4LHXA 2KBFA 3TE6A 3GP8A 4W9MC 4EDHA 4MYTA 4GP7A 4JJZA 3AM1A 2Z0MA 3AVOA 3LDAA 4CYMA 3SHFA 2RGBA 1W5SA 1R7RA 3BFXA 1P6XA 3FKSA 4PPGA 3THWB 3KUDA 2OE2A 2IHYA 1JR3E 1T4GA 1AK2A 1UAAA 4MKIA 3SBDA 3I1FA 3I72A 1U90A 4P4UA 1DOAA 2NZJA 3GEHA 1DPFA 4M9XA 3Q85A 5FL7A 4AG6A 3GJ6A 5JWRA 5L3SA 1PVOA 3DM5A 5KNBA 1CR1A 3B9QA 1G41A 4NZYA 3BXZA 1U99A 1P9NA 2WJJA 1R8QA 3U3JA 1OKKD 2WWYA 2GZAA 4JBXA 4F7WA 3VHXA 1FQJA 5KOYA 3PV0A 4DT1B 4AD8A 4URWR 4M9QA 2ZUCA 1ZC3A 5A5GA 5L8VA 3THYA 4ZPXA 2GK6A 4HLUA 3UMRA 4D25A 1NBME 4BECA 1OXSC 4LBYA 3AGPA 2GXQA 3UPUA 4C7OB 3QJYA 1XPRA 3Q5EA 1XZQA 3B1ZA 3AQ4A 3EPKA 4JYBA 1XEXA 2JJ1D 4HDQB 4NCKA 2JLVA 4BLOA 4PFSA 1NI3A 4JKYA 3T35A 2QSYA 1ESMA 2KB0A 4JVSB 2R6DA 1FOEB 3BH0A 3IIMA 4OHYA 4QHYA 3QKSB 4JZKA 4E03A 2O0JA 4FCWA 4F91B 4HZUA 1UBGA 2ZXUA 4LJYA 2BMJA 4DBLC 2AL7A 2L0XA 1Q0UA 1UJ2A 5G41A 3LXRA 1YZQA 2QT0A 3FTQA 4P31A 5DI3A 4A6PA 4BEBA 1JPNA 1EFTA 4BZXA 4TMTA 2A5JA 5E3HA 2JLYA 3CH5A 4B3XA 4O2LA 1S3GA 3VKHA 4Q21A 4ZI2A 4P4SA 3RABA 5FTJA 1OW3B 4YLGA 1IJFA 1US8A 2AX4A 2Q0HA 2BCGY 4A0HA 1Z6GA 5EP2A 1QG4A 5DYIA 3HU3A 2ANBA 3FMOB 2FWRA 3K9LA 5J4VA 1XEWX 1XTKA 3P4YA 3G5UA 2IYRA 2KI5A 3L2OB 3L0IB 2O5VA 1ZM4A 3CRQA 4LJ6A 3KQNA 2OBLA 1MRNA 2Q21A 1GZSA 1TU4A 1E1RD 1OT3A 1OFUX 3UMSA 3QKRA 4A0FA 3ZZ0A 4EPTA 2JLXA 3VR4A 4CEHA 4XWOA 4EQ6B 1U8YA 1Q22A 4W7SA 3L0OA 5JCPA 2J0SA 3NIBA 2BDTA 5CM9C 5HPYB 2BWJA 4US1R 1KSHA 2PZGA 1N0VC 4ERNA 4TL7A 4JSTA 5FPTA 2YINC 4V02A 2XXAA 2ZI4A 2H8KA 1Y3AA 4M1MA 2WOJA 1OXUA 1N6OA 1ZNXA 3CWZA 3I3SR 5FBLB 5FOSA 3RS7A 3W8NA 3REFA 3TR0A 1G16A 1CJKC 3GFTA 5EZ6B 5TMPA 1SVOA 4LV8B 4EJSC 3CW2A 5C4GB 2J7PA 3CB4A 3TVDA 2HJGA 3H84A 2VLIA 2A9KA 3ASYA 1GKIA 5JMTA 1NVXQ 4WBSA 5CITA 1R2QA 1FX0A 1HQYE 3G82C 2RMKA 1G8GA 4PPFA 4DCTA 4DDUA 1ZM9A 5L3QB 1UDWA 5J4LA 3QBTA 5FR2A 5BYJA 3L0PA 3LD9A 4LJ4A 3X1DA 3T5GA 1G4UR 1W2GA 1W0JA 3WY9A 2H5EA 3L43A 4A8JA 3BH7A 4PHGA 1XD8A 4Q66C 1KMHA 1J99A 1G8YA 3LVQE 2XZLA 1UF9A 3C15C 4C9BA 1CJTC 5KO2A 5SZHB 2OZEA 1E2LA 4RCYA 1R0WA 3MUFA 3GEEA 2QN6A 4GT1A 4DSUA 4KSCA 1GIAA 1E99A 4WZAE 1L8QA 2P65A 4P3YA 2AWOA 4EJSA 4OL0A 2VP5A 5P21A 5KSYA 4BLQA 2DBYA 2ZS9A 4PC6A 4I4LA 4QM7A 2JJ1A 2JLWA 4CEIB 4YXWA 3FFBA 1Z0IA 3AF2A 4DCVA 2CHQA 4PC3A 5JI2E 4TYNA 3LVRE 1FUUA 1DE0A 2WSSA 3R8CA 3BJIC 1VMAA 2PT7A 4FI3C 5KSPA 5CYPA 4AY2A 1UADA 4NTZA 5EXXA 5JHHB 2B92A 2JLRA 4IDNA 4YMVA 1KK2A 1E2DA 2GEVA 2YVUA 4JVNA 4OI0A 1SXJC 2FG5A 2OM2A 4RD3A 3IQXA 4OI2A 5CK5A 1E2HA 1Z22A 1G3IA 2V6IA 4Q7MB 3EA0A 1RPZA 2WAXA 4XVQA 2F1HA 3OEHD 4NBSA 4S35A 4C4PA 5FOVA 2QP9X 4MA4A 5TB5A 5AWFC 4OHZA 5B57C 5A0FA 4B44A 1E9BA 1S0UA 3BRWD 4L9WA 3NDBB 3PITA 4Q1BA 1CTQA 4TL6A 2GETA 5CLQA 3D3QA 4A8JC 4Q9IA 1WF3A 4PC7A 4X8OA 4MGZR 3U6BA 3AKEA 2HLDA 4UQOA 1DARA 2F7SA 1ANKA 2BKEA 1XMIA 3OIUA 4LY6A 2ZE8A 2VHCA 1E9AA 4OHVA 1TQ6A 1I4DD 2GNOA 4JS0A 2UVQA 3I5XA 1CEEA 4Z51A 3WP1B 2DWPA 3IPXA 1SVMA 4U00A 1Z6TA 2ZRJA 2QAGC 1S8FA 4LOAA 1N6HA 5JRZA 5UKDA 1XMSA 3QE0A 1Q3HA 2QZ4A 2BBTA 3JZMA 2DFLA 4IVQA 1NNEA 2NZ8A 4IEIA 1HQCA 2O8EA 5CIQA 4DDWA 2PL3A 2GJAA 2IW3A 1ZC4A 4NMMA 4B3GA 3CZPA 2OG2A 1JEEA 2D4HA 3TLXA 4ASUD 3CZQA 1E9DA 2XX3A 3I5YA 3ZQJA 5IDVA 2G0NA 3LLMA 5LBIA 2J3EA 5K8IA 1GAJA 1Z8FA 5J5CA 3GJ4A 4B2LA 1X1RA 2VTKA 4DIEA 4XSGA 3U3KA 1KGDA 5LB4A 1GFIA 2J0UB 3A37A 5DI9A 3WNDA 1T5IA 4AURA 2W2TA 4MGKR 4C0QC 2P6UA 1FP6A 3K70C 2F43A 2IC5A 1NJFA 1Z47A 3QF4A 2OXCA 1VHLA 1XTJA 1CU1A 2CVHA 4R71A 3QKTA 1E2JA 4UNNA 2H17A 3VR2A 3WRYC 2IF0A 2NG1A 4A36A 4UXJA 4BASA 5FBRB 1DTSA 1XXHA 2CJWA 5DHAA 2IYZA 2XSZA 1KJZA 2ZI9A 4M8NE 3BB4A 2R6CA 2ODBA 3QVUA 2GEUA 1IQPA 1FFHA 3SJZA 3GLGE 1J8MF 2ZJ8A 4PHFA 1X3SA 3EPHA 2DCUA 2QE7A 2J1LA 4LDJA 1E0AA 1E0KA 2XEXA 1Z6YA 4KCGA 1IBRA 3A4MA 3M0EA 3VMFA 2KJQA 3D6TB 1U98A 3RSOA 3KQKA 1TEXA 2BBWA 5F2EA 2D7CA 4LC0A 3LBNA 3F8TA 4TYPA 2OCAA 3U7EB 3QEJA 2VL7A 1KSGA 1UKZA 2XNDA 4M2LA 1NSFA 3W8RA 3BE4A 3DMDA 4JLVA 3BB3A 4C0HA 1GNRA 1NRJB 4IFEA 1K6MA 2GESA 4MUAA 4FCTA 2ODEA 4LUCA 1DVRA 1N6PA 2XOKA 2J46A 1FNNA 3NDPA 2YWHA 3EIQA 1OB2A 2OBNA 3B1YA 5KYKA 2AFIE 2QA5A 4B35A 4BZPA 2WMNB 5KDDA 2WKRA 3TIFA 1NMYA 3MG9A 4V0ME 3OE7D 4TT3D 2QMUA 2ZI7A 1SVLA 3EAQA 4M1WA 721PA 3RRYA 4RKEA 4KLNA 3AGQA 2VHQA 4HLCA 3RANA 4M53A 3OHMA 5JCZA 4NYJR 4HAUA 2VP9A 3CKLA 2JASA 5KUTA 3GCGA 4D4JA 1PLJA 1GL9B 1XEWY 2ZI6A 4TLEA 621PA 1OSNA 4TSFD 3K70D 2V55B 3FMIA 2HV8A 2EQBA 4JT4A 2GKSA 3LA6A 3O8BA 3SQXA 3QXXA 1QHXA 4B74A 4QJ3A 1W0KD 2FSHA 1ZNWA 3HU2A 2D3WA 4V0KA 3SDZA 1BOFA 3SHWA 2G77B 4CIDA 2C98A 3B1VA 5JJIA 1Z0AA 1RW4A 5J40A 4UNRA 3ICQB 4Q47A 2R6GA 2W00A 3J81k 2Q9AA 2W6ID 2QUZA 4PX9A 2ANCA 3GLGA 3ICEA 4IDOA 1YRBA 2I1VB 1N6LA 2W6JA 1S9HA 1UKEA 4QGGA 4G5RA 1C4OA 3QBVA 4MITA 4TN1A 3QENA 1GG2A 2QGNA 1VECA 1XTSA 3MFYA 3CF2A 1QZXA 2OHFA 2GWHA 3K9GA 4JL6A 1W4RA 1SGWA 1N3BA 1G3RA 1IN4A 3VR3A 2PJZA 1JAHA 2OV2A 3C41J 3PXGA 1N5KA 3E2IA 4LRWA 4PTLA 4BGDA 1ONBA 1E32A 4C0AC 1XJQA 4E09A 4C2UA 3A1SA 2JIZA 3NXSA 3FWYA 