4E03A

Structure of parf-adp form 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
206
structure length
204
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partitioning protein ParF
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 69
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e03A00
1NBME 3BS4A 2BJWA 3KB1A 2EYQA 1XEFA 3CF2A 5FBLB 4LDJA 4Q47A 2WVJA 2GEVA 3BGWA 4Q18A 3IIJA 1RFLA 3SHWA 3LBIA 5LB2A 5LD2B 2VRWA 1CULC 4GOXA 4HZIA 4QOSA 4P33A 1XD2B 4QBIA 3VKHA 2LCFA 3SYLA 4XTRA 2OM2A 1XXHA 4DLTA 1OF1A 1KHTA 1MKYA 2ZQ5A 2KE5A 3G82C 1T9HA 4C7OA 2HF8A 2ZI9A 1U9IC 3HU2A 2C9CA 2PEYA 1Q3TA 3WRYC 2WJJA 4DXAA 4Z1MA 2IYQA 1E1QD 1F48A 4JVNA 4NYJQ 4U5XA 4TYWA 1DAGA 2NTYC 1RVDA 3DOEA 3WYFA 4Q1BA 3ZVNA 2UZ3A 1E1RA 4IDHA 1XDBA 3RS4A 2A5GA 4HB3A 3MD0A 5J4LA 4CYMA 1G3MA 4Y0VA 3A4NA 1XJCA 2GBLA 2ZUCA 3AM1A 2J0QA 5GJCA 3VU9B 3CRRA 5HCNA 2GXUA 2ZEJA 3AVOA 3DM5A 2FSGA 3DMDA 4C30A 1XNJA 3AF0A 2X2EA 2AX4A 3O8CA 1QG2A 4JZKA 2REBA 1OH8A 5FPTA 1AN0A 4QGGA 1HQCA 1KI2A 2JDIA 4CIDA 4RCZA 1TUIA 4C7OB 4QJ3A 1G20E 5FBVB 3U3RA 1P62B 1OIWA 2Z43A 1GIAA 2VP4A 1CTQA 2FSFA 2QNRA 1II9A 3EARA 1KAGA 4B6EA 2CDNA 1S3SA 4NYMR 2ANCA 1CR0A 5EE5B 2OCAA 3WRXC 2DFKB 5CIWA 1XWIA 1YZLA 3A58B 3LD9A 3DEFA 3P4YA 1G7SA 4JSYA 5KSOA 3K0AA 1RKBA 2XEXA 1KK0A 5UKDA 2ZM5A 3PENA 5A5GA 2IT1A 2EYUA 2F9LA 3LX8A 3L0IB 1KO7A 1QHHB 3OIYA 2QP9X 2B7CA 4NL4H 4MUAA 2J41A 3TMKA 2FMXA 3TJZA 1W47A 3B1ZA 1LS1A 3ZJYA 1W44A 1NVVR 4KYUA 1SKYE 1E2IA 5E4FA 1W46A 3IILA 5BYJA 2WBLC 4AYWA 2H5EA 3SC3A 1SXJA 2ZETA 1U8ZA 4LY6A 2RGNC 3MMPA 1G8HA 1VYUA 3LBNA 4MGKR 3IPXA 2NQ2C 3RAPR 2WOOA 2C9OA 3PUWA 3IIMA 3ZIAA 1SGWA 3QXHA 3BRWD 4Q48A 3D6TB 4FMBB 5H70A 4C0JA 3LO5A 2ZSAA 1N5KA 2WWIA 3Q8XB 4Z8XA 5GJWC 4V03A 2HT6A 5CDFE 4D0LB 1YRBA 3THWA 1NMZA 4BLSA 1P9WA 3AEZA 2CLDX 2ZVPX 4M1OA 2HF9A 2XXAB 3B1WA 3IBYA 1IN7A 4Q21A 3U6BA 1QBKC 5HCIA 2BKUA 3GLHA 1II8A 2GCOB 3EWAA 3QKSB 1TU4A 4OI1A 2QM7A 1DO0A 4BFVA 3U3KA 4N0DA 2EFDB 4MYUA 1A82A 1N0WA 2ZITA 3PR1A 2WM9B 3QG1A 1GAJA 4I81A 4IOKA 3GFPA 4X8MA 5FOSA 2EFCB 4TMTA 1TEXA 1OYWA 2NMVA 3NHBA 4Q66C 1VHLA 1EFRA 2IHYA 2AK3A 5AUOB 1RRPA 3C5HA 3BH0A 3I4LA 3FDIA 3P20A 4V0MA 3AP1A 4ASUD 2SHKA 5IK2A 2F43A 4KVGA 2O8EA 5C18A 2C78A 1J90A 1NN5A 4Z54A 5LD2C 4JLOA 1E9AA 5GVSA 4BFSA 3AVXA 1UBFA 3GLGE 5EP4A 2FFQA 4C0BA 4KITB 4TYYA 1XCMA 1I2MA 2ZSEA 3GJ6A 3TQFA 4BFWA 2KWIA 2HYDA 3QKRA 3TAHA 3W3ZB 2YOHA 1ZIPA 2FGJA 2O8DA 3LA6A 5HKKD 4M1YA 4EJSB 4BASA 4CT5A 1N6OA 3BIFA 2LWIA 1G41A 2YWEA 4NCKA 1EWRA 5TV2A 3AVUA 4WVFA 1G18A 2RGDA 2V1XA 2H1LA 3SR0A 821PA 2QQEA 1QHGA 1LV7A 4XWKA 5JI2E 1B23P 4LV6A 1NJFA 2FN4A 5F3WB 2XSZA 4E09A 4GOKA 3RWOA 2CL0X 1VCNA 1ZC4A 2GJSA 4L15A 4I1OA 5B64A 2GNOA 3FYHA 5JSZA 3ADDA 2PBRA 1P2SA 4F4IA 3U44B 1G6HA 4JYBA 1KK3A 2H16A 5LBIA 1QHSA 1ZP6A 3UANA 4YMVA 3ZVMA 3HYRA 3NWJA 5FUXA 2CVFA 4L8GA 2R8RA 4Q9LA 4OHZA 2GK7A 4DSTA 1T4GA 1G3UA 1COWD 3T1VA 4RFVA 3SHFA 5JEEA 2VHJA 3G0HA 4TSFD 5BN5A 3ADKA 4PPFA 4TQUS 3GJ3A 1NF3A 5DSZA 1W5SA 3QKUA 2D2FA 1U90A 5EE3A 3C8UA 2HCBA 2WV9A 1ZCAA 2WPDA 4Z51A 3R8CA 3J81k 1OH6A 1JBKA 1VYVA 1IXRC 3WYAA 4D82A 4LJ5A 1ONBA 4UNQA 4LZZA 2JLSA 2ANBA 3WBJA 3K9GA 1XMJA 3UIEA 2ONJA 4OI0A 4QM6A 1OFTA 2Q6TA 4MRNA 3RRMA 3OE7D 5AJZA 2IS1A 2ONKA 3LXRA 1BS1A 1P7CA 2PZEA 4IDQA 1AKYA 1G5TA 1L4YA 1WXQA 4G5QA 2G0TA 4LJ7A 3MUFA 5L3QB 1DAIA 721PA 4LX0A 1DEKA 4M0LA 3DOFA 2VHQA 3D7MA 4D80A 5IRCD 1HT1E 4B3GA 4D81A 3GQBA 4Y0AA 3GMTA 4ZPXA 4MKGA 4A2QA 2I1VB 3K9NA 4JLJA 1U98A 2ZU6A 2P6UA 4RFSA 1TADA 1S9DA 5FPYA 2BVNA 5EZ6B 1YZQA 2R44A 4O3MA 3E2IA 2BDTA 3MRSA 3DHWC 2B6HA 1VTKA 2XNSA 3K70B 1AJEA 5G40A 2FV8A 1Z0DA 4A0FA 3AVQA 1PLKA 1FX0B 2ZS8A 4G5RA 4UXJA 3QXXA 2H57A 1D9ZA 2QA5A 3CPEA 1EFHA 1Q1ZA 3TGPA 2AN9A 3GJ0A 4U02A 4MA4A 4JBWA 2YNMA 3U7HB 3CX6A 3PUYA 2H18A 2OT3B 2HJGA 4PHHA 5FBWB 4B2PA 1W0KA 4TMXA 5J5CA 4EQ6B 1NG9A 4C4PA 4Q7KA 4CEJA 1ESMA 2Q21A 4BPBA 2O8FB 4MGYR 3RS3A 3GLFA 3SN6A 3MFYA 4A0GA 2D74A 4QHTA 3W8RA 2GDJA 4DB2A 2FJUA 2GEDA 1OXXK 4DSOA 3AUYA 2PX0A 1IY2A 1HUQA 4A82A 2AWNA 3UATA 4G5OA 2DFLA 2JJ1D 4TTPA 1FQKA 2G1JA 1G17A 2AL7A 1P60A 3VFDA 1U81A 4U00A 3I92A 4A0HA 1KI6A 1N5LA 4XD7D 2ZJ5A 3SYNA 1G9XA 4IDOA 4EJSC 4B6FA 3RLFA 1XEWX 2ZRHA 3VR6A 1G6OA 3GLIE 1ZUHA 1VIYA 1VHTA 1VECA 3T5GA 1RYHA 1GKYA 3I5YA 4YDHB 4BZPA 2WKRA 4Q4HA 4JYCA 4IOJA 4NYMQ 1MO3A 4DT1B 2LKCA 3HU3A 1E79D 2W2VA 4DLWA 3LLUA 1S1MA 4HI0E 3WP0A 2EFEB 2GETA 4HLUA 3ZVRA 1LF0A 1F6BA 2L0XA 4DLXA 5B30A 5JCZA 4MITA 4NPHA 2OAP1 2W6JD 1NBMA 2QGNA 1ZINA 3SQXA 1G3QA 1PLJA 1XEXB 2F6RA 3UK6A 3QXSA 2O5VA 5TARA 3EPKA 2JJ2A 1S4QA 5EP1A 2WZQA 1H8ED 1NVVQ 1OW3B 4IOLA 3S1AA 3OAAD 3HDTA 1RE0A 5FL7A 5TDHA 2CNWA 1WB9A 2ZYVX 4FD2A 2EFHB 2MSCB 5TXGA 3CR7A 4FMCB 2QTHA 4HZUA 4PHFA 1G3RA 2XOKA 4M9QA 2W83A 3T5DA 3V00A 1NL3A 4BRWA 3B2EA 3VHXA 1VG8A 3QE0A 4L5BA 4W7SA 4DLYA 4DC9A 2O52A 1JR6A 4ITRC 2VL7A 4HAYA 4EIWA 2CLCX 2PJZA 5C1BA 4GL2A 3I62A 1P73A 2DPXA 2GESA 3EASA 4DBLC 4HLQB 4LSGA 4PX9A 5LDDC 1CR4A 1IAQA 2NIPA 1IN4A 4URUR 3Q7PA 1YU9A 3C7KA 1KZGB 3W34A 4PZLA 1R0WA 2J46A 1M1YE 1QHXA 2P5SA 2WIBA 4FIDA 