4E03A

Structure of parf-adp form 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
206
structure length
204
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
molecule keywords Plasmid partitioning protein ParF
molecule tags Unknown function
source organism Escherichia coli
total genus 69
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e03A00
4B6FA 2F55A 2WSSA 4Q4LA 2QI9C 1CULC 2QBYB 4FMBB 1GTVA 4XVQA 2CL7X 5DN6A 3KXIA 2VIIA 2BCJQ 2ZANA 3F3YA 1Q1EA 3I5XA 4JVNA 3CBQA 4IEEA 1WMSA 4EPYA 1SXJE 1NVVR 4ITRC 1N25A 4URVR 2BM0A 1AM4D 4NH0A 2OM2A 4B34A 3SHWA 1C9KA 3ADKA 1LTQA 1W0KA 4OHZA 4V0ME 3T5DA 4EJSA 4NU0A 5BN5A 1P6XA 2GESA 3PEWA 1ZM3A 1S1CA 4HATA 5TMPA 3GFOA 2WZQA 4QNMA 3GLFE 2OSBA 4QGHA 1SVWA 2C9YA 3SDZA 1XPRA 1R0ZA 2OEPA 2C95A 2D4HA 2XTMA 2AD1A 2F9MA 4JJZA 4QHTA 1TX4B 3QPUA 1UDXA 3NBXX 2XGJA 1SXJB 2OO7A 4FWIB 621PA 1G8YA 1SXJD 4UNQA 3SHFA 4BPBA 2ZRHA 4DB2A 2IXGA 4MYTA 4Z8YA 3WRYC 2OBMA 3BC1A 1E2MA 2WPDD 1KO1A 2QAJA 1AGPA 2QMEA 2A3RA 3FOZA 2GXAA 3ZQ6A 3GLFB 1JI0A 4B6EA 1II8B 1DAKA 1UBCA 4HAXA 4G5OA 4LV5B 3HYRA 5EZ5A 1K6MA 2R9VA 1S96A 4Q9HA 5IHPA 1IY2A 1G20E 4W5WA 3QXHA 2ZJ2A 5GJCA 4B35A 4BLOA 1RRPA 2IYRA 4C0BA 3WXMA 1NBMA 1KI7A 4LYHA 3RRYA 4TYYA 1ZD1A 4MITA 2QP3A 2Q6TA 2XSZA 2REBA 2YWGA 4C3ZA 3FHTA 1MH1A 2IW3A 1X3SA 5AJZA 4G5GA 1SHKA 2ZITA 3LY5A 1PUJA 2DY1A 3GCGA 1ODFA 4QJ4A 2R6GA 2ZRMA 4Q01A 4Q7JB 3I32A 4HLQB 2UVQA 3ZVRA 2NO0A 3GJ8A 3Q7QA 4HB4A 4TLAA 2ZJZA 4A2QA 3VFDA 1Q20A 3P27A 2V6JA 3PCRB 1KMHB 3SQXA 1BMFA 2WWGA 1YZUA 3HR7A 3SI7A 2OT3B 5KU1A 4H1UA 4AYWA 5F9HA 3FWYA 2H8KA 4UNSA 3LD9A 1E9SA 1US8B 3UG7A 1EFHA 1I2MA 4B32A 3GJ6A 1NI3A 4UNPA 4NYJR 3Q7PA 5GVRA 1QZXA 1AGRA 1W0JA 4TLBA 4U00A 4GP6A 4M8NE 4Q4JA 1G21E 2JLUA 4TYQA 1YZNA 1GKUB 2R6CA 5J4KA 1Q44A 3KTAA 4DCSA 3OHMA 3C16C 2CL6X 1Q22A 2KBFA 1M2OB 3PEUA 1M7GA 3RANA 2XJ9A 4ZKDA 5HZHA 1YZGA 1W47A 2XB4A 1YQTA 2PX3A 3WYAA 4B2LA 1COWA 3ZH9B 4ZDWA 4Q4HB 4HYYA 1E4YA 2MSEB 4FW9A 2GF9A 2BJVA 1YZQA 1OFTA 2GDJA 2XAUA 4DLUA 5E7MA 4C0QC 2VSOA 5FPYA 2YKGA 2IYVA 3RS5A 4NYMQ 5JS8A 2PZEA 3NWJA 4IOJA 3BB3A 1BYIA 4MRNA 1M6NA 4PR0A 2RGEA 1NLYA 5G3ZA 1ZU4A 4FMCB 4TZ6A 1E9DA 2V6IA 3BS4A 3W6PA 2AX4A 3PXGA 1OJLA 4BWYA 1Q12A 1XCMA 2A78A 4PHHA 1CEEA 4PAOA 2ZSBA 2FSGA 2QGZA 3SEAA 1OHHA 3QE0A 2FPMA 3BERA 4RY2A 5FUVA 2A5GA 2V55B 1E32A 2ZRAA 3SZRA 2IYSA 4OQLA 5B58C 1GDDA 4L9SA 3CRRA 3ZDQA 3R7WB 4FI3C 4XVUA 1S3GA 2RKOA 2GA8A 5BWMA 1E2IA 2E9SA 4BE7B 2GAAA 1YRAA 4Z1MA 3H0KA 4UJ5A 1CF4A 2C04A 1XTJA 4HSEA 5BYJA 1T91A 3W34A 1IN8A 3I92A 1LY1A 4DEYA 3GEIA 5JI2E 3K70B 1P62B 3JZAA 2J1LA 5A5GA 3K70D 3MWLA 1NN5A 1NG9A 4EPRA 3TLXA 1G7SA 2GRJA 1AJEA 4JSYA 5EQTA 3WMEA 4L9WA 4LI0A 2PJRA 4MGYR 1F2UA 2AXPA 2GAOA 1R5NA 4TSFD 1ESMA 2OESA 5CYPA 3RRNA 1TQ4A 2CCJA 3B1YA 3GEHA 2VP6A 1SXJC 1G3RA 3BH6A 1F3OA 3Q5EA 3ZIAA 4GSYA 4DWJA 5FBLB 4Y0VA 1S0UA 1E9BA 2XEXA 3BGWA 3KKQA 1HT2E 2NIPA 4AC9A 1IY0A 4XH9B 3DM5A 4HB2A 5SZJA 2IHBA 5LBIA 4PQYA 5JWOA 2QL6A 3C7KA 2X8AA 4MRVA 1OB2A 1XF9A 1M34E 3EZ6A 2X19A 4WXPA 1MOZA 3TVTA 1ZUHA 1A5TA 1Z0FA 3B1XA 1BIFA 1FMLA 3PEYA 1N6OA 1NVUQ 4B73A 5CYOA 5SZIA 3I62A 5B64A 1IXSB 4WAUA 1WBBA 1ZD8A 1XEWX 4DLTA 1OKKD 5J4HA 3AVOA 4GOXA 1KAOA 2IYYA 1CTQA 3GMTA 4JSTA 3VHXA 3TW8B 2J9RA 3MSXA 1YZLA 2R6FA 2QAGA 2JLQA 1OPXA 1KI3A 4WZAE 1MT0A 2GEVA 1W4RA 4A6PA 3FPAA 2KB0A 3OIWA 3GLHA 3PIRA 2WJVA 1VDZA 2OZEA 3ZS9A 2JASA 2H1LA 3K0CC 3Q8XB 4AG5A 3QY0A 2JIZA 3NTUA 2W0MA 5CM9C 3FHCB 2OAQ1 2YWEA 1CLUA 5GJWC 2ZRFA 4CYMA 1ZMXA 4M9ZA 1N5LA 2ZE6A 3TUJC 4E07A 5ELXA 2ZS9A 4EFLA 1I4DD 3ZGXA 3HWSA 3U7EB 1XZQA 4RKFA 3C15C 4PQRA 3BE4A 1VHTA 2P6NA 3SNHA 3HU1A 3TSZA 1WB9A 3U61B 4JKIA 3QUSA 2F43B 2AFIE 2OXRA 2CJWA 1TQDA 2PL3A 3DM9B 5FPTA 5H68A 1QHYA 3C14C 4ZV4A 3GFTA 1M8PA 1N0UA 4H1VA 1VECA 2JGNA 3SR0A 1QVAA 2ERXA 1P75A 4EKDA 4LJ4A 4NE2A 1UJ2A 4PSKA 5EXPA 4KJZA 2GETA 4TL7A 1WRBA 3EZ9A 3QKTA 4HLDA 3UATA 1Q3TA 3E70C 3KJIA 1R5BA 1TL7C 1DTSA 4JT4A 2REOA 1Z0AA 3K09A 1TF5A 3SFZA 1KSFX 5JJIA 2BVNA 4C30A 4CW7A 1B23P 3OAAA 3AQ4A 4H9GA 1HTWA 3ETLA 4JLVA 1W4CA 2FJUA 2FFAA 3AVQA 1E4VA 4A0FA 1OIWA 2IS4A 4Q4AB 1JXMA 4ZDIA 3EZ2A 3LX8A 3AP3A 3U6BA 3MD0A 2CE2X 2F3TA 3SQWA 4Q4HA 2QPTA 4TQAA 2H16A 3TIFA 1T6NA 3RC3A 3KQNA 1W36D 4O2RA 3AM1A 4V0NA 3K70C 3CNOA 4F7WA 1IOZA 4IDNA 1LVGA 2CLCX 2B92A 3F5FA 1G5RA 1SHZA 2NGRA 5JWHA 2J0SA 4FWTA 2OCYC 1KZ7B 3AP2A 3TBKA 1E98A 4L5BA 5EUQB 3FGNA 1DEKA 1OH7A 3U7GA 4A4DA 1XPOA 5E7IA 3H1TA 1E2QA 1CR0A 4TQ9A 1E9RA 4WZ6A 1S9HA 1XMJA 4BRWA 4BLPA 2JDIA 1KZGB 1HY3A 2QRNA 2VL7A 1K8RA 3W6NA 3W8RA 2BEKA 4LHXA 2Q3MA 2A5FA 2IXFA 4LK2A 3TNFA 4BFUA 2Z83A 2CK3A 4EPWA 2XZPA 4DCUA 1VYUA 3EPHA 2WIAA 2QP9X 1NVXQ 2CHGA 1UADA 3D6TB 2AXNA 3R7WA 4ZI2A 4B3XA 4TTPA 1A4RA 3A1SA 3FKSD 4Q1DA 5TV2A 4RD2A 1BOFA 4EQ6A 2BDTA 5HE9A 1OV4A 1RE0A 3AGQA 4JLPA 2F9LA 2QM7A 3AVVA 2FOLA 1E2NA 3C4JA 4L16A 4LHYA 3I61A 5F9FA 1Q57A 1EK0A 3WRXC 4A92A 4DDVA 2R6AA 4QBIA 4IDPA 2W83A 4GNKA 2EU8A 4GPTA 3B8HA 4UQOA 2O8DB 1S3SA 2X2EA 4BFVA 2V7QA 1OFIA 3F0TA 1QHIA 3IDQA 3KJGA 3K0AA 4ZIRA 2JA1A 1OB5A 4Q1EA 2FFBA 3BAFA 1GL7A 5FTLA 1KK1A 1Z8FA 