2Z83A 1NG9A 2O8CA 4I99A 1RRFA 2UZ3A 3AB3A 3Q8XB 1YR8A 2BM1A 4KYUA 4PANA 3SYNA 3SS8A 5KDOA 1LNZA 1S1CA 1XD2A 5FL3A 3AF1A 5BN3A 1T3LA 2RH5A 2ZUDA 4L15A 2ZRBA 2Q3HA 2BJVA 3A8TA 4HDOB 3CR7A 2JLUA 3CRMA 4Y0AA 1TU3A 1W2HA 221PA 3W9YA 1G8PA 1S4QA 3EZFA 4EPYA 3QPVA 3WNCA 2XB4A 1H65A 2NTYC 1KI8A 3AF0A 4QG7A 1KYIA 2HT1A 1TQDA 4KJZA 3GLHA 4Z8YA 821PA 1E9EA 1SZPA 2ZAOA 5AUNB 3SOPA 1MR3F 1ZMXA 2JJ2D 1LY1A 3CX8A 4B34A 3K70B 2XNSA 3ZYCA 4I1VA 4QKQA 1N5IA 2ONKA 1FMJA 1OIVA 1IOZA 1R10A 2B8WA 2OESA 2R6AA 3BD9A 4PSVA 4QGAA 1LF0A 3W6PA 4NCJA 4AG5A 1KY2A 4F4IA 5KNCA 5KTYA 3ZS9A 3I62A 4DLXA 1J2JA 4OHXA 3RDPA 1KSJA 1R0ZA 1SQ5A 1VYVA 2EWVA 3Q9LA 1GNPA 2NO1A 4JLJA 4Q9HA 3WP0A 4RCZA 3T06B 2ZJYA 2F1RA 3U7HB 3KJHA 2FX3A 3LNCA 4PAMA 2FN4A 3K8YA 1KNQA 1NY5A 3TAUA 5FTMA 4TYWA 3GLFE 1P9WA 3B8HA 3AVXA 1UM8A 3I8XA 4KV9A 4QBGB 1HYQA 2ONJA 1YE8A 4K8OA 4RD2A 1CJMA 3W34A 1JEDA 3TUIC 3QNUA 4QHSA 3PEUA 2W83A 2QGZA 1P62B 1MABB 1ZM3A 3GLIE 4A82A 3MJHA 5CYOA 3NBFA 4GOKA 1G17A 2QNRA 4FWIB 4LPSA 5EP4A 1Y63A 3N70A 4UJ5A 4CVNA 3MWJA 4UNQA 4DIDA 4BFZA 3EXAA 4BLTA 1WE2A 4PZYA 4V0LA 5FI0B 4DLVA 5EP3A 1P75A 2BC9A 3FKSD 3VR1A 2WIBA 4B6EA 4URZR 2J0VA 1VIAA 2XTNA 4BFXA 4CEJB 3SZRA 2DY1A 4O25A 5FOTA 3DO6A 3PUVA 4GBMA 2HLDD 4OK6A 2ZRKA 3CO5A 4D26A 4JSYA 5DISB 3UMFA 3EASA 3UXMA 4TMWA 3CNNA 2DFNA 5AJXA 2P2LA 2GCPA 4I1SA 2FNAA 4DCNA 4EFMA 4A0GA 2FZLA 3U4QA 1WDTA 4RD0A 2VF7A 4IXNA 2YZ2A 2DR3A 2FGJA 3IPYA 1OE0A 4BFTA 3BERA 2UKDA 1EFHA 3PR1A 3RHFA 4ARZB 4FWTA 1A4RA 1U0HC 1NBMD 2YOFA 5CM8B 4G1UC 4NONA 5FUXA 1OV4A 1CIPA 2GRJA 5BN4A 1VG0B 1KZ7B 2ORIA 3U2QA 4G3XA 1GUAA 1N6RA 1YJ5A 4Z54A 1Z0DA 1NKTA 2GXAA 1NVVQ 1H8EA 1HA3A 4LC1A 4OQMA 2IT1A 4BLPA 1E2FA 5DO9A 1E1QA 2MMGA 1CP2A 4Q4JA 1CLUA 3AKDA 5AJZA 2B7BA 3LW8A 4HLQB 4Q1DA 1ZBDA 1P61B 3BK7A 3A4NA 3EARA 3QXSA 1WB9A 4HAWA 1DAMA 3CPJB 5L3QA 1XTIA 4ITRC 5DSZA 2QP3A 4D80A 1KI4A 4D0GA 4BQSA 5EJEA 1UBCA 2BIFA 2DWQA 5FBWB 2GCNA 4KSBA 4A15A 3QXJA 2VBCA 3K0CA 1TNDA 2GVDC 2N42A 2O0KA 4DLSA 3BB1A 3DKPA 1M8PA 2FDCA 2FSFA 2VP6A 4MH0R 4OJKA 2E9SA 2F1JA 2VA8A 2PX3A 5DN6D 5CLLA 5AUQA 4P0TA 1O3YA 2Z6VA 3MWYW 1E1RA 2WJYA 3CR8A 2GJSA 3BAFA 4KYIB 1OH8A 1J8YF 2GZHA 1N6KA 4Q1EA 4DEXA 3ZJYA 1VCNA 2EW1A 4Q02A 1JPJA 5F9FA 2ZR7A 4B48A 1CR0A 3KL4A 1WQ1R 3L8YA 4BFSA 4C0LA 2WBLC 3B13B 1CRPA 1DS6A 3EWSA 1R5NA 3ASZA 2YYZA 3ZIAA 3QEOA 1E2IA 3AVYA 1E4YA 1Q57A 3IGFA 3P27A 4Q7KA 2J0QA 3AP2A 5TARA 4E22A 5LPNA 1KDTA 2FFQA 2HUPA 3CF6R 1SHZA 1T0HB 2YV5A 1AN0A 2CDNA 1ESNA 4NYIQ 4O0MA 1IN5A 3P32A 4GZLA 2CE2X 2JA1A 5FPYA 1N6IA 2XAUA 2O52A 2OLJA 3W6OA 2ZYWX 4HB2A 4B47A 4YXWD 1ZNYA 2IYTA 4IJMA 2ZPTX 4M21A 4A9AA 3ADCA 1F60A 3RS2A 4HAYA 5JS7A 3I32A 4FN5A 1YU9A 4LHYA 3FHCB 3RS5A 2BM0A 4DSTA 1XU4A 1NMXA 3OZXA 3HP1A 1TMKA 4JMPA 1QHNA 5GJWC 2G6BA 2BOVA 2V54A 2R6FA 4AKEA 1GKYA 2C9CA 5HR5A 2NO7A 3CRW1 4A2WA 2O8FA 2IXFA 5LD2C 2W6JD 3MWKA 1YR7A 3QKUA 2RGCA 2ASEA 1TUIA 2FPLA 2ZAMA 4EKDA 4LV6A 4US0R 2O8BA 1E1QD 121PA 2W58A 4HUQB 4WA7A 1W4BA 2CHGA 5HZKA 4G5OA 3DHWC 1VKJA 2BCJQ 2WWHA 3EX7C 3IEVA 3PUZA 4S2EA 1COWA 1F5NA 1G64A 1TX4B 2ZIAA 3THXB 4FINA 4RZ2A 2X8AA 2ZVQX 5E95A 4TMXA 4DLZA 3X1WA 4B2PA 1CJUC 1XJ0A 4U02A 4HAXA 1DAEA 3FPAA 1C1YA 2C9OA 3M6AA 4XSHA 5HE9A 5DE3A 3WBKA 1KO4A 3NBXX 5H68A 1U2RA 2F43B 2J87A 3QOFA 3A1UA 3RS0A 1PLKA 1F3OA 1AQYA 3EZ2A 3ZIAD 1Z07A 1KMQA 5EE1A 3SE0A 2J59A 2WHXA 4A0RA 4C0SA 5F3WB 4MDFA 1BYUA 5EUMA 3U3RA 3DEFA 1HUQA 1E6CA 2PMKA 2QBYB 4GMDA 1PLLA 1ZD1A 3OIYA 1AS3A 2WWXA 2O8DB 4MDEA 2ZJBA 3GLFB 2KWIA 4M1TA 3VX4A 2VP4A 3V4FA 1A2BA 1S2MA 5CJPA 3F0TA 3MSXA 3HDTA 3DL0A 4EJSB 4QM6A 1EG7A 1WRBA 3KQLA 4KBGA 2YOHA 2CLCX 3EZ7A 2QMOA 1R0XA 2WOOA 3FYHA 2RGNC 1KMHB 1II8A 1N2CE 1QHHB 3REGA 4Q48A 3AH8A 3AKYA 4TMKA 1G5PA 1KK1A 2YKGA 1A5TA 4GMXA 4Q18A 2WMOB 4AYTA 3WMFA 3I61A 1E2GA 1N0WA 4CDGA 1JXOA 2ZE7A 2QAGA 5FPHA 3AVWA 3WRXC 4DDTA 4A8JB 1E0SA 3PCRB 1NMZA 4TLBA 1UEJA 3EC1A 2OAQ1 1OIWA 3SNHA 2QTVB 4BPBA 4JLNA 1Z08A 3O8CA 3B78A 2AHOA 3WNBA 1CF4A 3TKLA 4OK3A 2QORA 4M9SA 1RE0A 4MRVA 5E4FA 4AIIA 2A2ZA 3C14C 3HJNA 4CGZA 2NOAA 1W1WA 2FSIA 2AN9A 5FUWA 3AVPA 4C2TA 2XTZA 4QJ5A 2OUKA 1EFUA 4MUBA 1E79A 3SQWA 2BBOA 3DVLA 3QF7A 3BFKA 1RFLA 3GLIA 5FH9A 421PA 2EFDB 4Q01A 2ZVPX 2IS2A 3PIRA 1KO5A 2VSXA 2JLZA 1NL3A 2ZANA 3TSZA 5JWOA 1D2MA 2VHJA 1QHSA 4DB2A 4QBIA 3MWLA 4CEIA 2J41A 2QQEA 3HR8A 4TZ0A 4V0MA 3B5JA 1BIFA 3QKSA 1EFRD 3ZD6A 4PQFA 1HH4A 4D82A 4DSNA 4YONB 3AV0B 1FUKA 2OCYC 1P7CA 4EPRA 4ZDIA 1ZYUA 1Q1QA 4HB3A 4H9GA 3GJXC 2WJGA 4V0OA 4C7OA 2VF8A 2QY9A 2ZJ5A 5JSZB 1T8TA 2HT6A 3P26A 2F9LA 1E3MA 1SXJD 1VCOA 2H1LA 1DG1G 3KKPA 2G0TA 1HURA 4HEJA 3E1SA 1ELOA 1KTVA 3AVQA 4C0JA 1KHTA 1SXJB 1TADA 4TTQA 1IXZA 3ND9A 3U44B 2JDID 3GLIB 2ERXA 4MKHA 5HTKA 1NJGA 3KUCA 2QMEA 1G7TA 3NTUA 3FB4A 1JQJC 3B1XA 3TGPA 4PHTA 2SHKA 2OFOA 1E96A 3QUSA 2NO9A 2C77A 2GVZC 3CM0A 3JVUA 1KZGB 4CEJA 1S96A 3L82B 1IN7A 1DEKA 4B71A 1MKYA 3C5HA 2PJRA 3CRRA 3EA5A 4RKFA 2IYYA 