3R9IA 3TIFA 5B57C 4CEIB 1HEIA 2WJVA 4YC7A 4XIGS 1HE1C 4TLBA 1G4UR 2X8AA 4FWTA 1RZ3A 2FG5A 1UKZA 1XBTA 4ZIRB 2BMJA 4G5SA 4PHGA 2OBLA 1NIJA 1NN3A 2IHBA 4P4SB 4D25A 2CE7A 4DCTA 1JPNA 3OF5A 2G3YA 1ZM3A 2DHRA 2O0KA 3FKSD 3THYB 4GT1A 1VMAA 3FWYA 3TRFA 3K0FA 2Q9CA 3HWSA 3K8YA 3DPUA 5KDLA 1IONA 4BLTA 4DDVA 3A1TA 4XH9B 1PVOA 2QAGB 2JIZD 4HAWA 1AIPA 3TQCA 1MABA 1U8YA 4TTRA 2WWXA 2WHXA 4Q4JB 2JASA 4FMCF 3LWNA 4LHVA 1A7JA 3LW7A 4DIEA 5HZHA 4YXWA 1BMFD 1BH2A 2G1KA 3ZZTA 1ZAKA 4LRWA 3NC1C 4DLZA 2GXQA 3V4RA 4DEXA 3CX8A 1FFHA 4N0EA 4XVUA 1Z83A 2DFTA 2ORVA 3TVTA 5F2EA 4TT3D 3C5CA 4M21A 1QHYA 5BXQC 5FPHA 5E7IA 2P67A 1NVXQ 4LHXA 4M22A 3BC1A 5DHAA 1IN8A 4LC0A 1XPOA 1Z0FA 1G5PA 1Z63A 1VG9B 1M7BA 4V02A 3R9WA 2HJVA 4QJ5A 1LNZA 1JI0A 1P9RA 5CDFA 3U3OA 4DCVA 1E2QA 1E6CA 1TF7A 3AVPA 1ZUNB 3DVLA 3WNCA 2RMKA 1IJEA 1FMJA 1UM8A 3M1IA 1G4AE 2ZANA 3NEYA 4P4UA 1MABB 1X8JA 5D3MA 3SJZA 2BEJA 4CF7A 2BMFA 4LBYA 4I1UA 2ZSFA 3Q7QA 1KKLA 1MO4A 2IBMA 3KKQA 3MG9A 2LKDA 3T06B 1AQYA 4NKRA 4KAXA 4BLOA 4ARZB 2D2EA 3CH5A 3P1JA 4G0NA 3I1FA 4D0GA 1BIFA 5KSYA 4LJAA 2ZRPA 1S2MA 3LVQE 4B44A 1DTSA 3QY0A 1WDTA 2Q3MA 1QG4A 5K8UA 1YHNA 2J5XA 2XX3A 3KQNA 2ZI3A 4FINA 1U0LA 4LJ9A 3QG5A 4OHYA 1AGRA 2HXSA 3AH8A 2IWRA 3EW9A 4M1TA 1DAMA 3GLGA 4DUGD 4OI4A 4URXR 2H92A 3LXXA 1GZSA 5FTMA 2P65A 4NCIA 4IW3B 1ZNXA 1G3IA 3FFAA 4KBFA 4MGZR 2OSBA 1GG2A 2VP6A 4IXNA 4LBVA 5J47A 5JBQA 4UNRA 4U7DA 1N2CE 2C9YA 1SKQA 2CEAA 2YVUA 1OXSC 4FWIB 1Z0JA 4JS0A 5CLQA 3IQWA 4MYCA 2IUTA 1N0UA 5J4YA 4WZBE 4Q02A 3FB4A 4PO1A 1NIPA 3TUZC 4QG7A 2ZI7A 2WSMA 4HLUC 1OHHD 2QT1A 2ZJ2A 4M8NE 4URVR 3AVVA 4UJ3A 3DZ8A 3GJ5A 3RDPA 1K5GA 3FMIA 1R8SA 1YZTA 2QE7A 1KDTA 1EFCA 2HDNB 5DGXA 4HLCA 4HAZA 4YLGA 1UAAA 1J2JA 1Z6GA 2MMGA 3CF6R 4B33A 4OBEA 2RKOA 2IXFA 5DI3B 4ACBA 3QXCA 2DWQA 2OBNA 2Y8EA 3CUEF 1AQUA 2RGCA 3SI7A 5EE9A 4B32A 4JT4A 4RZXA 3ZS9A 3I32A 1GUAA 3FMOB 2YINC 1FTNA 3ND9A 1M7GA 3I8XA 4LYAA 4D4JA 5IF9A 2D62A 1OLOA 5AUQA 4HAVA 2VIIA 2VF7A 2NO6A 1P6XA 4R2HA 4KLNA 4QGFA 1JAHA 221PA 4K46A 1KAOA 2JLXA 1J8MF 4LV5B 1T91A 1EXMA 4Q4LA 3VNUA 4KODA 2PLFA 2CJWB 1X1RA 3RS7A 4RKEA 1XB2A 2BEKA 2IK8A 1EG7A 1RYFA 4A8JA 3UPUA 1P2TA 2O8CB 4LWZA 4JBYA 1E9EA 3SJAA 1CU1A 2CCKA 4AC9A 3MWYW 3MGCA 1F2UB 4Q4AA 4Q9JA 2FFHA 2DB3A 1Q21A 5DNYB 1P61B 2IUSA 4CEHB 1OXUA 4ZI3A 1E94E 4RD2A 4HDOB 3KQLA 3NVAA 3O8DA 3V4FA 2CBZA 3CW2A 1F2TA 2CHGA 1W5TA 3THOA 1S3GA 2FEOA 1YKSA 4AWXA 2V4ZA 2ZXUA 1J70A 3PEUA 2ODWA 3EZ7A 1Q12A 4KFRA 1NI3A 2QPAA 4PZYA 2R6FA 4TLDA 1JB1A 1ZM9A 5GVRA 2ZAMA 2ZR9A 3NG1A 1LFDB 1UPTA 3BERA 1H65A 1GKIA 1M34E 3ZLJA 2IC5A 1Z0AA 3SOPA 3WMFA 5JI3E 3K09A 2Z5FA 2QL6A 2GVDC 3U4QB 1Z6XA 4II7A 1E3MA 1Z2CA 3PQCA 1G291 5KSPA 4AURA 1Z2AA 3VAAA 1ZM7A 2DY1A 2QMOA 3EZ9A 3RHFA 4BLQA 3KDSE 3W6PA 2JDID 1G8PA 2IYUA 3B60A 1SVSA 3E5HA 1QRAA 3TW8B 1YJ5A 3FGNA 4NCNA 5EE0A 4GFDA 4E07A 1W7AA 2DR3A 5D3QA 1W48A 1FL9A 4PC3A 3SFZA 2J7KA 3OEHD 2HUPA 3GJXC 3GJ8A 4F91B 4CRWB 3TVDA 3R9XA 2IXEA 3TBKA 4URYR 4PAMA 4PZZA 1OJLA 4HUQA 1KSJA 2YKGA 3U3MA 1ZM4A 4YQFA 3QF7A 2HLDA 2ZR0A 2A78A 2W00A 3LQRA 3IEVA 1G8GA 3C41J 2JEOA 1BYUA 1GTVA 3RRYA 5GJVC 1UKVY 5BN4A 1E2DA 1XXHB 2QROA 5KNCA 4OHVA 5AJWA 5B2ZA 2GXSA 1TU3A 3NBYC 3TUJC 3ICEA 1N25A 1W2HA 1XMVA 1R6BX 1QVRA 2V6JA 3HR7A 2WMNB 5C2JB 1J8YF 4JMPA 2REOA 1KK2A 4YMSA 2CLSA 1GRNA 4KVAA 4ZKEA 5DO9A 1ZJ6A 4A0RA 2PMDA 1JALA 1EFUA 3ZDQA 2F9MA 3X2SA 3TUIC 1SZPA 1W4RA 4B3BA 4HEJA 3OEED 1E1QA 2EW1A 3SNHA 3DMNA 4UKDA 2B92A 5EZ5A 2IYXA 4CVNA 3QEOA 3RNLA 2V3CC 2FWRA 5BYKA 4D0NA 1WMSA 3ASYA 1ZRHA 1KSHA 3O8RA 1TNDA 2YZ2A 1MH1A 1P5ZB 3P26A 1LY1A 2ATXA 4GBMA 5JWHA 2H17A 4XVQA 2W0SA 3HYTA 2RGEA 3VR3A 4QXAA 2GEUA 2XZOA 2F55A 3T61A 2UKDA 3CZQA 2WJGA 1AA9A 2QBYA 1X86B 4FCWA 2PT5A 5F98A 1ANKA 3T1QA 3AVWA 1KO8A 1MOZA 2QT0A 1C1YA 4GMXA 5K8IA 3QEJA 3TR0A 3HU1A 2X19A 4H1VA 4EPVA 2VSOA 1B0UA 3QBTA 1VDZA 3GCGA 5FUWA 1EFRD 4KSBA 4X8OA 2J1LA 2GRJA 2YOFA 2ZU0C 5FOWA 3UWKA 3EZFA 1UFQA 2IEYA 1R7RA 4WA7A 1C9KA 2XB4A 2QTFA 3I5XA 4DIDA 1KJWA 5IK2D 3B13B 1RRCA 4KFTA 4L9WA 2WWYA 2VEDA 5SZJA 2GJKA 1IM2A 1JJ7A 3BH7A 3KJHA 4M1WA 3BH6A 3RC8A 5C4GB 2WAXA 3K0AB 1JEDA 5KO2A 2E9SA 3IKJA 1TF5A 4JLKA 3NBZC 1CR2A 4IVPA 5TMPA 4O2LA 4BFUA 2VYFA 4JLDA 1PUJA 4JL5A 5SZKB 5CYOA 1NLZA 5HZKA 4TL6A 1SHZA 3UG6A 3TH5A 4DCSA 2EWVA 1O3YA 1FP6A 3DKVA 3JVUA 3K1JA 3R20A 3LQQA 2V7QA 3VR4A 1E2FA 2QMEA 3NHAA 4JLVA 1E0JA 5AWFC 1SXJB 1LVGA 5KSZA 2D7DA 1EESA 3W9YA 3AF1A 4PPGA 5FR2A 5FL3A 1UDWA 1WQ1R 3HPQA 2DWOA 3THWB 2BHRA 4MYHA 3U7EB 1CRQA 3AVTA 2GF9A 5KUTA 1SVIA 4JLAA 1N6NA 1KO5A 4A8JC 3GLHB 2BV3A 3T35A 3VNVA 1BYIA 2CMKA 1E99A 1II8B 2PMKA 2R6GA 4QM7A 5FTKA 3B82A 2RGXA 1U2RA 1Z06A 1E0SA 4DRZA 3EX7C 3TW4A 2CCJA 2WAYA 4B3DA 4WAUA 1AZTA 4LJ4A 1W36B 2BCJQ 2NG1A 4PSKA 5DE3A 4NCJA 4URZR 1KIMA 3UMFA 1OXTA 4JKYA 4RJLA 4JLMA 1JPJA 4TLEA 6Q21A 1XTJA 3TNFA 1JQJC 4IVRA 4PR0A 3LX5A 2JLWA 1HV8A 4TMWA 5CYPA 4H9GA 3GEIA 4F4JA 1VKJA 2F43B 2O8EB 3B5JA 2AK2A 3BXZA 3K70D 1R5OA 3UWOA 3RRNA 3T12A 1JR3D 2B21A 5L3RA 3KFVA 4OQNA 4ZO4A 1E98A 4ASUA 2PT7A 3CRQA 3W8NA 2VP9A 4M1SA 4BZQA 2XNDA 3K09C 4IDNA 