4E03A

Structure of parf-adp form 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
206
structure length
204
Chain Sequence
b'MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQAYSRKVEARFLITRKIATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partitioning protein ParF
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 69
structure length 204
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e03A00
1AS3A 1TADA 2C9YA 4JYBA 4AI6A 1LY1A 4FMDB 4BFXA 1Z47A 1E0SA 1COWD 2WSMA 3B7GA 1Q20A 5DGXA 3SYNA 5SZIA 2ZRIA 5TV2A 1XJ0A 3DL0A 2XEXA 3DMDA 5DI3A 3LRPA 3U3JA 1FNNA 1Q57A 3VX3A 1FOEB 1NBMA 4JL5A 4A92A 4TWZA 4LPKA 2P0EA 1DG3A 1XZQA 4E03A 3A1TA 3LWNA 1ZNYA 3TKLA 2WBLC 2R6FA 3UATA 3LY5A 3NWJA 5LBIA 4OQNA 1G8FA 1W0KD 4IFEA 4EFNA 3Q7QA 2UZIR 2DWOA 3OEED 2LKCA 4TLAA 4Z54A 3M0EA 2FPLA 1TF7A 1ZM2A 1GL9B 2JJ2A 5HTKA 5B2ZA 3AVPA 1UDWA 1G8HA 3FTQA 2OSBA 3MLEA 3DPUA 4QJ3A 4DLSA 2XB4A 3NBXX 1WA5A 5FOVA 4ZIRA 1DOAA 2JIZA 1TX4B 3KDSE 3ZZTA 3D7MA 2IS2A 3GLHB 1YU9A 3B1XA 4FWIB 3LDAA 1SQ5A 4KAXA 5TDHA 3QF4A 5CLQA 1ELOA 1KI6B 2EFDB 2XZLA 2FSGA 3UWOA 2F7SA 4PC3A 1G3RA 3MMPA 3UKDA 1XWIA 4W5WA 2RHDA 4JSTA 2IWRA 1IN5A 3PUZA 3GLFA 2VHTA 2WOJA 1PV4A 5FPHA 2RGEA 1TUEA 2XITA 1A5TA 3BH6A 1P73A 4JJKA 3IPXA 3AF2A 1QHIA 3WYGA 1EESA 3IO3A 1E79D 1M8PA 4ITRC 1KY2A 3SU8A 4JBWA 2GXQA 1NG1A 2C2HA 1E99A 5DN6A 4TZ0A 2BEJA 4P4SB 3K0CC 4RD1A 2ZJYA 4YLGA 1KKLA 1I4TD 4ZCLA 5FTLA 3BFKA 2IBMA 1NVVR 3FHCB 4HLUA 1X8JA 2ZANA 2G6BA 2A9KA 1Z8FA 4UXHA 4W5HA 2JLWA 3N70A 1UKVY 3OESA 1T8TA 2IYYA 1N6PA 1XEXB 2EWWA 3QG5A 1QHNA 2DWPA 1AS2A 3AF0A 2Q3HA 3K0EA 1E0KA 1DAGA 2XTMA 4D82A 3C15C 1JQLB 1SVMA 2O0HA 1N5KA 3EZ6A 3A1VA 4JLVA 1W0JD 2C04A 3Q9LA 1E9FA 2YWGA 3A58B 3FFAA 1S4QA 3L82B 5FR1A 1J99A 3OE7D 1G1MA 4I4LA 1CS4C 5G3ZA 2PX3A 1Z0FA 1HEIA 3B1ZA 1U9IA 3M4YA 3AVUA 3W6PA 4RD6A 8OHMA 4TQ9A 2V4ZA 2ZR9A 3SFZA 2VA8A 4DCNA 4POAA 2XXAA 2AK3A 2GCOB 1OIVA 3EASA 4MGZR 4XIGS 4B73A 4QKQA 1I4DD 2CBZA 1NNEA 1DE0A 4GP7A 1KO4A 1E9RA 1N5JA 1VIYA 1RVDA 2P5TB 1ZUIA 4ACAA 1W36B 1AGPA 2WSSD 2EFHB 1N5LA 1OFTA 2FOLA 4UXIA 