5H1YA 4CF7A 1NLZA 1L4UA 4QRHA 1QHYA 5KNDA 4RD1A 4F4CA 5B64A 3NVAA 1F2TA 4Q9JA 4M1SA 3I92A 2PX0A 4RVCA 3IHLA 4G5QA 1BMFD 5J4KA 4KODA 3AF4A 4DDVA 1KI6A 2RB4A 2BMEA 4KITB 4GPTA 4WAUA 4OI4A 5JI3E 2HXYA 1FW6A 5JEDA 1OFHA 4GNKA 5JS8A 3FOZA 3G0HA 5DLQC 3SJBA 4KFSA 5BWMA 1LS1A 2XNDD 4FD2A 3KJEA 5FTLA 2EVWX 2B6HA 4MGIR 2BV3A 1G1MA 2ZUBA 1VTKA 3BBPA 3Q7PA 1SVSA 3U3OA 3TK1A 5B58C 3RRZA 1XF9A 1XXHE 1EX6A 3EC2A 5IK2D 2WJVA 1VG8A 2REXB 3LBHA 2ZU0C 4IVPA 4PO8A 2G9NA 1QVRA 3LXXA 3ADDA 5TVKA 1WXQA 2Q6TA 1XPUA 3OEEA 4DUGD 5IF9A 1N25A 2CXXA 4OK5A 5DNYB 5L3VA 1II0A 4LZZA 2Q9CA 3GJ3A 2CCGA 3D7MA 5IK2A 4R7ZA 1OH7A 4OQFA 2FFAA 2TMKA 2FPKA 1O87A 4HI0E 4DC9A 3KTAB 3GJ5A 1U81A 4UKDA 3V00A 1J7KA 1E2QA 3ZGXA 3UATA 4BEJA 2QROA 3HPRA 2J45A 1KSFX 3THYB 4D81A 4IDHA 2HEIA 4QFMA 5JJKA 4FW9A 1XNJA 3FVQA 1E0JA 3ZQ6A 3RRMA 2A3RA 4LBZA 2XITA 2AFHE 2IYXA 2OLKA 1P73A 2X2EA 1ETUA 3NC0C 3QQ5A 3ECCA 2QL6A 2ZI3A 3F3YA 2HXSA 5D3QA 3SJAA 2C8VA 4JL5A 2J9RA 2ZSDA 4QGFA 5GJCA 4HDCA 1JJVA 1MO6A 2XZPA 3CH4B 4GOXA 5FTNA 3KKNA 1XWIA 4PC1A 4QHTA 1TF7A 2EYUA 3ZVLA 1GSIA 1X86B 3QXHA 2WSMA 4LYHA 2AR7A 1OHHA 3C7KA 4TMZA 1DG3A 2JEOA 3MLEA 4URUR 4LCBA 1HT2E 3C4JA 1RYFA 4JLOA 1AQUA 1E2PA 2R2AA 4JJKA 3SYLA 1Q20A 3ZH9B 2A5DA 2QTHA 3TNFA 4JVLA 1IN6A 5C1BA 2N1BA 4MRRA 5H70A 4MRPA 3N2EA 5BYKA 1ZCAA 3SEAA 1AGRA 1GOTA 4IKEA 1OPXA 1G4AE 4NU0A 3U61B 4F4JA 2FPMA 2QEQA 4RY2A 1VG1A 1JALA 2G88A 1FQKA 5FPSA 4O3MA 3AVUA 3S1AA 2J7KA 2XJ4A 3O8RA 1GRNA 2YC4C 2J7PD 2Q9BA 3PUXA 4ZDKA 3U7GA 2EWWA 2PEZA 4R9UC 2VPPA 5FFMA 4IOMA 4JVMA 1A2KC 2QSZA 2E87A 4KU4A 4JBWA 3GLHB 2O8EB 3LV8A 3U60B 2Z5FA 2W2VA 2H18A 1U8ZA 2OAP1 2VSOA 3BH6A 3B2EA 2OCPA 4ARZA 1EFRA 4CT4B 1A82A 4TQAA 1YRAA 1UBFA 3KQHA 3RC3A 1JJ7A 2ZSAA 2WAYA 3PFIA 4D4KA 5CIWA 4IW3B 3OEED 1IAQA 2ZRPA 4LV5B 3PEWA 1M74A 4KXFB 2CBZA 4PZZA 1I2DA 3K0FA 4ZDWA 3W5IA 2ZJZA 1NVUQ 4L4UA 4L16A 2QBYA 1XMJA 3QIAA 2GXSA 5D3MB 1GTVA 1ZIPA 2P5SA 3CF0A 3H86A 1T3HA 3ZS8A 5SZJA 2GHIA 2HDNB 1S1MA 1IM2A 3H4MA 1W5TA 4PSKA 5C4MA 4FMBB 3BOSA 1HE8B 4M4SA 3MMPA 2JJ8A 4JLBA 5FUYA 2VP0A 1KI2A 4TYQA 5C18A 4NYMR 5GVRA 3CPEA 1K8RA 2ZSBA 2HF8A 1LTQA 4ZI3A 4C30A 2REBA 2CL6X 2QPOA 2HYDA 1H8HA 2CNWD 1KI1A 3DKVA 8OHMA 1YVDA 5B30A 5L3SB 3LRPA 4BFUA 3MCAA 3UIEA 1CR2A 2LKCA 3IILA 2FV8A 4A1FA 4GP6A 5J47A 3THWA 3GQBA 1Z29A 3IUYA 3NHBA 2CCJA 3A4LA 5JZVA 3LQRA 3GLHE 1P2TA 2PCLA 3O8DA 3LLUA 2V7QD 1W36C 4DSOA 1T8UA 4M1YA 1XRJA 3ADBA 5BXQC 2X19A 1WBDA 1XB2A 2P5TB 1L4YA 3KXKA 3UANA 4DCUA 1R6BX 4MQBA 5EZ5A 1WBBA 2OILA 1VG9B 1GDDA 4M1KA 1E2NA 1DAKA 2WTUA 1ZCBA 1KI9A 2AD1A 4PZLA 1SXJA 4JLDA 3EW9A 1SVKA 2P0EA 1ZW6A 3AP1A 1TF2A 2MSDB 4Q03A 3CWQA 5JLJA 1G9XA 2YHSA 1U0LA 1W36B 4AKIA 2GF9A 1KJWA 5KSZA 1Z28A 3EPJA 1D8TA 1M34E 4TSFA 1JNYA 3I73A 3U7FB 4Q00A 2ZE5A 1G5RA 4A2QA 1Z3IX 1Z6AA 2JGNA 3ZZTA 3KDSE 4FMDB 3UK6A 4ZV4A 3RYTC 4DJTA 1U9IA 1YZGA 3Q5DA 2NMVA 2DYKA 4F93B 4AK9A 2W6IA 2ZE6A 4MRSA 4TLCA 4G0NA 2Q3FA 3V4RA 3PEVA 1A1VA 1NN1A 4RFSA 1RRGA 4L9SA 4XJXA 5H8WA 2O8CB 1UKVY 2JIZD 1DAHA 1A7JA 1F2TB 1G291 4LJ9A 5LDDC 5CDFA 4YMUA 3VNVA 1G6HA 1XJCA 1LV7A 1P2UA 1ZD8A 2VHUA 2ZSFA 4DLUA 4HSEA 4UXHA 4ESVA 3B60A 1Q44A 4YDHB 4Q7JB 5AK0A 3X1XA 4NL4H 1X8KA 3NH9A 4XWAA 1XPOA 1E4VA 3W90A 2A5YB 4HLDA 3PUWA 4ZIRB 3PEYA 2VIIA 5DN6A 2GBLC 1MV5A 5EE5B 3CNLA 5TY0A 2F6RA 5G3YA 2D7DA 3GD7A 4B75A 3CBQA 1OF1A 2FF7A 3IBYA 4KLZA 4ZKEA 4NKRA 1KAGA 3WYGA 3WYFA 4BFVA 4RJLA 3LW7A 3CLVA 3W3ZB 2A78A 2CEAA 5HKKA 1NIPA 4HB0A 2WIAA 5JECA 4B32A 4I81A 3EIHA 4LX0A 1B23P 5BQ5A 2JJ2A 1NN3A 5KDLA 1ZU5A 4TWZA 3RAPR 4DEYA 2QM7A 4LI0A 4OJQA 2AWNA 5J4HA 3B6EA 3JZAA 2FGKA 5JJLA 1MO5A 2VHTA 2PBRA 5GVSA 2GJ9A 2Q3MA 3KFXA 3VU9A 1HTWA 3B7GA 1XP8A 5FR1A 1FL9A 3GJ7A 4Z8XA 3SI7A 1W48A 5AJWA 1II8B 1QHHA 3HPQA 2LKDA 1WP9A 4EAQA 5JEEA 1VPLA 1NP6A 1XD9A 4JL8A 3GJ8A 2OO7A 4B33A 1YHNA 5HE8A 4ZCLA 2OEPA 4TQUS 2ZR9A 1XFAA 4JT2A 4WZBE 4POAA 4DCSA 5IT5A 2ZEJA 2IS4A 3DMNA 1YZKA 2V1XA 3RLFA 4WIAA 2O8DA 1OFTA 4QOSA 1AKEA 2BJWA 5JRJA 3QSYA 2V3CC 1U9IC 3P20A 3R9XA 2K5UA 2O0HA 1OH5A 4OQXA 1T5LA 2FMXA 2WSSD 1PJRA 2CK3A 1Z63A 3OFND 1D2NA 4LJAA 4OKSA 3VQTA 1P2SA 5DH9A 3N2IA 3DOEA 2G1KA 3WBJA 4JIMA 4JKIA 1W0KA 2XSZD 3KJGA 4CZ2A 5G40A 1G19A 3NEJA 3K09A 4DT1A 3NC1C 4XVUA 1FP7A 4W5JA 1GRRA 2DFTA 1LW7A 4AYXA 4HLUC 1BO6A 2QE7D 2MSCB 2YWGA 4G5SA 4LGMA 1GL7A 1CBUA 1W4AA 2JATA 5EUQB 1Z06A 2QAGB 1G8HA 2IXGA 1YZUA 3W6NA 2NQ2C 4U7DA 5BW8A 3BWDD 1HY3A 4ON9A 3JVVA 1ZP6A 1CS4C 1MABA 4Q1CA 1T6NA 1K5DA 3ZVRA 4C3ZA 1IXSB 3WXMA 4BLSA 4PO1A 3LX8A 4KVGA 2IF2A 4M1OA 2C78A 4MYUA 3WHLA 4W5HA 1NBMA 2EFGA 5EP1A 1QBKC 5LB2A 2QI9C 3I8SA 4D6PA 3T1VA 3T12A 2AKYA 4ZCMA 4NCNA 4IOKA 3OESA 2GCOA 2IYSA 5J4YA 2ATVA 3WMGA 1AZSC 1ZRHA 1W0JD 2WV9A 1K5GA 4N0EA 2QENA 4ESHA 2X77A 1SHKA 4C0BA 4Q19A 4X8LA 4FMDF 1KKMA 4BLRA 4Q4AB 3KTAA 5EXTA 4TTRA 2QM8A 1QF9A 2FJUA 5F98A 1M7HA 2ZS7A 2A5GA 4PQRA 4M22A 3TVTA 4I1OA 1IY1A 1V5WA 3E5HA 1I2MA 1UDXA 3GJ0A 4XTCS 2CL7X 1GRQA 