3QKRB 3L82B 4QBHA 3W5IA 2O8DB 2NPFA 3D31A 4X8HA 4IEEA 3SDZA 1ZNYA 3BFXA 3DO6A 1XEWY 1YRAA 4KXFB 4HB0A 3VX4A 1XPUA 1E2HA 1VCOA 4P31A 4ACAA 5HKKA 1ZU4A 4B3XA 1JEEA 1T0JB 2ZRLA 1CRPA 2ZRGA 3KTAA 4NP6A 2GBLC 2RGGA 5CM9C 1AS2A 4J0QA 1OFUX 1HQYE 3CIOA 2RGBA 4RZ3A 3RSOA 2A2ZA 1OYYA 2KJQA 2ZYTX 4N3NA 2QSZA 2RHMA 4A9AA 1NJGA 5JSZB 2RB4A 2F1IA 1FZQA 3ZS8A 1ZVQA 4MKFA 4RKFA 1QHNA 2GVZC 1J99A 2OEPA 1P2UA 2AFHE 2GZDA 3IPYA 3IUYA 3LV8A 4IFBA 3QBVA 3IHLA 1L2TA 2UZIR 2V1UA 1OIVA 4OK5A 5FI1B 5JWOA 2QMHA 2GAAA 1NKSA 2F1RA 1W0KD 4QC2A 5JMTA 2QU8A 2VA8A 1DG1G 4C0QC 1W2GA 4WZ6A 2FSIA 2OXCA 1COWA 1N6LA 1XRJA 1SVLA 2FF7A 3QOFA 4L16A 2D7CA 3Q5EA 4YMWA 1T5LA 3H4MA 4IKEA 5GADl 2HCJB 3KTAB 4Q9HA 4PSVA 2IUUA 3GP8A 1GM5A 1U8AA 2WSSD 1Z5ZA 2ZI6A 3X1ZA 1VG1A 5KNDA 4B71A 2IYTA 2BBWA 5DH9A 1TF2A 4LBZA 2X77A 4KU4A 2J7PD 2VTKA 1FQJA 1P72A 3EIHA 4XTCS 4YDSA 5A0FA 2QRNA 4OL0A 4F38A 1HURA 1OB2A 1K8RA 4Q7JB 3SFVA 4A1FA 2GA8A 2GILA 3L0PA 4ZI2A 3OE7A 2IYSA 2GK6A 2FE4A 3PG5A 4A92A 1W4BA 1EFTA 5FTLA 4FMDB 1SXJC 1XTQA 3CH4B 2B8WA 3B6EA 5KU1A 1YE8A 1R0XA 4QNRA 1XX6A 1PV4A 4B48A 3QXJA 1FUKA 4IFEA 4TMVA 4TYNA 4RFSB 4D2IA 1H8HD 4DLRA 3Q5DA 1N5JA 2PCJA 2GJAA 1NMYA 4HATA 3ONWA 4A4DA 3RS2A 3RWMB 3X1YA 2ZRDA 3HJNA 5JFGA 3AKYA 3THXA 2BMEA 2YHSA 1V43A 2PCLA 4ILEA 4P4TA 4B34A 2HXYA 1Q44A 4FW9A 3H86A 5AR1A 3ZD6A 2HEIA 3KKPA 1DS6A 2VBCA 4HB4A 2R6DA 5AJXA 3OIWA 4GNKA 3ZH9B 2JGNA 3LAWA 3M0EA 1T3HA 1KOFA 2GKSA 5FOVA 4R9UC 1W36C 4W5JA 5FL7D 4Q1EA 4CEJB 3A37A 1Z6AA 5JCPA 3CRW1 2FU5C 4OI2A 1DAFA 1KY2A 2G6BA 4DSUA 3KB2A 5DN6D 2XOKD 2WIAA 3GLFB 1S0UA 2G83A 4WZAE 5CJPA 4XJXA 2BCGY 1GL7A 1YR9A 4PXAA 2Q9AA 2MSDB 3AF3A 3K0SA 121PA 4TL7A 5FPKA 1FPMA 1JXMA 1QHIA 1ZNWA 3BJIC 4W5HA 4MH0R 4BEBA 1NVWQ 1V5WA 3KQKA 3CPHA 1GP2A 2J9RA 5KOYA 1E9DA 2IXGA 4TLAA 3BD9A 3ADBA 5SZHB 3AF4A 4IDPA 3B9QA 2OCBA 3PV0A 3UMSA 4G1UC 1F60A 3ZVLA 3KJEA 2FFAA 4QJ4A 3FKQA 1QDEA 1LTQA 1P3JA 2WKQA 2P0EA 1KI6B 5FTNA 2HYIC 3U3JA 3HR8A 2JJ1A 4FN5A 5JS7A 2FSHA 3R7WA 2QENA 1LB1B 3KXLA 4OHWA 2KBEA 2WJIA 3CB4A 5JHGB 4FMDF 3ZYCA 3KFXA 4QGHA 2FZ4A 1FOEB 4O0MA 1SVOA 4Q4HB 4XD7A 4BE7B 3FE2A 4C0HA 4BFTA 1CJKC 2FPMA 2KB0A 3GJ4A 1Z08A 5JJIA 5H1YA 4NBSA 4C9BA 4EPRA 1W0JD 2WWGA 3EAQA 3CX7A 1HA3A 1AGPA 3T1OA 1E79A 3ECCA 2J0SA 1Q20A 4F92B 2CK3A 4P0TA 3SS8A 4GZLA 1UEJA 1IJFA 4FCVA 3QIAA 5HTKA 1GRRA 4BECA 1R2QA 3UG7A 4JVLA 1IBRA 4DCUA 1YR6A 1X3SA 2W6JA 2QM8A 4BLRA 4K8OA 1N3BA 2OESA 1SVMA 3QF4A 4ZDWA 3S1AB 1GWNA 3A4LA 3WHLA 1IQPA 1EK0A 3B1XA 2RAPA 1EX7A 2YWFA 4OJKA 1OV4A 3KXIA 2XTMA 3N5CA 2BC9A 5L3SA 1H8EA 1I4DD 4HZUB 5J4KA 1BKDR 1E2LA 4YXWD 5A4JA 2J0UA 1R10A 3AGPA 5JRJA 2ZRKA 2H7VA 2ECKA 3AV0B 4DB4A 2O0JA 3I73A 1S9HA 3VR5A 2FOLA 2QP4A 4EFMA 3CRVA 1TUEA 4US1R 4BFZA 1IXSB 2W6ID 3REFA 2ZRFA 4PAOA 2FDCA 4M9SA 1II0A 3Q72A 5FI0B 4LBWA 1D8TA 2XTZA 4EFNA 1CJMA 1CJTC 1CP2A 3KQHA 5DISB 2OFOA 5ANRB 2R9VA 1O87A 1T3LA 3M6AA 4OQLA 1NN0A 4DLSA 1ESNA 1CJVC 1DOAA 1P2VA 4PC2A 1N6KA 4MQBA 2XITA 1OKKA 3KL4A 4GPTA 1D2EA 2FEMA 3K0CA 4JL6A 3B7GA 421PA 2WWFA 2F1HA 2C96A 1FUUA 5L3SB 3JZMA 1EGAA 1T8UA 5FPSA 2Z83A 3QQ5A 4XWOA 1AS0A 5FTJA 4JT2A 3BWDD 4HLDA 4QGAA 1HYQA 4LHZA 3AP2A 2C98A 4JJKA 3K0FB 4V0NA 4V0OA 4KSCA 4H1UA 1US8A 3A1VA 1LS6A 3DM9B 3E1SA 2J87A 3IIKA 1WA5A 3FKSA 3KZ1E 1SVWA 3P4XA 3WMEA 5B58C 4C2UA 3LVRE 4KYIB 4NE2A 3QUSA 4KLZA 1E2NA 2ZVQX 2FA9A 3LY5A 1E9RA 1NP6A 1T0HB 3W6OA 4DDWA 4AIIA 1YZGA 2PX3A 2JIZA 1G7CA 1XJ0A 4A2PA 4MUBA 3FFBA 1S1CA 2FH5B 2FZLA 3U7FB 1N6HA 1DBSA 3GD7A 1KI9A 3SYKA 2ERYA 1IXZA 2JJ8A 1M8PA 2BM0A 3O47A 2ATVA 3RS0A 1KYIA 1JR3E 4DZZA 4O25A 1DVRA 4IHQA 4S2EA 2ZE8A 2WMOB 3WNDA 2ZREA 3CO5A 2VHUA 2FFBA 1CF4A 3PJRA 4TL8A 2QE7D 3HPRA 3AF2A 1E2PA 3EG5A 3FOZA 2BKEA 2XJ4A 3EC2A 1M6NA 4MYTA 4UNSA 4C2TA 1FTSA 1DPFA 3L8ZA 3KUDA 3NXSA 5GJBA 3GJ7A 2JLYA 1XFAA 3B78A 5D3MB 2ORIA 3Q9LA 2OUKA 4HSEA 1T3SA 3L8YA 4KJZA 3RS5A 1D2MA 5HE9A 2NO9A 1MR3F 2GZHA 2REXB 1ODFA 5JJLA 1K6MA 3N2EA 1UJ2A 1Z8FA 3VHLB 1YR8A 621PA 2ZIAA 4Q1DA 3WNBA 1KDRA 3OIVA 1CXZA 5KPJA 1Q1QA 2BBTA 2ZR7A 3TAUA 2ZI5A 3DL0A 3NEJA 4NYIR 2J59A 4QL3A 1N6IA 2WJYA 1TQ4A 5AUPB 1IHUA 3QVVA 2YWHA 2O8BA 4JBXA 2WOJA 4P32A 3SZRA 1FMLA 3KXKA 4HAUA 2O0HA 1TX4B 3PEVA 3PEYA 1W1WA 3ETLA 2AFIE 2YC4C 4XWAA 5CK5A 1NNEA 4WXPA 3A1WA 2XB2A 1U0JA 1SVKA 1IN5A 1R0YA 2BBOA 1OPXA 1QVAA 3GPLA 2AHOA 3NH9A 2P5TB 3GLGB 2QTVB 5AJVB 1GL9B 4KBGA 5E95A 1WP9A 1KMQA 4XSGA 2BIFA 4PQYA 5FUVA 1GL6A 2QQ0A 2KBFA 5EXXA 4EPTA 3I61A 4DUGA 1N6PA 5F9FA 1D9XA 2P6RA 4IXMA 5JS8A 4EUNA 1X1SA 1E9CA 1XTKA 2DFNA 5CM8B 4TYPA 2AKYA 4EDHA 5FOUA 1ZUIA 3A8TA 3NBFA 1F3OA 1Z0IA 2DYKA 5G3YA 3KUCA 3K9LA 4C0SA 4KCGA 1KJYA 2JCSA 1KI1A 3CF0A 4OQXA 3NTUA 5SZIA 4TZ0A 2H8KA 2O8BB 1M7HA 1XD2A 1FW6A 1E2MA 3OFNA 4QHSA 1NVUQ 4B2IA 2B8TA 4Z1MD 5JEDA 4A2WA 1RJ9A 2Q9BA 2WKPA 1R4AA 5IT5A 1UF9A 2YYZA 1XD8A 3ZQ6A 1WF3A 3CNNA 4RCYA 3LFUA 2JLZA 1E1RD 5JRZA 4W9MC 1F5NA 2C5LA 3DKPA 2D06A 1E2GA 3I72A 4WBSA 5EE1A 3AQ4A 2MMCA 3KKMA 1DAHA 4F4CA 3B1VA 1PUIA 4TYQA 4L9SA 4I1VA 3H2YA 3TSOA 1Z3IX 4I1SA 1Z28A 3G5UA 3VU9A 2C95A 3AUXA 4IOMA 3U61B 4A8JB 2YC2C 1DARA 