3REGA 3K1JA 3PEUA 4PHHA 2GVZC 3LX5A 2ZUBA 4C2TA 2GF0A 1CR4A 3E1SA 2JCSA 5E7MA 1ZNXA 5FPSA 2HYDA 4D6PA 3RWMB 1YZUA 3U2QA 3V9PA 1XTJA 2DFLA 3CZPA 1R10A 3X1ZA 1I4LD 2PZEA 4Y0VA 2R8RA 3QKUA 5B30A 3CNLA 3PR1A 1IQPA 3ZIAD 2VSOA 1G3MA 2GJ8A 5FR2A 4UJ5A 4GBMA 2RGXA 1HT1E 4EJSC 5J4VA 2WICA 2ZYVX 3A8TA 1IN7A 2QSYA 2DB3A 2JEOA 2J5XA 5EXXA 4DEXA 1IBRA 3GEIA 2VIIA 4LBZA 1R7RA 2ZJ5A 3QBTA 2KB0A 3ZQ6A 4CEHB 5CIQA 4OL0A 1G4UR 1Z07A 1KK1A 4US0R 5JBQA 5D3QA 4Z1MA 2QRZA 1DAHA 2ZSAA 3TSWA 2ZRMA 3NDPA 4GFDA 4XOIA 1XXHA 1TEXA 2ZS8A 5LD2C 2ORIA 4NYJR 3IKJA 3SHWA 3HU2A 5EP1A 3FB4A 1AK2A 3T12A 2KSQA 1US8B 1ZJ6A 4M1SA 5KHOC 4HB4A 4OQFA 2VF7A 2JAQA 4M9QA 3CPJB 4A0HA 1UPTA 5GADl 4C0HA 1J90A 3TUZC 1KMHB 4H9GA 1RFLA 1Z0KA 5JLJA 2GJ9A 1J7KA 2BJVA 5JZVA 1IN4A 1E9EA 4KVAA 1TQ4A 4KYIB 1XTSA 3EZFA 4E09A 1H65A 3I8XA 1CR2A 2X19A 3C41J 3CLVA 1CULC 4QGGA 2H16A 3BB4A 3L0OA 4C7OB 1SZPA 1Z0AA 3EXAA 1NLFA 1K6MA 1QG4A 1PLKA 1ANKA 1E2DA 3B82A 4BFWA 3LVRE 3QPUA 3TGPA 3GLGB 2OLKA 1YE8A 2ZU6A 3FMPB 3QI2A 2Z83A 6Q21A 3WBJA 2DWQA 2OEPA 2OCPA 2OO7A 2H7VA 2LCFA 1SVSA 5FL7A 2OBNA 3TW4A 3M1IA 3PUWA 4YMUA 3KKOA 5C4GB 3CR8A 1F2TB 4M1YA 4MYCA 5L3VA 4QHYA 1GDDA 1SVWA 4PC6A 4V0ME 3GP8A 1EFHA 2XSZA 3FFBA 1MO4A 2DHRA 3QEJA 2MMGA 4P4SA 4ZCMA 2ZUDA 2FFQA 1AGRA 2NQ2C 2EVWX 5IK2A 4R98A 3RS4A 2FJUA 1LV7A 2EQBA 1UBFA 2D06A 3SR0A 1E32A 4Q4JA 3UMFA 3HJNA 2VHQA 4AYXA 3CRMA 1G19A 1XEXA 1N0UA 4RD3A 4Z8XA 1A1VA 4TTPA 3H4MA 1N5IA 1ZM4A 1NJFA 3LBIA 4Q7MB 4EDHA 1XU4A 2XTNA 2B8WA 2WWXA 4HDCA 4WVFA 4QL3A 4LBVA 3VFDA 2VL7A 4RFVA 2V7QD 3DEFA 1EFCA 3K0AB 3I5XA 3X1DA 1TNDA 2FSHA 4EUNA 3EC1A 2P2LA 4ZKDA 1L8QA 1E2GA 3NBZC 4PFSA 3SC3A 4MRNA 1VIAA 1YZKA 2WWGA 3FMOB 3VKWA 4JLOA 1WCV1 2GWHA 3B2EA 1K5GA 2G3YA 1DEKA 1OHHA 5JS8A 5JI2E 3K09C 3W3ZB 1Y63A 4TYYA 3DKPA 1X8LA 1JI0A 4TYNA 1KSFX 1IXRC 2GCOA 1YRAA 4LHVA 4PSAA 3RRMA 3VU9A 2XJ9A 5AJVB 2BEKA 3X1WA 1HA3A 2HLDA 3EWSA 2ZE8A 4TSFD 5E7JA 3K70B 4K81B 1KI1A 2IYSA 2G1JA 2Z4RA 3CONA 4IKEA 4LPSA 1SVIA 2CE7A 5L3SB 1RW4A 3AKCA 3EG5A 1A2KC 4Q5IA 2BVNA 3TAUA 2DCUA 4DKXA 1OB5A 2ANCA 2QTFA 1P62B 4DBLC 