4E03A

Structure of parf-adp form 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
206
structure length
204
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
molecule keywords Plasmid partitioning protein ParF
total genus 69
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e03A00
1IN7A 3LVQE 1DARA 2G6BA 4TZ0A 4PPFA 3AVXA 1OHHD 1Q3HA 1M2OB 2ZVPX 5CM9C 5HZKA 1HV8A 3SQWA 4UXIA 4AC9A 5AJWA 2ZREA 1X8KA 4EUNA 4B2PA 1HT1E 1II0A 3AF2A 2ZROA 3AKDA 1JPJA 3Q8XB 2W6IA 3TIFA 4JLBA 3OF5A 4C4PA 2IYYA 4DCNA 3CRW1 2IYWA 3A4NA 5LD2C 1ZUIA 4CT4B 3R7WA 1IQPA 4KYIB 3GFPA 3DKPA 1GILA 2Q3MA 4Q1EA 3T5DA 3JVUA 3T5GA 4LV6A 3QKSA 4IOJA 3K0FB 3Q7PA 4MRSA 1KI8A 1XJCA 2VHQA 4LJYA 3QNUA 3GJ8A 5H1YA 4UNSA 3HP1A 2PJRA 4QC2A 2YWFA 5FTKA 2QRNA 4AG6A 3THWB 3CO5A 5CLQA 4DB2A 5EXTA 5SZJA 5FOVA 3MWJA 3LH5A 4POAA 4QGGA 1U8AA 4FXPA 4IKEA 1W48A 5SZHB 1RZ3A 3FVQA 1VCNA 4XWKA 3AVVA 2IYRA 4MDEA 1P6XA 2WMOB 2A9KA 2NPFA 3UIEA 1P2TA 1R10A 1W4RA 2CHGA 2FEOA 2WWWA 1VKJA 2NO1A 1FUUA 1WDTA 2R62A 1KNQA 3B1XA 3PUYA 4LK2A 5B58C 1ESMA 4P3YA 3K1JA 4Q7MB 1FNMA 3Q5EA 2J46A 3QKTA 2QZ4A 1XFAA 1G8GA 3AB3A 3DL0A 1KOFA 2JJ1A 2OUKA 3B60A 3D8BA 3QXCA 5B2ZA 1DAIA 2VTKA 1II9A 2QG6A 3ZD7A 3EA0A 1W1WA 4QJ3A 5K8UA 4UNQA 4JLNA 5CM8B 3GJ5A 2UZIR 2WICA 5CLLA 2N1BA 5FI0B 5KNBA 3CF2A 4IXMA 3ETLA 2WSMA 5F9FA 2YYZA 3FHCB 3B7GA 1G19A 2REXB 2QU8A 1T5LA 3EX7C 3D31A 4EIWA 1P9RA 3NG1A 3PQCA 4KSCA 4NYIQ 4URXR 2FPMA 4W7SA 1D2NA 4BLTA 2WAXA 5CK5A 3F0TA 3P27A 3BRWD 1UJ2A 4PZLA 3SEAA 2ZE6A 3NDPA 3G5UA 1US8B 4MRRA 2QPOA 1U94A 4MH0R 1LTQA 2ZVQX 2RGGA 8OHMA 2N42A 2YHSA 4NONA 1TQ4A 1ELOA 4YXWD 3IO3A 5JSZA 4QG7A 1NY6A 2H18A 5FOUA 4ARZB 4B73A 2JLXA 5EUMA 3BB4A 2PJZA 3C16C 1G8FA 3CPJB 1Q44A 2H92A 4LUCA 4B74A 2FFBA 4PANA 6Q21A 4YXWA 4ILEA 2OM2A 3ZVLA 3GQBA 2LKCA 1RVDA 2LWIA 3E2IA 1D2MA 5JWHA 3CF0A 3OIUA 2X2EA 1L4YA 3BWDD 2GTPA 4DCTA 1F2UA 1G5RA 4P4TA 2FFHA 4Z51A 2D7DA 1QHHB 1LNZA 2J87A 3KB2A 2CL0X 1XPOA 2V7QD 1FX0B 2BKUA 3H84A 4FCVA 3GD7A 1QHNA 3HJNA 1AQYA 3MWKA 3T1OA 1PUIA 2YNMA 1G7SA 5GJVC 1S3SA 1P2SA 3TKLA 4E03A 3A4LA 4O2LA 1AZSC 2D4HA 1E69A 5DGXA 1IOZA 5FOWA 1OXTA 4B44A 2GXSA 2Z43A 5GVRA 4R7ZA 2W0SA 1RE0A 2BHRA 4CEJA 1TAGA 3NH9A 821PA 3THYA 4QNMA 1R5BA 1T91A 3FMIA 1D9XA 2DFLA 2RH5A 4RVCA 3SFVA 2VHJA 5E3HA 1AQUA 1OH6A 1HE8B 4BWYA 1C9KA 1Q1EA 2A2ZA 3K0AB 4ZI2A 1M7BA 4LGMA 3OHMA 2J0VA 4ZIRA 1FFHA 1AS2A 4WIAA 1SQ5A 1TQ2A 4OQFA 4URVR 2GA8A 4RFSB 1T5IA 3KXKA 2F9MA 3I8XA 4NCKA 4QHTA 1RJ9B 5EZ5A 4R9UC 4EPTA 3ZZTA 5EE3A 5DLQC 4MDFA 1XTKA 1IJEA 1E4VA 5IDVA 4C0LA 4CW7A 1KK1A 4D26A 3CX6A 3KQUA 2BIFA 1II8B 2JJ2D 3LBIA 4NCJA 4AYWA 3SQXA 4M4SA 3ZDQA 1G3QA 4LJ8A 4PPQA 1A2BA 4PO9A 4ERNA 2HUPA 2J41A 4XSGA 2PX3A 4B34A 4UNRA 1XTIA 5LBIA 3OESA 4KVAA 1E9RA 3RC3A 2JA1A 2JJ2A 3U3RA 1CJVC 1DO0A 4BFZA 1FTSA 1DAMA 1UF9A 4PSKA 1H8ED 1ZUNB 3H4MA 4Q7LA 3FFAA 4A92A 1CRQA 4UXJA 3BB1A 4LYJA 2JGNA 3THYB 5GADl 4UNPA 2AKAB 1Q1QA 1XZPA 4A2QA 4DDWA 3EWAA 3K0SA 2NO0A 2FN4A 2O0HA 3I73A 2REBA 4QGFA 1VHLA 2IXGA 5SZKB 2ORIA 3L82B 4JBWA 4LHXA 4B35A 2BDTA 2ECKA 2D62A 2BJVA 1N6KA 4F92B 3QSYA 1TUIA 2B92A 3A8TA 3N70A 3I72A 3KQKA 4DDVA 4PAMA 4LHYA 3HWSA 4HAUA 4NYMQ 1GIAA 4KCGA 2WAYA 5TMPA 1JBKA 1LY1A 2PLFA 1E2LA 3K0FA 4PO8A 1XJQA 2FA9A 1T6NA 3LQQA 4NCNA 3KX2A 1FZQA 5DI3B 2IS2A 2XNSA 421PA 2PT5A 1HTWA 2D7CA 2H5EA 2JCSA 1MT0A 3GJ6A 4LJAA 4DB4A 4BLPA 3NWJA 3I5XA 5LDDC 3RS0A 2GETA 1DADA 3OIYA 3UKDA 3LXXA 3SYNA 2BJWA 3NXSA 4FMCF 1WRBA 4P31A 1D8TA 1F2TB 5E7IA 3L0OA 4ZDJA 3WMGA 2GESA 4F4CA 4Q1AA 1XPUA 4BZXA 2HJGA 1WA5A 3B6EA 2FF7A 1OXSC 1VYTA 4KO8A 3MD0A 4BFSA 1EG7A 5G3YA 3KDSE 2RCNA 2NOAA 1VG9B 4FINA 4F4JA 4NH0A 4IFEA 3ZIAD 1O3YA 2FH5B 4HB4A 2RGAA 3U2QA 1G5PA 1TEXA 3P20A 4JLVA 2PL3A 3DDCA 1KO4A 3AUXA 1X1RA 1SXJB 1RFLA 2V3CC 2JLVA 3QEOA 4RZ2A 1ZBDA 2DFNA 3WMEA 4B48A 2YC2C 2CK3D 1RIFA 4Q7KA 4BLRA 3T34A 4A15A 1GDDA 5C18A 2ZRLA 2QM7A 3CX7A 1GITA 4B3CA 2IYLD 2GEVA 2ERYA 4MKHA 4F4IA 4OQNA 4ASUA 1KI4A 4B3GA 2BBOA 5B30A 3WBKA 2ZJ8A 3E5HA 2QL6A 4PQRA 4U7DA 1CJUC 2AXPA 2QMHA 4PTLA 4PC7A 3TUIC 4TMZA 3LLMA 2WIAA 2ZSBA 3WP0A 1JXMA 1N6IA 4C3ZA 1NBMD 3SYLA 2O8BA 3QVUA 3VR1A 3BERA 1GAJA 2KI5A 5JFGA 3KFXA 3IBGA 2ZI7A 1F6BA 3QF4B 1AS0A 3WNBA 3A1VA 2VLIA 3UG6A 4EJSB 1N6OA 3ND8A 2C9OA 3Q85A 3K09C 4HAWA 5KDLA 4BZQA 2ZJZA 3MUFA 1E2GA 4BPBA 5A4JA 2ZETA 1J70A 2JLUA 1Z47A 5FOSA 2ZJYA 4MA4A 2R6CA 1HQCA 3DZ8A 1Z5ZA 4IVQA 3OFNA 2CNWA 2IXEA 1SHKA 1R0XA 2ODNA 2VPPA 3EPLA 1SVWA 3RNLA 1B0UA 4M0LA 1PV4A 5F2EA 4QBFA 1JECA 1ZCBA 5EXXA 5FFMA 1KDPA 4QBHA 4XH9B 3WRYC 2IHYA 3AV0B 1JEEA 3SI7A 3QKUA 4Z1MA 5B57C 2A78A 3ZJYA 4JJKA 5AJZA 4CZ2A 3CPHA 2V4ZA 2NQ2C 1SXJD 4UQOA 4KAXA 1N2CE 4G1UC 4RZ3A 1NIJA 1R0YA 1BO6A 2VSFA 3TVDA 1WBBA 3THOA 4HZIA 1BYUA 3HYRA 2JLQA 4TYYA 3PVSA 2ZYVX 3KUDA 4PC1A 2Q0HA 1GVNB 2EWVA 4IJMA 1R6BX 3WHLA 3RS4A 4F38A 5BXQC 2PEYA 3IPXA 4IOKA 2DY1A 5KOYA 2A5GA 2JIZD 2FG5A 1QBKC 1OJLA 2GJ9A 1KY3A 4X8LA 2J3EA 1IN8A 5FL7D 2ZSDA 1DAGA 2VBCA 4PAQA 4H1UA 2PH1A 3VMFA 4GMDA 3GMTA 1R5NA 3B85A 521PA 3EZ2A 2ZEJA 4D0LB 3TSWA 3D3QA 3B8HA 4LY6A 4YMSA 4Q9HA 1ZUHA 2GDJA 