2AR7A 1MO5A 5M04A 5CK4A 2PZFA 2VSXA 1G16A 2VF8A 2QG6A 2DBYA 4PANA 1KGDA 4RZUA 4Q4AB 4AKEA 1AK2A 5CJ2A 1T8TA 1MO6A 1CEEA 1GNQA 2ZRAA 5EUQB 2FGKA 3CLVA 4JSTA 4UXIA 1YZNA 1AS3A 2CL6X 3NH6A 3A4MA 3CBQA 4S35A 4OQFA 1TEVA 2ZUDA 1E2JA 1RJ9B 1E0AA 4C0AC 1F2TB 2N46A 1GILA 1AKEA 2KI5A 3ZQJA 2OLJA 4OK3A 4LJ8A 5G3ZA 1P9NA 3K0CC 2W2TA 3B9PA 3X1XA 4CGZA 3AVYA 5DYGA 4K81B 3KQUA 2WWWA 1HTWA 5HE8A 4C0LA 4D4MA 2TMKA 1DAEA 2ZUBA 4F7WA 4JJZA 4BGDA 2ZE7A 4ERNA 5JJKA 3LRPA 1MRNA 2JA1A 1BO6A 5DLQC 4NZYA 3BK7A 2IYWA 4HDQB 5EQTA 3KKNA 4R7ZA 4EPWA 4R98A 3SJCA 3AGQA 3LNCA 1QHHA 1S8FA 2AD1A 2IYZA 2G77B 2OFXA 3LBHA 4RZ2A 1GNPA 3BORA 1S96A 2GHIA 4B2LA 4A15A 1XTSA 2GCPA 3GLIA 1L8QA 3U2QA 1SXJD 1U94A 2RH5A 3FTQA 1Z29A 1E0KA 3SE0A 1UKEA 3ZIAD 2ORWA 1K5DA 1HE8B 5EUMA 4HUQB 4B35A 2OXRA 1L4UA 3N2IA 4DDTA 4DLUA 4US0R 3OEHA 3AKEA 3SBEA 4M9XA 5JLJA 1OT3A 2E87A 3U7GA 2QP3A 1Q1EA 1W49A 4BEJA 2C2HA 3ND8A 2VSFA 2V55B 3B1YA 5H8WA 4E5UA 3B8HA 1RRFA 5CITA 1W4AA 1R5NA 2N1BA 4Q7LA 2EWWA 2G88A 4LJ6A 3P32A 4XSHA 2R62A 2OO7A 4WOPA 1GFIA 3AB3A 3O8BA 1G64A 2XXAA 4GOJA 2QMUA 1E4YA 5KPDA 3PIRA 1W36D 1SHKA 2GCOA 3QI2A 2GXAA 1KI8A 2GWHA 4RD1A 3QKSA 3P27A 3EPLA 4JVSB 1L7VC 2VHTA 3VMFA 1KSGA 4I99A 4A6PA 1XU4A 2FX3A 1CKEA 2V7QD 3VR1A 2QY9A 2XGJA 1YR7A 3GLIB 3CNOA 5H68A 1KK1A 4GMDA 2WTUA 2IL1A 4RD6A 2UVQA 2WJHA 3FHOA 3X1DA 2ZJBA 5FUYA 5G53C 2A9KA 4Q03A 4Q9IA 3OEEA 2ZRMA 5KHOC 1XCGB 4C0KA 1VPLA 2AKAB 1NG1A 1OIXA 2NPIA 2VP2A 2PEZA 2V6IA 4FCTA 4HAXA 3F0TA 2VP5A 3VKGA 1KTVA 1VCMA 2QBYB 2ZSBA 4PHTA 1WBBA 3E70C 1JQLB 2GJ9A 3KX2A 4KV9A 4PAQA 2EFGA 4YONB 1E96A 2R6CA 3QPWA 1GDDA 3MAAC 1UEIA 5J4VA 2RHDA 4Q9KA 2QUZA 3TR5A 3I8SA 4EJSA 1FNMA 1LW7A 5F9HA 1C4OA 4TQAA 1UDXA 3MSXA 4AYXA 2IA5A 3OESA 4JIMA 4KHZA 4LHYA 5FBQB 1ZD9A 1D2NA 3KKOA 3WY9A 5KNBA 4AY2A 4TMZA 4Q7MB 3NDPA 2XSZD 4L4UA 2ZRIA 1BOFA 3GEHA 1RRGA 4ZDKA 2QAJA 4AD8A 3RC3A 1JAIA 1DE0A 3L43A 5E7MA 2Z0MA 1N0VC 2ZE5A 3IO3A 1UADA 4GP6A 3D3QA 4OKSA 5BN3A 4LPKA 2G9NA 1E2KA 4AI6A 2YV5A 4NDZA 3RYTC 3IEUA 4PO8A 1UBEA 2XNDD 3PFIA 3DZDA 3U44A 4OHXA 4BWYA 2CE2X 2GCNA 1T6NA 4KI0A 3BB1A 4LJYA 3RRZA 2ZI4A 3WYGA 4BFYA 5JECA 4NHOA 4QBFA 2IX3A 4POAA 1JNYA 2ASEA 3CR8A 1Y3AA 4DCNA 1GKUB 4LUCA 4TN1A 3EA5A 4ABYA 3BB3A 5E3HA 2ZPTX 3F5FA 4NYIQ 3UMRA 2JLUA 4YMTA 1P75A 2WPDD 3C15C 2C04A 3U6KA 2GF0A 1G8YA 2ZRBA 4DLVA 1Z6YA 4A36A 4PSAA 4ZV4A 1KSFX 4DKXA 3ASZA 3NDBB 4GSYA 2FPKA 3WBKA 3KJIA 3L0OA 3QPVA 2OE2A 1IN6A 3EXAA 5CLLA 4QRHA 2PL3A 3C14C 1NMXA 4QBGB 2YOGA 4AK9A 1JXOA 2QGZA 4NU0A 1D6JA 4LYJA 3X1WA 2YJTD 3EPHA 4PC6A 1NN1A 5L3QA 4PC1A 3PXGA 1PJRA 1NLFA 3MLEA 2OCYC 1IOZA 2A5YB 3IO5A 1XMSA 3C16C 2VO1A 5LB4A 2D3WA 1G7RA 3PITA 1FP7A 4M4SA 1E9FA 1ZD8A 4AG5A 1DELA 2BWJA 5DHFA 4Q1FA 3A1SA 1WE2A 2IYRA 2R65A 2K5UA 2QN6A 3AP3A 4B43A 4BUJA 2F3TA 5FR1A 1YZUA 5J40A 3TSWA 4MRPA 2JLRA 2Z4SA 2ZSDA 4RD3A 1OB5A 1KNQA 3IGFA 1Z07A 1NSFA 4B74A 5DIFA 1OSNA 1ZW6A 2BM1A 1JR3A 2R2AA 4GZMA 2IS2A 2OBMA 3IDQA 2XTNA 3MWKA 1FX0A 1P4SA 2P2LA 4HB2A 4GDFA 5G41A 3VKWA 3CM0A 3H84A 1RC8A 3FMFA 1KDPA 4E22A 1Z47A 4LPSA 4EQ6A 1NRJB 4ZCMA 4TSFA 2DWPA 3REGA 2O8FA 1CLUA 3MWJA 4NONA 5EP2A 3CONA 1IY1A 1XD9A 3BB4A 3U5ZB 1GITA 1TQ2A 3GEEA 4LC1A 5AUNB 3AKCA 5FOTA 1X6VA 1OH7A 1JECA 4RD4A 1CS4C 3U60B 1AZSC 4UJ5A 1XXHE 1TMKA 3SBDA 2IYYA 4MKHA 4B3CA 2GZAA 1WCV1 2BBSA 2QEQA 2DCUA 2QPOA 2VH5R 1Y63A 2W2XA 4PO9A 4DWJA 1Z22A 2EVWX 4MRRA 4FXPA 2EU8A 3W90A 2VLIA 3V9PA 2E1RA 3L2OB 4UNNA 5AJYA 1KY3A 3NIBA 3ZZ0A 3TLXA 1G19A 1CIPA 3MCAA 4N1AA 1ZD1A 2VHCA 1E32A 2JATA 1SULA 4YMUA 4OYHA 3TKLA 2MSEB 4D4KA 4DT1A 4PTLA 1RW4A 2BOVA 1KKMA 1YQTA 1NLYA 1XTRA 2ZYWX 2V8OA 1ZMXA 1NBMD 2IYLD 2CL7X 2FNAA 5TVKA 4JKIA 1U99A 2R6AA 4NH0A 2ZTSA 4TTQA 1ZM2A 2I4IA 2JJ2D 1CR1A 4CW7A 1KO4A 2WSSA 1Q3HA 4JLNA 1KI4A 1A2KC 2EQBA 1XEXA 4TL9A 1CJUC 1I2DA 2X1VA 2Z6VA 2CNWD 2CXXA 4QFMA 4V0KA 1GOTA 2KSQA 2J7PA 3BAFA 2JAQA 4X8LA 2F3RA 1TTTA 3TK1A 1A2BA 2D4HA 2C03A 2P3SA 3CKLA 1U0HC 3D8BA 2A30A 4BZXA 1TL7C 1G1MA 3QJYA 3WMGA 3BBPA 3EPJA 1ELOA 2ZROA 3IQXA 1G7TA 3FPAA 4JLPA 4ON9A 5FBRB 2J3EA 3WHKA 4B73A 2ZJAA 2C99A 2ODEA 2ODBA 2CHQA 2ZE6A 2VQSA 3GFTA 4LOAA 3PUXA 2XZPA 4RSGA 5FFMA 3THXB 1H8HA 2CK3D 1G8FA 3NKVA 4LGMA 3T34A 5C46F 4TLCA 4QHYA 3AKDA 4LK2A 4Z8YA 1NKTA 3TE6A 2ZS9A 4PFSA 1A4RA 2W0MA 1ZBDA 4Q19A 3EZ2A 4B75A 3BE4A 5E7JA 1WRBA 1N5IA 2NO0A 4UXHA 4BQSA 2QORA 3IHWA 2N42A 2HT1A 1G21E 2QSYA 1SXJE 2W58A 4EPXA 2NZJA 2OZEA 3F8TA 2ZJ8A 4DSNA 4MGIR 4D4LA 3VR2A 1J7KA 1DAKA 5KDDA 4D26A 3H0KA 4PPNA 3MJHA 4CEIA 4RVCA 2ERXA 2OHFA 4LCBA 1Z6TA 4QNMA 4NYJR 1Q22A 3EA0A 3C4JA 1QF9A 1E9SA 4Q01A 4MRVA 3VTKA 4OJQA 4P3YA 5BW8A 1RPZA 1DO2A 2AXPA 2ODNA 4MRSA 5DN6A 1AM4D 4ZIRA 2I1QA 3Q85A 1OE0A 4R71A 1GVNB 3K0EA 2AD5A 4P4SA 2CHVA 3GLHE 3THYA 3ZZUA 3Q3JB 4AKIA 3WXMA 4Q5IA 1Q1BA 4BRUA 4MDEA 1OH5A 2QAGA 1DADA 2RCNA 2V54A 1KMHA 3R7WB 4DDUA 2BJVA 1E2EA 4NMMA 4A6XA 3OAAA 5EXSA 1YZKA 2OFWA 4KFUA 4E03A 4Q4JA 3DDCA 1VG0B 2WWHA 4GRAA 3UXMA 1OKKD 2A5DA 4V0ME 4EFLA 1HH4A 3K53A 3ICQB 4HYYA 3MJRA 3EZ6A 4BLPA 2A5JA 3HP1A 4HDCA 2B7BA 1DG3A 3FHTA 4AKHA 1Q57A 2A3RA 4Q1AA 3IBGA 