4RD3A 1ONBA 3BH7A 4K46A 4XWKA 4B75A 4CEIB 1KNQA 2C9CA 5J40A 3LV8A 3O47A 4P4UA 4RD6A 3WBKA 5H8WA 5AJWA 3LFUA 1E2LA 1SVLA 2WHXA 5CLLA 3OF5A 4ON9A 3W5IA 5SZKB 4BZPA 1E9FA 2ORWA 1DELA 3U7FB 3OFND 1E2EA 3QXXA 4BFYA 1ZRHA 2BKEA 4R2IA 4UNRA 5KYKA 2P5SA 1J2JA 1QHGA 3ASYA 4IJMA 1N5JA 3WHLA 3O8BA 1GZSA 3AVWA 4US2R 1DARA 1T3LA 2NG1A 3L43A 4KFTA 2WWXA 3R9IA 2SHKA 4XWOA 2HT1A 1E6CA 1LB1B 1G7RA 3CIOA 1U94A 2J0UB 5FBQB 1E0JA 1GIAA 2EYQA 1NL3A 4GI7A 3UXMA 1EFCA 1LV7A 4D82A 2XX3A 2EWVA 2HLDD 1T0JB 2DR3A 1V43A 1IJEA 2VYFA 4L8GA 3O8RA 1XJ0A 4OQFA 3PUWA 3HJNA 1R5OA 2IK8A 4NZYA 2IT1A 1ZC3A 2D2EA 3BJIC 3VHLB 1W5TA 2UKDA 3TGPA 1VTKA 4PPFA 1OH6A 4MYHA 1EG7A 3T34A 2GTPA 1T9HA 1SVOA 4LJYA 5H70A 4FN5A 5IRCD 3EC2A 1E9AA 3C5CA 1QDEA 1SQ5A 2G0NA 3AUYA 2FSIA 4JLMA 1N2CE 2VHTA 1E0KA 1NNEA 3IIMA 5CB8A 1GL9B 2CHVA 1G7TA 2MMGA 1QF9A 1R0YA 1Y63A 4PC1A 1W36C 3H2YA 1OXVA 4PO9A 4B43A 2ATVA 3LRPA 4AKGA 3EPKA 3SS8A 3ZQJA 4B33A 3SFVA 2ORVA 3BFKA 2BJWA 5H1YA 4LCBA 3THWB 2EFEB 3HP1A 3KXLA 3VR5A 2Q9CA 3FMIA 1VCNA 2ZI3A 4K81B 3TMKA 4A0HA 4D0GA 2ONKA 4YQFA 4DLYA 2PBRA 3E1SA 5FTMA 3CKLA 2WICA 3OEED 1RC8A 4Z51A 4U7DA 1W2GA 3B85A 4P32A 2J45A 4C0LA 3VNUA 2IS2A 1PV4A 3DOFA 2QE7D 1DAEA 1QHNA 1GSIA 5CDFA 3CR8A 1FL9A 2VP5A 4NCHA 5G41A 4CRWB 1Z0JA 2QT1A 1KI1A 1CRQA 3QXJA 4DLVA 4QL3A 1U81A 3U3KA 2WOJA 5SZHB 4IDHA 4JL6A 3DEFA 2O52A 2VSFA 3J81k 5JCPA 3CNNA 2VP0A 2EWWA 3CWZA 3OEHA 4Q4AA 4AG6A 4A1FA 4HUTA 4OKSA 1N6RA 1KSGA 4G1UC 4DDWA 4XTRA 1NMXA 4GT1A 2D2FA 4D4KA 1TPZA 4D0NA 3B78A 2ZR9A 1JEEA 4X8LA 2GNOA 1GVNB 2ZU6A 4LRWA 5C4MA 2BEJA 2WJHA 3TJZA 2ANCA 3HU3A 2IUTA 2R44A 2HJGA 1Q3HA 2Q0HA 4BLRA 1S9DA 2RHMA 2GF0A 3V9PA 1FX0B 1MV5A 2R62A 3IHLA 1N3BA 3QXSA 1JR6A 2H7VA 3NHBA 2ZEJA 4JZKA 4LJ7A 4D25A 2A5YB 1MO6A 1RZ3A 3KUCA 3HU2A 5CIQA 1GUAA 2ZI4A 5IK2D 1VYVA 3MLEA 2ZYUX 2J46A 1ZM4A 3SBDA 2P65A 2ZRGA 4Q02A 4YMTA 2VBCA 2VSXA 5FOTA 2QA5A 4HZUB 4CT4B 3GJ5A 2YWFA 5AWFC 1JQLB 2JJ1D 4Q9JA 1OLOA 4D4JA 1DO0A 4EUNA 1LFDB 1OIVA 3CPHA 2AWOA 5E95A 3W5JA 4JL5A 2RGXA 4BFZA 3PJRA 1N6PA 3IIKA 5KNCA 1HA3A 1G4UR 4IEIA 1TAGA 2QSYA 5A4JA 2IYWA 4L15A 3VX4A 1JNYA 2LKCA 4OHYA 4C0AC 4TL6A 2GEUA 2RGBA 1DVRA 3X1XA 3CRVA 5TXGA 5JSZA 3KQLA 5DYIA 3PFIA 1FNMA 2GZHA 1R4AA 3AF4A 3EG5A 5D3MB 2J0VA 3GLIE 2YV5A 3QKRA 1U8ZA 3PUYA 3MWYW 3TSWA 5JRZA 4LGMA 2D62A 1L7VC 1YR9A 1N6NA 2RB4A 2BM1A 2GJAA 4CEIA 1U98A 2ZRBA 1WBDA 2YOGA 4QJ3A 2P5TB 4JVLA 1ANKA 4DIEA 1VG0B 3CF2A 2DFLA 3OFNA 2MSCB 4W9MC 1XFAA 2XITA 4YXWD 3WP0A 3U5ZB 4TMXA 5D3QA 5KSYA 4XJXA 5JLJA 3M4YA 1E99A 4CGZA 4DSNA 2P6RA 1UEIA 5KSOA 2EVWX 4KBGA 4PAMA 4AK9A 3SN6A 2AR7A 4D4LA 1X1RA 3K9GA 3QIAA 4TMTA 5CK4A 3MMPA 2B7BA 5GJVC 1L4YA 3U6KA 3Q9LA 3ZVLA 1XTRA 4IVQA 2B7CA 1CS4C 4OI4A 1GFIA 2A30A 2X77A 2YJTD 4QGAA 4EJSC 5DHAA 2FG5A 1JPJA 2C8VA 3UWOA 3NG1A 2VEDA 4XVRA 1QHHB 1XD2B 2G88A 5G40A 4EIWA 4ASUA 3H4MA 1KI6A 4DLRA 2J59A 1RFLA 3KUDA 3U4QB 5C1BA 4CEHA 3S1AA 5IDVA 4M1SA 3VR4A 2FF7A 5AUPB 821PA 2V1XA 4TMWA 3WYGA 1G6HA 4KITB 2XOKD 2HYIC 5BXQC 2CNWA 3WMFA 5B57C 1G291 3I1FA 3RDPA 1F2TB 3NBFA 4QNRA 1CIPA 1MO4A 5EXXA 3T1OA 4F91B 1ZVQA 5E7JA 2BKUA 4KYUA 4M1TA 1VCMA 4MGKR 3PUXA 1FQJA 1NRJB 3D3QA 4PC2A 2CLSA 4BASA 2PEYA 4MKHA 4XSHA 1XZPA 4KFRA 1AIPA 4LOAA 1KK3A 1U2RA 2ZI5A 1AS2A 4DCNA 1C4OA 1S2MA 4WBSA 2IYQA 3SYKA 2FX3A 3MCAA 2PCLA 2ZETA 1DAFA 4M21A 3LVQE 5KSZA 4IFEA 1X8LA 4IVPA 1G7CA 1XPUA 3N5CA 1KK0A 2BWJA 1R10A 2F3RA 4DSOA 2N46A 3QKUA 4Q7KA 1A1VA 3OIVA 1ZD9A 4PX9A 3UPUA 3SE0A 4US0R 1E1QA 1YR6A 2AKAB 3THYA 3HPRA 5FL3A 2WAYA 5FL7D 4KAXA 3CX7A 2GK6A 4UJ3A 1RYHA 2AD5A 3JZMA 3ZZUA 1XTQA 5JECA 2ZSAA 1XXHB 2ZJYA 4XIGS 4M0LA 5J4VA 4IOKA 1NLFA 3MJRA 4DRZA 3T15A 2XB2A 2ZR0A 1UKEA 2I4IA 4KFSA 2WWYA 3A1VA 4MYUA 5C18A 2O8CB 5K8IA 4ACBA 2ZUBA 3K9LA 5E4FA 2F1HA 1KY3A 2ZRNA 1H8HD 1QHSA 2ZUCA 3HR8A 3MG9A 1AK2A 1G4AE 3IQXA 1FUUA 2DWPA 2VHUA 5F98A 2ZI7A 4M4SA 4I1VA 3I4LA 2YYZA 1IN7A 4WZBE 3RC8A 1CBUA 4R7ZA 1SVSA 2KSQA 5EE5B 2IEYA 4HAUA 4DSTA 4E22A 1FMJA 2WAXA 2BIFA 5FI0B 4QFMA 2O8FB 4MQBA 3W90A 1J70A 3UWKA 2IC5A 2ZREA 3MRSA 4X8HA 3EWSA 3LW8A 5FI1B 1D8TA 4X8MA 4NP6A 4I1OA 1KSJA 5DISB 1E1RA 4JLJA 2QZ4A 2B21A 3PUZA 4JS0A 2VHQA 2IHYA 4RFVA 5JEDA 1I4LD 1SVKA 3B60A 2BMJA 1XDBA 1OXUA 2O8BB 2PEZA 2L0XA 3NC1C 4IOMA 3NBZC 4C9BA 2XXAB 4GZLA 4BECA 1T3HA 1KHTA 3EA5A 1N6HA 3AGPA 3T5GA 3Q85A 2DFKB 2ZAOA 1R8QA 1U99A 1WQ1R 4YMSA 3P1JA 3TH5A 4TQUS 4TMZA 2GK7A 1C1YA 3QJYA 3A8TA 1JR3E 3BBPA 5JHGB 2IF0A 4RVCA 5EP3A 5HCIA 4A15A 2E87A 1DAGA 1M7BA 2JCSA 4BEBA 4OJKA 3ECCA 1IXRC 1EGAA 4GRAA 1ZCBA 4PZYA 2WV9A 1AN0A 4A0GA 1E9EA 1Z6GA 5LB2A 4ESHA 3SBEA 1YZKA 4NPHA 5FTKA 1ZUIA 5L3SA 3IO3A 1DAHA 2V4ZA 4KBFA 5CM8B 1UPTA 5KHOC 1S8FA 2ODWA 2WWWA 2I3BA 4JVMA 3REGA 2W00A 2XNDD 3MUFA 4HAZA 3DZ8A 2HXYA 1GNQA 4MKGA 4V03A 5AJXA 1JR3D 2PZFA 3OESA 2BMEA 2EW1A 3M6AA 1RKBA 5J47A 3DKPA 2RMKA 3QEOA 1FP7A 1OFUX 5KDLA 2HUPA 2GCNA 4A36A 4LV8B 4WOPA 1NKTA 2C9OA 2BCGY 3V4RA 4A82A 3B7GA 2QEQA 4PFSA 1H65A 1JEDA 5L3QB 1OYYA 3FVQA 3VU9B 3K9NA 1Z0DA 2QSZA 4MUAA 3G82C 3BK7A 2FN4A 3GLIA 4DBLC 5IF9A 2ZUDA 1N5IA 2AK3A 3WYFA 3WHKA 4TT3D 2G1JA 1N6LA 