4KLZA 4ZCIA 2YVUA 3MSXA 2GXQA 1YR6A 2W2XA 4XIGS 3P4YA 1LF0A 1Z6YA 3ADDA 1E99A 1ZD1A 1P4SA 1E9FA 4TL6A 1NI3A 4HDOB 1G291 1KK0A 2QQEA 3FTQA 1Q20A 4JIMA 4K8OA 2ZIAA 2YKGA 1A2KC 2J0UA 5FBQB 3ZZUA 2C98A 3AP3A 1FQJA 1N0WA 1R5OA 2XTNA 2VYFA 4M1YA 3NBZC 4HLUC 2IW3A 1LW7A 5FTJA 3C7KA 3VR5A 4DLRA 1GNQA 2ZJAA 1G4UR 2IYQA 4OQLA 2ZPTX 3NIBA 1Z83A 3RSOA 1DPFA 4LHWA 2B6HA 3PENA 1EWQA 4P4UA 2C95A 5JJLA 3ZD6A 2JJ1D 5CIWA 5D3MB 3RS2A 2GZDA 1E98A 4ZPXA 2DFKB 2ZE7A 4MGIR 4Q4AB 2IYZA 4HZUA 4Q02A 3JZAA 3LAWA 1T8UA 1J90A 2RHMA 2C2HA 4N3NA 3QG5A 3W34A 4I99A 1XWIA 3V00A 1AA9A 1X6VA 1KTVA 4HLDA 2XOKA 3I8SA 4C0BA 1CR2A 1KAGA 3RRMA 1C1YA 4DSOA 2Z5FA 3BIFA 3DMDA 4GP7A 2KSQA 1E1RD 3W6NA 5TB5A 2P6RA 4DT1A 5JMTA 3CIOA 1U8YA 3MFYA 1GWNA 1Z0DA 4Q4JB 2HLDD 1IHUA 4LPSA 4D4JA 1Q1BA 4EPYA 3TGPA 1EFCA 1II8A 3IIKA 2ZAMA 1YVDA 3PITA 3PEYA 1X86B 2X1VA 5DIFA 1G8YA 1GL7A 2AX4A 4TLCA 4GT1A 3O8DA 3AF3A 2QBYA 4NZYA 4CDGA 1XU4A 3T15A 4QJ5A 5EP1A 3B5JA 3IKJA 4GOXA 1T4GA 4JYCA 4JYBA 1FNNA 1P9NA 4A2PA 5AUNB 4CEHA 3A1UA 4ZIRB 2JDID 3W6OA 4JVSB 2W83A 4Q47A 2AK2A 1I4LD 3ZQ6A 2BCJQ 3K70D 2MMCA 4V0KA 4Q9IA 3FGNA 1KYIA 2R6GA 1JPNA 1NN3A 3DOEA 3H2YA 5IHPA 3M0EA 4W5JA 2QPAA 3B1ZA 4WBSA 2F6RA 2WJYA 3BC1A 2XGJA 3QJYA 3DVLA 4IHQA 3J81k 2ZRCA 3IQWA 4N0DA 2DWOA 3ADCA 1MKYA 1JI0A 1EFHA 1RYHA 1BH2A 1Z0KA 2ZYWX 3AGPA 4HLUA 3SHFA 3KL4A 1CJTC 5H68A 3FE2A 2BV3A 2R65A 3IBYA 3OE7A 5FOTA 5JLJA 4X8OA 4M1OA 4FN5A 4BECA 4ON9A 2WPDD 3PIRA 5L8VA 1P61B 2E1RA 2Z83A 3MGCA 5CYOA 2FGJA 2QNRA 2Z4RA 2GEUA 1QVAA 3AUYA 1QRAA 2NZ8A 1E4YA 3REGA 2CVHA 2H16A 2G0TA 1MO3A 1XMIA 2HF9A 2MSEB 4GZLA 4UXHA 4LBYA 1U0LA 2CHVA 4ZDKA 1XJ0A 1UEJA 3ZVRA 1NVVQ 4CVNA 4HB0A 3FKSD 1KI6A 3NEJA 1I4DD 4RZXA 4B32A 1UDWA 1E2PA 1SVIA 3W6PA 1YZKA 1G7RA 4M1WA 4O0MA 4DC9A 1DG3A 3IEVA 1T9HA 2YC4C 1AK2A 4ACBA 2CJWB 5JJKA 1KHTA 3W5IA 1AN0A 2O8FB 4Z8YA 2J59A 2RGXA 4ZV4A 4PSAA 1BS1A 4LJ7A 3AVWA 2DB3A 4OJKA 1US8A 3HR8A 3KQLA 1KO5A 1M7GA 1W36C 1E9EA 2GEDA 1N6HA 2GRJA 2H8KA 1UAAA 1FP7A 1G3UA 4C7OA 5EQTA 2GJKA 4Q00A 2A7QA 3LA6A 3R8CA 2IT1A 2IUUA 2JAQA 2VA8A 3GLIB 3A36A 1CTQA 1UBFA 3PEUA 5H70A 1Z08A 2WKPA 3BXZA 2QI9C 4YC7A 4D80A 2HYDA 2BEJA 4XVRA 2ZSFA 1NIPA 3QIAA 1KKMA 3HDTA 1XNJA 3AKEA 5B64A 4M22A 2IEYA 1UKVY 2ZSEA 4PHGA 4JBXA 4WZAE 5ANRB 3K9HA 5BW8A 1E0AA 3DM5A 1Q12A 4TT3D 1N6LA 1XXHB 3OAAA 1XD2B 2WJIA 1E1RA 2ANBA 3R9XA 1SVLA 2ZS9A 3DEFA 4GFDA 1J8MF 2ZRJA 5DNYB 4TT3A 2Q9BA 4AG5A 1G18A 1Q3TA 2PBRA 1TF7A 4HUTA 4TSFD 2J45A 1S9HA 1CR0A 2GJ8A 3MJHA 3VR6A 3FOZA 5CITA 4G3XA 4DT1B 3FMPB 3LWNA 4NKRA 3WP1B 2WOOA 1XDBA 2QSZA 1B23P 2WJGA 4TTRA 3X1ZA 1ZW6A 4U02A 3MMPA 5FUVA 2BBTA 4Y0VA 1UKEA 4MKGA 4L15A 5EE1A 4YDHB 4DLSA 2VRWA 3L0IB 4JKYA 3M4YA 4PPGA 2W2TA 1UBGA 1E2NA 3VX3A 4NBSA 1HY3A 2QMEA 3R7WB 1P62B 1Z0AA 4LYAA 2VP4A 3PUZA 3LBNA 2X19A 5D3MA 2EW1A 4JL8A 1E79D 1CR4A 1MO4A 1GRQA 2RMKA 4URWR 1UBEA 1UM8A 3IGFA 4GOKA 1JAHA 1W4AA 1W0KA 2XJ4A 5KDDA 3K0EA 3U3MA 2L0XA 4IEIA 5AWFC 1V43A 4GDFA 4KITB 4DUGA 1UFQA 1XD9A 3BE4A 2VP5A 1ZD8A 1U90A 2ODWA 1GP2A 1Z0IA 4M1TA 5BQ5A 2YOHA 3U44A 2IUSA 1IXZA 2WWFA 3Q5DA 5AJXA 1SHZA 2ZRPA 1T0JB 5E7JA 1FQKA 2PZEA 4ASUD 3O8BA 1DS6A 3SJBA 2ZRAA 2PMKA 4TMXA 5BYKA 3IPYA 4B75A 1JEDA 2B8WA 4MRVA 2P5SA 2Q9AA 2F7SA 4JLMA 2GCOA 3K0CA 4OI2A 2WVJA 2W58A 1A4RA 2UKDA 4JSYA 2F1IA 3ASYA 3BORA 3F8TA 3LDAA 4JBYA 4XD7A 4ZDWA 1NBMA 3W8RA 3GLHE 2H7VA 3VFDA 1OH7A 1G16A 2C9CA 3TQCA 4HDQB 1JXOA 3TLXA 3NBFA 2QORA 2PEZA 2HV8A 2W6JD 1H8EA 1NN1A 4IFBA 2MSDB 1FTNA 4WW0A 2BWJA 2CE2X 2GK6A 2ZS7A 1ZCAA 3VTKA 4LYFA 3RLFA 1U9IA 3LNCA 1MOZA 3LLUA 4US0R 4DZZA 4AYTA 4GRAA 3C5HA 3VR3A 3T61A 5FPKA 1TPZA 2W6JA 2CNWD 1QVRA 1M34E 4TLBA 1NG9A 4TN1A 3ZYCA 5DE3A 4EFNA 4B33A 1HURA 3BGWA 2BKEA 1D2EA 1J7KA 4HAZA 3Q7QA 1XEWX 3RAPR 2K5UA 4MYCA 4EQ6A 1QHGA 4OHZA 3AF1A 1NVWQ 5FUXA 2EFHB 2ZI6A 2QUZA 1UEIA 3W9YA 1JR3E 1XXHE 2VHTA 4JKIA 4LWZA 3GLFE 2IL1A 1AZTA 4LSGA 3RVBA 2WMNB 1GL9B 1F48A 4NMMA 721PA 2ZR7A 4JLPA 2V1XA 3UMSA 3B13B 2ZI9A 5C2JB 2F1HA 2ATVA 2W0MA 5JCZA 4RCYA 5J47A 3EIQA 1R8QA 1JNYA 3SN6A 2ZJOA 3K9GA 1W2HA 3TBKA 3WYAA 1FW6A 4NHOA 2VH5R 1TTTA 4A1FA 4MKFA 1KSGA 1EESA 4NYMR 2OCPA 3A4MA 5E7MA 1LS1A 2IEZA 4MUAA 2A30A 2KWIA 3PXGA 4F91B 2IF0A 1RRCA 1VYVA 1Q57A 1TNDA 2R2AA 4YLGA 3UANA 4PHFA 2ZRKA 2GWHA 3MAAC 4KXFB 3G0HA 5DI9A 3LO5A 4AY2A 1E79A 3MCAA 4HUQA 3TUJC 4LJ6A 3OIWA 1XD2A 5HE8A 4DLUA 1ZD9A 1EFUA 3C15C 4L16A 4QBGB 4KVGA 2XZPA 1QHSA 1ZJ6A 5FUWA 2ZJ2A 2QRZA 3TSZA 1ZP6A 1W2GA 3U7GA 2N46A 1HT2E 2V9PA 3PEWA 3JZMA 2DYKA 2O0KA 2Z6VA 3N2IA 5L3QB 2G1KA 1GZSA 3RYTC 4B3BA 1VMAA 4IDNA 2Y8EA 4BFWA 3TUZC 2OFXA 2QENA 2QP4A 2VHCA 5KNDA 1QHIA 3QQ5A 2QSYA 1TF5A 1F60A 2O8FA 1XBTA 4URUR 3M1IA 1C4OA 1GNRA 2AK3A 2FZ4A 4URZR 4ZDIA 2XZOA 2EFCB 4IDHA 2HYIC 4HAYA 1QHYA 3FKQA 4O25A 1F2TA 4PXAA 2O8CA 4I81A 5JRZA 1ZMXA 1XTJA 2V6IA 1XB2A 3A1WA 3AKCA 2Q3FA 1CR1A 4EPVA 1G3RA 3TR5A 3E70C 3AF4A 4BRUA 4OKSA 1CJKC 3ZLJA 1U2RA 1ZVQA 2GHIA 3WY9A 3UATA 2QMUA 5G3ZA 5JJIA 2OZEA 4BEJA 1XCPA 2ZM5A 3NEYA 2PCJA 1KSHA 2FZLA 4F93B 4JLOA 4ZCMA 2GVDC 3WYFA 1W7AA 1OKKA 2HLDA 1MO6A 4TMTA 4OI1A 1X8JA 