4XOIA 2NO1A 1R0ZA 3PCRB 1TQ6A 1W0JA 4B3FX 1KI3A 5BQ5A 1HY3A 3JZAA 4AG6A 5AK0A 5L3VA 5EJEA 2Q3HA 5HPYB 2ZS7A 3K70C 1RIFA 3FVQA 4M53A 1U9IA 1NY6A 3QF4B 1A1VA 1GRQA 1OFHA 4CDGA 4JLBA 4DHEA 1HT2E 2JLQA 3CPJB 4G5GA 4HUTA 3A36A 4M1MA 1XMIA 2NO7A 1VIAA 1KMHB 4GI7A 1TQDA 2XAUA 3CWQA 1E4VA 3OIUA 2J0UB 1MT0A 4QKQA 4GP7A 2IWHA 4V0LA 4EKDA 5KDOA 3RANA 5KTYA 1SQ5A 1TPZA 3SEAA 5JWRA 4NCHA 2XZLA 3GFOA 3PVSA 2XJ9A 1X8LA 1D5CA 3CNLA 4Q1CA 3OHMA 1UKYA 2IW3A 3R8FA 4B76A 1KNXA 2ZAOA 5LPNA 3QENA 4ARZA 3ZD7A 4AKGA 1XP8A 2C8VA 3A6PC 1ZCBA 1W4CA 4RY2A 2G0NA 2IS4A 5EXTA 4PQRA 2NOAA 3LH5A 3EC1A 4URWR 1XPRA 2GAOA 2IEZA 2ZRCA 4OK6A 4ZKDA 1KJZA 3T1TA 2PJRA 1TAGA 2W6IA 1Z0KA 2IYVA 2ZJZA 2F1JA 2CVHA 3QNUA 4ESHA 5K8TA 4ZDIA 4KFSA 5TY0A 3B85A 1NY5A 2PZGA 1YVDA 3LDAA 3VX3A 3N70A 3VQTA 1SKYB 4BFXA 1BMFA 2PH1A 4JL8A 2OILA 2NGRA 2OG2A 1EWQA 1Q0UA 4G3XA 3BFVA 4WW0A 4DJTA 5ELXA 1CBUA 2GJ8A 4NTZA 5JHHB 2P6NA 4TT3A 1N6RA 2OAQ1 2OLKA 2AWOA 3PEWA 2Q3FA 1ZU5A 3CZPA 5HR5A 2FPLA 1MV5A 2NZ8A 1EX6A 3SQWA 2ZYUX 1US8B 3PUVA 2F7SA 3PUZA 2QPTA 2IS6A 4PC7A 1ZC3A 2VPPA 4XVRA 3LW8A 4PQFA 5C4MA 4MDFA 3UKDA 3L0SA 4EAQA 3H1TA 5DI3A 3MWLA 1A5TA 1XF9A 3EIQA 1UBGA 4Q00A 3BFKA 4IRUB 5DYIA 1M2OB 1WBDA 2A7QA 5FOXA 4IJMA 3FMPB 1E69A 1G5RA 2X2FA 3ADCA 2C77A 4TZ6A 5CIQA 2RGNA 4LYFA 5L8VA 5KYKA 1GSIA 5J4HA 1I4TD 1UBCA 4B47A 5CB6A 5JZVA 1KZ7B 1VCIA 2J45A 4TMKA 2ZJOA 1JJVA 4IVQA 1VYTA 4OQMA 1KDOA 4R2IA 4DEYA 3W5JA 1XZQA 3F3YA 1IY0A 3T15A 3CRMA 1NSTA 4CT4B 3M4YA 3QSYA 2CJWA 3OZXA 4RD0A 2CCGA 1XJQA 4AYTA 4F93B 5EXPA 1ZIOA 1OFIA 3SJBA 3RVBA 2QI9C 1LF5A 4FI3C 1FNNA 2AXNA 2O8CA 1ZYUA 3KJGA 3OFND 4ESVA 2IF2A 4W5WA 1F2UA 1XTIA 2HV8A 1T5IA 2Q0HA 3RSLA 3NBXX 1PZNA 2ZRNA 4CEHA 5K8LA 4KO8A 3GLFE 2BMDA 2Z4RA 2ZJYA 4IEIA 4JVMA 1XZPA 2QZ4A 2VP0A 3W6NA 2OCPA 1ETUA 2RGAA 5FH9A 2YWGA 3EIEA 5P21A 3SU8A 3JVVA 4LV8B 2A5FA 5EP3A 3LLMA 5BWMA 4ZCLA 4WIAA 2PLRA 4PPQA 1M74A 4ZCIA 1KO1A 521PA 4UNPA 3EWSA 2QRZA 3K9HA 4CZ2A 2WICA 4TQ9A 1MRSA 1OHHA 3NC0C 4WXRA 4G01B 4DVGA 3QVUA 2OV2A 4EPYA 2JLVA 4C3ZA 2ZRJA 2J0VA 4MKIA 4UQOA 4O2RA 2V9PA 2I3BA 3U4QA 5DI9A 4US2R 3QKTA 3RABA 1PLLA 4ZDJA 4D6PA 3WP1B 4M1KA 1QZXA 5CB8A 1OXVA 3FHCB 1ZNZA 3BOSA 2QAGC 1R5BA 1I4LD 3CWZA 3ZGXA 2IF0A 3I3SR 2GTPA 4LYHA 8OHMA 3A1UA 4LHWA 4LI0A 1R8QA 1GNRA 1XCPA 1X8KA 3W3AA 4M9ZA 5IDVA 5IHPA 4TWZA 2HLDD 1KI7A 5TB5A 3TSZA 4M2LA 4I4LA 1E9BA 3QPUA
chains in the Genus database with same CATH superfamily
1THGA 3Q7EA 1F4LA 3KB1A 5F77A 2Y1XA 3B12A 3WLFA 2X9GA 3SIWA 4E94A 4ZI7B 5A9RA 4U0KA 2WD8A 3DTTA 2WVJA 3EIFA 4Q18A 1FSGA 2EFJA 2RHRA 5A6SB 1EK6A 3FA2A 4G97A 3K9FC 5K4AA 1ZSVA 2Y1CA 5LD2B 2PAAA 1C0EA 2VRWA 4GOXA 4QOSA 3W79A 3ZGNA 2P35A 4DR2B 1EGMB 5DPMA 4YRBA 4YYZA 3OPYB 4XTRA 3BRQA 1ZHHA 2IBTA 1KQNA 4DLTA 1LI7A 1OF1A 1KHTA 4TKUA 3U0BA 2KE5A 4E2FA 1T9HA 5MN4A 3WYNA 3OZFA 4QQRA 4BE4A 4PPYA 1FNDA 1EGVB 2EX1A 4NNJA 3ZIUA 2XAAA 4LF4B 4LVCA 2AFHB 2PEYA 4PONA 4MPRA 3GPBA 2CHUA 4JVNA 4MW0A 4UTZA 3VMMA 4CI0B 4QOGA 3CVWA 3IP7A 1E5LA 4NJOA 3UJHA 4P83A 2A3NA 2WF5A 3BCUA 4LNUB 5JTUA 3O8OA 4RM2A 1RBMA 3SM9A 4IDHA 3AR3A 2HNBA 4HB3A 3TX2A 4P4GA 1G3MA 1I6KA 1O0SA 2ZUCA 3A4NA 4Y0VA 2R7KA 3M6UA 4MVJH 1RYNA 3IUBA 2X86A 3VPXA 1PVDA 5TIIA 4ZOLB 1P8JA 1ENYA 2FCRA 3RW9A 1QIIA 3AVOA 1SCDA 2A9OA 3HFSA 4KNWA 5IAEA 4CR7A 1K8ZB 3QU9A 3TZLA 5EHGA 3KAQA 3UV7A 5HWSA 5BV1A 1AO0A 3TJRA 2DWCA 2XQFA 1B1CA 1F8GA 1OWPA 1CQJB 1JLKA 1P5FA 1XA0A 3RYFA 3RG2A 2PUGA 1I3OA 2OO5A 1O2DA 4GMHA 1AN0A 1G2PA 1YXMA 3NHSA 1EK1A 5KI6A 4J75A 5K09A 2Q5IA 3E8MA 4LRQA 4NCXA 1Z68A 4RCZA 4RH3A 3AEKA 3ZI0A 2H2FA 4CIDA 5BSEA 4RD4A 3O7WA 2HBRA 3BYZA 3V1NA 3HJTA 1EJ6A 5I51A 3T4XA 2EJVA 1P62B 2X9QA 1VI5A 2B5WA 1L5QA 1GIAA 2A57A 4H3HB 3EIUA 3L7OA 4RY9A 3OTGA 1NC1A 2QNRA 1IZ7A 4DM7A 1II9A 3GZ4A 2BTOA 1DWUA 4HCJA 4NYMR 2FWBA 4IUBS 1CR0A 5BP7A 4E51A 4DR7B 3ENZA 3IVXA 1NYQA 2OCAA 3N86A 4IHJF 4Z7QB 4AMBA 2FLVA 1YZLA 3M2TA 4JNKA 1G8KA 2P69A 5F51A 1JIKA 2DHDA 5JH7F 3LKVA 5IANA 1FIUA 1RKBA 2XEXA 5K6TA 4TRJA 5HQJA 4O4JA 3PENA 2EYUA 5JSUA 3LX8A 3LQ4A 4RJJA 3OIYA 1QZZA 2QP9X 2A0UA 3U49A 1KA9H 1KF0A 4NL4H 2PVSA 4MUAA 2VPXA 1Z4LA 1JG4A 4CIWA 2P1RA 3L1IA 4TSRA 3FIJA 4LCEA 3TMKA 3AW8A 1Z0SA 3QLUC 3ER6A 2QSJA 3JZDA 4NZ9A 3ZJYA 2DLCX 1SWVA 2HMYB 2VH1A 3VSAA 2YV4A 3CJQA 1XALA 5DLEA 1EK5A 1PK9A 3AERA 5D5PA 4IO1A 2CFOA 1MJHA 3LPCA 5E4FA 4BAUA 4L07A 3DOIA 2LDXA 1DAOA 4LY6A 3MMPA 1NUAA 4HL6A 4U7WA 5E6RB 4EDFA 4MGKR 4UHBA 3RAPR 5I9NA 1XXLA 4L5IA 4DSAA 1AQLA 2EBWA 3IIMA 1SGWA 1KJ8A 1V3UA 3O8QA 4PRLA 4Z4HA 2ZUVA 3AKZA 1CZNA 3V2IA 1EDOA 4C0JA 2MJLA 1E5TA 2E55A 3HKCB 4AICA 3OQ6A 1N5KA 3LT1A 4L72A 4ENPA 2GZ1A 2HT6A 1PHPA 1NMZA 4OLHA 3R5HA 1P9WA 2E4VA 1QG0A 2C00A 2QZPA 4X41A 1WULS 2HF9A 4IGEA 2H8GA 3OKCA 2CFRA 3B1WA 2XXAB 8ADHA 1KE2A 1II8A 1PG2A 3P9CA 1WIWA 1TAQA 3EWAA 4O4JB 5CCXA 4DR1B 3NHYA 2HPHA 3H04A 1DO0A 1PZMA 1SQSA 4FHEA 4XB2A 4E1AA 4E5NA 2ZITA 4WX2B 4IOKA 1RPAA 1GAJA 4I81A 4AX8A 4GIBA 3PXBA 4YGXB 5FOSA 2R84A 1TEZA 4IJ5A 3RIEA 1RJWA 3NHBA 1BROA 5AUOB 3NALA 1QUEA 2AK3A 1QFXA 3DFKA 1J06A 1MVLA 3MWFA 4HX9A 4A5SA 5KOJA 5LJLA 