2QBYA 2KJQA 3SU8A 3THOA 4G3XA 4KV9A 4TN1A 1XMVA 3U60B 1XEXB 4R2HA 2OLKA 1R8SA 4N3NA 4A8JB 5BN4A 3CWQA 4QKQA 1XMIA 2W2VA 2YNMA 4JBWA 1RPZA 5CITA 2HF8A 1OF1A 3MGCA 4GP7A 1AQYA 5BQ5A 1W49A 1YJ5A 4LWZA 4KO8A 2RGDA 1CXZA 1QHXA 1T5LA 1JALA 5TDHA 4C7OB 1F2TA 1XEFA 1ZNXA 4JLKA 3KJEA 4LJAA 3QG5A 5DHFA 5EP2A 1MABB 4C0HA 2E1RA 1XEWY 3CF0A 3QNUA 2PH1A 4RD1A 3SYLA 1UKVY 2GJ8A 4HLUA 1XJQA 4HUQB 3RS2A 1IHUA 1AS0A 2QTHA 1SXJA 5JFGA 3RSLA 3CZQA 5KDOA 3FMFA 2JAQA 4I99A 2WPDA 3L2OB 4ABYA 4CDGA 2KBEA 2ZE7A 4B74A 4DLWA 1XBTA 1TQ2A 4QJ5A 4V0MA 3WY9A 5J5CA 1P2VA 1E2KA 3LA6A 3GLGE 2R2AA 1U9IC 4HAVA 3VR2A 3GLFA 4HZIA 3SJAA 3R8CA 1II8A 1GL6A 4OI0A 1XNJA 4P4TA 1II9A 3K9HA 1M1YE 5HZKA 2XJ4A 3R20A 4B3GA 1I4TD 2WBLC 1E9CA 1KIMA 3AEZA 2QPAA 1E79D 1KJWA 2J7PD 2YZ2A 3LW7A 3FKQA 1Y3AA 3NKVA 2EQBA 2A5DA 3T1QA 1MO5A 2PT5A 2JJ2D 1CJVC 1AZSC 2QENA 3NH6A 2EYUA 2IYLD 2W6ID 4URYR 3I8SA 2ZI9A 2WTUA 1CJTC 3DMDA 5FOSA 4C4PA 2BC9A 1K5DA 2GCOB 4G01B 2OE2A 3QVVA 5DIFA 4C2UA 4OK5A 3GLGB 3IPYA 4DSUA 4FINA 2VF7A 1S1MA 2O8CA 3GJ3A 4TLDA 2GVZC 5EXSA 1XMSA 4XOIA 1KY2A 3I3SR 3QPVA 4DT1B 1KGDA 1KMHA 4OQXA 4BLQA 3KQKA 4D26A 2CHQA 2HYDA 4GL2A 4Q7LA 1OH5A 2FNAA 3A37A 1A2BA 2QRZA 1US8A 4OK6A 4ZI3A 3K0CA 1Q0UA 1U8YA 3DHWC 4DCVA 1P61B 1W4AA 3DKVA 1GWNA 4NYIQ 3PVSA 2FSHA 2O8FA 2IYTA 4QBHA 3WNDA 3LBIA 4DUGD 1Z6AA 2D7DA 5FOXA 521PA 3LLUA 4LPKA 5DH9A 3PV0A 3LXRA 3GPLA 1TTTA 3RRZA 2W0SA 1Q21A 1KMQA 3LQQA 1P3JA 1IM2A 1BH2A 3TSOA 4KVGA 5LB4A 2GXUA 2IF2A 1W36B 3ADDA 4B3DA 4GOJA 3FHOA 5L8VA 2FV8A 4PANA 4X8OA 3EA0A 4UXJA 1M74A 2OG2A 2PZGA 2GKSA 4QXAA 4AY2A 2IXEA 3RS3A 1UBFA 4PAQA 2REXB 4AYTA 1TF7A 3B1ZA 2W6JD 5C2JB 1Z2CA 2N1BA 4JLAA 1OXSC 1SKQA 1EWRA 1KO7A 1ZIOA 2RHDA 1NY6A 3DO6A 3JVUA 4G0NA 1YR8A 1Z5ZA 1N0WA 4JBXA 1F6BA 3NDPA 2DWQA 5IT5A 2FE4A 2GCPA 3U3MA 3NIBA 2CMKA 2TMKA 2WKQA 3CRW1 5AR1A 2ODNA 1CU1A 2OBNA 1XTIA 3CZPA 4ILEA 2OBLA 4Q19A 3X1WA 2CEAA 3VNVA 2QNRA 2G1KA 3X1YA 5CB6A 2A7QA 5DE3A 1JR3A 1N6IA 2FH5B 4MDFA 2ZVPX 4XD7D 5EE9A 4A8JC 1GOTA 4AURA 4BZXA 4RFSB 1IN4A 2O8EB 4KYIB 5HKKD 4AD8A 2G0TA 3K53A 3U44B 3C41J 2N42A 1UBGA 4RKEA 5JJKA 4LYJA 3L0SA 3QVUA 4V0OA 4TWZA 3RYTC 3U3OA 2VP4A 3MAAC 4TSFA 1W1WA 1ELOA 3AV0B 3Q72A 5CK5A 4B76A 2CVFA 3CM0A 2F1RA 3ZVMA 2C77A 3AKEA 1ZINA 1XRJA 1SZPA 4BFWA 2NZJA 1N6KA 2VQSA 3TUZC 3N2EA 1YR7A 2OV2A 3LBNA 4F4IA 3LO5A 3U3RA 1QG4A 3MFYA 1DE0A 4TZ0A 1PLLA 1TADA 4NYMR 4XTCS 1Z63A 4TL8A 4TLEA 1NVVQ 5AK0A 1KI9A 3CLVA 2ECKA 3KZ1E 3TE6A 3G5UA 2QMUA 4B47A 1DBSA 3A1UA 4Z8XA 3THXB 3IKJA 4MRRA 1XCPA 2QT0A 4JKYA 1ZC4A 3ZVNA 4LBYA 4M9SA 1G6OA 2QM8A 4I81A 1WXQA 2CVHA 1Z2AA 1TNDA 1NMZA 5JBQA 1U0LA 2GZAA 4P33A 4KXFB 4OQMA 3NDBB 3K0EA 4BLTA 1SKYE 2FPKA 2I1VB 2ZPTX 4OK3A 3CPJB 2OFWA 1OKKA 4JBYA 1G18A 4KSBA 4DCTA 3CF6R 2PCJA 5B30A 4QM6A 4LJ8A 2Q9BA 3ZD6A 1GKYA 1QVRA 3TW4A 3ZLJA 5TB5A 4C0JA 1XU4A 2WJYA 421PA 2VRWA 2P6UA 2CLDX 4ERNA 5FOWA 4EDHA 1ZCAA 1P9WA 1AQUA 4BEJA 1T5IA 5LD2B 4PPNA 2ZRLA 2WJIA 1SKYB 1Z6TA 4A0RA 5CLQA 4DIDA 3T1TA 4O25A 2ZI6A 4LJ5A 1O3YA 3EZFA 3KX2A 3W9YA 2RGNA 1NIJA 2PLFA 2RH5A 3WNCA 2WSSD 5UKDA 3KB1A 5DNYB 5FBRB 5JI3E 1Z0IA 5DN6D 1E2JA 4D6PA 2WWIA 4Q1BA 3A1TA 2C78A 3N2IA 1PJRA 1U0HC 4DDTA 3GJ7A 4F4CA 4OJQA 1V5WA 5FTNA 5F3WB 1L2TA 4CT5A 4YC7A 1NJFA 2IS1A 3LH5A 1NN1A 4IRUB 2EFHB 2F43A 4LBVA 4TTQA 2Z5FA 4EJSB 3OZXA 2CE7A 5FBWB 2FDCA 2QN6A 1XX6A 2C5LA 4DT1A 2XTNA 1P60A 3BH0A 3QEJA 4DDUA 2IX3A 1KJYA 4Q03A 3UK6A 1X8JA 3FFAA 4LV6A 4NYJQ 3EAQA 3TK1A 4MYCA 1GNRA 1LF0A 2DHRA 1HE8B 1P7CA 5KNDA 4BFXA 3QQ5A 1W46A 1GITA 2W2XA 4US1R 1MO3A 4PZLA 2DFTA 1EESA 3L82B 5HTKA 2G77B 2KWIA 1IN6A 4MDEA 2MSDB 4JT2A 3PUVA 4FXPA 1A7JA 5EE1A 1JPNA 4G5RA 5M04A 3P4XA 1DG1G 1XWIA 5BN3A 3FYHA 1FW6A 2VPPA 4HB0A 3RWOA 2GXQA 4IFBA 1L8QA 1JB1A 2AKYA 4RZ3A 5BW8A 1IJFA 1VYTA 3NEYA 2ZE5A 1ZU5A 4JLOA 2YC4C 3ADCA 4JLNA 1QRAA 4BFSA 4ZDKA 1NBMD 1KO5A 1N0VC 2XZOA 4R9UC 5FUXA 1VMAA 2XSZD 2YWHA 2JATA 4AYXA 2W6JA 1K5GA 4LUCA 3T12A 3IBYA 4M1WA 2A2ZA 3KXKA 1CR4A 3SJCA 3D31A 2VA8A 2NO6A 4ZCIA 4OL0A 4B2IA 1HV8A 3CR7A 4TMKA 1MKYA 4I1UA 3RABA 4DKXA 1BMFD 2C96A 3LNCA 4KLNA 1NKSA 4OI2A 1NN0A 1UDWA 1NJGA 1EFRD 1MR3F 1Z47A 3NH9A 4Q00A 3ZYCA 1Z22A 2F6RA 3EC1A 1EWQA 1XD8A 3AF3A 3CB4A 4Y0AA 3GJ4A 1BKDR 3FKSA 2FZ4A 1CJKC 4POAA 3AKCA 2QORA 1FUKA 4W7SA 1HT1E 3IBGA 4Q4JB 1W0JD 4D0LB 1U90A 4IVRA 2J5XA 2GBLC 2BMFA 3L0OA 4LYAA 2BBSA 3BORA 1I2DA 3KTAB 4TYPA 2IEZA 4NYIR 2BV3A 4YLGA 4A2WA 2NMVA 1W48A 3IPXA 1AS3A 2ZQ5A 3KKNA 2H5EA 3U44A 3VKHA 1Z06A 4Q66C 2HF9A 1E2HA 1COWD 1X8KA 2ATXA 3TR5A 3GP8A 1YRBA 3FFBA 4A2PA 3IEVA 2FGKA 1DAMA 1HYQA 1W2HA 221PA 2D74A 4URWR 3I72A 2X2FA 2ZRCA 4RD4A 2O8DA 3BB1A 2OCPA 1TQ6A 1KKLA 4DC9A 1ZIPA 4LX0A 1P5ZB 1GM5A 3W8NA 3QF4B 1VIAA 4C2TA 1DADA 3E2IA 3KKMA 4HB3A 4MGZR 3ICQB 1UF9A 2X1VA 2QQ0A 3CPEA 4LHZA 4V0KA 5LD2C 1KSHA 3BXZA 3TR0A 1FTNA 4BFTA 1OHHD 1G3QA 3B2EA 4URZR 2G83A 2C98A 3BRWD 1G17A 3THXA 3U3JA 3DMNA 3TAUA 4WW0A 2MMCA 2VP9A 4QGGA 4PC6A 2HDNB 5JEEA 1RRGA 2B8WA 3FMOB 1R2QA 4Z1MD 3HYTA 2WWHA 1Z29A 2ZRDA 1J8YF 2RGCA 5JS7A 1ZM2A 4B3BA 5JZVA 2FSFA 1SGWA 2J0UA 1IXZA 2NTYC 3AH8A 4RZUA 