2QPTA 1OV4A 3QF4A 5TY0A 2ODBA 3VNUA 4GBMA 5J4VA 4CEIA 3KB1A 121PA 3ND9A 4NCHA 4C0HA 2O8BB 4AKIA 3SC3A 3KJEA 4OL0A 2FJUA 2V6JA 2D3WA 3IEUA 1SULA 3K09A 4KV9A 4KYUA 4AIIA 4DLYA 5G53C 1O87A 1VDZA 4CGZA 1TEVA 4L8GA 2Q21A 4HATA 3W8NA 4BGDA 3BOSA 1JR3A 1XXHA 4E09A 5DSZA 4LJ4A 3I32A 5LD2B 3TQFA 4P33A 1Z22A 4DKXA 4C2UA 1YZUA 2ZI5A 4EPRA 1Z3IX 3KTAB 3NC1C 2BMEA 3C8UA 4XVQA 4M1SA 3FDIA 4RD0A 1EFRD 2AXNA 2QTVB 3KXIA 4EPXA 1OYWA 4IDQA 4W5WA 2ONJA 4FMBB 3GLIA 1DE0A 2A5FA 2WV9A 4NL4H 1OB5A 4C7OB 1HA3A 1Y63A 3PEVA 3ZGXA 5TV2A 4BRWA 5JBQA 1EWRA 1S4QA 3RS7A 3OE7D 3O8RA 2QP3A 1DOAA 1I2DA 3B2EA 4FMDB 1DAEA 4S35A 5JHGB 3ZVMA 2BEKA 3GCGA 4KFTA 2RKOA 4XWAA 2JLWA 4D0NA 5FOXA 2HDNB 5P21A 1ZIOA 2BMJA 3NVAA 621PA 1E2QA 1HEIA 2OO7A 1Z63A 1YR7A 1G9XA 2P65A 3KUCA 4N1AA 1DG1G 1OIWA 1W49A 4FIDA 4IVRA 5EP4A 4YONB 5KO2A 3BH7A 3QG1A 1X1SA 4IDOA 4BEBA 2NMVA 1WXQA 4V0LA 4LDJA 1R0WA 2QEQA 4HB3A 3EAQA 4Q19A 5DI3A 2IYSA 1E9AA 4XTCS 1TUEA 3GJ4A 4G01B 2ZTSA 3PG5A 2NZJA 3D7MA 4E5UA 2XAUA 1HQYE 1KY2A 1OIXA 1NKSA 2I1QA 4HDCA 3KXLA 4C0AC 1NG1A 4OQXA 1KMQA 1CP2A 2DFTA 4AD8A 4G5OA 1NLFA 2IS6A 1J2JA 2ZI4A 4TLAA 4QHYA 1U0JA 1Z07A 5KYKA 1SVSA 3TAUA 1AM4D 3LX5A 1D9ZA 2J7PD 3KKOA 4BLQA 5KPDA 1NVVR 4R2IA 2FPLA 5FPSA 4U00A 3NTUA 5BN4A 4Q48A 4TSFA 1G8HA 3U7FB 1JALA 3T1VA 4R71A 1XTRA 2J0UB 5JHHB 2G0NA 1BMFD 1KIMA 5FUYA 2GILA 2D06A 1U99A 3VKHA 3CLVA 2ZJ5A 4LCBA 5E4FA 4RKEA 4W9MC 4B2IA 4OHYA 1OYYA 4D4MA 4WXRA 5G41A 3KJIA 4CEHB 1NLZA 1OKKD 2AWOA 2FGKA 2R44A 3IDQA 3MWYW 3GLGB 4WVFA 4CT5A 3KQNA 4A4DA 1T3HA 1SKYE 1VG0B 4L9SA 4TTQA 5EXSA 1NVUQ 1E2KA 4IOLA 3NKVA 4A0GA 2WKRA 2CDNA 3QVVA 2AD1A 4D82A 4MRNA 4KSBA 4QHSA 3CWQA 1F5NA 3RC8A 2KBFA 2IUTA 1NNEA 1E9CA 3EC2A 3N5CA 4OI4A 1XF9A 2GVZC 4WAUA 3UMRA 3KFVA 1QZXA 5DHFA 4ZCLA 2C8VA 2QM8A 2BMDA 5EP3A 3SE0A 5C4MA 1YHNA 2AFHE 2VIIA 3KTAA 4GL2A 5F3WB 1XP8A 4MRPA 1JJ7A 2OBNA 4ABYA 5F9HA 3U5ZB 4PPNA 4O3MA 1EGAA 4HAVA 4NCIA 5TVKA 1KNXA 5DH9A 1ZC3A 2QP9X 1UPTA 2WWIA 2OILA 3A1SA 4NE2A 5BN5A 3BJIC 2QGZA 3OEHD 4NYJR 5A5GA 1W4CA 4LOAA 5KNCA 3GJ7A 4CEJB 4RD1A 1E32A 2GBLA 2OG2A 2QAJA 2QROA 4DUGD 4Q4HA 2DCUA 2QTHA 2ZXUA 2IXFA 2R6AA 1G21E 2ANCA 3TW4A 3VU9A 3GP8A 1OXUA 3LXRA 3GEIA 4CEIB 4FWTA 1T0HB 3OFND 2AWNA 4LC1A 3RS5A 1IY2A 2YINC 3GLGE 1W36B 3SZRA 2CCKA 5AUPB 2D74A 5HCIA 1Q1ZA 3BAFA 4FD2A 3LY5A 4FCTA 1SGWA 1YE8A 3MG9A 3UK6A 5DN6A 5FBLB 3GLFA 2OCBA 3F5FA 4DCSA 1QF9A 1MO5A 2GKSA 1SVKA 4GP6A 3UXMA 4QM7A 4B43A 3CWZA 2VSXA 4PZYA 3I1FA 1CJMA 2C9YA 1MR3F 4QRHA 1K8RA 4DHEA 4BFUA 4TMWA 5M04A 1G6HA 1JJVA 1XRJA 1DTSA 5JWOA 3KKNA 4EPWA 4KBFA 3UPUA 3QPWA 1VIYA 1KO1A 2ZSAA 4KHZA 1GTVA 2VF7A 4C2TA 1VCMA 3P1JA 4OHVA 2OBMA 1KDTA 4V0OA 2E9SA 2PT7A 3VR4A 1H8HD 4HI0E 1N5KA 1JAIA 1N6RA 1S9DA 1N25A 1XEFA 3QPVA 3ADBA 4LJ5A 1KMHB 2JLYA 1MV5A 2VP0A 3OAAD 1KI2A 4DSNA 1KI3A 2NTYC 3K53A 1MRSA 1S1CA 5EUQB 2WWHA 1RC8A 4AWXA 4OYHA 2BCGY 5EZ6B 3K70C 1SXJA 2X77A 3SOPA 2XB4A 221PA 4C0KA 5L3QA 2OESA 2QAGB 4TYQA 2XNDA 2A5YB 4LV8B 5DYGA 3X2SA 4RKFA 3X1WA 5KSZA 4JL5A 2I1VB 5EE0A 1YZLA 3VKGA 1CLUA 4K81B 1ZINA 3ZH9B 3TE6A 5KUTA 3AM1A 3GEHA 2XSZD 3WHKA 4EKDA 3FMFA 3BK7A 2OT3B 2YWHA 4V03A 3QY0A 3VX4A 5CB6A 2VP2A 3CRQA 4DLXA 1JB1A 2AHOA 2IA5A 2XTZA 1NJFA 2OV2A 4X8MA 3TR0A 3T1TA 1CIPA 4LBWA 2F43A 4RZUA 3AQ4A 2FE4A 3C41J 3EPHA 5ELXA 2G3YA 2ORVA 2IYTA 3RABA 3HPRA 4PHTA 2FSFA 3B82A 2HJVA 1FUKA 2IF2A 1PLJA 4WZ6A 1XPRA 4US1R 4HYYA 2HT1A 1NLYA 4A8JC 2FFAA 2RHDA 1NMXA 2ATXA 1E0KA 1R0ZA 1K5DA 3F3YA 1KZGB 1QDEA 2ZANA 2OAQ1 1W5SA 3PFIA 2KE5A 2R8RA 3EZ6A 3SJZA 3P26A 3H1TA 3SJAA 3QXJA 2G77B 2AN9A 3NH6A 2UZ3A 2GF9A 2WHXA 2F43B 1OE0A 1TQDA 2C99A 3THXA 4QKQA 1Z6XA 4RFVA 3RS3A 2CE7A 4R98A 2I4IA 4KFRA 4Q1CA 1ODFA 4NU0A 1S2MA 3L8YA 5FTLA 1KSFX 3EZ9A 2F1JA 4NTZA 2HCJB 3CX8A 2ZRFA 1IY1A 2OSBA 4TWZA 1PLKA 3OIVA 3R9IA 2X2FA 4BZPA 1OXXK 5KHOC 3AEZA 1ETUA 2CCJA 3QXSA 3SBEA 3G82C 3CW2A 3E1SA 5LB2A 3GPLA 1D6JA 5JS7A 2JEOA 2RGBA 3BH6A 1G20E 4Z54A 1SKQA 1SXJC 1W4BA 1ZYUA 3CKLA 3L2OB 3ICQB 4LBVA 4U5XA 4D81A 3FWYA 2J7KA 3V4RA 1M8PA 1E2IA 2B7BA 2P67A 1R7RA 3K8YA 2O52A 1VG8A 4A2WA 1WQ1R 4DDTA 3I61A 3HU1A 1YZQA 2FPKA 1RJ9A 2G1JA 3VQTA 4KFUA 3MWLA 1DBSA 3LVRE 4RFSA 1ZM4A 3DOFA 1IM2A 4BUJA 4FWIB 3RHFA 1WF3A 3ZVNA 4CRWB 4I4LA 2LCFA 1AKYA 2AKYA 4DEYA 2IX3A 3QF7A 4N0EA 2C96A 4AYXA 2HCBA 3W3ZB 4DLWA 4QM6A 1LFDB 4PR0A 4OHWA 4LX0A 3SJCA 3AVOA 1KJZA 3PJRA 1NL3A 3GFTA 3M6AA 5FBRB 2JJ8A 4HEJA 3GLFB 1W0JD 2GNOA 4I1UA 2RGNA 1F3OA 2QY9A 4BE7B 4P0TA 2I3BA 1EFRA 2WWYA 2YWGA 2GJSA 4V0NA 4LHZA 1QG4A 4B2LA 1ZRHA 2G83A 2RB4A 3WMFA 2DWQA 2BOVA 1XMSA 1W0JA 2FV8A 2FWRA 2NO6A 2QE7D 3HU3A 3HU2A 2F9LA 3EZFA 1CS4C 1Z28A 4PQYA 1VIAA 4Q4HB 1FX0A 3QEJA 1VHTA 2OBLA 3HPQA 1G41A 2ZUDA 1F2UB 1W46A 1ZAKA 5LPNA 4MITA 2HF8A 2F3TA 1Z6GA 1NF3A 3AKYA 5SZIA 1D5CA 5UKDA 3NBXX 2WSSA 4B76A 3CBQA 5HZHA 2OE2A 4A0HA 3QXHA 2QGNA 1KGDA 1OLOA 4B3DA 1G64A 3VHXA 3D6TB 4DLZA 4G0NA 2FSIA 1VCOA 3I4LA 4FW9A 4YDSA 5J40A 4P4SB 1IXSB 1E96A 3ADKA 4ARZA 2LKDA 1E94E 1K5GA 1TADA 2QT0A 3SU8A 4E22A 5JCPA 1XTSA 4LV5B 4TL8A 2CXXA 5IF9A 3U4QA 2YWEA 3FKSA 1P72A 1HE1C 