3H6KA 1HSOA 3FNBA 4EHDA 5CEFA 3BH0A 3KZMA 3ITNA 3I4LA 3FDIA 2RJNA 1PCXA 3Q7IA 4W9RA 3ZDXB 1K4YA 5IK2A 4ASUD 1H2AS 1P1IA 1KQPA 2VRCD 4PG7A 4KREA 1TGVA 2O8EA 1J1IA 3DJFA 3D7SA 5C18A 2C78A 3DFUA 4GQIA 1YRYE 3O8QB 1NN5A 4Z54A 1YS6A 3HEMA 3OIGA 2WVGA 2W2LD 3HBJA 5J9FA 5THXA 3VH3A 2OR3A 2BAGA 3AVXA 3RRFA 1F9EA 3GLGE 1U4NA 4TYYA 4YR7A 2R751 2AR9A 5IYZA 1BXGA 4E13A 3TQFA 4BFWA 2O3SA 2HYDA 3W3ZB 5KOHB 1R0SA 6CHYA 4HYTA 1Z74A 2FK7A 4YHHB 2ECFA 1EQ2A 4BASA 2VJYA 3OT5A 1UBMS 2CNNA 1L0BA 5E1BA 4RV4A 3BJZA 4I2NA 5KYNA 2LWIA 4K1XA 1NXXA 1X1EA 2AJDA 1IBSA 1DBRA 2GPTA 2HPAA 2PGDA 2W2OA 4I5DA 4JJFA 3KYBA 3EJ6A 4NCKA 5TV2A 1GQQA 2RGDA 3RF7A 5IX8A 1B41A 3I9FA 5EI5A 2QQEA 4A2CA 1LV7A 5JI2E 1CJBA 1QUFA 4S1PA 4YMIA 4G5HA 3AHCA 2G9UA 1NJFA 4KQWA 4O4HB 2ZJ7A 4E09A 3OKAA 3E58A 2NSLA 1VCNA 1ZC4A 5TGZA 4ARVA 4NBVA 3FYHA 1NBHA 4XEUA 2PBRA 4E5SA 4LDRA 1ETHA 4F4IA 3U44B 1XAHA 4HN4B 2A4MA 5K6RA 2N75A 4JYBA 2V7BA 4AJ4A 1K8YB 5LBIA 4EY6A 1PQ4A 1K88A 2YJ3A 4YMVA 3ZVMA 1FJGB 4GX5A 3A26A 3O94A 1XVUA 2OHOA 2FPXA 2PT9A 1BXGB 4DSTA 2GK7A 1PT5A 1NM5C 2M32A 3DE0X 4H08A 4AZ3A 4PX5A 1JEYA 4KAJA 1WX1A 4RHYA 4Q6BA 2VHJA 1P1RA 4MAAA 1GPNA 1Z38A 5LP1A 2I9PA 2Z5LA 4MV1A 5H4GA 1C3OA 1NF3A 4HRXA 4UCXA 3QKUA 4BC0A 3EFOB 1ZMBA 4ILKA 5J58A 1R9GA 4YJGA 1TM2A 3ERCA 1M2EA 1EBUA 3SPXA 4G67A 4Z51A 5BNTA 1BEEA 3PI7A 4C4OA 1C1XA 5CGZA 1QE5A 1VYVA 1IU9A 3G13A 3V8NA 1ONBA 4UNQA 2XCQA 4IV5A 2JLSA 1XZLA 3R6DA 4P80A 1J56A 1JT2A 4H60A 5B7PA 4KO1S 1DUSA 3CGGA 4MS3B 1EVKA 1OFTA 2LTAA 2ONJA 4PN7A 1L9KA 3V1TC 5AJZA 4YS6A 5E6SB 4C5AA 2IS1A 1FZTA 4WTOA 2ONKA 4MVYA 5JY1A 1P7CA 1G5TA 3WFZA 5KC9A 4M99A 1V4BA 2D0IA 3S8YA 5DGIA 1NR7A 2W2MA 3OT1A 1DEKA 3L49A 1M66A 3DOFA 4HXGA 4LX0A 4NU6A 1IBKB 1HT1E 4B3GA 5ARDA 1F12A 4U7PB 1I5EA 1S8OA 1RI5A 4IXTA 4A2QA 1CQWA 1T8SA 4PGHA 2R8BA 1TADA 1DEHA 1T8YA 2Z1MA 4FFOA 3I23A 3E9RA 2R44A 2ZUFA 1NOJA 1Q7BA 2FK8A 2FFRA 5JPIA 3T9FA 1JB9A 1F38A 1JA9A 4JT9A 3HYSA 3LUGA 1A0OA 2B6HA 2FSVC 4JJAA 4IDGA 5FKJA 4YXFA 5FLYA 2FV8A 1Z0DA 4RA6B 3U26A 1YDFA 1LV8A 2FZVA 1GAEO 4GOMD 1E1CA 2QF7A 1PLKA 4JUBA 4A26A 4CMKA 2J9FA 2H57A 1TFUA 3D3NA 4CKXA 4UPEA 2Q28A 1EFHA 4JCOA 1Q1ZA 3DZFA 3Q3GE 3AJ9A 1ZK3A 1SUPA 3RGWS 1E5XA 1FFWA 2BFFA 2H1WA 3DO8A 4ROTA 4GYWA 5J5CA 1FY2A 2PO5A 3X2EA 2QYHA 4EQ6B 1A8IA 3MWDB 1OTHA 3NHKA 2Q21A 5T4HA 2WQ6A 1P7VA 4C6TB 4R9SA 2NU9A 3GLFA 2VPYA 1U0BB 1PQUA 2I71A 1SVUA 2H2GA 3ZDFA 5CT4A 5C7OO 1Z18A 3U9TA 3R0ZA 2XQGA 3PFHA 4RAOA 1WCIA 3ZD9A 3DZGA 1K3TA 1ZEMA 2CFCA 1X39A 1FFXA 2PX0A 3AUYA 4BX8A 4UM9B 4ZEMA 2XMPA 4WBXC 3VNSA 1KZ1A 1U8CB 3PQ7A 2H7CA 2LPMA 1TCUA 1GLVA 4LJSA 1FQKA 5ALJA 1RYMA 3I0NA 4GL4A 4LVNA 3RCBA 2JH8A 3JQEA 1P60A 4QYIA 4W6QA 2D5BA 1N5LA 1RZVA 3T1YB 5T4EA 2VJCA 1PJTA 4EJSC 5MN6A 2J9FB 1Y7IA 3ZV3A 5IT9A 1B8OA 3MT8A 3L9XA 1VECA 1OAOA 2X6RA 2PSSA 3F7TA 1WZCA 1NLMA 1OAAA 3O93A 3R41A 4UZEA 5KZMB 4JYCA 3C7TA 2XYPA 3FDZA 4NYMQ 1MO3A 2Y93A 1V8ZA 2J3DA 3ROFA 4J0EA 2W2VA 5F12A 3MCZA 2ZAGA 2W2KB 1NLUA 2VK1A 2ID8A 2GETA 2FVYA 4HLUA 4E32A 4Q15A 4QJIA 3ZLJA 4BV9A 1V25A 3UWSA 4IIEA 5B30A 5JCZA 3BHMA 1WCIB 2B8EA 2W6JD 1SQGA 1DDIA 1NBMA 3BWYA 1SU7A 3HLKA 1DOHA 3ORYA 4YP9A 4EY8A 2QGNA 2LZ0A 1ZINA 5A0VA 1IG0A 1WPGA 4FMPA 1MG5A 4PYLA 2HMUA 4Y9SA 1ORWA 1PLJA 2F6RA 4KB5A 3UK6A 4WEOA 4CM8B 2ZXEA 3M33A 2JJ2A 3HFJA 3F9CA 3CJTA 3HJHA 5IBRA 4F8JA 4JOSA 4LG1A 1R8YA 1H8ED 2VNAA 3VI3B 4E11A 4FB5A 5HJEA 4B3SB 1UMBA 4FFBA 4MUGA 1UC8A 1JX6A 4D9NA 5KYXA 3HDTA 1KZHA 4OJTA 5TDHA 2CNWA 3UWDA 3EVFA 1E1MA 2ZYVX 1M0SA 3E7WA 3G2IA 1U9JA 1DL5A 1ZI8A 3AJAA 4KGVA 4LK3A 4Z86A 5FA8A 4FMCB 2CSXA 2QTHA 1YACA 1G3RA 1Y98A 1YZFA 1PV1A 3EXHA 1A9ZA 2W83A 4K6HA 5HFNA 3V00A 3K1AB 4CM9D 5CJJA 1QORA 2E37A 2BKXA 3B2EA 3ONVA 1GZHB 4M86A 5IZ4A 5CNIA 3VHXA 1VG8A 2OTCA 3QE0A 1YB1A 2V5AA 4D9GA 1Z88A 3D54D 4CF3A 5JARA 4HAYA 4DMCA 2LUOA 2NU7A 1C0KA 4A8HA 1VB3A 2GFQA 1YVPA 1O5IA 2QRMA 2DPXA 1NW9B 2GESA 4IDCA 3TXXA 1N7JA 3GY0A 4P81A 4BJ6A 4BNJA 3EASA 4RZIA 4DBLC 3I9LA 4EMTA 2DERA 4W5QA 3O21A 3F6BX 1K6XA 2C7BA 3ZGOA 3JR3A 3DE5X 1IAQA 4YK7A 3VYVA 3ZXXA 1CVIA 2NIPA 2F9FA 1NP3A 5CCEA 1EUZA 1L7NA 1CNEA 2BONA 4K03A 4ZYUA 4S1NA 2CWDA 4AXXA 4TS4A 1Z4KA 5DCUA 4UBJA 1R0WA 1QHXA 1VJDA 4CEIB 1Z6ZA 2YVQA 3MS7A 1ADBA 2WJVA 2X14A 1EJ0A 2AEMA 2R66A 1TOAA 4XIGS 4F6CA 1HE1C 2QLNA 3ZXUB 3WNQA 4LOKA 1NURA 4MUXA 2AV6A 4DDMA 3E22B 1L4BA 3A6GA 5DFAA 4ZIRB 5B4TA 1NJSA 2BMJA 1YBAA 2C29D 2ZBVA 3F6SA 3RVMA 1QP0A 2M6LA 4D25A 1ONPA 3UAXA 2CE7A 1MHTA 4C4RA 4LF9B 4HWGA 3T95A 4QTXA 1GAWA 4LQCA 3BDVA 2O23A 1RXYA 1VLMA 2WZBA 3UUWA 4H6WA 1T3ZA 3DPUA 1BMQA 1VRWA 4ZWNA 4MZXA 2UAGA 2Z9DA 4ZARA 4XH9B 2IHJA 2QAGB 2QRUA 5LKAA 2IPXA 1C8KA 3U5ZB 2ARKA 1NW8A 4BC1A 2FXIA 1U8YA 5JMPA 1N36B 4D0RA 4DR5B 3NJ8A 4E5VA 5EA2A 1RADA 3GGJA 5BSFA 3M4JA 2JASA 5G4KA 3LWNA 3OZEA 1A7JA 2FW1A 3OE1A 4BLVA 4ZJYA 4TTAA 2WW8A 3UXHA 5JVDB 4BZZA 3NFYA 3OLQA 2HD4A 3ZZTA 1OX4A 4P08A 1BXRA 3BEDA 4REQB 4L1KA 1N92A 2K4MA 4Y7CA 1FFHA 1KH1A 4K1LA 3WHIA 1Z83A 2ORVA 2QI9F 1PFGA 1YRHA 2B3TA 2VWPA 3C5CA 2AHRA 1QHYA 3PR2B 5FB3A 5ISMA 4G8JA 5FPHA 4FHFA 2QW0X 5CM2Z 4BO9A 