4OHZA 1JXMA 2HCBA 4ZO4A 4EIWA 5CB8A 3I5YA 3H86A 1NSTA 1FW6A 2XGJA 3ASYA 1B0UA 4JVNA 5H68A 4HB2A 1GNPA 2W2TA 1GZSA 4OJQA 2PT5A 2J0SA 4RJLA 4B74A 1NBMD 1U98A 1N6LA 2HJVA 2WPDA 2N42A 2HV8A 1DTSA 2HF9A 1W5TA 4IOMA 4QBFA 2A3RA 1JQJC 3P32A 1DO0A 2QMOA 5BYJA 1Y3AA 1CJVC 2WWIA 4PZYA 5DHFA 3LX8A 4BLOA 3P26A 1E0AA 2D2FA 4MYHA 2VP2A 3JZAA 4AKIA 2GZDA 1GKUB 2XNDA 2JJ2D 1YHNA 2ZPTX 2FPKA 4Q4HB 4IXMA 1F3OA 5JCZA 2JIZD 3H84A 4NL4H 4Q7LA 1DVRA 3FMFA 4FMBB 4LJ5A 4F4JA 1US8A 3DZDA 1G64A 2EW1A 5FUYA 3D8BA 4CEIB 4ESHA 1R5NA 2OILA 5DNYB 3AGQA 4UNNA 3AF1A 1QVAA 2K5UA 2QAGA 2Z5FA 2MSCB 4HAYA 4A6PA 1MRSA 1L4UA 3I73A 1KMHA 2V6IA 3T1VA 2ODEA 1L2TA 1OSNA 3WMFA 3KQKA 3THOA 2J7PA 4QJ5A 2PMDA 4I1OA 3C16C 4D0NA 1Q0UA 1AIPA 4QHTA 1UEJA 4F4CA 3NKVA 3PENA 5CK4A 3RSLA 4TYWA 3IQXA 4ZPXA 4B34A 1CTQA 4GPTA 2AHOA 4CEJB 2IYWA 4A2WA 5DN6D 1XTQA 3CRQA 2O8DB 2HEIA 3CPEA 1YZNA 3OHMA 4ZCIA 4Q4LA 5H8WA 1A7JA 2YWEA 2XZOA 4JIMA 2DFKB 1GAJA 2R9VA 1T9HA 2PBRA 3C8UA 4NBSA 4DUGA 3QF7A 5SZJA 1EWQA 1U90A 5C2JB 2NO1A 4W9MC 2BM1A 4KBGA 4A2PA 1F2TA 5CM8B 3KX2A 4DWJA 3WYAA 1GTVA 4MITA 3DKVA 1J70A 1Z6AA 4MGKR 3AB3A 3ADDA 2J1LA 2PCJA 1W46A 4AG5A 1Z06A 3B13B 4TMXA 2YWHA 4R7ZA 3CF0A 4IEIA 4U02A 4PPFA 3REFA 3TBKA 4PAQA 2F9MA 3I62A 4JLJA 3WY9A 3PXGA 5A5GA 5DSZA 1NMZA 2AL7A 1E2QA 1U0JA 4TMVA 3DO6A 5HZHA 3B9PA 4D81A 1E9CA 4L16A 3SYKA 4ZV4A 2QY9A 4M1OA 1Z6TA 2YV5A 1FP6A 4B32A 3K0AA 1QF9A 1FX0B 4I81A 3R7WA 5GJBA 2GNOA 3NH6A 4R2IA 4OBEA 4FMDF 2RGAA 3VMFA 1GIAA 5DI3B 3X1YA 4NYIR 1ZC4A 1E2IA 4DZZA 4NONA 3WRYC 5JMTA 5KSYA 1UBEA 2XB2A 2NGRA 4ASUA 2MMCA 3KXIA 1Z29A 2C99A 2WIBA 2H57A 1RRGA 4JKIA 4AIIA 5TXGA 3ETLA 3TR5A 2IEZA 2IHYA 3B1VA 3QKRB 1ZU4A 3HPQA 1GL6A 2ZI7A 4DSUA 5KSOA 4IDQA 1JAIA 1F5NA 4B76A 1GKYA 2ZYWX 1OIXA 4M4SA 2WOOA 3ZS9A 2F3TA 1GUAA 2J0QA 4BFUA 2ANBA 3NDBB 2KBFA 2WJIA 1II8A 2PMKA 4XVQA 4ZIRB 2OT3B 4GNKA 1KK2A 1WBDA 1ZNWA 2W58A 1XBTA 4B33A 1P6XA 4B43A 1VYTA 2E9SA 4IDPA 1P7CA 1U99A 3NC1C 4F93B 3NEYA 3OIYA 1DADA 3T5DA 1EFRA 4UNRA 1KI2A 4BLTA 2FMXA 2EU8A 2CK3A 1IY2A 3PEYA 4F7WA 1HT2E 3MAAC 4QBIA 1UADA 4AYWA 2RAPA 2HDNB 