4QM7A 2ODBA 3AF0A 1SVMA 4HDOB 4P4SB 3NHAA 1GKIA 2ORIA 2HLDA 3NBYC 4RCZA 5TARA 2ERYA 2ZXUA 1F2UB 1GAJA 4YMUA 1CJUC 4FCTA 4C0KA 1G3MA 2ZJ5A 1J99A 4II7A 4LC0A 1G64A 2YC2C 1IONA 1EFTA 1HH4A 1ZAKA 1XJCA 1MRSA 3MJHA 4PPQA 2QY9A 3ZS8A 4E03A 3EX7C 1F5NA 2V9PA 4TYWA 1NMYA 3DZDA 3ZIAD 1WE2A 1TEVA 4OYHA 1ZNZA 3IILA 4E5UA 3AVTA 1EX7A 3KL4A 1G1MA 3JVVA 3A4MA 3X1DA 2OILA 2R8RA 1OW3B 1D6JA 3E5HA 4NCKA 1DG3A 4EPXA 2FEMA 4QGFA 4PSAA 2ZE8A 4PXAA 4O2LA 5EZ6B 4TLCA 2ZYTX 2HCBA 1G5PA 4I4LA 5CIWA 1R6BX 1E2GA 4QRHA 4EFNA 1XXHE 3L8YA 3V00A 3RLFA 2NOAA 3EXAA 3BFXA 3BOSA 3GLHE 4M1MA 2V8OA 2XTZA 3UKDA 2A5JA 2IWRA 1GRQA 1EFUA 2Z4RA 2R65A 3ONWA 3ICEA 3BB4A 3THWA 3BWDD 3FDIA 4PO8A 1GRNA 1D2NA 5FOVA 5KO2A 1JXOA 3HPQA 3OEEA 3I8XA 5GVSA 3AVYA 1CKEA 3QF7A 1NG1A 2FEOA 1T8TA 2QE7A 5J4LA 1XTSA 1G8FA 2QAGB 4M53A 1JAHA 1LW7A 2KI5A 3K1JA 1KI8A 2PJZA 3QPWA 5KTYA 2O5VA 1G16A 1XB2A 3GLHB 4KLZA 1E94E 1KDOA 2AHOA 4ZPXA 1KI4A 2GVDC 4URUR 3VR1A 3I5YA 4GDFA 2ZYVX 5FUYA 3TRFA 2NO9A 4IHQA 3WMGA 2VTKA 1TU4A 2G6BA 1M7HA 5AUNB 1NF3A 2JIZD 5AJYA 1RW4A 1GG2A 1DAIA 5B2ZA 3IIJA 3X2SA 3CRMA 2J87A 2C2HA 2VHJA 3U7HB 1VCOA 4PQFA 3SYNA 4IXNA 4ZKEA 1ZW6A 1G19A 1TF2A 1NY5A 2ZRPA 2OCAA 5FBVB 2WWFA 3NC0C 4JYCA 2FZLA 1Q1QA 2QU8A 2OFXA 2IBMA 4OHXA 2HT6A 1Q1ZA 1D2MA 3B13B 4YDHB 2CJWB 4Q21A 3B9QA 2IUSA 1UEJA 4Q18A 1X1SA 3EW9A 1FX0A 1T3SA 3CUEF 1XCGB 2GWHA 3LX5A 5GJBA 1EFRA 3QXCA 2WMNB 3UMSA 5IK2A 4M1KA 3PITA 4PHTA 3T06B 2WSMA 2O0KA 4LBZA 2F1IA 4KSCA 5JMTA 3TQCA 5AUOB 4MKFA 3M1IA 4RZ2A 8OHMA 1U0JA 4LY6A 2IS6A 1NVWQ 1ZP6A 2JLZA 5TY0A 4ZDJA 1RRCA 1XP8A 4HZUA 2JJ1A 2ZVQX 721PA 4OQNA 3OAAD 1Z0KA 3KJHA 3CO5A 121PA 1E0SA 1PVOA 1QBKC 1AKYA 1KDRA 4HAWA 4PHFA 5CJPA 3WP1B 4QC2A 3BFVA 3IUYA 4FMCF 4ACAA 4DB4A 2V3CC 2GZDA 3C5HA 4ZO4A 3B1WA 4HDQB 3QBTA 4AKEA 3AVPA 2OFOA 2O0JA 2QG6A 4Q9IA 3WNBA 4NONA 4LBWA 3WBJA 2JLRA 1FQKA 3VKWA 1VHLA 1D5CA 1II0A 3H84A 1H8ED 3TKLA 4Q1CA 4OBEA 4R71A 3FE2A 4RJLA 1NN3A 1W5SA 4YMWA 5HPYB 2OCBA 5K8TA 3GFPA 3PEVA 3QF4A 4AIIA 2VO1A 5D3MA 2DPXA 1R0XA 4Q48A 2Q3FA 4B2PA 2JDID 4R98A 1UAAA 2IYZA 3IO5A 2JLSA 2BBWA 3RHFA 4LJ6A 1OT3A 2C03A 4Z54A 4YXWA 4IKEA 3RSOA 1W4BA 3A4LA 2CK3D 2EFDB 4P3YA 4GMDA 3VX3A 1FTSA 3B82A 3ASZA 4JMPA 4WIAA 2RGGA 4W5JA 5EP4A 2CCKA 4EQ6B 1DO2A 4NL4H 3X1ZA 3LQRA 4XSGA 2VHCA 2NPFA 2BBOA 5G3YA 5HCNA 1RVDA 3CNLA 3TAHA 2WM9B 1P72A 3DDCA 3BIFA 4BLSA 2QMOA 1A2KC 4Q9KA 4LHVA 4RSGA 2DCUA 4HLCA 3LBHA 2CDNA 4A6XA 1E0AA 1VPLA 2YVUA 4P4SA 1FZQA 1ZNWA 4HI0E 4BRUA 1QHHA 1XD2A 1YU9A 4GOKA 4NKRA 3U4QA 3CW2A 3RNLA 1UFQA 4GBMA 4HLUC 2NQ2C 2HV8A 3R8FA 2XOKA 1OSNA 1KJZA 3GJ0A 3B5JA 3ZZ0A 3R9XA 1HUQA 4EAQA 3K0AB 3BD9A 2V7QD 4WA7A 4D81A 2QAGC 4F38A 4ZIRB 5AUQA 3O8CA 1OYWA 3D7MA 4YMVA 3V4FA 4HDCA 1SVIA 2G3YA 4LC1A 3EASA 2ANBA 5C46F 4QHYA 2GJSA 4PTLA 3VR3A 3B1VA 3QKSB 4LDJA 1D9ZA 1J7KA 4GFDA 4OHWA 5KNBA 1E2PA 2JJ8A 1W44A 2OHFA 1ZM7A 2DB3A 4WXRA 3PR1A 4I1SA 3FTQA 1RRFA 1G41A 1T0HB 2Q21A 2PMDA 2IL1A 4AWXA 5BYKA 4J0QA 5EP1A 5TVKA 2J7KA 4CIDA 4URXR 4F93B 2D3WA 4ESVA 2ZJBA 4Q9LA 3EIQA 1E2FA 3UMRA 5J4YA 5FL7A 4NBSA 1IAQA 2Z6VA 2HCJB 4CEJB 5FOUA 3A36A 3NVAA 2BOVA 1KTVA 1X6VA 3CONA 3K0FB 3KB2A 4G5QA 2NZ8A 1XXHA 1FFHA 1X86B 4S2EA 2AFHE 4IDQA 4JLBA 2OLJA 2EFCB 2IWHA 3ZJYA 3RRMA 2P67A 2VH5R 2ZRJA 3DVLA 1H8HA 3P26A 4QBGB 2ZR7A 4B71A 4FCVA 3F8TA 2BBTA 3VKGA 4KODA 3K09C 5DI3B 2KE5A 4M9XA 2FU5C 4V0LA 3SOPA 2JEOA 2JLXA 4JIMA 4OI1A 1TEXA 2WIBA 1TMKA 1F48A 1ZBDA 1U9IA 2ZU0C 5FPSA 4LYFA 1JAIA 1CRPA 5HR5A 1JJ7A 1EX6A 1KKMA 1ZJ6A 1MRNA 3KKPA 2VF8A 3LVRE 5CJ2A 3T1VA 5CDFE 1QG2A 5FUWA 1YVDA 1ESNA 1KK2A 5K8UA 3PQCA 1PLJA 2V1UA 4Q5IA 3RS0A 2QTVB 2W58A 3Q5DA 1LS6A 1XTKA 4XWAA 2J3EA 3EPJA 2YOFA 4N0EA 3IEUA 3CRQA 2O8BA 2DYKA 4NCIA 3LAWA 3SJBA 2JLYA 1PLKA 1ZNYA 4HEJA 3L0IB 1IQPA 2XXAA 4DXAA 4M1YA 1HQCA 1NLZA 3CX8A 4NMMA 1IN5A 2QPOA 5DLQC 5EJEA 1IY1A 1NSFA 1Z28A 1KOFA 3EIEA 3PG5A 4B48A 4Q7MB 4OHVA 2GHIA 4MA4A 4JJKA 3W6OA 2D06A 1WA5A 2LWIA 3QI2A 4UKDA 2CBZA 1R0WA 4BQSA 3HDTA 3OEHD 4TMVA 1T4GA 3QSYA 1FNNA 4CF7A 2ZRKA 3A4NA 4UXHA 2Y8EA 2YINC 4M2LA 1UBEA 5FPKA 1H8EA 2ZM5A 2A9KA 3QOFA 4L4UA 2XNDA 1KO8A 2ZRIA 1HQYE 2AK2A 4FCWA 4P0TA 4YDSA 3P32A 3CX6A 2YOHA 1YHNA 1G8HA 1WP9A 2DFNA 3DL0A 1UKYA 3OE7D 1E3MA 2QGNA 2OUKA 2WMOB 3TQFA 2WOOA 1NP6A 3REFA 3UANA 1G5TA 3SC3A 1JJVA 5LPNA 3VAAA 2ZS8A 2H17A 1AZTA 2NO7A 2NPIA 4HAYA 5JCZA 2AWNA 4KU4A 3IQWA 3PENA 2ZSFA 3GQBA 3NXSA 1AKEA 1EXMA 1ZYUA 3GJXC 5L3QA 2GJKA 1P2UA 3VU9A 4ARZB 2FWRA 4D80A 1B0UA 1F60A 1RJ9B 4UXIA 1FP6A 1KNXA 1E96A 4IOLA 4TT3A 2RGAA 3IHWA 1GRRA 3AF2A 4M22A 4NTZA 4GMXA 4FMDF 4PC3A 5KUTA 1E69A 2ZIAA 3SJZA 5JWRA 3L8ZA 4B3CA 1VCIA 3B9PA 4NCJA 3QG1A 3GD7A 1XEXA 4QOSA 1LS1A 5JJLA 4NHOA 4LSGA 3UMFA 1G8GA 2H18A 4IXMA 4KFUA 3RWMB 4A8JA 3U2QA 1RYFA 3P20A 1WF3A 4LHWA 5DO9A 4FMDB 5FPHA 2DBYA 4DLSA 3Q3JB 5JSZB 3ND9A 4IDOA 1HEIA 2B6HA 2VLIA 5L3VA 1OH8A 3AKYA 1CP2A 1NIPA 4C7OA 3IGFA 3NEJA 3VTKA 5DI9A 1DOAA 3QKRB 2LKDA 1MABA 5KSPA 3K0SA 2CL0X 4BUJA 4EFMA 1P9RA 4AKIA 1GP2A 2GEDA 1PUIA 4DEXA 4HUQA 3ND8A 2ZJOA 2PT7A 2W2TA 2IYXA 3QKSA 3L0PA 3O8DA 2JLVA 2RGNC 4U02A 3W3ZB 