4GQBA 4Y1GA 1YS2X 1XPOA 2FPRA 3B3JA 1G8SA 3NETA 4ROSA 1T4CB 1VG9B 2DECA 1NV9A 3W4IA 4D3FA 1UP7A 2CBGA 1GSOA 1GZDA 2C07A 1LZLA 3U3OA 1X7HA 1EHCA 2PT6A 5BSWA 2X0RA 3AVPA 1UM9A 1YZHA 1IJEA 1SK8A 1QZ3A 3UUGA 5FWNA 1SD2A 2ZANA 2YNMC 3ORHA 4G1MB 1TAUA 3KUXA 4WFQA 4GPZA 5E0OA 5EHZA 5D3MA 4UHFA 2BGIA 5CURA 4CF7A 3O92A 2JFUA 4LBYA 4I1UA 3Q7QA 1KKLA 2IBMA 3KKQA 4H3VA 1PS8A 1Y1PA 5DGTA 5FI5A 4I3HA 1YS7A 5C0OE 1P7ZA 4NG4A 4ARZB 2D2EA 3CH5A 2PQMA 3EFBA 3QJGA 4F5DA 3P1JA 1EVEA 3E81A 5ADUS 5KSYA 4P4LA 3KE9A 3OKFA 2M6RA 3DZKA 1N3IA 2V6BA 4JODA 3TLKA 5E7QA 4K2HA 4OYYA 5CDSA 2AZXA 1L5WA 1WDTA 1W1UA 1TIPA 1P0PA 2D5CA 2J5XA 2XX3A 4BN5A 3PXDA 2PZKA 2ZW9A 1DXOA 1NPYA 4IF4A 3UT5A 4WXHA 1I14A 2WG0A 1U0LA 3QG5A 5JAIA 4XM1A 2WAAA 3UZUA 1KJQA 4QULA 3ZK7A 4CLEA 2OCDA 4M1TA 5H3LA 4J0CA 2VI5A 1QLJA 1K97A 4FNMA 2H92A 1GZSA 5FTMA 3LF1A 2PLWA 1HZZC 2GUGA 3FLEA 4BO6A 3CXRA 4KBFA 3IV9A 2VTBA 3ZWWA 5BT8A 2MSLA 2I7VA 1JHMA 3HSYA 4IXNA 3GH1A 2PS0A 4EVQA 4QLBA 4O2AF 4J6EA 4D4KA 2G17A 1SKQA 2NXJA 4W4TA 1OXSC 5CLQA 1ULZA 2XF8A 2PUBA 4I3GA 1PZXA 5I7RA 3IUEA 4CKEB 4E14A 1M0EA 5HGXA 1OUMA 1S2DA 1SHJA 4ITVA 1KMIY 1E4EA 3LKZA 2RAFA 2Q1YA 2WSMA 4KUGA 2QT1A 3IVGA 1BFDA 1HORA 4RL4A 3GJ5A 1UFRA 3EVNA 3TQHA 5DBIA 1K5GA 1TJ4A 4W9NC 1T8WA 4EKNB 1YZTA 1KDTA 3R7DA 2NV6A 2HDNB 3ZU6A 3F3KA 4YLGA 3T7RA 4P9NA 1UAAA 1J2JA 2Q3BA 2MMGA 2VHXA 3CF6R 1JZSA 3E2MA 4RDHA 1U1IA 1NPDA 1SXIA 2PL5A 4RGYA 1VE7A 4Y1RB 3QXCA 1D6SA 2DWQA 2R1UA 2Y8EA 4HADA 4JI5B 1QYRA 2W98A 1T4DA 1BXZA 2IFTA 5EE9A 2GBGA 5EIWA 2R1ZA 5A03A 2WIJA 1GO2A 2Q8QA 3ZS9A 2E7ZA 5LU8A 4I8XA 2HMVA 3F90A 2G4LA 5CXXA 5LN1A 3IIEA 2D62A 3W3AD 5AVJA 4Z0HO 1IB6A 3BCRA 2AW3A 2VJMB 3ICCA 2VF7A 3VZCA 4F06A 1P6XA 1A95A 4KLNA 2EWMA 2B6NA 3DP7A 4YMLA 4WCFC 5LYJF 1PWZA 2XT0A 4Q4LA 2VDRB 2PLFA 3BXXA 4OSOA 1LLFA 1AKTA 2FSPA 1QGUB 1SBYA 4DIUA 5EWLA 2J32A 3WGVA 4MKRA 3WOVA 3L46A 1EG7A 1DLJA 4A8JA 4U63A 4G63A 4CV2A 1QK3A 2CLOB 4OU5A 3GWGA 4GC9A 4IZ6A 4MVWA 2JAHA 4JBYA 2ET6A 4A91A 2FWNA 3GDHA 4HXYA 3HL4A 4JV5B 1F2UB 2DB3A 2FFHA 1AY0A 1H6CA 3B51X 1L6RA 1Q21A 5HDQA 4AJPA 1FDSA 2O7VA 4ZXFA 4DNQA 4CEHB 3HJRA 5FWAA 2C2GA 1DWPA 1RM3A 1WB5A 1JDVA 5DNDA 1WXXA 4RD2A 4HDOB 3T1NA 2O05A 3GBSA 3NVAA 3O8DA 2YMLA 1R6VA 1O57A 1F2TA 2QUKA 2ZIWB 4Y0NA 4DL9A 4NU5A 2WIDA 3THOA 1VLQA 1LPPA 3LGAA 3QPAA 7MHTA 1YKSA 2CUZA 3OH8A 3ZWAA 3H5OA 4IICA 2ZUSA 3ORQA 5AP9A 2X9VA 1N34B 3GFBA 2G40A 1NI3A 4PZYA 2D1YA 2IDZA 4TLDA 4D02A 4UTRA 1MGOA 1RM5A 2W2NA 5LZ5A 5MGNA 4KPYA 1UPTA 5FA6A 1XK6A 3BERA 1H65A 2AMYA 5CTJA 3H1AA 3ODPA 1AKQA 1LX7A 1Z0AA 2F3SA 4L5YA 5AHKA 3T8YA 3WMFA 1UPUA 1JWLA 1H4QA 3FR8A 3K09A 2UVPA 4WH0A 3VOBA 1Z6XA 4MNTA 3VUFA 3ZJUA 3T9CA 6LDHA 2C5EA 2H2DA 3VAAA 5KTKA 1Y9JA 3HRHA 4UHKA 4BLQA 1D5WA 4J1NA 3P2JA 1ZN2A 4U8GA 4UQPA 5E2AA 3ZCTA 1E6WA 1NFFA 1SVSA 4XX0A 4LE0A 4FS8A 1KPIA 4OKNA 5CFZA 3V8VA 2PFKA 5BRNA 2ZSHA 1W48A 4QOEA 3QOWA 2J7KA 1N8KA 2M6SA 5GAJA 3GJ8A 4PVDA 3SXPA 2JGAA 4BPRA 4CRWB 4F91B 5I9IA 2IXEA 2PNJA 3TBKA 5LIRA 3D0KA 4H15A 3IAHA 4PAMA 3T5MA 1GR1A 1V9LA 5DYWA 3A7EA 3DE2X 3S27A 2YKGA 4ZOQI 5JLAA 3QUAA 4ER5A 4YQFA 2DY0A 3ET5A 1JU4A 3MS4A 3DMYA 1T2VA 4ZAXA 4I08A 4FU0A 1VB5A 5JSYA 3V48A 4BVLA 3DVSX 2ZAIA 4QOHA 2JEOA 4Y2UA 4E31A 1GTVA 4KYTA 5GJVC 1NMEA 3WL5A 1XXHB 2Q8PA 1F8XA 4YVFA 4LW8A 5IC6A 5KNCA 1F20A 3TUJC 3H8SA 2NUBA 1ODIA 1K2VN 2WSYB 3F74A 1W2HA 1QMPA 1R6BX 2B34A 2E4AA 2PZJA 2V6JA 3GA0A 3K8OE 4KI7A 4OIFA 3KP1A 1VXRA 1RKUA 1RAAA 4JMPA 2XUGA 3OLXA 4YN3A 3UJ9A 1ACJA 1QAOA 4I4TB 2AN3A 4YMSA 5HKOA 5DO9A 5G0VA 4A0RA 4AWBA 4F6RA 5IT0A 1EFUA 3DLTA 4C05A 3SE7A 4KH1A 4ZT3A 4EABA 3FSEA 2Q1XA 4EF4A 5IAJA 1W4RA 1N0IA 2Q4DA 4XX0B 4B3BA 3CEPB 2PJRA 4B4WA 1KYZA 3OEED 1QCCA 4KQIA 3QPUA 3TTUA 1E1QA 2EW1A 3SNHA 4BP8A 2ZZMA 1SU4A 3DMNA 3QV1A 2IZZA 1DT3A 9LDBA 1XC7A 4JJEA 5AYVA 1WKBA 4FNGA 1ZEJA 5EZ5A 2IYXA 4ZVKA 4CVNA 5T67A 4J94A 5KJEA 3SVLA 3R7LA 2BW0A 3QEOA 4GX0A 4LXHA 3WFIA 1WUJS 1T24A 2YXLA 1EXDA 3FRJA 3MTJA 1T5TA 3BT7A 4IIJF 4TZKA 2I5PO 1P7WA 1C7ZA 1OYOA 3VVCA 4MVXA 3GPIA 3SZMA 4MWGA 1MH1A 3P26A 4XXHA 4E5KA 2H17A 4XVQA 3TZ6A 3Q9NA 5AOVA 4W1RA 1KEPA 3LQYA 2GEUA 2XZOA 4GE3A 4M87A 3PRYA 10MHA 2PUDA 1VHWA 3BQNB 3BL5A 1LDYA 4FCWA 2PT5A 1U0GA 4ZT2A 3OF3A 5CVVA 4FDAA 4NV3A 1GPMA 3LCVB 3TOVA 4B5KA 1JLMA 5MF6A 1C1YA 4GMXA 3QEJA 1JKJB 1MB9A 4O08A 3STUA 3HU1A 2OGTA 2EZ4A 4FGJA 6AT1A 1GRVA 1X42A 1J9GA 5I5GA 4AL4A 3DVAA 4KIWA 3CE6A 2XCTB 2ZSIA 3VXKA 5KYWA 1MF7A 3NYRA 2J1LA 2GRJA 2ZU0C 3BGVA 5FOWA 4IHAA 3D02A 1GQSA 3PHLA 3UWKA 2IEYA 5J5AA 4K6KA 3WL7A 3ZXSA 4EGCB 3UJDA 4FOOA 1GGMA 1WPRA 5KS2A 3HJCA 5IK2D 3BHJA 4ZVMA 4L9WA 5JYCA 2I4LA 2E4YA 3BH7A 3KJHA 1DXHA 4M1WA 1XAIA 1P45A 4ND8B 4FUQA 2O06A 4F84A 3SY8A 3LP6A 2GI4A 3TB6A 5CBPA 5KO2A 3TRKA 2XE4A 4L8LA 2E9SA 5FBKA 5FWXA 1B23P 2P8SA 1P4AA 3VJMA 1P5JA 1CR2A 1RT9A 3NBZC 2FPIB 4TKZA 5ITZB 3ZJTA 4ZZ2A 1W85A 2Q2QA 4JL5A 3V8QA 5CYOA 2Z09A 1NLZA 3G79A 1SKBA 3SDSA 3HS3A 3AL2A 2FQXA 4TL6A 1KVRA 2FFJA 4EA9A 1QRSA 4WE3A 3DKVA 3GFGA 3T9BA 3K1JA 4WKNA 2IZ7A 2V7QA 3KT3A 4BAGA 4PYNA 1E2FA 1W87A 2G76A 3NHAA 4EW3A 4ZQEA 4HDKA 