4B76A 2WM9B 3VFDA 1UEIA 4A2PA 4GL2A 2XJ9A 2ZRCA 4II7A 5FI1B 4ZCIA 1H8ED 2GILA 2EYQA 1P3JA 3PQCA 5ANRB 1FMLA 4DZZA 1DAFA 1TAGA 1XZPA 4Q4AA 4X8HA 2QU8A 3NEYA 1IY2A 4KAXA 1HEIA 4PPQA 1OIXA 1IN8A 2G83A 2HCBA 2KBEA 2DWOA 3KFVA 1EWQA 1B0UA 4IOJA 1KO8A 3AP3A 1TL7C 3IEUA 2GCOB 2ZYTX 3RS3A 3RWMB 3R9IA 4V03A 1RC8A 3W3AA 2EU8A 2ZS8A 4XD7D 4B6FA 4EQ6A 4F92B 4BRUA 2DHRA 3DOFA 3WHKA 1GITA 2C95A 4HUQA 3X1YA 4Q9KA 1EK0A 2HYIC 2BVNA 5KHOC 2RGGA 2BMFA 5TXGA 2NO0A 2CVFA 4KHZA 5KPDA 1JECA 2OFXA 2QTFA 4GFDA 2ZRDA 1RRPA 4LBWA 5GJVC 3LX5A 4RD4A 2O8FB 3CX7A 2XZOA 4NCHA 2ZREA 3DZDA 4JLPA 2V6JA 2D06A 3K9NA 1KI3A 2N46A 3K0EA 3CX6A 2DFKB 1JB1A 3KJIA 1E79D 4NPHA 4WXPA 1P2VA 4AWXA 1JR3A 2X1VA 2WJHA 1XX6A 2VQSA 5K8UA 2HF9A 1QDEA 2GJ8A 2JLQA 3L0SA 1KI7A 4QNRA 2F3TA 4DLTA 1D9XA 1H8HD 2CNWA 4D0NA 3THOA 2NIPA 3MAAC 4BE7B 1OKKA 2GA8A 3QI2A 1RRCA 3SBEA 1LFDB 5K8TA 1E9FA 1RZ3A 3P4XA 1CJVC 2A30A 2FEOA 4OHWA 4ASUA 3BS4A 1G7SA 3TW8B 2VP2A 3H1TA 1KDRA 2RGDA 3TUZC 1NSTA 1IJEA 3GFOA 1CKEA 4RD6A 5AUOB 1W36D 2Z4SA 2B21A 1RKBA 2PCJA 2PMDA 1GNQA 2ZRNA 1MH1A 1QRAA 4DKXA 2IUSA 1U8AA 2WKQA 2A7QA 1Q1ZA 4IHQA 5JWHA 1U0JA 4LYFA 4NYIR 3UKDA 5JHGB 4QBHA 1LS6A 4YDSA 2ZTSA 3NWJA 3SFZA 1PZNA 2YJTD 5FBVB 1QHIA 3OAAD 3RNLA 1G7RA 1XTQA 4I1UA 4IRUB 2AXNA 3QY0A 1MRSA 4LJ5A 2YWFA 3MD0A 2GJKA 4DLWA 1SVIA 1NLYA 4XD7A 1G6OA 3LQQA 1ZINA 1NLFA 3B1WA 3VR6A 1F2UA 1KO7A 5E7IA 1IXRC 4EFNA 1TTTA 2W0MA 2CL0X 3NKVA 4PPNA 3TAHA 2ERYA 3R9WA 2V4ZA 2QPAA 4NCIA 5HCNA 2ZRLA 4DLRA 5AUPB 1GM5A 1M7BA 1NF3A 3FMPB 1BKDR 1G21E 3UG7A 3VX3A 3THXA 4BWYA 3B9PA 5B2ZA 1GILA 4XIGS 3R8FA 3UWKA 2KSQA 2FH5B 4Q4JB 1KY3A 4GOJA 2D2FA 4MKFA 1W49A 3HYTA 2ZITA 2FE4A 3EIEA 3UWOA 1LB1B 4PSAA 5JFGA 3VKWA 1PV4A 3LY5A 4YC7A 1TPZA 3AEZA 1Z2CA 2CHVA 4AKGA 4HATA 4LWZA 5FUVA 2IYWA 1KOFA 5EQTA 1JR6A 3FHTA 2ZRIA 4TL9A 4NDZA 2WPDD 1RJ9B 2WKPA 2DPXA 1F2UB 2CLDX 3PG5A 1YKSA 3U3MA 1UBEA 3E70C 3M4YA 4H1UA 2X2FA 2OCBA 1KK3A 2CE7A 4JLAA 3U44A 2ZI5A 5FL7D 3QF4B 3K9HA 4IDQA 5DI3B 4LPKA 3RC8A 1LVGA 1VCIA 3HU1A 2IS6A 2QG6A 4MRNA 5CB8A 4B3BA 5KSOA 1P5ZB 1L2TA 3TBKA 1N0UA 1XMVA 3TW4A 5A4JA 3BFVA 1AA9A 2NO6A 2OT3B 2RGNA 4IDPA 1Z2AA 2GZDA 1SKQA 4US2R 3D8BA 3WMEA 2WWWA 1TQ4A 1CXZA 2JDIA 1AS0A 1I4TD 2IBMA 4LHVA 3OAAA 5DYGA 1NKSA 1KO1A 5JSZA 5G53C 4LHWA 2GDJA 1R4AA 2CCKA 2WVJA 3BORA 3V9PA 5SZKB 3C16C 3F5FA 2FFHA 4MYCA 1E9SA 3TQCA 4A6XA 1F48A 1HV8A 4Y0VA 3MJRA 2ZJ2A 3ZVMA 5DIFA 4PHHA 5C2JB 1ZUNB 4M9ZA 5EE0A 2VRWA 1D6JA 3X1ZA 3NH6A 4IFBA 4DWJA 1E2MA 3VTKA 4EFLA 4ZO4A 2H7VA 1Z0FA 2Z4RA 1BMFA 3EZ6A 2BMDA 2CLSA 3CUEF 3QKRB 1D9ZA 4TTPA 2FA9A 4CEHB 3VKGA 3IHWA 3FGNA 4FMCB 2O8BB 1WMSA 1Z83A 4UNSA 3M1IA 3PENA 1LF5A 4LK2A 3HYRA 2LCFA 3T34A 2XTMA 2QT1A 4HB4A 4LYJA 4LSGA 3SR0A 3PUYA 3NHAA 2ZJOA 1WA5A 4OI1A 3GPLA 3ZD7A 4UXIA 5L3RA 4P4SB 5AR1A 4TLAA 3EWAA 1P4SA 3K0FB 4YMWA 2YNMA 4NE2A 1N6NA 1E9RA 1QVAA 1GL6A 1GP2A 2JLSA 2I4IA 3K53A 5CJ2A 2IYUA 5D3MA 3QG1A 2PLRA 1RYHA 2F55A 1VHTA 4R2IA 4URYR 2FEMA 6Q21A 4HZIA 5SZIA 1KDOA 2ZROA 1OLOA 1X6VA 1IHUA 4JYCA 4Q4HA 5AJVB 2R44A 3K0AA 3LH5A 4G01B 4EPWA 4OYHA 1OFIA 2C9YA 4CT5A 5KPJA 5FOUA 1UPTA 521PA 2WPDA 1BH2A 4WOPA 2RGAA 3CONA 4LJ7A 2C99A 4EUNA 3OIWA 2ZM5A 5GJBA 3ETLA 4DUGA 1J90A 2G3YA 1P72A 3EZ9A 1D2EA 4W5WA 1DBSA 4XTRA 3VU9B 1V43A 4JLMA 4WZ6A 5DHFA 1TQ2A 2EFEB 2B7CA 2OXRA 4M0LA 2ZRHA 4D2IA 3A36A 1KNXA 2LWIA 4JLKA 2VO1A 3S1AB 4BFWA 5K8LA 1YQTA 5CDFE 5FOWA 1MT0A 3CIOA 2ZRGA 4KFUA 1JBKA 3KKMA 1YZLA 4F38A 2B8TA 1P9RA 4FXPA 2MMCA 4QGHA 3FFAA 4R98A 4TQ9A 4EPVA 1RJ9A 1T9HA 1IONA 2RGEA 4OQLA 1DELA 1JI0A 4HAZA 1T3SA 3EG5A 3LWNA 4NYJQ 3PJRA 2QQ0A 3H0KA 2XXAB 1SKYB 1EX7A 4L5BA 3A1VA 2GBLA 3LO5A 4MGYR 4WXRA 1XDBA 5E7MA 2WZQA 2D2EA 1YR9A 5F9HA 2NPFA 4AKHA 5EXPA 2RHDA 3PVSA 1QHGA 5AJYA 4QJ4A 3GEIA 2ZRAA 2C5LA 1X1SA 2H16A 3A58B 5EE3A 5FOXA 4AYWA 2KE5A 1VYUA 3K0CC 1ZNZA 4PAOA 1JR3D 4B3CA 3RS4A 1W7AA 4KFTA 1RIFA 4YQFA 1XCPA 3ADKA 3CRVA 3FKQA 3K0AB 2H92A 4LBVA 2PZEA 1DAIA 4Q1AA 2ZQ5A 2RAPA 4D0LB 1M7GA 1CRQA 4HZUB 3Q3JB 3VAAA 1J70A 2DB3A 1FNMA 1KDPA 2BHRA 2P3SA 3HWSA 1KAOA 3CPHA 1R5OA 4RZ3A 4CW7A 4XWKA 4C0KA 3SU8A 1KJYA 2BBSA 1XEXB 1ZVQA 3KQUA 4A4DA 2AXPA 4NHOA 2ECKA 3QXCA 2I3BA 3GMTA 2REOA 3MRSA 2HCJB 3ONWA 2R62A 5ELXA 3VHLB 2ZRFA 2R8RA 1UFQA 3DZ8A 2FFBA 4LJ8A 3TSWA 2ORWA 3W5JA 1TUEA 4QL3A 3WYAA 3OIVA 3TH5A 3EPLA 3NG1A 3O47A 2WICA 1G18A 4X8MA 1DO0A 2CMKA 4E07A 1CR4A 2QAJA 1Z0KA 2Z43A 4DVGA 2IYQA 4NH0A 1OXTA 2FZ4A 3SN6A 4EIWA 4K81B 2RKOA 3R20A 4B2IA 2PH1A 1AS2A 2J5XA 4URXR 3T1QA 1G3UA 1W46A 3IIJA 4E5UA 1D5CA 1N5LA 4PQYA 4DHEA 3OEHA 4B73A 1G20E 2CK3D 1XEFA 1GWNA 1E2EA 2AK2A 3R7WB 3H2YA 4B3DA 2D74A 1DAGA 1MO4A 2V1UA 1MOZA 1X8JA 2BEKA 3FE2A 2IUTA 3LBIA 2ZSEA 2FSGA 1SKYE 1KIMA 1M2OB 3LFUA 2IWRA 3DDCA 1ZM7A 1JAIA 4KVAA 1XCGB 1PUJA 3U5ZB 3FDIA 4N1AA 3T61A 1US8B 2ORVA 1T91A 3UG6A 5M04A 4QNMA 2Y8EA 1ZUIA 1AM4D 3R7WA 3ZVNA 4K46A 3TMKA 2RCNA 1GVNB 1G3MA 2W0SA 3ND8A 4ACAA 1ZJ6A 4BUJA 2C04A 