4PO1A 2Z0MA 3AVUA 4DLXA 3P4YA 2YHSA 2ZROA 4BZQA 2UZ3A 3AF1A 1YZTA 3DPUA 4JVSB 3ZZTA 4G5SA 1OXTA 4QHSA 2PX0A 1BYUA 3T61A 5FR1A 4MUBA 1NSTA 2P0EA 1G3IA 1KI2A 2F1JA 1HE1C 3RS7A 4E09A 5A0FA 5DGXA 5EXTA 4F4JA 3OIUA 3TVDA 1E79A 2J7PA 2HXSA 2ZJ8A 1P9NA 1S4QA 4A9AA 3KFVA 3QENA 2JJ2A 2F7SA 1CJMA 4O0MA 4CEJA 1VG9B 1A82A 1E2DA 2W6IA 1ZUNB 4EPTA 1Z6YA 4Q1FA 1KI6B 3K0FA 3RAPR 2GCOA 4ASUD 1JBKA 3C8UA 4MRPA 4LPSA 3S1AB 4CEHB 3GLGA 1HURA 1BS1A 3H86A 4PPGA 4DHEA 4B44A 3QBVA 1W0KD 4M1OA 1J90A 2R6DA 2CNWD 4LZZA 5ANRB 5JRJA 3RS4A 5FH9A 5DI3A 1P73A 4CZ2A 1RIFA 1BO6A 2QP4A 1GILA 2Z4SA 2D7CA 1XD9A 5AJVB 1Z07A 3CH5A 4W5HA 2ODEA 2ZTSA 3KFXA 4QG7A 3VQTA 2K5UA 4AKHA 1KAGA 2QUZA 4DLZA 1NBME 1WCV1 3LWNA 3UIEA 4U5XA 4MRSA 2FGJA 4DUGA 4KCGA 5JHHB 3B6EA 4Q1AA 4KI0A 2FPLA 1JECA 4JLDA 4KVAA 4MKIA 3VR6A 1UM8A 3THYB 2P3SA 1D2EA 2QQEA 1E1QD 1TUIA 1DPFA 1VG1A 3EWAA 1G8PA 3LLMA 2HJVA 3DOEA 4IW3B 2FMXA 4RCYA 3AB3A 5C4GB 3I73A 2V54A 2QTFA 5KPDA 2FFQA 5KDDA 4TYNA 3EZ7A 1O87A 3KQHA 3MWJA 4O3MA 4PHGA 1D9XA 1N5KA 2ZSDA 5FFMA 6Q21A 2IA5A 1SULA 1YKSA 2OXCA 1OE0A 2AN9A 2WKRA 3MWKA 4D4MA 2I1QA 2FA9A 2G9NA 4M9QA 2ZS7A 4DVGA 1KYIA 2CXXA 1J8MF 1G3UA 4DZZA 3LDAA 4C0SA 1T8UA 1P4SA 1OIXA 3OIYA 1P2SA 1GNPA 3GEEA 5DYGA 2ZSEA 2ZJAA 4GZMA 4UNNA 3EPLA 5FTJA 3AUXA 4XD7A 3KKOA 1AA9A 3R9WA 3M0EA 3A1WA 2LCFA 2IUUA 2H92A 5P21A 3FB4A 2O0HA 3OE7A 1VIYA 2XNSA 1U8AA 4FIDA 5HKKA 4RFSA 1W7AA 2O8EA 2J0QA 1Z83A 2H57A 4LJ9A 1E1RD 2WJJA 2UZIR 4JYBA 4PZZA 4S35A 5EUMA 2HEIA 1CR2A 2VP2A 1Q1BA 1G9XA 3T35A 1VKJA 3TUIC 3ADBA 3A6PC 1FOEB 4QBFA 3CH4B 2GJ9A 2DWOA 2BHRA 3LXXA 3VMFA 3RVBA 3EIHA 1KDPA 1TU3A 2Z43A 2C99A 1LNZA 2RAPA 4ARZA 1RJ9A 2GILA 2Q9AA 2ASEA 5G53C 3KQUA 3D8BA 5EE0A 2OAP1 4ZCMA 5L3RA 2B8TA 1Z6XA 3K8YA 2QMHA 4B3FX 3FMPB 1CR1A 4MH0R 4N0DA 1LF5A 4JL8A 1OXXK 2QROA 2IYUA 5EE3A 2WKPA 2NO1A 2CCGA 4P31A 4WVFA 1UKZA 2GBLA 5DSZA 1VG8A 5L3SB 1Z3IX 5KOYA 4N1AA 1OFHA 4Q47A 4K8OA 1WDTA 1L4UA 1PZNA 4FD2A 3AP1A 2RCNA 4YONB 4BGDA 5E3HA 1TUEA 3EARA 4DJTA 4RZXA 1ETUA 3KDSE 2J41A 2ZYWX 1JQJC 3A58B 4MGIR 2GXSA 4F92B 5K8LA 3N70A 2ONJA 2FFHA 4NDZA 4NCNA 4EPVA 1KDTA 1R7RA 1YE8A 1Z08A 2JLWA 1IBRA 4TTRA 2WVJA 2P2LA 1P2TA 4PSVA 4TL9A 5LDDC 4AI6A 3AVXA 1DS6A 5HE8A 2XZLA 4KHZA 4D2IA 1FPMA 3ZD7A 5KPJA 3AKDA 2PLRA 2AL7A 2PMKA 4RD0A 5GADl 1ZM9A 2WJGA 2BMDA 3W3AA 4CVNA 1KO4A 5F2EA 2Q3HA 4ZCLA 2ZAMA 3GLIB 4V02A 3G0HA 4PC7A 5FR2A 3UG6A 2EFGA
chains in the Genus database with same CATH superfamily
1JEJA 3H5IA 3PXUA 1Z7GA 4YJ3B 1TZCA 2BP7B 1WU7A 3W4JA 1H0HA 1GTVA 2BCJQ 4N41A 1Q1EA 1R9MA 2QY6A 2EKQA 3O3OB 4JVNA 1JYFA 4BE9A 2Q29A 1UFRA 3KBBA 5JSYA 2O2IA 5EY5B 1D04A 2C0PA 4EMBA 1WMSA 3FDZA 3E58A 3HZHA 4J0IA 4XGIA 4J3NA 2WU1A 1T2AA 1EFPB 3L7JA 1PJQA 2RI6A 1G5IA 1GG9A 2LV8A 2I76A 2YNMD 4ITRC 4F5DA 1AM4D 4RH3A 1NXVA 1F1JA 5TT1A 4X6UA 3O84A 1C9KA 4FEGA 3ADKA 1LTQA 1W0KA 4XM1A 4V0ME 4OHZA 3NT4A 1Z33A 4DSAA 4NPAA 4NU0A 5BN5A 1WY7A 2Q2VA 3AR3A 3PEWA 4PINA 4E5YA 3GFOA 3GLFE 3ZCSA 3TQSA 3UF0A 2WJWA 3R3WA 3DTVB 3QELB 4CM8A 1NP7A 3G7NA 1PL6A 3DTVD 1QE5A 3OUZA 4BO5A 1W6RA 2F9MA 3WDKA 4DWOA 4X7RA 4MULA 4Z7NB 3QPUA 3ZLBA 4O5OA 4FWIB 3EXHC 4UNQA 3SHFA 2CXPA 2ZRHA 2JAXA 2C0CA 4C29A 4PZUA 1JHRA 5TF4A 3UH1A 3EBOA 5J2TB 1NW6A 1KVRA 3HM2A 5IJWA 4XVCA 2GXAA 3LUGA 1DBRA 1XAGA 2FUG6 1B1CA 4P98A 2NW6A 2V7PA 1UBCA 2EC5A 3E03A 3HKBA 1K6MA 2R9VA 3AKZA 1EX9A 1IB6A 2DWUA 2ZBFA 4Q9HA 3G2HA 1IY2A 5AVWA 5IHPA 3FIUA 2Y67A 3GLSA 2ZKLA 1FUYB 4LNHA 4B35A 3ES9A 2QRKA 1Z62A 3IB3A 3MTJA 1ZBQA 2A3NA 4NECA 3BL5A 4LYHA 5EC8A 4IH4A 3RRYA 3U1VA 2IU6A 4Y2XA 4EKYA 1TQ8A 2G9QA 2QP3A 2XSZA 3LHDA 5LQAA 2JD0A 1MH1A 2IW3A 2J6CA 1X3SA 3DO5A 4XZ3A 4AVYA 1UKCA 1XCOA 1A04A 2ZITA 4TKLA 1PUJA 3VNQA 1ZOIA 4D42A 3KU4A 4QJ4A 2R6GA 1YSCA 2ZRMA 3AR9A 4DYHA 1EEHA 4HQKA 3ZVRA 3GJ8A 3Q7QA 3CWCA 4TLAA 2ZJZA 4DQVA 3VFDA 3KJZA 3P27A 4HF7A 2V6JA 3PCRB 3WXBA 5K0BA 1VI5A 1BMFA 1E58A 1YZUA 4UHCA 4KR9A 2JI7A 1VMEA 4NWIA 4FKZA 2OT3B 4PX5A 4AYWA 1TZ2A 2EKBA 2XMCA 3W77A 5F9HA 3CEHA 2BGGA 4F3RA 1YZYA 2FTKE 3TMAA 4CMGA 1TYDE 1KJQA 1FFGA 3BMQA 4B32A 1WUHS 5AVSA 1Y34E 1C4KA 2JD1A 4UNPA 3ZWYA 3PGLA 1FXWF 1QZXA 5GVRA 3EGVA 4UAJA 4BQEA 5K8JB 4EW2A 4DBZA 3MWDA 4NQRA 2AI2A 1RKQA 4X3CA 2GEJA 3OQ6A 4KX3A 3I3OA 4MK4A 3DDNA 4E30A 3ZNPA 5BV1A 1YAHA 2D8AA 5J4KA 2AG8A 4DCSA 1DNPA 3C16C 4IS2A 4ND7A 1JHMA 1S4MA 3RANA 3DDSA 4ZKDA 2QS9A 1XZ8A 5HZHA 1N0IA 1W47A 3WYAA 2X0IA 3ZH9B 3FVTA 3RVRA 1P81A 4Q4HB 5LQMA 4N9QA 2V74B 5KWSA 4YJDA 3SX4A 2OZKA 2GF9A 4NG5A 3LBYA 1UBOS 1YZQA 1OFTA 2GDJA 5E7MA 5KTRA 2P4EA 1F1BA 5FPYA 1XALA 2YKGA 2IYVA 4R3NA 2VPTA 5JAOA 1GXSB 3AUSA 1I6LA 2IU4A 3C4VA 3A1FA 5AKYA 3RS5A 1ZMBA 4DIKA 2VQDA 2ADFA 4MRNA 2V4MA 1ZD3A 2KYRA 4RS4A 1VPTA 2JHPA 5A0VA 2OR3A 3IOEA 2RGEA 3C6KA 5J5AA 3PHIA 4FMCB 1UODA 5DFAA 4MR8A 1ZI9A 2H06A 2MYNA 2PM8A 2JFBA 2J5KA 2ZIUB 1QB7A 3BS4A 3ITEA 3K2IA 3W6PA 5KVSA 4AUEA 3G1TA 4V1CA 1XCMA 2A78A 1CEEA 4LDZA 1IRXA 2ZSBA 2FSGA 3HY3A 4M0FA 1DEXA 1DSSG 4EY7A 3BERA 4RY2A 2A5GA 3UUGA 3Q6NA 1E32A 3DFFA 4GXNA 1E4OA 1X1QA 1YU6A 4H1TA 4IV5A 3C7AA 3SY8A 3L1KA 5IDQA 1SXPA 1GDDA 5CNKA 