5HE9A 4EJSC 3UWKA 5FH9A 3K70B 4QL3A 3TW8B 2HXYA 4XWOA 3U6BA 1P7CA 3KJHA 3KJGA 4LC0A 3U7HB 4HB2A 1GKYA 1S1MA 4A82A 1WB9A 2YV5A 4QGAA 3GLGA 3FFBA 4RCZA 1DEKA 2NG1A 4PQFA 1RRPA 2FX3A 4YMUA 2EFGA 5F98A 2C03A 2ZU6A 1IJFA 1DO2A 2FFQA 3BBPA 1N6NA 3K0AA 4IXNA 4NPHA 4ZO4A 2ZITA 3GJXC 1OW3B 1P9WA 2ZRDA 2FOLA 4KJZA 1E3MA 2ZRMA 2XITA 1GSIA 1COWA 5G40A 1A7JA 2WBLC 1M74A 3TNFA 1NN5A 3W5JA 1E9SA 1XX6A 4PSVA 2AR7A 2OEPA 1JQJC 3CH4B 2RGNC 2VO1A 4W5HA 2GCNA 2G9NA 5JEEA 3X1XA 1G6OA 5KTYA 3T06B 3UMFA 4LHVA 5CDFE 2GXAA 3N2EA 4MGZR 3THWA 3BS4A 1GFIA 1Q21A 2V54A 3K9NA 4PZZA 1QHHA 1KI6B 2Z4SA 3BD9A 3A6PC 1E2FA 1H65A 4JLKA 4KBGA 2JASA 1ZU5A 1A5TA 3QBTA 2F3RA 3QKSB 5EE5B 2P2LA 2EQBA 4KI0A 3V9PA 3KQHA 3DHWC 3Q9LA 3RWOA 2CK3A 1Z29A 4G5GA 1PVOA 1GRRA 3ZZ0A 5GVSA 1OH8A 1DAHA 2AD5A 5HCNA 4EAQA 3VAAA 2XZLA 4WZBE 1TF2A 2Q6TA 3U3JA 3GJ3A 1S8FA 3CB4A 4LBZA 1A1VA 2O8CB 1EXMA 5JWRA 2D2EA 4GZMA 1Y3AA 1E1QD 2WWXA 5BYJA 1X8LA 2P0EA 5L3VA 2JLRA 4PC6A 2C04A 4P4SA 2IS4A 3CR7A 3RRNA 4H9GA 4BLOA 1P3JA 2XEXA 4OHXA 4YMVA 4D25A 4BQSA 2P3SA 2RGEA 1T3SA 2O0JA 1KZ7B 3CZPA 1L8QA 1AS3A 3EPJA 2ZU0C 3H86A 3B78A 2IK8A 2ONKA 4LI0A 2OXCA 3DM9B 4PX9A 4QXAA 3GJ0A 4CYMA 2V55B 2ZUBA 4JVLA 5DHAA 5TDHA 4Q1BA 4M1MA 2OLKA 3MRSA 4WXPA 4Y0AA 3L0PA 4JVMA 5JZVA 2DR3A 3IHWA 2ZYUX 2CL7X 2ODEA 5EE9A 4DLTA 1ESNA 1Z2AA 3RANA 1IN5A 2V1UA 1XZQA 5K8LA 3QKRA 5KPJA 4FI3C 3LQRA 2JLZA 4IOMA 4A0FA 2FEMA 4Q9LA 3SHWA 1SZPA 3TRFA 2QBYB 1XTQA 4DWJA 5HR5A 5JECA 1RYFA 1GNPA 3EARA 3TJZA 4TQUS 4I1OA 4ZKDA 1NN0A 3FPAA 2QT1A 4RD3A 4LPKA 5KSYA 2J0QA 4MQBA 2ZRBA 3LRPA 1OHHA 1CEEA 2ZS8A 4M9XA 4ITRC 1PUJA 2ERXA 3R8FA 1N0VC 3BFVA 4HAXA 5LB4A 3RRZA 1AKEA 1OFUX 2ORWA 1K6MA 1KAOA 2W6ID 4IEEA 3WXMA 2XB2A 1S0UA 3SDZA 1VCIA 4OJQA 5AK0A 4L4UA 4Q7JB 1J99A 2BBSA 2NIPA 1PLLA 3AVYA 2D2FA 3TMKA 5CYPA 1Z2CA 1ZM3A 4AKGA 1Q22A 1KDOA 4M9ZA 3GLIE 3B1WA 3QOFA 1TL7C 2WJJA 4D4LA 4TYPA 3EZ7A 1S3GA 4LZZA 3NHAA 2A5JA 1BMFA 1SKYB 5DISB 4B3XA 1HUQA 2VL7A 4KLNA 3AVPA 2H17A 3U61B 1DELA 1N3BA 3QXXA 4Q03A 3WYGA 4BFVA 1KI7A 4BFYA 1ZNYA 4JLDA 1U98A 2DWPA 2H57A 4JT4A 4B71A 5AUOB 1J8YF 4NYIR 5L3SA 1NJGA 5J4KA 4LYHA 4B3FX 5C1BA 2HT6A 4X8HA 3R20A 1VG1A 2XXAA 3FYHA 3LD9A 1Z0JA 2QAGA 3BH0A 1CKEA 1MABA 2BVNA 1EX6A 2ZYTX 4GMXA 1N5JA 4C0JA 2BBWA 4LRWA 3WNCA 1Z8FA 2Q3HA 3R9WA 1P5ZB 1YZTA 1NSFA 2EWWA 2OAP1 4DCUA 5CJ2A 1LV7A 5KSOA 3P32A 4KODA 3CRRA 2KB0A 1NMYA 1ZNZA 1ZU4A 1AIPA 1OSNA 2AL7A 3T35A 4A36A 1BYIA 4TLEA 4DCVA 3TSOA 4C0QC 2IS1A 1SVMA 4QJ4A 4G5QA 2CL6X 2GCOB 1VECA 1UKZA 4DSUA 3Q3JB 3EC1A 3QENA 2GF0A 4MGKR 1G7TA 3IUYA 3VNVA 1OF1A 1LB1B 4GI7A 5AR1A 4DLVA 4RY2A 2QN6A 1SVOA 4Z8XA 1TX4B 3CPEA 4CF7A 2NGRA 3PUVA 4HLQB 4Q01A 1NMZA 1MABB 1YU9A 1RKBA 3IHLA 4G5SA 2XXAB 2CLCX 4TZ6A 2AFIE 5JI3E 1HYQA 2B8TA 3CUEF 4HSEA 3W3AA 2IHBA 4UKDA 3LW7A 3OEED 1NRJB 1V5WA 3EXAA 2EVWX 5D3QA 3VU9B 4ZKEA 1FMJA 2O8EA 4A8JB 1L7VC 4JLJA 5JEDA 2ZI3A 2PCLA 5K8TA 1XCMA 2WOJA 5AJYA 1WP9A 5CJPA 1M6NA 4JJZA 1WBDA 1Z6TA 3UG7A 1OFHA 1U0HC 1OB2A 1XEXB 2A3RA 3EA5A 1G5TA 2ZRGA 3OEEA 4TQ9A 3ZS8A 4EFLA 3B9QA 4EQ6B 5DN6D 4OI0A 1CULC 1CF4A 2ZRHA 2YZ2A 2R6DA 4YMTA 5L3RA 2C77A 2PZGA 4FMCB 1UDXA 3A37A 5GJWC 4BLSA 4GNKA 3IO5A 4AKHA 2R9VA 4AK9A 1L2TA 2JIZA 1G7CA 4Q1DA 1KK3A 3U60B 4EJSA 1MRNA 2GCPA 3C4JA 2IYUA 4JZKA 2ASEA 2OCAA 4RD6A 2FU5C 1YZGA 1TMKA 1SXJE 1UKYA 3HR7A 2HEIA 4DBLC 2ZE8A 3CONA 4Q4LA 4Q66C 3FHTA 2X8AA 3RSLA 1QHXA 2JLSA 1E6CA 4TQAA 2A5DA 1GKIA 2QAGC 3QI2A 2QA5A 3CNLA 5FTMA 3TVTA 3ZS9A 5J4LA 2CCGA 1ANKA 4C30A 1KKLA 5JS8A 3LV8A 1KSJA 2QE7A 1JQLB 1ZM7A 1ZNXA 2XJ9A 4MGYR 4GSYA 1AGRA 1G3IA 1WCV1 3C14C 4GPTA 4PO1A 4EDHA 2O8DB 3QKRB 2IC5A 5HKKA 1VYUA 3S1AB 5HPYB 1KJWA 2WPDA 4JS0A 5FL7A 3W90A 4G5RA 1YRAA 2BM1A 2XX3A 2CHQA 1E2DA 1BIFA 2RAPA 1GUAA 3IILA 2WTUA 1YQTA 4TYWA 1TU3A 2GK7A 4RD4A 3U3OA 2XSZA 5FL3A 2J1LA 1LS6A 2CMKA 5HKKD 2XTMA 4PC2A 1W36D 5EXPA 1KK2A 1AJEA 1NBME 1IONA 3SFZA 1W44A 4IVPA 3REFA 3O8CA 4MYTA 1A82A 5CB8A 3ICEA 2PZFA 1RRFA 1ONBA 4TMKA 4Q21A 5L3SB 3EIEA 2P6UA 3EASA 3L43A 4NDZA 1G1MA 1XMVA 4C9BA 4V02A 4GOJA 1MH1A 1CU1A 4D2IA 3EPKA 4AKEA 1ZC4A 5KDOA 2WSSD 3PR1A 1FOEB 2B21A 3SBDA 3WRXC 4DSTA 2GAAA 1AGPA 4UNNA 5KSPA 2UVQA 3GLHB 3MLEA 4B6FA 4R2HA 2OFWA 1KI1A 3LW8A 3MJRA 4TMVA 4QNRA 5AJVB 3I5YA 4XOIA 3JVVA 1G17A 2KJQA 5A0FA 3T12A 2FSHA 2NO7A 4ZI3A 4OBEA 2J7PA 1FL9A 1E2JA 2W00A 3P4XA 2J9RA 3GLHA 3SYKA 3PUWA 2OXRA 4UJ3A 2OLJA 5FBVB 3X1YA 2F1RA 2WM9B 4LJ9A 5EP2A 1QG2A 4JLAA 4PAOA 5IT5A 2ZR0A 4WOPA 4QBIA 1U8ZA 2WJVA 2P5TB 2WWGA 4XTRA 2RGCA 5BN3A 4I1VA 4J0QA 2XOKD 5GJCA 1GRNA 3X1DA 2WZQA 3B1VA 2V7QA 2QQ0A 4FMDF 2P6NA 4V0MA 5EJEA 4TLDA 4I1SA 1GKUB 3AP2A 3CF6R 1RPZA 2FMXA 3ECCA 1E2EA 1T3LA 4S2EA 1G8PA 3O47A 4PHHA 4V0ME 4D0GA 4NP6A 4RJLA 1S96A 5FTNA 1IXRC 4KFSA 2TMKA 1NKTA 2BC9A 1U81A 4M9QA 1PJRA 2V8OA 4BASA 3U7EB 3L0SA 4DRZA 1IN6A 5J4HA 1R8SA 3AVTA 5GJBA 5C46F 2IWRA 4K46A 1COWD 3AP1A 1UBCA 5HTKA 3FMOB 1R2QA 2SHKA 4UJ5A 1E2MA 3A1TA 3QE0A 3S1AA 3SNHA 1XEWY 2B7CA 4MYUA 5J4YA 4Q9JA 1NSTA 2O8DA 3CZQA 3SS8A 1KI9A 2PMDA 4O2RA 4B47A 1NVXQ 2MSCB 2C78A 2JDIA 3DO6A 4A6PA 2H1LA 1N6PA 