3KKQA 1OYWA 2QPTA 2ATXA 2V8OA 1XTRA 1YR6A 3QPWA 2ZRMA 2J0UA 1G3QA 3DPUA 1E9CA 2ZYUX 1HE1C 2XOKD 4FIDA 1NY6A 1QG2A 3B82A 4IOLA 3OF5A 1EGAA 4LYAA 2H57A 3KXLA 5TV2A 3IQWA 1DADA 3I4LA 4G5GA 3A1TA 3HR7A 5GADl 2EFHB 2JAQA 1W47A 1SULA 3BGWA 3T15A 4H1VA 4BFYA 4N0DA 4JBYA 2P6NA 1OXXK 1Q1BA 1EXMA 4LHZA 4AI6A 3VR5A 3KX2A 1MO3A 1R8SA 3FHOA 4ACBA 2PZFA 4IVRA 2UZIR 1M1YE 2ZU6A 2XGJA 2D62A 4URVR 3C8UA 3A1WA 4V0NA 2IS1A 5IHPA 3TR5A 1XBTA 3KXIA 4FCVA 1EWRA 1JXMA 3AUXA 4HYYA 3OE7A 4TT3A 5HCIA 1G5TA 1DO2A 1KKLA 1EESA 4KI0A 5C46F 2IYVA 1Q21A 4KO8A 2PEYA 2NPIA 4Q9LA 4TL8A 3FMFA 1ZAKA 4MYHA 2W2XA 5CB6A 5BN5A 5JBQA 1E69A 1ODFA 2OSBA 2ODNA 3IDQA 4PR0A 5FPKA 2I1QA 3RWOA 2WJIA 1FTNA 2AD5A 3N5CA 1COWD 1NIJA 2NGRA 2OBMA 1NN0A 3LAWA 2VH5R 4TLDA 2F3RA 3MGCA 1U94A 1OHHD 2JCSA 5HKKD 1FZQA 2WWFA 3NBYC 3T1OA 4QBFA 3AUYA 4KFRA 4WVFA 1SXJE 2ZETA 3QG5A 5FTKA 3TJZA 4GSYA 1E94E 2WWGA 1AKYA 1ZIOA 3NBZC 4R2HA 2IX3A 5G3ZA 4ZKDA 3AVTA 3TUJC 3IIKA 2MSEB 1ZUHA 3AF3A 4KBFA 4OBEA 3TQFA 4PXAA 2V7QA 3A6PC 1W4CA 4GZMA 5HZHA 1Z0JA 2IEZA 4PAQA 2GAOA 5CK4A 4RFVA 4OQNA 3DM9B 2HJVA 4J0QA 1BS1A 4Q7LA 3SJCA 3GFPA 4HUTA 3K09C 4DLYA 5LD2B 3GLFA 1S3SA 2AKAB 1EFCA 2IA5A 4YMTA 4HAVA 4UJ3A 4XH9B 2FU5C 4Q1FA 3Q72A 4P33A 2V9PA 4Q4HB 3X2SA 1FPMA 3CNOA 2IUUA 1UKYA 2VYFA 5DGXA 5TDHA 2YC2C 4BRWA 4PC2A 1S9DA 1HT1E 1KK0A 4L8GA 2GAAA 3IO3A 1JQLB 4N3NA 4WW0A 2PLFA 3P1JA 2GF0A 4B3FX 3T1TA 3KB2A 1NG1A 2A5FA 2P67A 2C03A 2IYLD 1G8FA 5EE9A 4TMVA 3IBGA 3SC3A 2BEJA 1FX0B 2F1IA 2PT5A 5EXSA 3OFNA 2XB2A 3SYKA 2IL1A 2FOLA 2ODWA 2R65A 3B85A 4DRZA 4CRWB 2YWEA 1WCV1 1VCMA 2EFCB 1XD2B 2GK7A 4ZDJA 2G1JA 3K1JA 3BIFA 4ZIRA 4RZXA 3RSLA 4U5XA 2VEDA 2IHBA 1AGPA 1ZD9A 1XCMA 3T5DA 3AKCA 1E2KA 2RGXA 4MKGA 3L8ZA 3IKJA 4DXAA 3AVVA 3ZZUA 1VYTA 2C2HA 1AZTA 2GXUA
chains in the Genus database with same CATH superfamily
3D31A 3PQ2A 3RG8A 2VNAA 1WB4A 4EYGA 3TRFA 2ZYVX 1FEZA 4GAEA 2JKZA 3L7LA 5JCXA 1TCAA 2I62A 2GM4A 2IFTA 4IEEA 3FRJA 4WDRA 5I01A 3K0SA 1OBCA 1OUMA 3I9V6 4QODA 2I4TA 2QSJA 4QXAA 4CQMD 4GI7A 2RCYA 5J1TB 3ISJA 3KELA 4TXNA 4XOUA 2ESRA 5THKA 1QBGA 2PVSA 1ST3A 3BL8A 1N5OX 3DAPA 3FTCA 4I5IA 4MICA 4PO9A 3AL2A 4D8UA 2DQZA 3FDZA 4ZD6A 5KQMA 1E98A 5ERYA 4GDFA 1II9A 3MWFA 1P7VA 1OH6A 4QPNA 1VPDA 2DPMA 4IH9A 2WWIA 4IXMA 4EI2A 1C9KA 4C05A 4OHOA 1NXPA 5JCOC 2D0PB 2Y0PA 1M6NA 2PYZA 2QTBA 1W5EA 4U5QA 3KLMX 3OM1A 1W59A 3GP3A 1DEOA 2RG1A 1OXVA 1ADCA 4KLCA 1E8DA 2A1TR 4QOFA 4BN4A 5G1NA 1FA9A 2NZWA 5FKJA 4RF3A 4BVKA 1JDSA 4EHIA 2JIMA 2E48A 2VHVA 1RWMA 3BC1A 3BWEA 1DP4A 4GP9A 3QBEA 4DA9A 3OQOA 4GPD1 1S02A 2B5OA 4B43A 1CNMA 1D4OA 4D4MA 2Q28A 2OV8A 1T4DA 4K3VA 1QG6A 1KRHA 1XQ1A 4II3A 3TSOA 2Q99A 2ZR0A 4IFTA 3QYJA 3BGIA 3BEOA 1XNHA 2AR9A 4MPPA 1VIYA 3JAMA 2P4UA 2G40A 1CEYA 3V2GA 1XMOB 2C31A 2H7XA 4TM8A 1XFDA 5AKXA 3EC7A 3IOEA 3U4QB 3O8QA 1N8TA 2OZPA 5F2KA 1NBOA 1T13A 5KZMB 1SUAA 1PNVA 1V35A 3DG9A 4Q5IA 2V7GA 2CZCA 5DGHA 3RSQA 5IRCD 1EP3B 1SN7A 2JFYA 2QRZA 2EZTA 1WAMA 3GWZA 3SDSA 1Z5ZA 4M83A 4ABYA 1N5JA 3T5BA 3U4AA 1OJLA 2IK8A 3B36A 3GL9A 4G0XA 2BKUA 1Q1AA 2ES4A 4O5AA 4I9NA 4P4TA 3EXFB 4ES6A 4RSGA 3WLTA 5HVNA 2GEDA 1EFLA 3RBAA 2KBFA 3SZGA 1OU4A 3WQBA 4OP3A 4AF7A 2TYSB 1C3VA 4GP7A 4AG5A 5M29A 2Z0MA 2BKXA 3JALA 2IV7A 5MGBA 1EMDA 2CXOA 2RGBA 3B89A 4QXQA 1AY0A 3BFXA 4FP9A 5TGDA 4ND4A 1QAOA 3DZFA 3EOBI 4X1KA 4KQKA 2OE2A 4CCWA 10MHA 2QQFA 4M46A 1JR3E 1T4GA 4FFRA 3FGZA 1UAAA 3EPRA 5ICEA 4GKBA 1C8LA 5AW9A 4PE5B 2RGWA 2NZJA 3K92A 5FL7A 3OICA 3L5KA 1PVOA 3GJ6A 3ASVA 4YA6A 1KRWA 4WJLA 2ZUUA 1WR8A 2HIGA 2Y9PB 3C7CB 5EHGA 1X1DA 4IXDA 2ADFA 1P5HA 4K26A 1R8QA 3U3JA 4W6QA 1F0KA 1NX6A 1NXQA 3PYMA 3NHZA 1U9JA 1P1JA 3Q15C 1AK9A 3VHXA 5AK3A 5HF8A 1FVFA 5KOYA 3CGWA 1GNTA 4B6RA 4X7RA 4JQYA 3PNOA 2Q29A 4L74A 4DT1B 1EUYA 1YC2A 2NWQA 3A3OA 4K0KB 4QUAA 2C54A 3UK7A 3MRXA 4BEVA 4HLUA 5AM2A 5L8VA 4D25A 4MV8A 2WV7A 3HGQA 3S2SA 5BO5A 4ARVA 3ABQB 3ZGNA 2V7VA 4J0IA 4RMHA 5TPZD 4BMDA 1XZQA 3AQ4A 4RA6A 3VO1A 4X24A 4HDQB 3RYIA 4BXOA 4UTOA 3EBOA 3G8YA 2JLVA 4PFSA 3TS1A 3BIXA 2KB0A 3WYEA 4IZIA 5L4LA 2PKEA 1YI8A 4E03A 3U7QB 1UINA 3MLBA 3HUFA 2O0JA 1E3JA 1GPAA 1NC1A 2P68A 3EY4A 4LJYA 4UM9D 2RHRA 2AL7A 4MAAA 1C3OA 2X9VA 4MR8A 1UJ2A 5G41A 1UANA 3LXRA 3WGYA 2QT0A 4WOCA 2P6MA 4A6PA 5LQAA 1JPNA 4TMTA 3OC6A 1N8KA 5FDFA 2A5JA 3MWDB 3D64A 4O2LA 3IKLA 3H11B 3PP8A 4Q21A 3WWPA 1FUIA 2MYUA 3GQBB 3RABA 2ETXA 2JGDA 4ANFA 2Q0HA 1XAIA 2R6ZA 4Y1RA 2YKGA 2B3TA 3RHTA 1KMMA 3TWOA 4C4RA 1RBQA 1V1MA 1YL7A 1PT9A 3CZAA 4IMRA 2V03A 3K9LA 1WPXA 1XTKA 2XUHA 3LQKA 4NOJA 4Z53A 4UDOA 3G5UA 2KI5A 4MDHA 1QYRA 1GNVA 2XMZA 3BM5A 2X0DA 5FUBA 3L0IB 3FMGA 2WFLA 3D8UA 1LVHA 2YV1A 3TX6A 1DJPA 2Q21A 1RJEA 1GZSA 5FT9A 3V1UA 1TU4A 1OT3A 1Q7EA 3GAAA 4IHKA 2P9CA 2DQ4A 3QKRA 3M3DA 2V3VA 3VR4A 3ZZ0A 4EPTA 4CEHA 3E7FA 4EQ6B 1T8YA 4B7CA 1Q22A 1AGNA 2QM0A 1YKGA 2R2GA 3TQQA 5JCPA 2I66A 2EXXA 5CM9C 1TVCA 4MIKA 4US1R 2VQEB 2PZGA 1N0VC 1TYZA 3DVQX 2ZSKA 3PYLA 4TL7A 