3CRRA 4I9UA 4FI3C 4LN1A 4RLSA 3E7DA 2GA8A 2AJTA 1IHPA 2ODPA 5BWMA 3SVZA 3PPXA 4CQNA 1TVCA 5FPPA 3NRBA 4D46A 2XT0A 1Q6YA 3E53A 3G9TA 3KT6A 1T91A 3OSUA 3TNJA 3W34A 3WQBA 3GPCA 3I92A 1LY1A 4DXDA 2GSDA 5JI2E 3HCCA 1OGIA 1U5AA 3GFFA 3EGWA 5FFNA 1OTHA 2J1LA 3G8CA 3GZNA 3DWEX 1WPGA 4G4GA 3LOQA 4G1FA 1QB8A 2CNKA 3AERA 1NG9A 4CKEB 4LWOA 2GA9A 4MS3B 2FVXA 3TLXA 2GRJA 1KY4A 2HF7A 2HK7A 2R85A 5AHWA 5J59A 1N4DA 1V8BA 1XQYA 2HIHA 3LQ2A 1GPLA 3O4GA 3IR5A 1L4HA 4MQFB 2A9FA 2PSEA 2VTEA 2GAOA 3LKZA 2C2ZA 4DG5A 3EYAA 4R01A 5AK6A 1SHJA 4HXYA 2CCJA 3B1YA 1LQTA 3GEHA 4E1BA 3FPCA 1G3RA 1PGNA 1Y3BE 3RBXA 4O08A 4BQOA 1UPCA 2MSLA 3LPNA 3TJRA 1R27A 3OJFA 4M38A 1GA4A 3E7XA 3NBUA 5FBLB 4Y0VA 5JSUA 1R3DA 1WSWA 3OQPA 1IOWA 4LY0A 1AMOA 2XVXA 2WD7A 3DZIA 4QVKA 3DM5A 1Z8DA 1Y8RB 4HB2A 3IAAA 2E5LB 3SZOA 1LUAA 2B4KA 3ZI4A 4MWZA 3UK2A 2WRZA 3NYQA 1OQAA 4MPRA 1SWWA 1C7JA 3PC2A 1M1NB 3H9EO 2MT9A 2R1UA 3NHKA 4WXPA 4L1KA 1JG6A 1Y7HA 1YI0A 1JIQA 1LGYA 2CLKB 2XF2A 4C03A 4G36A 1Y1LA 2B4RO 1KVSA 1HE5A 3B1XA 1FMLA 2O57A 2AG6A 2B20A 3VDXA 1QKKA 4EA7A 4NCAA 4KQMA 1P2BA 1PD0A 4YR7A 4JC8A 1Y3IA 1GCUA 3G02A 1LPSA 2GYVA 2JLCA 2Z5GA 5SZIA 3S28A 1HKHA 1D4ZA 3EIWA 3H1EA 4Y1RA 2IV3A 4DLTA 1Y9DA 1T34A 3E3NA 1JG2A 4B7ZA 3UCFA 3GMTA 3TW8B 3DAGA 3U0VA 2QRQA 1KS2A 5A02A 2P5UA 3BTUA 3QNMA 4WNAB 2JLQA 1EDDA 1UPXA 4WZAE 4HYTA 1MT0A 3BG5A 2FZVA 3IV9A 4GSLA 1FTYA 2KB0A 3MUEA 4A6PA 3OIWA 1VDZA 2OZEA 4Q7QA 1AV6A 4PTZA 5U4QA 3BMOB 2IZ0A 4DYDA 3HFGA 5AJTA 4GUDA 1TTPB 5CM9C 3AI7A 3HB4X 1QGED 2YWEA 5HK8A 4UD6A 5JCOA 1O95C 2H2AA 1CLUA 4MV0A 3CXUA 5GJWC 1DWPA 5GV7A 1N5LA 1ULSA 1XHLA 2IOFA 2O2GA 2H54A 4G8DA 1VGVA 2C94A 3NAGA 5LDDC 4RKFA 3NV9A 3FNRA 4D6YA 2MCFA 1V2GA 5AP9A 2V0NA 4TSRA 2Q28A 4D9JA 2E1PA 1YT5A 4MW4A 1GQQA 1XQXA 3M5WA 3QV1A 4N9WA 3TSZA 1WB9A 4JKIA 3QUSA 5A7GA 7YASA 4HDNB 1ZMTA 2F43B 4JJGA 3T3DA 5DCYA 4H6XA 2OXRA 3VO1A 5B7NA 2VRCD 3SZUA 4GPIB 1QGYA 3DM9B 4NS4A 5ESWA 3GLVA 3C14C 2LUOA 3ZHBA 5EA2A 4XPIB 1G20A 4GX5A 2IOFK 1VECA 5REQA 4G24A 2WHPB 3DR5A 4EKDA 1P75A 4Q3KA 4MR7B 2NU9A 3EDCA 1MJNA 4LJ4A 4NE2A 4PGGA 4MGHA 4G81A 1EJBA 2E37A 5DKFA 3UB3A 1WPQA 1H22A 2G08A 2PUCA 3LDGA 5JCJD 4BJ1A 3IUPA 3MIZA 1PJTA 4JT4A 2OB1A 3K09A 3UAVA 2XRZA 1KSFX 2UZ0A 3UPTA 2BVNA 1Z4NA 4C30A 4CW7A 4EHKA 3OAAA 5CDSA 1FTWA 1T36B 1DDIA 4ID3A 4ND4A 4ARUA 3ED5A 1ZWLA 3KM0A 3LIPA 4LTMA 1W4CA 3QLUC 4ITUA 3LYHA 1FUEA 1EVJA 4YV7A 2D7JA 3PVZA 4OX9B 1U3TA 3U6BA 4RY0A 5HTOA 1T9BA 3N7UA 4TQAA 3FR7A 1T6NA 2QTMA 2Y1LA 3RC3A 4YMIA 3M70A 4RVSA 3ZK7A 3K70C 3CNOA 2ZXEA 1WHSB 5BORA 2NZWA 5L51A 4JQSA 1UT5A 2P4HX 1SHZA 1C3JA 2QTAA 3DUFB 4UULA 4FWTA 1KZ7B 2R7KA 3K6SA 1JHXA 3AINA 1UT8A 4YP7A 3PWZA 2F3SA 1QIIA 4Z9YA 1IM8A 4D4HA 3FGNA 3SZGA 4IFIA 4X71A 1AKNA 1K97A 1XDWA 3TE7A 2B1GA 1NU8A 2XPCA 3H1TA 4IPTA 5TRTA 3UT0A 5LFAA 1T1EA 4RK7A 1X80A 1NDUA 4RJKA 1U8CB 4UNIA 1JL3A 2ZJ0A 4R9NA 3FCCA 3UTCA 3ZEAA 1ODJA 3S0JA 2VL7A 3VOAA 2QD4A 4DWWA 4EG3A 3DHEA 1RSZA 3T7RA 1PNQA 5H5JA 2WB2A 3P8ZA 5E4YA 2CK3A 1RACA 1VYUA 2IDMA 5B2FA 2QP9X 3FOAA 1UADA 1Y6RA 1M1XB 2X22A 3FPLA 1V6AA 2HFKA 3EF3A 5IH7A 4UOZA 1Z35A 4HNTA 4NQZA 3U48A 2P68A 4LVCA 1QR6A 2CMGA 2O5RA 2JHGA 4YRPA 1T6YA 1BOFA 3FNBA 4Y1FA 3EHDA 2BCEA 3AGQA 4FQ8A 3ELYA 1G55A 4JLPA 4UUBA 2QM7A 5JMOA 2P3OA 1Z4LA 3AVVA 2FOLA 2X76A 1AXEA 1E2NA 2HU8A 3D43A 3C4JA 4TPKA 1YUMA 1ZJWA 4UCWA 2A92A 1TVKA 3QUQA 3ULKA 5EJFA 5ICSA 1LC0A 1QFJA 1E66A 3WRXC 3WOHA 4WBNA 1FJ2A 1ZOOA 1U7WA 3N2GB 1C9YA 4QBIA 3SJUA 1QCCA 1FFXA 4AM8A 1L4FA 4GNKA 4MUEA 2EU8A 5A4MS 3B8HA 4MUIA 2PUAA 4UEJA 5ALGA 2KPOA 3ENWA 3H05A 1EUQA 2CNNA 1CQZA 2HX1A 1VE1A 4WN9B 4FONA 2EZ4A 1Z4OA 2HIGA 3KPUA 3W2IA 5JDCC 1ZS9A 2IU0A 3KJGA 3Q3GE 2JA1A 3OZTA 2YVAA 1VJGA 1GL7A 1RP7A 1VIVA 2R87A 1ULZA 4IJWA 5G0SA 3I9JA 5G0VA 7ADHA 3SVLA 3DB2A 4GWLA 4RUKA 5ALLA 1XRLA 2R6ZA 4DIBA 5J40A 4RD6A 4JR2A 3PC8A 2WFMA 2XUQA 4QWMA 2NACA 4PG8A 2WHXA 3OF5A 4X94A 5HFJA 2JGFA 3T41A 2ORWA 2Y3IA 1UXJA 3B51X 1KFBB 1RZRA 3ZHUA 3F7MA 1E2EA 1XL0A 3UUEA 1DKQA 3V46A 3I37X 2BKEA 4KE7A 3EIOA 3T4EA 4R2IA 2EATA 5AKHA 1J2JA 3ASYA 5CVDA 2Z8ZA 1JPUA 3OX2A 5AVZA 3C2QA 2COUA 4WJKB 2RJ3A 2ZATA 1VBNA 2Z1NA 4QPPA 1G5HA 3TTUA 3AVWA 1T3LA 1JDNA 4KFTA 3ZHTA 4JEUA 1PT6A 1E59A 4FP9A 1WMFA 5EAIA 4ER7A 2HT1A 3KV3O 4PYNA 1U94A 1T5TA 2OV1A 4Y9UA 1E0JA 1GIAA 2B8EA 1C50A 1NL3A 2RHLA 3QPCA 4OQ4A 5JXIA 1WNFA 3AR8A 2QTRA 3L1UA 4JB3A 2PR7A 4D82A 2WTNA 1KYQA 1XK7A 1L9XA 1ZUD1 3LVFO 1YFZA 3JQFC 4ZO7A 1QF6A 2GAJA 2HLDD 3AEUB 3N8DA 1IJEA 3Q1KA 4WCFC 3PQ5A 3SIWA 5ESRA 3NKLA 2IK8A 2AYYA 3G59A 3AL2A 3VHLB 1W5TA 2UKDA 3D2CA 3LG2A 3K3PA 2Z9CA 1EG7A 4RV5A 3RAFC 2GTPA 4N6GA 5IDYA 4DSZA 1SVOA 4Q6WA 4FN5A 2V7BA 3BUSA 5IRCD 2QXTA 1X94A 4DL9A 3FGZA 2D1RA 3L6OO 3O1LA 3A2KA 1ESDA 1I3MA 1NWCA 2G0NA 1FLVA 3PRYA 5DGDA 5KQSA 2WYVA 1Z3CA 3WK7A 5ITZB 1E8NA 3G0OA 1E0KA 1NNEA 5CB8A 1HDZA 3ZHCA 1GL9B 3MMNA 1KRWA 2BKVA 1GPDG 2W8ZA 4P80A 2G5TA 3OUUA 4R0NA 2AEJA 1R0YA 3A2NA 4LMAA 2WC1A 4V39A 4A1OA 3JQBA 3NP9A 5D5PA 4MX8A 1W36C 4PO9A 1RWPA 1QDUA 4KAFA 2ATVA 3HSKA 4M0EA 4AKGA 3TQOA 3KT3A 1M8GA 2JBAB 1VMDA 1NQAO 2FE1A 2P11A 