2OCYC 1P60A 1I4TD 4DJTA 1FMLA 3B9PA 3PCRB 3ASZA 3I3SR 1N0UA 1WMSA 3QBVA 3TH5A 1Z0FA 4AI6A 4ACAA 3BB3A 1YRBA 1N5LA 1N5IA 3SR0A 1HH4A 2CJWA 4Q4JA 4WA7A 4DEXA 5IK2D 2ZRNA 1VPLA 1TU4A 3ZQJA 1IBRA 3NBYC 1E0SA 1ZM9A 1CRPA 2IWHA 3NDBB 4QFMA 3I92A 3PV0A 4FCWA 3AVUA 1JR3D 2Q9CA 2F55A 4M9SA 2DPXA 1FP6A 2DBYA 2E87A 3RDPA 2R6FA 1M1YE 5IK2A 1ZM2A 2Z0MA 4JSTA 1LF5A 4JMPA 2ZJBA 4YMWA 1E2HA 4HZUB 1OIVA 2GBLC 4H1VA 4JVNA 4Q4AA 1E1QA 3FB4A 4XSHA 2YOGA 1XEXA 1OT3A 1W47A 1OFTA 5FR2A 1JR6A 3WNDA 3VHLB 3QUSA 1R4AA 1KJYA 2VQSA 1EX7A 3NHBA 3OEHA 3QPUA 4EFMA 2O8EB 2G88A 4M53A 4AURA 1IN4A 1OXVA 5DO9A 3L8ZA 1YZNA 5FR1A 4E07A 4OK6A 4PFSA 1WE2A 2FNAA 5FPHA 5FPTA 3LBHA 4US2R 1GG2A 2VP9A 1OPXA 3KZ1E 2PLRA 4URYR 2IYVA 1EK0A 4M1KA 4TYNA 3GEEA 3I62A 3C5CA 1ZNWA 5FI1B 3TK1A 2QMOA 4Z1MD 5FPYA 2HXSA 1BOFA 3EWSA 4OK3A 4BFTA 2CEAA 3RWMB 1P2UA 2EFDB 3DMNA 2IYXA 4C0SA 3AGQA 3KKQA 3CRVA 4MYHA 1LVGA 3PUXA 3K9LA 3AVQA 4MUBA 4TTPA 3CNNA 3BFXA 2MMGA 5JSZB 1OFIA 4HUQB 5BWMA 3EIHA 3H0KA 5J5CA 3EG5A 4A9AA 1IAQA 2WJHA 2WKQA 1XMJA 3IQXA 3T1QA 2FDCA 1KO8A 2XNDD 1BKDR 3LFUA 1EFTA 3DPUA 2CLDX 3OZXA 5FBWB 1CXZA 3CRMA 3U4QB 4DIEA 5KU1A 4XJXA 2GZAA 4YQFA 1P2VA 2GZHA 4D4KA 1DAKA 5TARA 1H8HA 4QGHA 4PC3A 2CLSA 2GAOA 4M2LA 4ESVA 1OH5A 1YR8A 1TQ6A 1Z06A 3CH5A 3CM0A 1I2MA 4MKIA 4A6XA 5C4GB 2CBZA 1E0JA 2CVFA 2ZAOA 4IRUB 3VKWA 4OQMA 1L4UA 3AF0A 2ZUCA 3LX8A 5IRCD 4L9WA 4OK5A 1GM5A 2JATA 3FHOA 3KKMA 5JI2E 2VHUA 5DYIA 3THXB 4JT2A 4Q5IA 2EFEB 2DHRA 1M7HA 2W2VA 2VF8A 1NP6A 4TL7A 3HYTA 2GJAA 3EW9A 3ZIAA 1G3MA 3B1YA 4A8JA 2BM0A 1XD8A 2J0SA 1E9BA 2BMFA 1YR9A 3TAHA 2NPIA 4XVUA 2ZRIA 1IY0A 2FSGA 2KBEA 1PZNA 2YJTD 1RW4A 1VTKA 2C5LA 1T8TA 4M8NE 4ESHA 3GFOA 4II7A 4Q9KA 4DXAA 2EU8A 4KU4A 4TL9A 2ZR9A 4QOSA 3U6KA 4HLCA 4DIDA 3DZDA 1W0KD 3IIJA 1KDRA 1GL6A 1FPMA 4L5BA 2J5XA 3Q72A 1RRGA 2YOFA 3WBJA 2QTFA 4M21A 2EYQA 4XD7D 4CIDA 2VP6A 1ZIPA 3CNOA 1YKSA 1CBUA 5CDFA 1YJ5A 2O5VA 1DAFA 1GOTA 2GXUA 1Q0UA 3IIMA 4P32A 5H8WA 4B6EA 1NY5A 4RD2A 1DVRA 3A58B 4BFXA 3AH8A 1E9DA 1XCGB 4F7WA 3K0CC 4JL6A 2EYUA 1KO7A 1X3SA 3DKVA 3ONWA 2RGDA 3U3KA 3UWOA 4A0RA 4DVGA 5JRJA 3CR8A 3BFKA 2REOA 4Q18A 5E95A 4IW3B 2VEDA 2OHFA 2WIBA 1W5TA 3RRYA 4DDUA 3KKPA 5CK4A 3V4FA 5TXGA 2ZE5A 1UADA 4Q1FA 2NO9A 5K8IA 3U44B 2IBMA 1G4AE 2OFOA 4IDPA 4D6PA 1P75A 1P73A 1U9IC 2ZQ5A 2VSOA 3NC0C 4NYJQ 1KMHA 4RSGA 5CIQA 2PX0A 1Z6AA 5AUQA 3VR2A
chains in the Genus database with same CATH superfamily
3NNSA 1NGSA 2JH8A 2R7LA 1D7OA 1DARA 2HJWA 2G6BA 4N03A 4WDQA 5HK8A 3AY3A 1EK6A 3C5VA 3PRYA 1RWNA 1O89A 2G9ZA 1HV8A 2ZIWB 4HQKA 1OLXA 1VLZA 1I6KA 5BNFA 4TT8A 4LRSB 4QIHA 1JLMA 4Q3KA 4NS1A 1HT1E 3AKDA 5KX5B 2ZROA 3B20A 2W6IA 4O2BA 3OF5A 3AV3A 4ALNA 2O2HA 2IYYA 3H5LA 3OPXA 4NOMA 1ZQ1A 4BNJA 4TKLA 2X8BA 4TS9A 3ZN2A 1SOUA 3IP3A 5A4FS 1J56A 5CR9A 3UAXA 4G4SP 1XDUA 2A92A 4HTFA 3GFPA 3T5DA 2AE2A 2QI9F 2VF4X 1NXWA 2RHJA 3H2GA 1DC4A 3QKSA 4LV6A 3E5NA 4GPEA 3EGXB 3QNUA 1LSUA 5H1YA 4ED9A 4QXMA 1H2WA 4XR9A 1ES9A 2PJRA 1CVRA 1VKHA 1TZMA 2YNMC 4TV9B 5ARCA 5EAIA 5L4SA 4DB2A 1QB8A 1MJFA 2F8MA 2G0AA 2OHIA 2VJMA 3O9VA 5KAMA 2IPAB 5LA6F 3TQOA 5FOVA 2FTKE 4Y1RA 4K9LA 1RLTA 1U8AA 3NWOA 4IKEA 2FR0A 2IU6A 5KREA 3E18A 4B3SB 2E3JA 3EOZA 3EVEA 4PNEA 1BQ4A 3UIEA 1AMUA 1W4RA 3E2PA 2XRYA 3GMDA 3KYDA 5B1DA 5KCZA 1FUUA 3A2NA 1Y4UA 4PV7A 5B58C 2MJLA 4WK2B 3EQ9A 1M10A 4M9UA 4MSUA 4L07A 4PY2A 5BMVB 4N47A 4BPRA 4HYEA 1G8GA 1QM5A 3AB3A 2OUKA 4YWJA 3QXCA 1ZOOA 4JGBA 2HO4A 5B2ZA 4PNHA 5G4KA 3O9ZA 1II9A 1RHKA 2QG6A 3L8EA 1MOSA 4KWHA 4QXOA 3ZD7A 2F67A 1DKNA 3EA0A 1HK7A 4CKCA 4UPEA 1WNFA 4M36A 4I1PA 1T0PA 2O0MA 3GJ5A 4YJ3B 2N1BA 5FI0B 4CI9A 4IXMA 2A67A 3KUKA 1PL6A 5F9FA 4E2YA 4FEEA 4LMRA 3DOOA 4LHSA 4HT3B 2XAAA 1I32A 1X7HA 3B7GA 3FWPA 3EX7C 2FEPA 4OGKA 2HMAA 1GVHA 4EIWA 3NG1A 4X65B 5LBUA 3N58A 1K5HA 3RTGA 3CWCA 2B3DA 3G5AA 1C8KA 4DR7B 4BLTA 1H22A 2Y1GA 1XF1A 3M2TA 1JDNA 2WE8A 3MMNA 1UJ2A 3DCYA 3IQDB 3NVDA 1PHRA 3P27A 2ZE6A 4EFDA 3G5UA 4RTOA 3Q6NA 3A3KA 5I48A 3DYIA 3IQHX 3AL2A 3O3OB 4MRRA 4EHHA 1U94A 2ZVQX 3T1YB 4UD2A 2CVOA 4NMWA 2N42A 3JYQA 1ZKMA 2ENUA 3H2SA 3ZNQA 3N5KA 4EYOA 2H2AA 2C3YA 3PDJA 3NUZA 4XEHA 4YXWD 4QG7A 2UVPB 3HUFA 5JSZA 1F7UA 1B6RA 2H18A 3D4LA 3E22A 1XKLA 3E7FA 4GD3Q 3SDBA 1VMEA 1JHXA 2PJZA 3LKBA 3VPCA 3UHFA 1G8FA 3L6RA 3JASA 3CPJB 3VHXB 1K7CA 4D8VA 1J5PA 4EMBA 2NU8B 1F4LA 3PC4A 3NT5A 3RAJA 3UOAB 1N9GA 3UT0A 4LNAA 4YXWA 1Z0ZA 4ILEA 1VPEA 4MTCA 3GQBA 4UBLA 4JX8A 5TF4A 4JI0B 5H82A 5JWHA 1OFUA 3RFUA 3L6BA 4CM8B 1J9EA 1DFIA 3BWDD 4BRZA 4FM9A 4LOKA 5I9MA 1I7DA 5DDIP 3QHPA 1GZ3A 1LNZA 1QFSA 4QE3A 3FNRA 3MTAA 5EIBD 4A16A 3BT7A 1RBQA 1ODJA 1WMAA 3NOVA 4UHFA 4GLOA 3GD7A 2OM6A 3HJNA 5IABA 2CMGA 1OBOA 3G9UA 5CM2Z 3ESDA 1IVSA 2RK6A 3C85A 2KS6A 4B0OA 3AONB 1TYCA 5GJVC 1P2SA 5ISMA 4O2LA 2GLXA 2R8OA 2I3AA 3V8BA 3H8WA 1VSVA 2OV6A 3HB1A 4Q6WA 1UBNA 4MWSA 1VRWA 5FOWA 1KPHA 3HN2A 2JH3A 2Z43A 3DDWA 3F5DA 1QKIA 3CVJA 4NULA 4QO7A 3TRHA 2BHRA 3IHKA 3ROGA 3NH9A 1AHIA 4HGOA 4R1NA 1R5BA 5DHUA 2X2PA 4IIFA 1DXYA 5CLJA 3U56A 1PD1A 3ZK9A 3B3JA 4D41A 1USVA 3UUWA 4DEVA 2FPRA 3LSTA 1UXIA 1E7RA 1J5XA 