1YJBA 5TSDA 3R75A 3FPKA 3LCMA 3TD9A 3AF1A 3W4JA 4IJQA 4EA7A 2H7XA 4M8KA 2XMGA 4YMGA 2PYZA 3GRZA 2OAGA 3MJFA 3JWGA 4MYSA 1WQ1R 2Q99A 4IKOA 1IQUA 2BHRA 4HGZA 4QX6A 3RRXA 1B7GO 1CRQA 1TK9A 1W5FA 3GNSA 5I9SA 4EARA 2GF9A 1GEEA 2WF8A 3WQBA 5KUTA 1T1GA 4TVOA 1V9CA 5TMEA 2C2WA 1KO5A 3JQAA 2FDRA 3GLHB 3T35A 1BYIA 1W94A 3GVPA 2R6GA 3DKKA 1O7JA 2BM9A 2FX5A 4ND3A 4ARSA 1GFWA 4MMXB 5C51B 1WHSA 4MS4A 2PU5A 2QE6A 3TW4A 3D6VA 1NQTA 1C0IA 2CCJA 2WAYA 4WAUA 4BKQA 3QU2A 4ESOA 3FWPA 1W36B 4O8CA 1FTGA 2DTDA 1PBTA 1ESEA 3DTNA 3FJ1A 3PC4A 1A8QA 3VNAA 5JMWA 2JARA 2Q4OA 4RJLA 3I1IA 3R74A 4KR6A 4GPBA 1JPJA 4TLEA 2P2GA 1NAHA 3TNFA 2Z30A 4IVRA 2HIMA 3H9BA 3LX5A 4N41A 2OB1A 3LUHA 1X14A 1PKEA 4WXEA 5ICGA 5HGJA 4DR3B 2JLWA 1NJ5A 1NRWA 3FYCA 3LCJA 4HDKB 4IH4A 3VV2A 4F4JA 2FQWA 5KJCA 3H4VA 3ZDCA 3OE5A 1XTVA 2Q2OA 5HBRA 1R5OA 3UWOA 3M6XA 2Q4RA 3DV9A 2JFFA 3I34X 1JR3D 3NT2A 1PZEA 2B21A 3OMWA 4IV8A 4JJ7A 4PCAA 4CODB 1TYEB 3A4TA 5F3RA 3DVRX 3RADC 3W7VA 3EZYA 5LOVF 4FS3A 2R2GA 3HV0A 1HKHA 4M1SA 2XNDA 2PL1A 2YICA 3BIOA 2BEUA 4TXJA 2HJRA 2WAOA 3QKRB 1DJOA 2GVNA 3GO4A 3L82B 5AVRA 1CRZA 5LXTF 5KWVA 2YFQA 3JQAB 2O8DB 2NPFA 2O3JA 3BXPA 3C70A 3PGMA 4MULA 3I39X 4X8HA 1ZNYA 3BFXA 1EZZA 1EZ4A 2HJHA 3EXG2 3TCNA 1Z5PA 4FE3A 4ABTA 1JF8A 4P36A 1WHSB 3PL5A 1XPUA 1E2HA 1C8BA 5E6UA 2ZIZA 1J21A 4WDRA 1KZ9A 3I4CA 4HWKA 5IT4A 1GT91 4IUCS 3IJ5A 4F2HA 5BVGA 3AZPA 2OZPA 4CE6A 3KTAA 3U48A 2GBLC 4WI1A 5LWHA 1BXKA 2VXYA 2VC2B 4J0QA 2TMDA 4UM9D 3II6X 2AJ8A 3IIIA 3NIGB 5EJ6A 5JFTA 1FYXA 1JHAA 1GNTA 1ZXXA 1OYYA 4H17A 2I2BA 4UHDA 1YIDA 2O1XA 2WZCA 4AQ7A 3G59A 5JSZB 2RB4A 1TDJA 3TMYA 3ZNQA 1L7OA 4ERXA 1GZ6A 5T4FA 3FTDA 4L3VA 3WGUA 2AE1A 2AFHE 1USKA 2JAUA 3DD1A 1W73A 3IPYA 3IUYA 3KPYA 2XYVA 2M9MA 3QBVA 4OHMA 4XUCA 2AI3A 1HNWB 2UZIR 3ITEA 4WNYA 2V1UA 3HB5X 4OK5A 3AI2A 2V3WA 1L4FA 1YKGA 2CVOA 2GAAA 3IAUA 4KDCA 4X3PA 5FX2A 3VJKA 1E1DA 4KPEC 3H9GA 1BAPA 1PG5A 4NICA 3L7MA 4MMYB 3VTAA 4BX0A 5I7VA 3MGBA 2JZOA 1QAMA 1BS2A 1I8TA 1DG1G 3KV1A 1W2GA 1LDGA 2UYHA 1NASA 1L4EA 1COWA 4CWAA 4O4IA 4BO0A 5IJXA 4RHUA 1H2BA 3NP7A 1YO6A 3UMGA 3NTQA 4EENA 3KTAB 1PR6A 5EJFA 4PSVA 1NU6A 1KAEA 3H42B 2HU2A 3DXFA 3FRHA 4AKTA 1U8AA 2EF0A 3M6FA 5CFRA 1W6RA 3TZBA 3U3ZA 1DDOA 1M67A 3WA6A 2H3EA 1E61A 1H2WA 1R1DA 1WV1A 4B71A 3TZHA 1UK9A 2IYTA 5CGQB 1KEUA 5C5CA 4EI8A 3PWKA 4LBZA 1L5HB 3GELA 2VTKA 3EIHA 3EWIA 1X13A 2XCIA 4L2IB 4PAGA 1HURA 2WD7B 2WM3A 4R5HA 4FT4A 1A9SA 1VZ2A 2GILA 2CKDA 4D8YA 5EJ8A 1J2UA 3IP6A 1ONNA 2PQ2A 2PIAA 4PYQA 4QUDA 2OENG 3PX3A 3EUAA 3SX0A 4FMDB 1SXJC 4EGSA 4J4HA 1J22A 3B6EA 1BE8A 3CH4B 4NOJA 4YA6A 3QLTA 1SC6A 1R0XA 4B17A 5E0KB 2VWQA 2H11A 2JLAA 3IERA 1FUKA 4YCAA 5H83A 1ZMRA 3VC1A 1EM8A 1H8HD 2FUNB 3ROEA 1ZVJA 1P2BA 3G49A 1N5JA 1OD6A 2GJAA 2PCJA 4LNHA 4E5MA 4B79A 5DTMA 2QL7A 3NHJA 3NOVA 3FD8A 5CW2A 1HDZA 1ULTA 3AKYA 3E7FA 1U7WA 1CUUA 1YE3A 2A92A 2VYCA 3T3GA 4C78A 5ALGA 2GOYA 1UJCA 3KJNA 2YHSA 3WKAA 3SYRA 2PCLA 3Q5GA 2QLJA 1NW7A 2HXYA 1SEVA 1Q44A 3M5WA 2XWQA 4JQCA 4MOWA 4Y1EA 5AR1A 3STTA 1XZHA 2C20A 3KS9A 3PPXA 5DW0A 2UUBB 1E3IA 4O2BA 3L4SO 1GCGA 2Q5LA 1U0FA 1K4MA 3PDCA 4NZNA 4GM0A 4DBVO 3ZQ4A 1KOFA 3V8EA 2OZVA 5FOVA 2XUDA 1Q0ZA 3M3HA 1LSSA 4XYBA 1V41E 2B9EA 3A37A 1Z6AA 4P3XA 3CRW1 5KAMA 2WNIA 1F2VA 3AU8A 4M7PA 3E8XA 1U7ZA 1DAFA 1X1CA 2G6BA 4DSUA 3KB2A 4C29A 5CJPA 1B6RA 5K0LA 2BCGY 3KSRA 3BMQA 3BL6A 1OILA 3BKWA 4TL7A 2BFWA 4PG4A 5FPKA 5C53B 4W5HA 1AHIA 1K3UB 4JFRA 4LDAA 2EKDA 3ZHXA 1IUPA 5KOYA 1E9DA 4DR4B 4TLAA 3KKLA 4TSKA 3LYUA 1L8OA 1MAVA 5B1SA 4AJKA 2DQZA 4ZREA 3VPCA 2J5RA 4D42A 4QJ4A 2ZBQA 1VLJA 2IV2X 2ZDQA 4YECA 1LTQA 1P3JA 1QNLA 4AMVA 2XQIA 3RHZA 1D0SA 2JJ1A 1E5DA 1QBGA 2V45A 3M9WA 2C7OA 3LPNA 4RGQA 1GFZA 2DHCA 3R7WA 5L95A 4ZOCA 2KBEA 5JHGB 1HYEA 3WL8A 2C84A 4O0MA 3UUEA 1SVOA 2RIPA 4J1TA 1U3FA 4Q4HB 3FE2A 1EWYA 4K9RA 1SNYA 3VH2A 3SJUA 3GLTA 3QU4A 1CUYA 2KB0A 4G89A 5T64A 3ZV6A 4KDRA 4NJEA 1R12A 4EPRA 4ARIA 2PKQO 3KLMX 1WVGA 5ALMA 5JSKA 4YDQA 1TU0A 3E5NA 4NZOA 1BHJA 1HA3A 1VJGA 1ZQ9A 1R74A 1NRXA 1T1SA 5EVCA 4YJHA 4P0TA 3SS8A 4BGEA 2BYTA 3EHDA 5F4ZA 1UEJA 4HJXA 3JASA 1TQ8A 2YZNA 4IWYA 4BECA 3N8DA 3OCJA 1CEQA 2C4UA 5BUSA 5TRTA 2UYOA 3UG7A 3NQ41 3DAOA 2BLLA 3E1KA 2VZ9A 4WXYB 4OB8A 5E8RA 1FNCA 2VJPA 1NMSA 2XXJA 3QF4A 4YDRA 3A4LA 4NAHA 3WHLA 4RACA 1A9YA 1CUVA 3B1XA 3O4JA 2RAPA 2YUIA 5AHXA 2YWFA 1KYXA 1OV4A 4RIGA 2XTMA 2BC9A 1XLVA 4MUMA 4HZUB 4RS4A 5EJGA 2GGSA 2VJNA 5HKLA 3N6XA 3PC3A 4K0RA 1E2LA 2ZYSA 3TI9A 3UHAA 4JOBA 2ZRKA 2N3ZA 4F3KA 4LXTA 2RGYA 4IRMA 2H7VA 4AP6A 4F8EA 3WRWA 2NXNA 4MEBA 1S9HA 2D1QA 2FOLA 2QP4A 3VR5A 3W2IA 4EFMA 3I45A 1W35A 1OVMA 1UP6A 2BP7B 3SU8A 1MU0A 4YHBA 3VVLA 1AKVA 2H5IA 2B20A 2ZRFA 4PIVA 3NBUA 1NUQA 4MVJM 4MXDA 4CCSA 3MMSA 4NE9A 1P4GA 3RUFA 3ZDBA 4LBWA 1D8TA 2XTZA 5EP3A 5K0NA 4GPIB 2XNHA 3RVDA 4EFNA 3JQ7A 3W9UA 1RXWA 3D81A 2FI1A 1CJTC 1RFGE 4AT1A 4KRYA 3KQHA 1J1ZA 5CR9A 2FQYA 3NYIA 5ANRB 2R9VA 2GEJA 5AOAA 3OQ1A 1RTTA 3I64A 1IHXA 4Y8VA 3BILA 3OZ7A 3EYAA 1U2TA 3IP1A 1NGSA 3KFLA 1ESNA 5JSFA 1DOAA 1EFPB 4YJ2F 5TEVA 5A3QA 2XITA 4TVBA 1OKKA 1DRJA 2FYTA 3F6YA 3K0CA