5FPTA 4ERNA 2YINC 2AG5A 2PGXA 3FCUB 2JVKA 1HNNA 1Y3AA 2WOJA 2PRJA 3UOGA 1N6OA 2UVPB 3CWZA 1T9BA 1F4VA 4TTAA 5DASA 1VSQA 1U28C 4KXYA 4EVRA 3RS7A 4JVOA 2LCIA 4HF7A 3LTNC 2BHLA 1D1TA 2PFGA 1YVEI 1C0EA 4YJDA 1V3QE 4LV8B 4GMKA 3CB4A 2HWKA 2HJGA 3CRZA 4WNAB 1NTRA 2A9KA 1J00A 3H99A 1GKIA 2XOXA 3QFFA 4L51A 5JMTA 3G82C 1HQYE 3OZDA 4DDUA 4DCTA 4XX0A 1O96A 5JSUA 2CV2A 1EP2B 1UMBB 4F2GA 5AW6A 3VPBA 5JC8A 2FW0A 3R6LA 5BYJA 3T7TA 3L0PA 4C0XA 1RI4A 2WD9A 3CE6A 3F6EX 1ISIA 2CD9A 2IZ1A 3ETEA 3OF3A 4MRMA 2H5EA 3R75A 1U1GA 3WFJA 1HDGO 1VE9A 2I7VA 3BH7A 4PHGA 1XD8A 1YK1A 3LWBA 1KMHA 1KZ4A 3CGGA 3LVQE 1XE3A 1HL3A 2HU7A 4MKZA 5EYPB 3NHPA 1JG6A 3Q40A 1XO1A 4BMZA 1E2LA 3MUFA 3HBJA 3HR4A 4GT1A 3KT6A 3LM8A 1KS2A 1UIMA 1ZH0A 3D4IA 3G89A 4G2NA 5J63A 1HE2A 4WZAE 4JHLA 3RIGA 2WIJA 2AWOA 4C76A 3FUVA 1M75A 1QGZA 4EJSA 5DGIA 5JSYA 4WLNA 3LUPA 4ZOEA 2YS6A 3V42A 3G8AA 1Q0ZA 2EKLA 2GPYA 3FNRA 1S3IA 4ZT2A 3SSMA 2BP7B 4H0NA 3GPCA 1UC8A 3SYRA 3E3LA 1MC8A 1MX9A 4ALLA 1L4KA 4Z7NB 5JI2E 4TYNA 3LVRE 5TJHA 3I01M 4R9NA 1DE0A 1B76A 1XZLA 3BX1A 4FFLA 3EQ2A 3RK1A 1VMAA 2PT7A 4FI3C 3WAKA 1MPTA 5EXXA 3SHVA 2JLRA 2XNKA 5JHHB 2WP0A 5I4KA 1E2DA 1JU4A 4AUMA 2GEVA 1QCCA 1GPNA 5LMNB 4MGEA 3MN1A 4A03A 1VIMA 2OM2A 3A6ZA 3OQ1A 3IQXA 3M5PA 1Y3CE 2ZYIA 1IWOA 1G3IA 3LLVA 1R37A 1S8OA 2V6IA 4IZOA 1WWKA 3G1UA 2XQJA 4S35A 1YTUA 4BKUA 4HY3A 4IUDS 1EUDB 3PNQA 4G23A 3ZLBA 1M6WA 3RADC 2QRLA 5B4TA 1PCXA 2YIJA 3A06A 4ZVOA 4B44A 1QFYA 1NNSA 1CTQA 2Z5GA 4K28A 2IPLA 4Q1BA 2IZOA 4KKXB 2NVUB 3VBCA 1RYZA 3D3QA 4O4LF 4Q9IA 5BW4A 5KTRA 4PR3A 1W85A 4M0FA 4LNHA 3AHFA 4YJGB 4JHXA 2W48A 5F5LA 2D1SA 1MB9A 3ZDRA 3JS5A 3UHAA 2HLDA 1U3CA 1DARA 4XFKA 2VS1A 4IILA 3D6NB 4J49A 4NEHB 3T7JA 3C3XA 4JS0A 1I4DD 4UVHA 2D1FA 5P8WA 3I5XA 2CL5A 4V1CB 3ONEA 2DWPA 3RRFA 3WP1B 3N5KA 2GGSA 2X4GA 1SVMA 1WW2A 3CKMA 3IE0A 3OMLA 1KYZA 4MUMA 5I48A 1TIKA 1KEKA 1DKUA 2PD4A 3IBSA 3L8MA 3N8GA 5UKDA 2QZ4A 3JZMA 4ZOCA 5JYDA 2O8EA 1NNEA 4U2DA 2GPNA 5CIQA 1LI5A 1OZ0A 1DCKA 3GA7A 4ND7A 2Y2VA 1W52X 4NMMA 4B3GA 5KWSA 2ODPA 3CZPA 1D2HA 2D4HA 5FI5A 4ASUD 5JQGF 4RYLA 4NIMA 2XX3A 4FHZA 1KIFA 1C3OB 3B2QA 3OPNA 1MAWA 1UJBA 2HY7A 1LQUA 3AR6A 3JYLA 4GGMX 3LLMA 3ISTA 1NMEA 2J67A 4YRJA 4G8DA 1H3EA 2H5IA 3GJ4A 4B2LA 4G0WA 1PEDA 2UZ1B 4XSGA 5CW1A 4DIEA 4OEHA 2G9ZA 4HAIA 2B0JA 5EEHA 5LB4A 1E7MA 3V8PA 3ZD8A 1GFIA 3A37A 3QFRA 3WNDA 4Q4CA 2FR8C 4OFWA 2PX5A 5ENDA 3PXUA 1HORA 4DYDA 3OQNA 3DT8A 2OA0A 1CZLA 1FP6A 3PFGA 1DAOA 2IC5A 4HTAA 4YJ2F 1OTHA 3QF4A 1R8XA 1RLMA 1FX1A 1CU1A 3X1KA 1HT3A 5HF9A 1EE9A 1YHYA 3VSEA 1TCUA 3PK0A 2J3KA 3VR2A 3WRYC 2VDWA 4GLJA 1XHEA 1TXGA 3FHLA 2WK1A 4DE5A 5FBRB 3AIIA 4JUCA 4N7MA 4YUYA 2XSZA 1KJZA 4P84A 4M8NE 1PJ4A 3GVXA 1BJTA 2A58A 2H06A 1DOZA 3AEUB 3EEQA 4ONEA 1QKKA 3LHFA 1FFHA 4KQ6A 3SJZA 4DSZA 1B42A 1DWQA 2XYRA 1A7UA 4TWIA 2J1LA 1NZFA 2WUDA 3B48A 4PYMA 1CFJA 4I7EA 1E0KA 3C3YA 3FFXA 4PGMA 1O6CA 1WDKA 4D9EA 4BNHA 5LU9A 2W2KA 4KCGA 3A4MA 3M0EA 4R2WA 2DQSA 4MHTA 2GN4A 3D6TB 4IIJF 3U3DA 5IVDA 2RHHA 2DH5A 1UBKS 1WG8A 2BTQB 3BRWA 2XUZA 3W5AA 5BN1A 4TYPA 2OCAA 3A1CA 2NACA 3QEJA 3U7EB 5AHXA 1Y7LA 3RV3A 2O59A 4M2LA 1NSFA 1NV9A 3BE4A 3DMDA 1PFKA 3BB3A 1MB0A 1RKUA 2GWRA 4JLVA 4C0HA 2HMWA 1NRJB 3DBRB 4IFEA 1UODA 2BFFA 1GTMA 3FPGA 1Z4IA 3MSCA 2VPIA 4KE8A 1DVRA 3C6MA 4LUCA 4XUEA 4F4FA 1EU1A 1RQPA 2XOKA 16PKA 1DC4A 1FNNA 1SB9A 2BFDA 2UYYA 3NDPA 1P4JA 3QYFA 4MJ3A 4QT0A 4MJ7A 3DKIA 3QPBA 5EPOA 1DJOA 3U7QA 2ZAYA 5EI5A 2V7PA 3QWFA 3GPIA 1X1EA 2QA5A 4B35A 2A9VA 2WKRA 1NMYA 3JWGA 5LIPA 3HLTA 2G9UA 3NJRA 4QYWA 4RVOA 1P7YA 3MJSA 4RA6B 1O5OA 5HF6A 2PUJA 1BW9B 4ENWA 3UQYS 1N1EA 4R01A 1UDRA 1P17A 2VHQA 3AGQA 3KPYA 2WD8A 4M53A 3TLAA 4BLWA 2BH9A 1KU6A 3O73A 3ZK7A 4C7XA 2VP9A 2WJZB 1F8UA 3LWZA 3OOSA 2IH5A 2P5UA 3CF4A 2A0XA 3B3FA 3C0KA 1XEWY 4FJ1A 2C2BA 4RYDA 4FJ0A 4TLEA 1P4AA 5CPFA 3UXHA 2W9XA 2HHLA 3PQ8A 4MMXB 2HV8A 2IYAA 3L4BC 4LGVA 4ZAVA 3ZD9A 4BO5A 4RLFA 2GKSA 3BWBA 1BHJA 4C1BA 3FSEA 3OKAA 1W0KD 2FSHA 2VQDA 1NXTA 1R4ZA 3JAWB 2QVCA 3PNSA 4RJIA 2CZQA 3FETA 3U19A 3PNMA 3UMBA 3PDIA 1Z0AA 4YIHA 2DETA 2XHEA 2CFIA 2QUZA 2WQ6A 1TVMA 1LDMA 3ICEA 3TQTA 2IBTA 2WJWA 2FKNA 2BFCA 3GU3A 1APBA 4XSVA 3VAYA 4AFNA 4DUZB 1F7VA 3QENA 4O2AB 1J24A 3MFYA 3N76A 1Y0BA 3WWDA 2PO5A 2OHFA 3A2LA 2PL5A 5AVOA 3TVYA 1SGWA 2XRFA 4L8WB 1J97A 3BN3A 2WM2A 1JAHA 4D57A 1ZI9A 1RSZA 3RSCA 5IJAA 1OI2A 1MW8X 3ROZA 1ZGZA 3PXCX 4ZZ0A 2QN3A 1AUPA 2I99A 1R4NA 3PXGA 5D51S 2I87A 2A84A 3BMCA 4NJMA 4BGDA 1DXHA 1ONBA 2FN3A 2GPJA 3JSXA 4AX8A 1E32A 3F9IA 3U0BA 2Q0SA 1RHUA 4G26A 4C0AC 1SRRA 4K1XA 2JIZA 1ICEA 1L7AA 2Z83A 3ZLUA 1J33A 3OETA 1O9GA 3RVPA 4ADSG 3KTDA 3AHCA 1T8SA 4ZOLA 2WILA 2GFQA 3SYNA 4I4TB 1LNZA 2EEPA 3MMXA 5B5SA 1T3LA 2RH5A 3NGXA 4HNGA 2MYPA 5A04A 2H4HA 3DF7A 2FG6C 1U7WA 3A8TA 3KUUA 4G8BA 5FLKA 3U16A 3K30A 1N8SA 1JPUA 1NQTA 5EJ5A 5CB4B 3CRMA 1TU3A 3KQQA 5IXSA 3H87A 3CTPA 3Q7TA 5EJIA 3RNOA 1Y4DE 4CKBB 3EZFA 5AVVA 4EW3A 5F64A 1MENA 3G9XA 