5JG7A 3L8HA 4FOSA 2HKIA 3TIGA 1D09A 2PWZA 1FC0A 4H08A 5F77A 5KOHA 2XD4A 1N2CB 1W73A 3K7EA 3MSCA 1VC2A 3VR5A 2KS6A 5JZOA 5LWQA 4KO3S 4TZTA 1Y5NA 3RFXA 5BW5A 3FSRA 4GWGA 3W79A 3KC2A 3CKLA 3I42A 3OEED 4WQMA 4MQMA 2Z2YA 3QFCA 4EVSA 1W2GA 2J3QA 3B85A 4CF5A 3VNUA 3OLXA 4FKBA 1TYAE 2ZUUA 3C5VA 5ULLA 1JKJA 1CERA 1XJ5A 2OQRA 3I45A 4JI7B 1CIJA 1EP1B 4LY9A 3N7TA 3QXJA 1TDJA 1CRQA 1PJ8A 1SY7A 4QL3A 4XRRA 3FCAA 3U3KA 4CM1A 4EBFA 3THSA 2O52A 3J81k 3CWZA 3NIWA 1ZSVA 2EWWA 5FLEX 1RQ7A 1YXMA 2PGLA 4KUGA 4G1UC 3WNZA 1TGVA 5EJ9A 1LW6E 1CIVA 1U7TA 4GT1A 5LA6A 4JXJA 4UE6A 3UJNA 1BA3A 2VPQA 2QRVA 2QQGA 1TPZA 1TK9A 2BONA 3G8AA 3QUTA 4GLOA 2WG2A 2PRIA 3Q7TA 4KI7A 4X8LA 3SMQA 5B7QA 4S04A 3V8BA 3AB7A 3VR0A 1D6SA 1V7CA 3JQDA 4R4JA 1FP1D 2BEJA 2HA4A 2WJHA 3IJEB 2ANCA 4GMGA 4AS2A 2IUTA 3C4QA 3G1UA 4RTRA 2QR3A 3E7PA 2YW2A 3VV2A 4FB5A 4IQFA 1WKVA 3S5JA 2GF0A 4D9HA 1FRNA 5CDYA 1F0KA 2YN2A 3COPA 2W6PA 1QIEA 4I50A 3FDXA 5CT6A 2B3TA 2SECE 1O6CA 1YOVB 2ZEJA 4GO1A 4JZKA 4BEBA 3NU1A 1ZKMA 3IBFA 5EHGA 3QYFA 4DV1B 2XVAA 4G97A 2HZ7A 4WACA 2A5YB 5HDQA 1RZ3A 1OLSB 2JARA 4PSDA 4X1IB 5E1MA 4AZ0A 5IK2D 1O4VA 3IJRA 2UUOA 2R86A 4KPEC 3CVUA 2VPZA 2ZSUA 2ZYUX 3OOSA 4ZU6X 2IE8A 4RPHA 1T4DA 6ABPA 4QQNA 3EDRA 4IH1A 2P65A 3WQHA 3I0NA 2VBCA 1MFZA 4IM7A 4MWEA 1KJNA 4BV3A 2I80A 4GXTA 2QA5A 3KDAA 4HZUB 3SZLA 1HT3A 3WKDA 1M5UA 3W9BA 1NNI1 3T3NA 2YWFA 3GEPA 1P2FA 2J9XB 2YMLA 4Q9JA 5AWFC 2E4VA 2YY6A 3VPDA 4DJJA 1MB0A 3B3JA 5FWDA 3UNXA 2PN1A 3INYA 2AWOA 3UXYA 1IZ9A 4B5KA 2TSYB 5EGSA 4DWVA 4L4SA 1GPBA 4BFZA 3KE9A 4QULA 3CLUC 5C7OO 3PJRA 1L4KA 1KQPA 1Z75A 4QRDA 3JD2A 6GPBA 1G4UR 3HMQA 4GG1A 1H1LB 1TAGA 3PSAA 4R1NA 4UE3S 5A4JA 4L15A 4QX6A 1ZD5A 1SUDA 2PRSA 1FJGB 3A6FA 4QUIA 5F5LA 1QYVA 4OH1A 2EGGA 3JQEA 3A14A 3EFEA 1B1AA 4J94A 2GEUA 5ES3A 1DVRA 4GMFA 3SKXA 3X1XA 4C87A 4DANA 1EI9A 5DYIA 2CFTA 3SBXA 3ZLTA 4RTQA 5F5NA 3MBOA 2VYVD 4OCZA 5A5EA 4XUEA 3NTVA 2WE7A 4O4HA 4J75A 1T2FA 1WY5A 3KSRA 5D3MB 1C0IA 4AN1A 2GWRA 4A10A 4Y6OA 3MWYW 1DRUA 4LKOA 1N6NA 2GJAA 3R7DA 4RPKA 1KEEA 3IODA 4XRGA 5JQGB 4C76A 2HJWA 5JH7B 1L4EA 3L1IA 1ANKA 4C3UA 2IHUA 1VG0B 1V95A 3CF2A 1KWKA 2DFLA 3OFNA 5J3JA 3BDVA 1T4CB 1XTTA 1LPAB 1JA0A 1OPRA 2QYOA 2XITA 3GD5A 4G85A 4HPXB 4XM2A 5KSYA 1NMEA 1ZL0A 3KO8A 3WI7A 5JLJA 1ECLA 5ADWA 4PM4A 3INGA 5IYZF 4LOIA 5KSOA 2WYOA 3PUKA 1P7VA 1KVTA 1V1RA 3L0BA 4X44A 4BTLA 3I64A 1THZA 1X1RA 3F96A 2XR1A 3QIAA 1U2EA 3V6LA 2G9VA 1VL2A 3D5TA 1RXWA 3L1VA 1L4YA 4BVGA 3Q9LA 4DCGA 3I2FA 2VATA 1HQKA 2A30A 3ILXA 2YJTD 3MRVA 4V24A 1MHPA 1N1GA 3PRHA 1JPJA 2C8VA 4ZRNA 1ZUNA 4GS5A 4XVRA 2WWRA 4EIWA 4IIJB 3D6AA 3FAKA 3H4MA 5I9BA 3ICOA 4MAFA 1RFLA 3LCRA 3U4AA 5C5CA 3HO8A 3ER9A 1EWKA 1F3LA 3H8JA 5C1BA 5C1OA 2X0NA 4G2TA 4CEHA 3S1AA 3O4IA 1NR7A 4MUYA 5B53A 1JYEA 821PA 4R1TA 4KPUA 3R9XB 4KITB 5HBGA 2BEUB 2R1TB 4G9GA 5F7JA 3CR3C 1A5AB 1V45E 1GAEO 5THKA 5B57C 4EW6A 2ODQA 2WP8J 1Y1SA 4Q82A 1F2TB 3GBPA 3UAOA 3H1FA 2PNFA 1REQB 5KTTA 1MO4A 2D4AA 4XB1A 3C7TA 2ZAIA 1JHAA 1W19A 2BKUA 3GUHA 4RETA 3ESYA 4O4IF 1DOHA 1NPTO 1QK5A 3G9ZA 5AICA 3TL3A 1R15A 3FHJA 5FUMA 2CLSA 3VM6A 3ESRA 3W4KA 2PEYA 3F6RA 4MKHA 1XZPA 4XSHA 1AIPA 4GPBA 1PX2A 2ZI5A 1KC1A 5CB0A 2NPOA 1S2MA 5EJ7A 3E22A 4WKGA 1WU8A 2VDUE 2PCLA 2ZETA 2O0MA 5HIMA 3LVQE 4EO9A 3RU7A 4IFEA 4IVPA 5K6TA 3BT7A 2VDLB 2XNKA 4YEDA 4LF4B 1XPUA 2BWJA 3GDWA 4BGUA 3JYOA 3QKUA 2NVWA 3RC1A 3VAYA 1JX6A 1DUIA 4JI1B 1FS6A 3VPAA 1E1QA 1GZUA 2EG5A 3ESQA 3HPRA 2V9CA 2WAYA 1TCUA 1SBTA 5FL7D 2WP0A 1WMBA 3P9PA 4QDKA 4UJ3A 1Q0LA 3LYUA 4PR3A 4L28A 5ECDA 2R6HA 3FNGA 1H9CA 4RHXA 4DQKA 4OHKA 1PR6A 1TCBA 5JECA 4IP0A 2CLOB 1UBJS 1HDCA 1KMNA 3B48A 3D8UA 3NTXA 4E32A 5J4VA 3RS9A 5K0GA 1NLFA 3MJRA 4UUMA 3T15A 2O7NA 3DOUA 4OA8A 1UKEA 3HKDB 4OAQA 3ZKWA 5C18A 2K4MA 2B36A 5KTMA 3DZBA 4EB6B 1QUEA 4GICA 1CRLA 4S12A 2F64A 4CPDA 1Q77A 2ZRNA 2QN8A 4HADA 2HOQA 3EULA 4GWKA 2VHUA 2E6KA 3COYA 5CLHA 2OENG 1IUNA 1YMVA 3AR4A 1IN7A 3I4LA 2C8LA 4UQPA 3PDWA 1C80A 1PE0A 4NBTA 5KYXA 1G1AA 3G2QA 4YTEA 3HCFA 3QKWA 4WOKA 3DE2X 3JS5A 1F06A 3WL6A 3RVMA 4LYDA 3I9KA 3ZTYA 4XGNA 4WTOA 2I3GA 1NFQA 4FHCA 4G6ZA 4QFMA 5FQNA 2EBUA 4MQBA 1C0KA 1J70A 4X8HA 2OQIA 4JC0A 4KGDA 4YRLA 4YV0A 1NQWA 1VGQA 3MWEB 4LWPA 4I1OA 4NP6A 1JI3A 1FP4A 1NYTA 1SZJG 3CEJA 1DEHA 1FSGA 2VHQA 3IBCA 4ND8A 4EABA 2WUVA 5JEDA 2QQFA 1ZQ9A 2BMJA 3E0XA 1OXUA 4EGCB 2PEZA 1GFWA 2L0XA 4IOMA 3L46A 3TEMA 3NBZC 4P8RA 4MA5A 1ZCJA 4PG7A 1DQNA 4KX5A 1FSPA 1A77A 2BHSA 3EG9B 3QA3E 1BS2A 1YR3A 1V8ZA 4XXHA 5JSKA 3KWLA 4YMSA 3P1JA 2WKSA 2XECA 4WWHA 4TQUS 5B7GA 2JH3A 4GGPA 2H9AA 1FLNA 1BEEA 4EVRA 5K0FA 1P39A 1EQ2A 1GUFA 3HCNA 4CTMA 3VHQA 5HCIA 4A15A 4PS1A 1JAXA 1M7BA 4L4ZA 4TX1A 1DU4A 1B8PA 1UMDB 2PGOA 4JB0A 3ZHSA 1IXRC 2RK4A 4GRAA 3CUKA 2GRAA 4MPPA 4A0GA 5B3JC 5KJ6A 1QZUA 3IAFA 1W4ZA 4TT8A 2PUGA 5GAJA 4MVCA 3LY8A 4ESHA 3DFIA 4UHHA 3O1JC 1L5GB 4NPHA 1W9HA 4DLPA 3MLAA 3RT7A 4TWJA 4P3NA 3LECA 3ZR4B 5G1OA 3IO3A 1SG6A 4EWLA 5AW3A 5JXHA 2V4ZA 4KBFA 1ULHA 1K8YB 2HIAA 2F48A 3IJPA 5IUJC 1UPTA 2D2VA 3JQ7B 4ER3A 3CVWA 1J9EA 1O94C 3FVVA 4K2HA 1E7SA 4JUAA 3V2GA 5I47A 4C22A 4DLLA 