4CIWA 3TLAA 2A2ZA 2VRBA 1MB3A 3K0AB 4ZI2A 3OHMA 3ZDYB 2J0VA 4TLLB 4ZIRA 4PN7A 5AESA 2YJZA 3PT5A 4WIAA 2JHAA 1SQ5A 4ZVQA 1K9SA 4J9UE 4OQFA 4FR5A 4URVR 1HC7A 2J3IA 2J6BA 4RFSB 1T5IA 2QWXA 3I8XA 5E8JA 4DQKA 4KP7A 4YI3A 5JSKA 3HV0A 3NHWA 4M98A 4R9UC 2CMDA 4EPTA 1E9VA 4W8GA 1ZSVA 1RE1A 3GZJA 3DS8A 5I8WA 1IJEA 5KOJB 1XLVA 3B48A 1BCRA 3KT3A 3QMVA 1KK1A 3JD0A 5JXWA 4D26A 3E0QA 3VZDA 4CFZA 4LZWA 4UHJA 2BIFA 2JJ2D 3PGJA 1MOQA 5A3JA 3UAZA 3V7WA 3OM1A 4NXNB 2CC2A 2NUPB 1HTBA 3SQXA 3FRHA 1RNLA 4LJ8A 1A2BA 4PPQA 3K4HA 2HUPA 1O2DA 1M8KA 2PX3A 8LDHA 5BQXA 1IULA 5LBIA 3ONNA 1H6BA 2MR6A 3R5FA 4MV0A 3KJNA 4UHDA 2JA1A 2DPYA 1PFQA 1M76A 4LY3A 3WMRA 3T5PA 1FTSA 2GCGA 4ZOLB 1RYEA 4AJNA 4OYYA 1H8ED 1PQWA 1Y1PA 3L1KA 3A7EA 3S99A 4Q7LA 3V7FA 3PUHA 2ZSKA 3OLYA 4LYJA 3BQNB 2JGNA 1UH5A 1RWBA 5ECWA 2NAFA 4BVEA 3C8HA 4C6TB 4GRDA 1Z39A 2R3SA 2EGHA 5H02A 1LLFA 1EUCB 4ZT3A 1Y4AE 5IFKA 1A3CA 3I73A 2REBA 4J0FA 2LZ0A 3Q4GA 4X61A 3KOOA 4LHXA 4LKOA 1YBFA 5SZKB 1KDZA 4DQ0A 4DWOA 5KNLA 2BDTA 2D62A 2BJVA 1N6KA 3JV7A 1ORHA 3ZZ1A 2PG3A 1TUIA 1GKKA 2XUZA 3HCPA 2C4VA 3I72A 2CVPA 4D3DA 1DZ3A 1JDJA 5G0WA 4PAMA 3KYIB 4LHYA 4EATA 1QQBA 2IIPA 4M0FA 1EP2B 3OTGA 1HDGO 2IYAA 2NVBA 4BVBA 4C7JA 4WLEA 2AZ4A 2HWUA 1PZXA 2YXNA 3TBHA 5TMPA 5JTTA 4YT5A 1E2LA 3JQGB 1MA3A 4NY1A 4PO8A 4RHFA 3A9WA 1JQAA 1NT2A 5D01A 1JHRA 1SBZA 3LQQA 4R1UA 4WECA 4F86A 1RQPA 5DI3B 1QP4A 4YAJA 4DB4A 1MT0A 4LJAA 2WT8A 4BLPA 3HYSA 1BEEA 1QXSA 2W9XA 4ZC1A 1X1TA 5T3UA 3UKDA 4C07A 2BJWA 1T9ZA 4ZREA 4FMCF 4EP1A 2YIJA 1WRBA 2JD2A 2XYHA 5C1IA 5E7IA 1PSZA 4KQKA 5CU7A 2GESA 2J48A 5BUZA 3B6EA 2OAGA 2FF7A 2VUIB 4LZLA 3PT9A 2EARA 1LNSA 2ZWVA 1Z2OX 2NOAA 2RCNA 4WN3A 5EIAA 1N8KA 1WU7A 3ZKWB 4DR5B 3K2EA 3QV2A 1A8SA 3TX2A 3TG2A 3G8BA 5EKXA 3V8QA 5AVJA 4BJ1A 3P20A 4JLVA 2Y1WA 3DDCA 3EH2A 2DBVO 5F12A 4RVGA 4E2FA 4YO7A 3VPFA 2WF7A 2V3CC 3HFRA 4MA5A 2Z1MA 4MLCA 1TA0A 4RZ2A 2V7BA 3EWIA 3OWXA 5TPWB 3H13A 2YC2C 3ODGA 4HDSA 5EMNA 2CK3D 2OCLA 3T7RA 1Z17A 3QPDA 3JZIA 2ZRLA 4WLFA 3IT1A 5C8YF 4B3CA 3PNMA 2NWQA 3QH4A 3SXJA 4J1NA 2FRDA 2ZIXB 5TMDA 3GYBA 3D2AA 3VUEA 4ASUA 2BBOA 3FLMA 1PG0A 3TCKA 5B30A 1JEQA 1GUBA 1Y4DE 2BFEA 3E5HA 4BMOB 2RAVA 2BEUB 3I2KA 3QFCA 2JFOA 1I3MA 2VXBA 5TPZA 3NWBA 3PF8A 1QFYA 2IIBA 3UQYS 5HUQA 1FLDA 4TMZA 5CVDA 5JZSA 2HTEA 1TDJA 1XV5A 3TM5A 3STVA 1DCKA 4PBTA 1NBMD 3OFJA 3MCVA 4YNBA 2BGGA 3AR8A 1ZH8A 3VKUA 5JFGA 2KI5A 4KQJA 3IQIX 3IBGA 1ZPDA 2J3DA 3KZKA 4U7GA 3UG6A 3GLKA 1RQXA 3L7MA 2AUNA 3Q85A 4HAWA 1J42A 1RM0A 2EKBA 1USUA 3ZNPA 4EHKA 3KPJA 4DW8A 1TFUA 2VYCA 2GYWA 3N2KA 2ZTUA 4OUDB 3EEFA 1KYVA 4PG6A 4MICA 1N2CB 4DHWA 1E5VA 1LSSA 3BCUA 3MCWA 3MZ0A 5FOSA 3QVGA 3SHFA 3OFNA 1X7YB 3TJRA 1U2ZA 2RGYA 1SVWA 1B0UA 1NP7A 2K87A 4M0LA 3OZAA 1HEYA 4DY6A 8MHTA 1RT9A 2X86A 4WCDA 1G5FA 3MTDA 4U7TB 3BJZA 4BEVA 2W2KB 4QBHA 3WRYC 3N6RA 3FETA 5DNEA 3L4JA 3SI7A 4B8ZA 3ZJYA 1YR2A 3PXAA 2AG1A 4JJKA 4LSZA 3CUTA 4N49A 2NV2B 3GFQA 3AK4A 2IHVA 1U3TA 1I10A 4MV8A 2DQSA 2YJNA 2CW5A 3Q3HA 1QGYA 4G1UC 3S5JA 4GI5A 4WBNA 1UMBB 3Q3CA 2R1VA 3B6MA 1IOVA 5IN5A 5T4HA 3TVDA 3X2FA 4EB8A 1OT5A 3THOA 2UYHA 4DR2B 4QBTA 5ER6A 1WBBA 4S04A 4MEJA 3DMHA 5K45A 4G2NA 3KUDA 3DAOA 3WHLA 1R6BX 2TECE 4S12A 1I36A 2PEYA 3HN6A 3TINA 4YDQA 3C6BA 2WAMA 3IPXA 4IOKA 4RTPA 1RYMA 4DA8A 4KPYA 3IOYA 5EQJB 3R44A 4YT8A 1R88A 2A5GA 1CUYA 2FG5A 2BFNA 4F3YA 3H1EA 1H0HA 1OJLA 5JJCA 3PGLA 2X9QA 4AUKA 2BFFB 5HRAA 3L7DA 2BUBA 3ZWCA 3HL0A 3WNVA 1XSEA 2OKCA 1BRMA 2G4VA 3AW8A 3JQFC 2P91A 3F6RA 2WJWA 4X64B 1E8MA 1W0CA 1KC1A 3T4XA 2EP5A 4KDCA 4O4JF 5KTNA 5HBRA 1R5NA 4MYDA 3G0BA 4IINA 1X0XA 1WZUA 3EZGA 2ZEJA 1M2KA 4D0LB 1GNTA 4XDHA 5JDIC 4EG7A 1I2BA 3P2JA 4C4SA 4HPJB 4XVCA 4QVGA 4Q9HA 1F0PA 2HLPA 3MSXA 2VJKA 2WKWA 1YR6A 3AJ9A 3AU9A 3EGEA 3P4YA 4HV4A 2Z2KA 1BJRE 1OAOC 3ADDA 1E99A 1KH1A 2Q4BA 3T9BA 1EU1A 3FRJA 3FZGA 3BIOA 1NI3A 3BSFA 4GECA 4HDOB 1N8NA 2B35A 2QQEA 2QUBA 4LGCA 4K8OA 2ZIAA 3I8OA 4RHXA 1NAIA 3CSDA 4P36A 3ZZUA 5BURA 4W5TA 3AP3A 2PKCA 4OPMA 2AN3A 4FGJA 3IEIA 2XV1A 1Q0QA 5FYDA 1N0WA 1GU1A 1R5OA 2G08A 2XTNA 2DFPA 3TOVA 2VYFA 3V2IA 2Z5LA 4X5OA 4HLUC 5JDCA 1E3WA 5FTJA 3C7KA 3QVKA 3KNZA 2QW8A 3IT0A 1RJGA 1RWMA 2V74B 3FTDA 1V39A 2R79A 1WHTA 3JQPA 5A4IS 4CM9D 2B6HA 2NX2A 2ZJ4A 1H4VB 3JALB 3NTRA 4MW2A 4P4UA 5LZ9A 4COOA 2Z08A 1UZMA 1UKCA 2JJ1D 4PXSA 1J24A 1S8OA 2PRIA 1U63A 2B1JA 1E98A 3QZUA 5B4TA 4AMZA 3X43A 5KJ1A 4MGIR 2ZPUA 2Q5QA 3R3HA 4HZUA 2F4VB 3JZAA 3JVIA 1GGNA 1ZGCA 2V9CA 3LAWA 1U8FO 2RHMA 3I5MA 5A7FA 3RF6A 4YUZA 4CGYA 3QG5A 4I99A 3GLRA 3V00A 2GHRA 2DPMA 3DV0B 2NZVG 3N86A 2HTFA 3MQFA 1EXWA 4HDKB 4HLDA 5E1OA 4C0BA 1KAGA 4ENSA 2A9RA 2ZJ7A 4DSOA 4BYGA 2P5YA 1G2OA 3DZKA 4NAHA 1E1RD 3IOCA 1KVSA 4KNWA 1Q7EA 5TB5A 3VYUB 5JMTA 2VOEA 1JQ3A 3FZEA 4UZSA 3EF0A 3P97A 4G9EA 2HLDD 1GKLA 1RPNA 1IHUA 2BPOA 4M1ZA 1Q1BA 3MJFA 4MCIA 1SA0B 3TOZA 4EPYA 1II8A 3T3PB 1R12A 4MR8B 1QTRA 1V11B 3RI3A 4MEAA 3UVEA 1X86B 1QVZA 3K1AB 3LCCA 2IYNA 4XPZA 2AX4A 5DIFA 1HDXA 1CNEA 3WGIA 4UOEA 4QUHA 4CDGA 2HA7A 3T15A 5ALRA 4KAAA 1FLVA 3UUFA 3JTMA 3WLOA 4YCJA 4EMTA 1Q50A 3ANTA 4JYCA 4JYBA 5EJ8A 