4D3DA 1KI8A 1PR0A 1F14A 4QG7A 5DP2A 2ID8A 1TQDA 2ORED 5FBZA 5IBQA 1ZVVA 2FWIA 3R3SA 3OZ7A 3UK0A 4CLOA 4WFQA 3T0FA 2B36A 2ZBRA 1E9EA 2O23A 1SZPA 1X19A 2ZAOA 1MR3F 3CX8A 5EYPA 5HILA 3FLMA 3K1AB 4OIFA 2X2OA 2IHVA 4JOCA 5AOCA 1TM3E 3HFJA 4RPHA 4QKQA 1NRXA 5EIHA 1FMJA 1Z2PX 3BD9A 4WXHA 4YB8A 5KTNA 3AVYA 3EULA 4QGAA 4NCJA 4FZRA 1EWKA 2OP0A 1B6RA 2VR1A 4HQLA 4O2BB 5G02A 3HVRA 4OHXA 3ZW9A 2FTKE 4OXRA 1O95A 1SQ5A 4OVKA 4RH1A 3Q9LA 5LUBA 1L1FA 5AVXA 4Q9HA 4B2YA 2QRGA 4C5AA 2W4QA 2PH3A 2XVYA 5JO0A 2ZJYA 2R8YA 3QZUA 3GGPA 1Z33A 1NQAO 2KM1A 2PKRA 1NOIA 1Y1TA 2FX3A 2Q5QA 1H5QA 2YY6A 1JEQB 3L4SO 4HH3C 4PAMA 1OI3A 2FVYA 1QGED 3BBLA 3TAUA 5LM3A 4UREA 4JMLA 4CLDA 2DG2A 3AVXA 1MZPA 4L5CA 3D2CA 2YRWA 4QOHA 1YB4A 1RLOA 2E0IA 1CJMA 1LNQA 3W34A 3WB2A 5F7OA 1N0IA 2BM9A 4MS1A 4C78A 4HVCA 3UTCA 1DQYA 2EP5A 2W83A 5B7NA 3IOBA 3WADA 3OZAA 3INTA 4P0PB 3GLIE 4A82A 3MJHA 3C43A 5CYOA 1J2RA 1IBLB 2PUGA 1H9AA 4RWZA 4IIDA 4E5VA 5ADVA 1TUBA 1U6JA 1Y63A 2I4OA 4UJ5A 2XMSA 5FEMA 4CVNA 1Z4OA 1TD1A 4E2YA 4MAFA 3OCJA 1DIHA 2HLPA 1Y1RA 3QEBZ 1E60A 4EMUA 4RAQA 1Z5GA 5EP3A 1P75A 1VLLA 5ITSA 1A3CA 2HFJA 2VAXA 2DR0A 5DNCA 4URZR 3N58A 1H4TA 1V4NA 4BTLA 4GYKA 3SZRA 1SBCA 1RTTA 2FZWA 5FOTA 2A9JA 2AJDA 3DO6A 1ORIA 3PUVA 2JBAA 3W8EA 4R6WA 1ECCA 4H4DA 2O3SA 4GBMA 4PYKA 2Q62A 2HSWA 5DWVA 4JSYA 4NMHA 1IPEA 1H5NA 2Z2ZA 2FUEA 3UMFA 3UT6A 3ZI4A 1QAQA 4AULA 4D98A 2Z08A 4HEHA 2P2LA 3U3XA 3TTYA 2WW8A 4EEXA 4I1SA 1VZ3A 1NMSA 3CY6A 3WL4A 1PGJA 4RD0A 1W2WB 5FNVB 3GLKA 3IPYA 3WL5A 5LQJA 3L1UA 2NYVA 1A4RA 1WF6A 4WDQA 3VR5D 4BV8A 5DYNA 2AFHB 4A23A 3SBXA 4INJA 4DJDC 1C2TA 1DUSA 1KZ7B 3UA4A 4G3XA 1GUAA 1N6RA 1T0BA 4Q9AA 1TYBE 4IIGA 1NKTA 5LL6P 4KO2S 4O02B 4H31A 2D1TA 4GPAA 1Z4JA 5A1TA 3HN6A 1P80A 2I3GA 4C4ZA 4LC1A 1G8AA 4TS1A 1FRQA 2IT1A 3H97A 4ER7A 7REQB 1RZVA 2PUAA 4EGSA 4ZT3A 3VDXA 1ZGGA 1JZQA 1ZX1A 4DIBA 1BEZA 3U4DA 2WMYA 3PE4A 2FPPB 1X7ZB 1JYSA 3QFTA 1XZIA 2AA3A 1P61B 4JN6B 1PK9A 2AQ8A 4QYIB 1WJGA 4H6XA 1FF9A 3PF8A 4HAWA 3CPJB 3C3EA 2QP3A 4D80A 1F9AA 2R4TA 4D0GA 1Y1KE 5T8KC 1ZQ1A 1RLJA 5EJEA 1UBCA 3IVMA 2BIFA 2DWQA 4FYPA 4MS1B 5AM5A 1DL5A 2NN3C 1RXVA 4KSBA 4D5EA 5B53A 1Q0LA 1DV1A 2OO5C 1IEXA 1TNDA 2CDBA 3K0CA 4H17A 3DKPA 2FSFA 4JODA 2VP6A 1VIVA 4JX8A 1SM4A 5EIFA 3V97A 4TMYA 4M60A 4DG8A 2X1HA 2C5EA 4GH5A 1SD5A 4OM7A 5IDXA 1EXVA 4OB7A 4BEWA 5CLLA 2V98A 4B0PA 2H2DA 1KJQA 1LX7A 1O3YA 2D54A 4JIGA 4JYMA 1RWXA 4P0TA 4XD2A 1XQXA 5CDSA 1E1RA 4KYIB 1RC1A 3ELUA 4EW6A 3GDHA 2GZHA 3SJUA 4F5YA 3OJFA 5LMCA 4NE9A 2FEKA 1VCNA 1IATA 1MG5A 1X7HA 1DRJA 2EW1A 2QZSA 2ZT7A 4Q02A 1Y81A 3O75A 2XCUA 4D9HA 1GADO 2ZSUA 1OWMA 1YR1A 3I23A 3VVLA 4B48A 1PO7A 4ZO6A 1WQ1R 1X0XA 2NZYA 1GGHA 2WBLC 1T4CA 3W2TA 4C0LA 1FTQA 1ZW1A 3MQ4A 3SNKA 2XE7A 2J0QA 4LTMA 5A9RA 5HJEA 1GDHA 1USKA 2FFQA 3AHGA 3ESZA 4UHBA 4YP1A 5LPNA 2YV5A 3N8HA 3OURA 1AMNA 4KO1S 1EUCA 2E4AA 3W0LB 2IU4A 2QLBA 4H1WA 1BCSA 3S68A 2VXCA 5ADUS 4LX8A 3L7NA 1PQ4A 4Q15A 3B5EA 3S5JA 1HT0A 1XVTA 3RK4A 1WVIA 4AXXA 1XPRA 1CPYA 4JITA 4V0QA 1Z2EA 1K7SN 4LXXA 2J9FA 2CDRA 4CMCA 1E1YA 4RWEA 1FXWA 4W7IA 2ZPTX 3OZVA 4AMYA 1GQ2A 3KHUA 1U7ZA 4N41A 2KQUA 1NJ6A 4HAYA 4QOIA 1YU9A 1JF8A 1VP3A 3E3AA 4RQBA 3VNAA 4Y1EA 4N3GA 1KYWA 2RD2A 3L49A 1E59A 3D4NA 1TTPB 1XU4A 2FCRA 4G84A 1GKLA 5LOVB 1Y5NA 2HTEA 3I1YA 4JEMA 1Z13A 5C0OE 3VH3A 4B4OA 3GDOA 3ZDEA 2C3PA 2M6SA 3G6KA 4GMFA 3DZIA 3RVRA 5JS2A 1KQGA 3CRW1 3Q8MA 4QDUA 2O8FA 3UW3A 2VUHB 1YR7A 1XYGA 2D1QA 5I9NA 1FE8A 2V45A 5DIZA 1AKTA 2GAIA 1RMTA 2ZAMA 1KARA 5C34B 2HK8A 1E1LA 2HZBA 3QGMA 4MW1A 4QOJA 3SEFA 5AESA 1PNQA 1G66A 2ACVA 1W4BA 2CHGA 3KZMA 3DHWC 1SIOA 1VKJA 4BX0A 3FLEA 3HABA 3HM2A 1LH0A 5EJFA 3IEVA 2JKYA 1XNGA 2LP4Y 4Z3KA 3UH0A 4XYLA 3ZGOA 4YJGA 3QWBA 5ALUA 6GPBA 3HGMA 1TX4B 1HQDA 3FPJA 1D0IA 3IUSA 3UB2A 2QZPA 3N6RA 1JJBA 4TMXA 4ZU6X 3X1WA 2QY6A 3DVAA 1J39A 1XHLA 4RGYA 2CZGA 5LLSA 4EABA 5HE9A 5DE3A 1T4BA 3FUUA 3NBXX 2ZWPA 4U0KA 4JDUA 5F2NA 3DYVA 3SS9X 4BUZA 4K9QA 1IEQA 2QN7A 3I83A 4BMCA 2Y1FA 3EZ2A 4K9OA 1DJLA 1NBWB 2WU0A 5EE1A 2WHXA 3SE0A 1K2WA 4C0SA 3ZJTA 4MDFA 4F86A 2I80A 4GI2A 1K75A 1ZJ4A 2NUAB 5CJJA 2PXXA 1NR7A 1PS8A 2ZYHA 4P38A 4GQIA 2PUEA 1FU8A 1RVV1 2BZ0A 3EIFA 2OBFA 1QP0A 3R40A 3MC1A 4MDEA 3GLFB 2BY4A 3DV9A 2ZZKA 1JG1A 3AQIA 1J09A 1Z2OX 3EFOB 3ONVA 5CJPA 3F0TA 2GO1A 1F17A 3GLRA 1V6SA 3EEIA 4CE6A 4EJSB 1EG7A 4QM6A 3CT4A 3CEPB 3LFHA 1C3JA 3PHLA 1R74A 3N8IA 5G0TA 2XMRA 3H9QA 4TLMB 1BN6A 4ZZ2A 5KOHB 1X15A 3B3QA 5BR1A 4FNOA 5A02A 3Q10A 1GPKA 4ZMRA 4PZ9A 2IUYA 2ZT6A 1II8A 1N2CE 4HN2A 1HYGA 2X9NA 3KVOA 2VYND 3AKYA 4R05A 3ZV4A 5J2UF 3KKEA 4ICIA 3RUCA 4HNVA 2AJTA 5KTMA 3IJ5A 3QX8A 5IF3A 1PYOA 1E92A 3WSVA 3WMFA 3PX3A 3I61A 1N2IA 1F9EA 3HHEA 4JZYA 5ESXA 3K9FC 1N0WA 4JB3A 1JXOA 1CY4A 3ZZ1A 4AUKA 1ZSVA 1DO8A 3WRXC 5ADHA 3SVTA 3DEAA 2C00A 1SA0B 2BSXA 1FCJA 4LWPA 5KU7A 1KZ9A 1SUCA 4TTJA 3WG9A 1V0JA 2BJHA 2FQQA 2OXIA 3ZUGA 4TLBA 5GP1A 2BGMA 1Z2DA 3ABSB 3EC1A 4GIBA 1OIWA 2FW9A 