1GNQA 5F33A 5F78A 3USCS 1C0EA 1VM6A 2V7VA 2PZFA 1WSBA 3F90A 3OESA 3QFRA 4S1PA 1Y0BA 2BMEA 2EW1A 1PTJC 1M72A 3DKPA 5LR6A 2RB5A 2RMKA 3K4QA 1FP7A 2GCNA 2Y05A 4A36A 4LV8B 1GG8A 5CDGA 3O3CA 5IBQA 3ZCTA 1M6HA 4QQ8A 6CHYA 4L5JA 2BFCA 1E18A 3GGGA 3KYIB 4HNVA 4QVIA 5KOIA 4DR1B 4E11A 2WQ7A 2VI5A 1P4HA 1H65A 4IJ6A 3K9FC 1JEDA 2YIMA 2HBYA 1CUBA 1N1EA 3G0GA 1TT5A 1UZNA 2C9DA 2L69A 3VU9B 5DEIA 3FGOA 1Z0DA 2PVPA 1B73A 2QK4A 5KCMA 1JQEA 2AK3A 2EKPA 3OPVA 3WHKA 2P27A 2PPVA 3O2NA 2YCBA 1YAJA 5G2OA 3SZMA 4UVEA 1EVKA 3IDFA 1U0RA 2EEZA 1QS0A 3SU8A 5HZMA 1XMVA 2IZ6A 3VR6H 4YJ2F 1UDBA 4YI3A 2AUTA 3VJKA 5E1BA 2JKYA 3HS3A 3F6CA 1W88A 3B2QA 4X93A 4MQ4A 3WLEA 5BN4A 4DTIA 5KMGA 1WHTB 3NHMA 4HPJB 4MDHA 4J4TA 2ONZA 1BCRB 4O4JA 3WBBA 1PJ4A 1PZMA 4G4SP 3IDOA 4H60A 4PYQA 1ZONA 4XCVA 1YJ5A 1ML4A 1ODTC 4G1VA 4NEQA 2RGDA 5TDHA 1CRWG 4MVJG 3U3ZA 3WL8A 3F74A 3AZOA 1XEFA 5TGTA 1C3OB 5HUQA 3KJEA 1V9SA 2HWXA 4MI3A 5DCWA 5EP2A 3I9V6 2E1RA 4AJHA 3Q98A 3CF0A 2QMZA 5KTSA 2XA2A 3BK1A 3HKCA 1NRIA 4HUQB 4BV9A 3RS2A 1KOLA 2B99A 4M8IA 4QQRA 2QTHA 1SXJA 5TMBA 5JFGA 1FJXA 2X7JA 3N0WA 4DC0A 4ARAA 3CZQA 5KDOA 3HJBA 2H48A 2YVKA 1R4MB 3PEFA 4ABYA 2LBPA 1TECE 4RVGA 4URHA 1D6MA 2HK9A 1XBTA 1TQ2A 1PR9A 1KXJA 1LEHA 5B1DA 1K7EB 1JQKA 3SYRA 3GLGE 4K9SA 1K4YA 4HAVA 5KJEA 2ZAYA 1FNSA 4COOA 1XNJA 2SKDA 1FDIA 1M1YE 1GVHA 4PZAA 2QF7A 2XJ4A 2QX7A 2HEGA 2PK3A 1IIBA 3ENZA 4GYKA 3VPHA 3I05A 1QRSA 3NKVA 4E5SA 3LW7A 1L5HA 1ACLA 2C4MA 3DZGA 1Y3AA 5I8ZA 2PKXA 3B8EA 1MO5A 1YA8A 2H1VA 3CC8A 4YUZA 3NYRA 5K3FA 3NH6A 2EYUA 1RHKA 2ZI9A 4ITVA 1CJTC 3FF1A 4S0ZA 1K5DA 3QVVA 1CS0A 4HEA1 5CH5A 4HH4A 3WMRA 1JDBC 3L7YA 4CKBB 3NHWA 1I5EA 2R8BA 1E4EA 1QM5A 3IPYA 3KD2A 4FHFA 3ZOZA 1QQBA 4FINA 2A9QA 4ZJUA 1JT2A 1Y5RA 3GJ3A 1DAPA 1CSEE 1NSYA 2JZOA 3B5EA 1TD1A 5KYTA 4PTYA 1XMSA 4X20A 5K5EA 3L77A 1ICIA 3EEOA 1FRVA 4XOIA 1KY2A 5F1OA 3I3SR 1ETHA 3EBPA 1Y4ZA 5A6SB 1KGDA 1KMHA 4BLQA 4Q3EA 2Q1XA 2QRHA 3EVTA 4J2OA 4WCFB 2J4CA 2PV7A 3WZLA 1N2IA 1XRQA 2GGSA 2Q6KA 1XRNA 4UHJA 3QKIA 4V3CA 5CDHA 3DBVO 4GYYA 1J97A 1PR1A 2HMVA 3A37A 4PG4A 1RPTA 1NW7A 1US8A 2VJMB 5ESXA 2Z1DA 4ZI3A 3RVDA 1W4AA 3DKVA 1R12A 2XUAA 4TRJA 4DJEC 2BFAA 4F0JA 4QBHA 1Y9ZA 1H2RS 3WNDA 2W6CX 3LBIA 1B93A 3VZDA 4YRAA 1GGMA 1KP9A 5FOXA 4ZI7B 1QSGA 4YUYA 2AKEA 4YX9A 4GXQA 3PV0A 3WGZA 2ASVA 1WMAA 2IPXA 3QMMA 1Q21A 1KMQA 4WZBA 2GLTA 3NQ41 5BN3B 3RHSA 3G3EA 1P3JA 1I14A 3MGBA 1UOPA 5ALYA 2AE2A 3LHIA 2IF2A 3IAEA 1NUAA 5LMNB 1W36B 4B3DA 2BGWA 1U4OA 1GR0A 5JAUA 5C8XA 1PT7A 1T9CA 2R5WA 3M3PA 1LBTA 3KZNA 4PANA 3T94A 2FMIA 3KVYA 3TI9A 4CFZA 1THGA 4EW1A 3MS7A 5I7EA 3EA0A 4UXJA 1G21A 2OG2A 4XYMA 1JG4A 4HMPA 2VKQA 4QXAA 5EGNA 4YRGA 5FA6A 3T1YB 2Z6UA 1XOIA 1A95A 1UBFA 2IOQA 2UAGA 2W6JD 5ERXA 2GFHA 5LZ7A 4E5PA 1GSOA 4BNDA 2C5GA 1KO7A 1M10A 1U3WA 4FLMA 1NY6A 4M87A 4C7VA 1Z5ZA 4P58A 4BX2A 3VA7A 4TUYF 1GG5A 3OCYA 4YS6A 4TVSA 2CMKA 3RYCB 1SJ9A 4M6WB 1YI1A 3LC7O 3PNSA 1XTIA 1J23A 1ZX1A 2L17A 2X1LA 3CZPA 3G8BA 3TOXA 4D0RA 1F38A 4IHJA 4TRRA 4GPZA 3UC9A 2JHCA 2OBLA 5EPUA 3JWIA 2PE5A 3TQHA 3AOGA 2CEAA 4IIVA 3VNVA 3HVIA 3X1YA 3OMWA 1MH9A 4OF4A 3CW9A 1JR3A 3ZGLA 3JPWA 3WGKA 1GR1A 1BQEA 1HMYA 1XE3A 2QB5A 1DUSA 4Q16A 1FE8A 5EE9A 3RTAA 4IGEA 4P5EA 5CBPA 1IBSA 3RUHA 4PGFA 2ZIXA 2J85A 1K9SA 3WFJA 4HYQA 5FCDA 1ZD2P 1UBGA 3GJZA 4RKEA 1IWBB 2ORYA 4LYJA 5JJKA 2FW7A 1ATZA 2Y0DA 4XUCA 1WD5A 1EJ6A 1ZRNA 3RTGA 1E2UA 4FJ2A 2WVGA 1IQ0A 4OHCA 4JT8A 4LDQA 3ZXIA 1W76A 2BFDA 2K2QB 3DBIA 1ELOA 2P2GA 3ESAA 5K20A 2CVFA 1IATA 1IFXA 2GEFA 3A1DA 3DGEC 3AWIA 2CLHB 3TIIA 2A0FA 3PC7A 3AKEA 4EI9A 1HGXA 4HGZA 1JG1A 4LY3A 1F6DA 1SZPA 4LAFA 4BFWA 2NZJA 5JV5A 2VQSA 1YRWA 3ZV3A 1U7OA 1JKMA 4I8IA 1YR7A 2VG8A 4J1QA 2IHZA 1Y89A 1TM7E 4DG8A 4NAUA 3MFYA 3REQA 4Z7OB 4TZ0A 3I76A 2WMYA 2VCYA 3KAKA 1GAQA 1Z63A 3U1BA 1K7CA 4L02A 5AK0A 3DZJA 1XDDA 3UJ6A 2ECKA 5LBTA 1OWOA 1QF7A 3KZ1E 3NOXA 4P35A 4Z4HA 3WA6A 1ZIYA 5KTKA 3WAGA 4B1FA 3J81A 1L5SA 1ZY2A 2IPNA 1DBSA 2KHZA 3U4CA 1FQOA 2DQ4A 4Z4IA 4ZARA 5EI5A 1JR2A 1U2DA 3TRDA 3GLRA 3UOAB 3EMVA 4JKYA 4D8YA 3GDHA 3B6KA 4M9SA 1T5HX 3VKFA 3PD0A 4AG3A 2X58A 2QM8A 4GDMA 4I81A 1VRCA 5HF5A 2CVHA 4GNRA 4YJHB 4WNCA 2JK0A 4CJXA 1GGEA 1C81A 4YP1A 2HMWA 2ZTMA 2K2WA 4GKVA 4JYPA 5JBIA 2I1VB 1OBVA 2YN0A 2WIJA 4NU8X 2QJRA 1JVBA 3GEDA 3OZGA 2RAVA 4IJKA 4JBYA 4MV4A 2OHIA 2PCJA 4KSBA 4LJ8A 4F8YA 3E18A 2HO5A 3ZD6A 1GKYA 1QVRA 1JHDA 1TYEB 4XR9A 1YJCA 3IP3A 1KTIA 3D8NA 5BW4A 2XHEA 3WWYA 1X0VA 2VBGA 5TB5A 1L4MA 4N5DA 4PAWA 5CNMA 3K2QA 1NF2A 2Z4TA 1W29A 5ALZA 1SFRA 5ALFA 1PJCA 2XRMA 2QIOA 2BGIA 2CLDX 2PZJA 1W9MA 5FOWA 3WLTA 5JATA 1FB5A 4Q3LA 4P0PB 1C1DB 1ULBA 2JGLA 5I9MA 1AQNA 2PUTA 1SKYB 2JZCA 4QJBA 2P2DA 2O7VA 2ZI6A 3DV2A 3WGNA 4LJ5A 1JXAA 2BEWB 1NIJA 4JX9A 5IU6A 5ILOA 1FUIA 1O57A 3KB1A 1XXLA 4YACA 5UKDA 1DQZA 4DUPA 4D6PA 2WWIA 2XMSA 2C3YA 4Q1BA 2C78A 1KKUA 1U0HC 1E3EA 1ORWA 1UZUA 2ZDQA 3N2IA 3R5JA 4OU5A 5DB4A 4DDTA 1ZITA 3IAM6 3WGUA 5C5DA 5HOEA 5JSHA 1L5FA 1L2TA 3VDMA 4QGBA 3LRTA 4NR0A 5T64A 4TS1A 2CWDA 1KPIA 1NN1A 2IYOA 3PXAA 2X9VA 2EFHB 3RVJA 4E7OA 3PNYA 2ISCA 1Y8QA 1NVBA 5BN5B 3P2JA 1S8AA