3UV3A 3CF4A 1P2GA 3L7NA 3LYHA 2INGX 4HRAA 5IVDA 5LZ7A 3W0LB 3NJ8A 4A2PA 1JTEA 2IP2A 2PUAA 3P9XA 1DEAA 1QKKA 3D6UA 3O84A 4JNCA 4XPIB 2AOUA 2R96A 5LSAA 2W83A 4J07A 1A5BB 4KRYA 4BQRA 4Q9IA 2EX1A 4MLZA 3AG6A 1Y9EA 4C78A 6AT1A 5JG7A 5IHPA 2Z8ZA 2J3MA 1LXCA 2JHPA 3IESA 5KVAA 4RANA 4OQEA 1JG3A 4S1PA 3RTEA 3AERB 2RG1A 4M9QA 4TUYB 1TK9A 3WMWA 4MMXB 4D3XA 3VJLA 1P7WA 3IUSA 2OOSA 3DVLA 4IHQA 1UBJS 3J81k 4RW0A 3GYGA 2C0QA 2WFLA 4N0DA 1Z4QA 4G41A 1UOOA 3EXG2 3GIWA 5T41A 5EIEA 2P7IA 3PE4A 4L4ZA 5JS6A 4L02A 4EY8A 3DR5A 3K9QO 3CNEA 2AZMA 2V59A 3EBLA 1VLLA 3IE2A 3OQ6A 5GIOE 4JI4B 1L5HA 4JXXA 3CX4A 4JDUA 4AULA 2R65A 3OE7A 3AFNA 3GK3A 1YJQA 3ZY5A 2P6PA 4M1OA 4NV3A 4BQPA 4FN5A 1IIBA 2AOWA 1PJAA 3PIRA 4D44A 1P61B 1DUVG 1T4CA 2IOYA 3DOHA 2E1RA 5H5JA 4F3RA 1VCHA 3MGCA 4PSDA 2QNRA 4YJGB 1V7QA 2E6KA 1D1TA 4XJSA 2FK7A 4BVAA 1ZK3A 2R2GA 1XTUA 3CEMA 2CVHA 3JQBC 1G8MA 2BJHA 3AM4A 2HV9A 3L8FA 3CLTD 4ZDKA 2HMTA 2CHVA 2EX4A 3VNAA 1LLDA 1OC4A 2O3QA 4UEOA 1KI6A 1O94D 1WXHA 1UDWA 4IHJA 3ESXA 2JAWA 1I30A 1C30B 4YACA 1TMYA 1OYOA 1SVIA 1T4MA 4DMGA 1G7RA 4Z0TA 4L3OA 3WK7A 4JB8A 1YIOA 1YZYA 3MT9A 3IEVA 4JUAA 3EHEA 1AK2A 2CJWB 5IWCA 2WA2A 3BWVA 3W5IA 4MRMB 2RD2A 3AJDA 5FI3A 2RI6A 4TWJA 3KQLA 1US8A 3HR8A 2YR0A 4IIYA 3WGOA 3GVXA 1N6HA 4XI9A 3KEFA 1UAAA 3R5KA 4C7OA 3U7RA 4Y9TA 2GJKA 3R8CA 3UUEA 3TLMA 3GLIB 3K2QA 2JAQA 4M6WB 3OLQA 4AO8A 1UBFA 3ORQA 3PEUA 4RF2A 2FRDC 3DL7A 5JCOA 2BM9A 4YC7A 1FJ2A 1Y81A 2HYDA 2WD7B 4YP1A 3UT6A 2BP7A 2EBUA 1P4RA 3DWEX 3G9QA 5BW8A 2GGSA 3MOIA 4RFLA 4GBJA 2ZCVA 1ONNA 2IQ5A 2O4CA 1RPTA 3EZLA 3TI9A 3M82A 1E0AA 1PFUA 1Q12A 2QJWA 4TT3D 2BDEA 3OAAA 3TIGA 3JWIA 1TVEA 3SICE 4OG2A 1XD2B 4CKBB 5FWDA 1JYFA 1E1RA 4DZRA 4RTRA 2ANBA 4F6CA 3AOGA 1SVLA 1RXEA 3DAGA 4YH1A 4A91A 4AMYA 4H15A 3TW8A 3ASUA 1MJNA 1ZH0A 4JHXA 1V37A 5FF9A 4MHOA 4TT3A 5C5CA 2C7QA 1K6XA 2TSYB 1Y98A 1W34A 3H9JA 2EJBA 1HXHA 3P2KA 2H2GA 2PBRA 3SYRA 4O29A 4V1CI 3WQQA 4TSFD 3ZV3A 1S9HA 4L2IB 3MJHA 3K32A 4C22A 4YX9A 2PXXA 3FPEA 3VR6A 3P9RA 4H3KB 4OJNA 2YHBA 1XXLA 3RIGA 3FMPB 3OT4A 4X41A 1P0PA 3H1GA 4IHJB 3DWFA 3H65A 1KOGA 1PR4A 4KK3A 1MFZA 3TNJA 2WIDA 3I42A 4YMIA 2RHOA 3DE6X 3VR6D 3E3MA 3M70A 2VRWA 3WK4A 2P2GA 3NBUA 3KDPA 3HJAA 4FGSA 4CLHA 3OE1A 2WZDA 1VIVA 1IOLA 1U7OA 1Q7BA 1OI3A 1PR1A 1SU6A 1UIRA 2X4DA 2Q5EA 3BICA 4LYAA 5CPBA 2J6HA 2E18A 2X19A 2EW1A 1K4YA 4JITA 4CF4A 3KALA 1JDTA 1GRQA 4NBTA 1KS9A 1TA4A 2OHHA 2XD9A 3QNWA 4DIOA 3GGDA 3EGWA 3KO8A 1P0FA 4O8ZA 3IGFA 4GOKA 1HT0A 1TM7E 4WFQA 3WQRA 3SR4A 5KDDA 1ZL2A 3U3MA 4GO1A 4F9EA 3OM9A 5HS4A 4JY7A 3O5AA 4XFKA 1SD2A 1I6LA 2B2NA 4UM5A 1Y1TA 1HX7A 1VHJA 2ODWA 1YKGA 2EHDA 1X74A 2NTEA 5L7YA 1GP2A 1KEUA 3WISA 1T0UA 2IGBA 3U4IA 4LN1A 2I65A 5AJXA 1LV8A 3WGJA 1UWCA 4F2WA 1NBAA 1KRWA 3ESRA 5C5EA 4HC4A 1LUAA 1J23A 4ASUD 1BWQA 3O8BA 4NJEA 3OP1A 3NHUA 1S89A 4ZT6A 1O5OA 1S3IA 2AOUB 1GEEA 3SJBA 2PWPA 2ZRAA 1JRLA 3H9GA 4QRDA 1LFAA 5FXMA 1LLQA 1XLTA 4B75A 4MRVA 2P5SA 3ENQA 3FAZA 1U8TA 3GB9A 2GCOA 3N7AA 3EUEA 4MVJE 1O1YA 3A6ZA 3ET5A 4W1PA 3N39C 4C7KA 3NKFA 4ZK6A 4XD7A 1NW9B 2R8ZA 5D86A 5GGXA 1CUUA 5ALNA 3GLHE 2H7VA 4JODA 3USES 7MHTA 1OH7A 3MUEA 5E8RA 3I6QA 1D0IA 2YFYA 3NBFA 4I5DA 2HF7A 4OHCA 3V34A 3ONEA 1AN9A 5IFLA 1AKWA 4IV5A 1H8EA 1NN1A 2FXIA 2MSDB 1IOWA 1FTNA 1PTJC 1V11A 4IM7A 4ZVOA 3W2GA 4QAQA 4FLMA 1SA0A 2F9FA 2HLHA 1ZCAA 4GAEA 3VTKA 2B37A 2GSDA 3E81A 4LYFA 1K7YA 3F49S 3R0XA 3ZW7A 3IR6A 3RUHA 2H5IA 4J7CA 4RU1A 4US0R 3MK31 2XQVA 3RG8A 3ITKA 4GRAA 1Y1QA 3VR3A 3L8HA 1X38A 2BZ1A 2C92A 4FMPA 4KMOA 4AXBA 2DCMA 1GT6A 1M34E 4DREA 3VZRA 2RBEA 4TN1A 2G1UA 2DOKA 3MTJA 4XGIA 1KZ1A 1OYVA 4AN1A 2W11A 1NVKA 3DV0A 2VT2A 2ZQZA 3IMKA 3STYA 3WGKA 5HJ5A 3CLKA 1HURA 1WU8A 2J32A 1HWYA 1FS6A 2ORED 3KAJA 2XDQB 1J7KA 3AWDA 3RAPR 3FPFA 3VO1A 3GRVA 3AU8A 3LM8A 4K28A 5GIPE 1QHGA 1HMPA 3AF1A 1EX1A 1CWUA 2BFAA 2ATIA 3FJYA 3H16A 5BMVF 2QUZA 5FUBA 4BNDB 2IKQA 3W9YA 3UJDA 4BO7A 4LWZA 3OJFA 4RTNA 1AZTA 3K7EA 2BF7A 1QH8A 3CT6A 4LSGA 4L9RA 1X7GA 1W9HA 2W2PA 3K8QA 2WMNB 1A95A 2DKOA 4NMMA 4JLPA 1V6CA 4OA5A 4MV3A 2DFVA 5JCZA 4B9EA 3EPRA 2PJUA 4IFIA 1SY7A 2ZJOA 4FCCA 3RK4A 1U7HA 1FW6A 2PU5A 4NHOA 2VH5R 2BLNA 5BY2A 4MARA 1NDQA 2A0FA 3PNYA 1XLWA 1O4WA 5E7MA 5HF6A 3CF4G 1MC5A 3QP9A 3CH6A 2AFIB 1GN8A 4BZWA 3CYFA 2DGDA 2CT8A 5LMUB 1GQFA 4ZJUA 1PI3A 2GPYA 3QE4A 3ZWMA 3WXMA 3G8AA 1J0XO 1UZAA 2QTMA 2VHYA 1SK9A 4P98A 3PXGA 1TKBA 1TM4E 1ZK1A 2HA4A 3I34X 4FT4A 4QX6A 3SEZA 1U6IA 2WUEA 4F91B 2IF0A 1XZEA 2ISSD 3BE8A 4BO0A 1FDOA 2R2AA 4FFWA 4X54A 2D5BA 1V96A 5COBA 3GMSA 4GM0A 2GWHA 3MAAC 5BYAA 5LWHA 1ZVKA 1E79A 3MCAA 3A4VA 4H7IA 3TUJC 1YB2A 1RTTA 1MGPA 3HDVA 4L16A 1IVYA 3CVWA 4QELA 3D5TA 2VUUA 2YZGA 5JANA 1M2VA 2E0IA 2PZMA 3GQVA 2B98A 3E84A 3USCS 4ROSA 2ZJ2A 4EVQA 2QRZA 4GWGA 1OXBB 2XVZA 3LT0A 5CAEA 3GA7A 2O0KA 2WHRA 2RKWA 3S2GA 4DNQA 3S44A 1OV6A 5ED4A 1TCBA 5L3QB 1YA8A 2G1KA 4ZU3A 3RYTC 3DBRA 1D1PA 4R8KA 4MO2A 3KEQA 1DZIA 4IDNA 3RR2A 2OFXA 5GPBA 1BZYA 3PNKA 1HE2A 1XVTA 1XZIA 2V9ZA 2VK8A 3KL2A 2PWZA 3L92A 3SC2A 1U65A 2C1ZA 5B36A 1DCTA 1XBTA 2EIXA 1C4OA 1P2FA 4MIYA 3LP5A 4KVFA 2JVIA 