3RBXA 4F11A 5CLJA 6ADHA 1NNLA 3WB0A 2W42A 4ND2A 2WSLA 1VKNA 5E1DA 1EFPB 1QIGA 1T5TA 2C5FA 2AHOA 2C9MA 4IJWA 3JYOA 4PBSA 4TS4A 3WNBA 1JLSA 4D0RA 4O2AA 4OK3A 1I5RA 3DPIA 1VJ0A 4MV6A 5IU6A 5ER9A 2VDJA 1LQ2A 3C14C 4KO3S 2AN9A 3EE6A 1WZCA 4C2TA 5I3CA 4QJ5A 2IBSA 2W2KB 2HCRA 3TRKA 5I45A 2YZMA 1DJQA 3LXUX 5LZ4A 1MXHA 3GEMA 3SQWA 1ZHOA 2X0KA 2VUUA 3NHFA 3EY9A 4RVDA 4QG3A 3NBKA 3QA9A 1ZUNA 3NIGB 3IMKA 1M9NA 4LZLA 1U1CA 2HSEA 3FPFA 3PIRA 1WOYA 5CRIA 1BE1A 1FFXB 3KU1A 1GEGA 3HCAA 3TLGA 5HIKA 3QE2A 4GPIB 4QXRA 4EG4A 1AMOA 1KEEA 3MM4A 5HA5A 2CB0A 5KVAA 3OM0A 1Y3IA 2QG4A 4A8HA 1J8FA 3HR8A 3PC4A 4C4YA 5IJWA 5LNK1 3SE7A 2YJZA 1J1IA 3JWIA 1WKBA 4Q7EA 4PLYA 1ODLA 2GBPA 4MVJG 4J0DA 4R40A 5I7UA 1HH4A 1OZGA 1RPTA 1U8EA 4D82A 4ARUA 1MAVA 4YONB 3AV0B 3A9CA 2OCYC 3OQIA 5CAEB 3G59A 4BWGA 2XLCA 1ZIYA 4PLFA 4OGGA 2PGIA 1KVTA 4TYMA 5CEJA 2WJGA 2VRCD 2ZJ5A 3LT4A 2F9LA 1DCFA 2HSGA 3NTXA 5F12A 1NSYA 5BN3B 1VCOA 2G7MC 2OCIA 4K6CA 4QJIA 1LPOA 2OUIA 3ABOB 2JVJA 1KTVA 3E1SA 5GOZA 1SXJB 3VSBA 5SY4A 1A9XB 5D6OA 1MG0A 2Q5LA 2Z1MA 1IXZA 2DCMA 5AIAA 5IM4A 2H1SA 2JDID 3Q4GA 4XIJA 3GLIB 2ERXA 3UA3A 4OAQA 2YV4A 3V7UA 2C7QA 4LDZA 2W90A 2DAPA 3NTUA 4F6RB 3TGPA 3HKDB 3ZOKA 1GZ5A 1QGUB 3I5UA 1UC5B 2O0LA 2SHKA 2E6KA 3QUSA 4IJVA 2NO9A 4OH1A 3JVUA 4MUNA 1O5IA 2ATEA 2D5BA 4CEJA 1SU4A 4B81A 2PGLA 3N2ZB 3L82B 4PIMA 1UMKA 3KOMA 3S3TA 3COJA 2H0QA 1MJFA 1A98A 3DXFA 4ZAGA 1MKYA 3C5HA 2PJRA 3HEAA 1Q0QA 2Q8NA 3ABRB 1WV0A 3GAFA 5H1YA 1NLZA 3IJRA 3IOYA 3WOVA 1B2LA 3I3OA 5JZ9A 3RVSA 2I8AA 5B64A 2H0RA 4LMRA 2FXIA 3FVTA 4UOQA 3LUDA 1PD0A 2BI8A 4NU5A 4RVCA 3IVCA 3M4XA 1RCUA 1QCDA 1FDIA 3WIVA 4H4CA 4TLLB 5JASA 2GYUA 1OTYA 4KODA 4NJMB 3O1IC 1KI6A 1TUGA 1VSVA 5K01A 1AZWA 2FOXA 4WAUA 2NPOA 5FXMA 4QPDA 5JI3E 4DV1B 3F4LA 1FW6A 3ZCTA 1A7KA 5F33A 1M8JA 1OFHA 4GNKA 1IHPA 3HYCA 1W1IA 2NYRA 3T94A 3AEQA 4GE0A 3SJBA 4LFBB 4YUVA 4RMJA 2XNDD 4FKBA 2VPXA 4G8CA 2QM3A 4TTSA 2AJBA 4TVSA 5TQ0A 4FK8A 2BV3A 3BBPA 4KZKA 4X1IB 3MJFA 3ZWVA 3R3VA 4FEEA 1SG6A 4M3NA 2X40A 2IHTA 3U3OA 3TK1A 1XF9A 1JVNA 4MS4A 4P86A 3EC2A 1NXWA 5K3FB 1VG8A 1IMOA 3FHJA 3PNVA 4QUHA 3AR3A 2QE6A 3ADDA 3O82A 4UZFA 2AFHA 1MLDA 1S2IA 4TV8F 4H16A 3HVJA 3OD1A 4MR8B 4EO7A 1YVRA 1NVFA 1L5FA 5IF9A 3GZNA 1X1BA 1W35A 4TGLA 1DFHA 5A03A 5D3KA 2D7DA 4YMIA 1MN6A 1AE1A 5BT9A 4LZZA 3SM9A 3UMGA 4Z4HA 1DBPA 1NW7A 3GJ3A 2QN2A 2CCGA 1FQOA 3D7MA 3CPSA 4FOSA 4N54A 5HQ3B 2FFAA 2IEAA 2TMKA 3GO4A 4RV4A 4D99A 1HFEL 2WLTA 3KTAB 2Q6IA 1R27A 1PFGA 4E6PA 3L84A 1BJRE 4EGCB 2E4YA 3O94A 1KSFX 1UWLA 4BLVA 1R5JA 4IDHA 2YDXA 2ZSJA 1UK7A 2HEIA 2E4WA 4HMPA 4IKOA 4RTMA 3OCWA 3FVQA 3V8EA 3T1YB 3PIDA 3BUSA 2B83A 3DHNA 3IXMA 3LYLA 5KOJB 4NFHA 1P73A 5EJ7A 1YBFA 3CVUA 1ETUA 2WHQA 3NC0C 2QTTA 1GHTA 4GVLA 3VPAA 1V11A 4GSLA 5B2FA 2ZI3A 5D3QA 3UAYA 1MP0A 2J9RA 2ZSDA 1V96A 1EAMA 2GSWA 4F2HA 3CXRA 1LPAB 2G1PA 1P81A 4GOXA 4JUFA 1T24A 4UULA 3KHSA 1YULA 3KCQA 1TF7A 3EXEA 3A14A 3ZU2A 2W2LD 2K6GA 4F4DA 1GSIA 3VC7A 1JKFA 5JJ5A 4HBGA 1X2BA 4M55A 3C7KA 3P4UA 1FIUA 3GB9A 1QV6A 3CZ5A 3O3MB 4K6FA 4BB9A 4KE9A 1DTWA 4JLOA 4ZPJA 1UBJS 1DTWB 2R2AA 2HNKA 2Z9BA 4JJKA 1Q20A 3USES 3ZWWA 3TL3A 1K06A 3SWWA 3TNFA 3GEDA 3RFUA 1HF3A 1IN6A 3H3JA 2N1BA 4INZA 4MRRA 4OIMA 5C1BA 4DZRA 2YXEA 4MRPA 4JP5A 3O92A 4CKZA 1LC0A 4CCYB 4TKVA 5B3JC 2ZT8A 4J2HA 4F4JA 1PL7A 2QEQA 3DBHA 1V25A 3N0XA 3WYBA 3LE8A 5DRTA 1FQKA 5FPSA 1Z4PX 2WM3A 4O3MA 3AVUA 2J7KA 2BGLA 3JQBC 1VLVA 5EKDA 1E7QA 1QE3A 5JD6A 4BO9A 1DRKA 3PRJA 3SXUA 2G9QA 3T3GA 2GZMA 3P9RA 2QUIA 1IN1A 1ZCZA 2QSZA 4QYSA 1O6BA 5CUQA 1HDRA 4LYGA 1C7EA 1CD5A 2KW5A 1OYVA 3LV8A 4YRKA 4L27A 1RBZA 2W2VA 1YWGO 2OAP1 5C51B 1D8AA 1AGYA 5I9MA 3BH6A 5CB6A 1VFNA 1A82A 2VTEA 2BCEA 2NNWB 1YRAA 2V5AA 4D3YA 3KQHA 2PNJA 5JMPA 3K2BA 2ZSAA 1SUBA 1VRWA 2XWQA 3PCTA 2AE2A 1V5EA 2CLHB 5BQOA 4PSCA 3NP7A 1EI9A 2I2AA 4IW3B 1IAQA 3LWDA 1HGXA 3ET5A 1K6XA 2G07A 5K0SA 1M74A 1C1HA 1O54A 2CBZA 1U9CA 4PZZA 3A26A 5LKRA 4QBTA 3K0FA 2BEVB 4AW9A 5C8DA 1WX1A 1O97D 4KR9A 3D6FA 3BD6A 4NICA 5U1PA 1NVUQ 2EQAA 4ODIA 3OM8A 2F8MA 1L8AA 3QHQA 4L16A 3K73O 4IWXA 2QBYA 1L5QA 1O6ZA 3CCBA 1WM1A 2QTMA 2J5RA 4IJQA 5D3MB 2UZ0A 1I5OA 3WWZA 3PVZA 3V4VB 4Z6KA 3QJ5A 4WESB 3WRXA 3FOCA 3BKWA 1W96A 2HDNB 1S1MA 1L0BA 3N2NA 3H4MA 4GM1A 3WE7A 3RTCA 3CLRC 4DNOA 4L73A 1YU6A 2Y3IA 2YQ5A 1U5AA 4PSKA 4OQDA 5C4MA 4FMBB 3BHMA 4M89A 3BOSA 5A0TA 4M4SA 1SIUA 1C14A 2VP0A 2WUVA 3CVOA 4Y1GA 5T67A 4B09A 5GVRA 5C18A 2MR6A 3O4HA 4D3FA 1UT6A 4WWHA 4RHEA 4ZI3A 2H7CA 2YZNA 1FFBA 1UUFA 5DM2A 3SLGA 3T3PB 4RHFA 4LECA 4RJ2A 2QPOA 2HYDA 1H8HA 2CNWD 3MCZA 4X91A 1QYIA 1KI1A 1UPBA 1YS6A 2XIQA 4N03A 4AJEA 1KAMA 3ROPA 4F8JA 3UIEA 3T9AA 1EVIA 1CR2A 2QRMA 2JIRA 2Q1TA 4A1FA 1GQQA 5TQJA 1WULS 4HK4A 5GY7A 4RPGA 2QW8A 3NWBA 5H0IA 3M1YA 3EYWA 3MCTA 1I4WA 5HW0A 1J0DA 5TS3A 3UFXB 2V3WA 1RT9A 1U7UA 1NTOA 3IUYA 3UO8B 3BTUA 1A9RA 3FF1A 2OXFA 3OJXA 3A4LA 3LQRA 4Q3DA 1P2TA 2PCLA 2F67A 3VNSA 4MNTA 3SSAA 1BJKA 3LLUA 5TS2A