3WR5A 1NYRA 1C9YA 2ETXA 4J2OA 3G2NA 3DH0A 1X0VA 5FWXA 2AR0A 2FWNA 3GN2A 5K05A 5JALA 2AC2A 1ZDMA 1ECJA 5ALHA 2FN7A 3TR5A 1AHPA 1A9OA 1B3RA 2AI1A 4TVOA 4BRUA 4J29A 3BE6A 4FHEA 4OKSA 3V1KA 5CW1A 5ALVA 1U2RA 4RSRA 5TQVA 3CKKA 4GOMD 4MWDA 4KO4S 1S7CA 3AIKA 1XROA 2C00A 1U0NA 2J07A 3F71A 3N6VA 3ZY4A 4YRZA 4X20A 3HU5A 2GD6A 1BGVA 3NEYA 1EE2A 4N8SA 4ZCMA 1G0NA 2GVDC 1OKKA 1WBJB 2O2YA 1KMNA 4TMTA 4BHTA 1ONSA 3DE3X 4OI1A 1SXQA 3BDVA 4UMDA 4TKUB 4PEVA 2VN8A 1VRCA 3VNUA 1I0IA 4MA0A 4MUFA 2RC5A 4NE9A 4Y2QA 1RQLA 2GNPA 121PA 2OHOA 1SXGA 1Z2EA 2CBXA 4C0HA 1TAHA 1KF0A 1G8KA 5JCOC 4QSHA 5KINB 1QO9A 3GF4A 3G2KA 4R9RA 4F56A 4QUDA 2QD5A 4PRYA 3ET4A 3WLHA 2V6JA 3EXIA 3AHCA 1SULA 1V9LA 3KR0A 3HVHA 2IEGA 1AXGA 1FFEA 2IHUA 4EKGA 3OOHA 5FHQA 4C4AA 2BFEB 4RCVA 1Y4SA 4ZANA 4OMUA 1FDVA 2O5RA 4TKZA 4N76A 4HATA 2ZIXA 3W8NA 1JR3A 1Q17A 1XXHA 1R6UA 4O4LA 4AP9A 4QDKA 5J2TA 1COZA 1P1KA 1P4JA 1KARA 5LD2B 5A04A 4OAQA 1CDOA 2P9YA 2P4QA 2IV3A 2HBRA 4EPRA 1Z3IX 4MI1A 3N0XA 3KTAB 3RSZA 2Q6OA 1G98A 4ENVA 3H0CA 4M1SA 3AUAA 2E37A 3FDIA 2AXNA 1D2HA 2QL5A 3GLUA 3KXIA 3HJGA 1KJ8A 1CY2A 3HZRA 4IDQA 3ZIUA 1BN7A 1GCAA 3IODA 3OEWA 4FMBB 1L7RA 2Z1NA 4DFDA 4F5YA 1UINA 5A3SA 1TM1E 4UULA 5DK4A 5ALMA 1P2DA 3M3PA 4MULA 1EM8A 3PEVA 4IIUA 3M3DA 5BUQA 2PR2A 5JBQA 1JIKA 4AJEA 1H6CA 3PIIA 4HN2A 5DGTA 5LUAA 2EJCA 2M6SA 1A2QA 1SBNE 3EGVA 1I2DA 2ROQA 1UJMA 2NYUA 5ALKA 1DAEA 4S35A 2D0DA 1JLRA 1RPAA 3GCGA 4GL4A 4KFTA 4UU8A 4DPKA 3OJ0A 4XWAA 2XUQA 2HDNB 3MTBA 1H4TA 1E2QA 3PU6A 1QS0B 3LWDA 4YLEA 1Y7TA 2E48A 1KEVA 1A9TA 1AUXA 1Y82A 1UCFA 3FY4A 1OIWA 1Y9AA 1KGSA 3BGDA 3KLBA 4IVRA 2XGGA 4V2UA 5EP4A 3IHTA 1D07A 5KO2A 3QG1A 5FT9A 3LI2A 3CLUD 1V4NA 3LUGA 2FQ1A 3DT8A 1RDFA 4B3MB 4Y9RA 5DI3A 2NXWA 5L3ZA 4WLOA 2FMFA 1TUEA 4FKZA 3FAKA 4MB2A 4XA8A 2X0JA 2X8JB 3CEAA 3PG5A 4FX2A 3D7MA 4BY9E 1GSHA 2QD4A 2XAUA 3N87A 5E7QA 1E8NA 3DVSX 4FGWA 3TGWA 1OIXA 2ZBQA 2Q7XA 4PRLA 4C0AC 2HLNA 1NG1A 1I2CA 4OQXA 1KMQA 2WG2A 3VNSA 5AKYA 3W6ZA 4AD8A 3BE5A 3O4GA 3WL4A 1M1NA 1N2JA 4TLAA 4QHYA 1Z07A 1T9AA 3L6UA 4H08A 1DCMA 3I4CA 3LX5A 4KIGA 3S68A 3F9IA 1N34B 4I9GA 4AY6A 4BLQA 5C35A 4YUXA 1Z8NA 3M8KA 3SHVA 3DMTA 1X19A 4U00A 2XMQA 3KR1A 3UMBA 3IBCA 2JIRA 5BN4A 1GRVA 3HFSA 2K2WA 1VIDA 1QIFA 2O2XA 3DFUA 3WLAA 4E51A 4X93A 5EUBA 3MJTA 3T1VA 2ID7A 1YBAA 2X3FA 1YULA 2J0UB 1XAJA 3PRKE 5C7LO 5JHHB 2W2LD 1P0MA 3MF4A 2PR7A 1KIMA 3QHQA 1X7ZA 3H7AA 5K3AA 1QU2A 4Z2YA 5K0EA 2ZB3A 5THQA 6CHYA 4K3UA 4XQCA 4RZQA 5E4FA 1NZFA 5AOCA 4OHYA 1SZJG 4YPOA 1YB6A 2FOIA 3LQFA 1MPXA 2GBIA 2CNOA 3PWSA 4JWKA 4MGEA 1IZ7A 3R6GA 5K3FA 3GFFA 5A3QA 2AQ8A 4IMPA 5JC8A 3HL4A 2W4MA 1R9GA 3KJIA 1WXXA 2AWOA 1DT3A 1OKKD 2EEZA 2W2LA 4MR7A 1PTJA 2EWMA 4NLLA 4XARA 4XD2A 3TWOA 3OHPA 3KQNA 1SKYE 2B4RO 4L9SA 3ZDFA 5BRAA 4J0IA 5LP6B 2NUPA 1E2KA 3NKVA 2R1ZA 2BHTA 3VTZA 1ZGGA 2YRXA 3VZPA 2EZ4A 1FDIA 1OTXA 3DZGA 4MRNA 1NKVA 5TRTA 4QHSA 3TOXA 2DF8A 3RC8A 1NNI1 1E9CA 1EM8B 4RK1A 2HH9A 1DJMA 2O7RA 3N5CA 4OI4A 4CMAA 2J85A 2R751 1BMTA 1HL3A 2PGAA 2AC7A 3CEJA 3ZKAA 1TC1A 1QZXA 2NQTA 1LTHR 1MB4A 3MBIA 5GZ1A 3ND5A 4ZCLA 1W25A 5K0LA 1VA4A 3OF2A 2QM8A 1S2IA 1FZTA 1QYRA 4HS9A 3KTAA 4UDYX 5SV2A 3T41A 4GL2A 3PS9A 1XP8A 5HA5A 3I05A 4MRPA 1FY2A 1M0EA 4NR0A 4OM8A 2LW7A 3HXMA 4HDAA 3U5ZB 3IEKA 4O4LB 4DIFA 1BCSA 2A14A 1WS6A 5BN5A 4NE2A 1UPTA 3DSRA 4RMGA 2JEZA 3S2UA 4N7MA 3KE8A 3BJIC 1T2NA 2QDKA 4UU7A 5ICFA 4B8WA 1GYRA 4PHCA 4P4NA 4LDRA 2IELA 3IV6A 3HCDA 3L7OA 4TX1A 1VZ2A 4OM7A 4YRSA 3SX0A 2JLCA 3AQIA 3LHSA 4KGDA 4ICIA 3JU3A 4Q4HA 5IUNC 3IMCA 2A84A 1G21E 2QQGA 2WNSA 5BXYA 3IAEA 5D51S 4D96A 2FHSA 4BNNA 5IJ9B 1PNTA 3LXRA 2XT6A 3GP8A 1C41A 4AL4A 3ZW8A 5KOHB 4J2TA 1NSYA 3OC0A 3BPSA 4ENWA 5SICE 1IY2A 4G8CA 4WUVA 1W36B 2VQEB 2V7PA 1G9TA 1Q1ZA 2M6LA 3WIBA 1SGWA 1WWKA 1ZD2P 3KJXA 3E6AA 3MS7A 1FFAA 2YV3A 1E0DA 2PRZA 3CW8X 3F5FA 4FUTA 1XN4A 1MO5A 1NT4A 1YS4A 3K5IA 1FFCA 3KEGA 4GP6A 4NZPA 1JF8A 1F8FA 4B43A 1NUUA 3NAGA 3A31A 3CWZA 3UXHA 1H94A 1MR3F 1A4XA 3FYCA 1SG0A 4U39A 4PNZA 2OSVA 1G6HA 3GXOA 1XRJA 3R4VA 4B3FX 5JQGB 4X6YA 3RYIB 4EPWA 5ADHA 4X24A 3UPUA 4G86A 3QPWA 1KO1A 3X1MA 1DXHA 4XGQA 2UVPA 2P4UA 1QIMA 2OBMA 1NZJA 4PIMA 1OC2A 4RXMA 1QO0A 3H5WA 4WHMA 3R3UA 2O2EA 4HMQA 3VJRA 4GPZA 3WJ7A 3KHUA 3SC2B 5KSWB 4YK7A 2JLYA 3NTLA 3OAAD 5ERYA 2PQ6A 1T3ZA 3OC6A 1S1CA 1RC8A 3AUJB 4AWXA 4OYHA 4BNYA 1NU8A 4GE0A 2CUNA 2BZ0A 4X66B 1YHYA 3HR4A 2G5GX 4W63A 1TJNA 2EP8A 1XCBA 2OESA 2XH8A 3FGZA 3I53A 3G1WA 1DMRA 1ZONA 4JU9A 1NRXA 4WOBA 5LLSA 3BD6A 1RWKA 5CAEB 1AXEA 4LV8B 1S7GA 5J5VA 2HPZA 2D5IA 4I5EA 4RKFA 4BP9A 5KSZA 4JL5A 3DEHA 2C7PA 4JH0A 3MUOA 4W5QA 2OR3A 3V4OA 4YCSA 4YP7A 1ZINA 4PU0A 3ICCA 5G4KB 5BSGA 3FMFA 4V3CA 1ZIDA 3VX4A 1KYXA 1SOWA 3L9WA 3LBAA 1SUWA 2VP2A 3CRQA 2PS1A 3NHPA 5E6UA 3QEKA 3DC2A 1WDLA 4HXYA 4M0MA 2GRAA 1AD2A 1LDGA 1NJFA 2OV2A 4MB0A 4X8MA 5FLXA 2VJQA 1CIPA 3EZXA 4F8JA 2P9FA 1K4MA 3KT0A 5KWVA 1RIIA 4F7DA 4YYZA 3EPHA 5IDXA 2BUCA 3D8NA 4LG1A 1N2BA 1V48A 1TGVA 2Q3LA 3HPRA 4ARBA 4PHTA 3SAJA 2HJVA 1MLDA 1F4PA 1GGKA 3PXEA 9LDTA 2AFIA 4LMPA 4B3IA 1XPRA 1JDBC 2HT1A 1SM4A 4A8JC 2VJMB 2UVDA