2WWYA 1C9KA 4ERNA 3ZVRA 3NTUA 5HE8A 4QOSA 5DO9A 4BRUA 1YJ5A 4LC1A 1GOTA 1A2BA 1S2MA 1M2OB 3MGCA 4B3CA 4PAMA 4E22A 2I4IA 1U81A 3ZDQA 1IAQA 1E2FA 2N46A 1G291 4NCHA 4NCNA 1E6CA 1CLUA 3LQRA 1G4AE 2MSDB 2I1VB 2JGNA 4Q9HA 4EJSB 4NP6A 2CCJA 3DMNA 3P27A 4IDHA 4LHXA 1F60A 2LWIA 1F6BA 4LJYA 1YQTA 4NTZA 5KDLA 4ZI2A 4QGFA 2YYZA 5IHPA 4AWXA 5JI3E 1NVVQ 1E1QA 3IILA 4XWKA 1FMLA 4F4IA 4XWAA 1J8MF 2OFOA 1OH5A 1KO7A 1XRJA 3GJ0A 3A4NA 4M9XA 1GKIA 1YZGA 2QN6A 5K8TA 3GLIE 4CEIA 1JBKA 4KFSA 3VR2A 2PH1A 1ZVQA 4XWOA 5LD2B 1P2SA 1Z08A 4OK5A 1N6IA 4B2IA 1Q22A 2R6AA 1E2PA 4LV6A 4FIDA 4ARZA 3GJXC 5J4HA 1HQYE 2FE4A 2J3EA 1X3SA 3GJ4A 4XTRA 4DJTA 1E2MA 2AKAB 4AKEA 3KJEA 5CDFA 5C1BA 3R9XA 5BQ5A 1G17A 2BBSA 2FG5A 2W6JA 1MR3F 3ZVNA 5E4FA 1PLJA 1YR6A 2GETA 2YZ2A 1PVOA 2GBLC 2REOA 1NIPA 5JHGB 3LFUA 4CEJA 2CL0X 2G77B 4TN1A 4DLVA 2XSZD 3PUXA 2WJJA 4NPHA 1TTTA 1S8FA 2IC5A 3L43A 2RH5A 1ETUA 4DCTA 1E69A 4FI3C 5IK2D 3ASZA 3ZZ0A 1SKYE 4JBYA 4B3XA 1G6OA 1XPUA 4CDGA 3KJGA 1R5BA 3WNCA 4DCVA 4HATA 1ZINA 4Q9LA 4ILEA 2H18A 4OI1A 3GLHE 1XZPA 4O25A 1VYVA 1YR7A 2YHSA 1CIPA 5JSZA 2ZJOA 1C1YA 5FH9A 3LXRA 3R8CA 3T35A 4TTQA 1RKBA 3W6NA 2FDCA 4DB4A 5HZKA 5FTMA 2BMEA 3EARA 2ZS7A 4Q7KA 3BORA 2AXNA 5DE3A 1QDEA 2IW3A 1AQYA 2IF2A 3AVYA 2DFNA 2PJRA 3MJHA 1SGWA 1ZD9A 2O8FB 3RNLA 2F1HA 1H8EA 1SXJB 2F43B 5C4MA 1VCOA 3ZD6A 1G5RA 1HV8A 4P0TA 2HUPA 4LHYA 5FTJA 1XDBA 3GFPA 2DYKA 3HP1A 3LLMA 5CJ2A 1LFDB 1KJWA 2QPOA 3EW9A 4C0SA 4OHWA 1BYIA 4XH9B 2GK7A 1KAGA 1OHHD 4KYUA 2O0JA 2V6JA 3U6BA 2AX4A 3MWLA 2CHQA 1N6RA 1EGAA 1Q3HA 4J0QA 4LYFA 5JS7A 2QGNA 4DLXA 1FX0A 2IS1A 1IN8A 1NSFA 3ZLJA 5KOYA 1Z5ZA 2W6IA 3T34A 1Z2AA 2J9RA 3AVVA 4HZUA 1KJZA 1NMYA 2V55B 4V02A 2HLDD 3EAQA 5DYGA 4GL2A 2OCBA 4YONB 4BGDA 1W36D 1VDZA 1U8ZA 1RJ9B 2QRNA 1XXHB 5EP4A 3FGNA 3CO5A 3VQTA 4URYR 3K9GA 5HE9A 1CKEA 1M6NA 2BOVA 1Z83A 3U4QB 3F8TA 4GZMA 3GJ7A 4XSGA 1U8AA 4IDNA 5CYPA 4YQFA 1NG9A 4TLEA 2CVFA 1I2DA 3QKRA 3RS7A 5L3QA 4NYJQ 1Q1QA 5F9FA 4TL7A 3P4YA 4W5JA 1KZGB 3EZ9A 2JLXA 1VTKA 2V3CC 5FPYA 4A8JC 3LD9A 1GILA 2ZROA 2ZR0A 2W83A 4QNMA 4WAUA 2N1BA 4R71A 3KJHA 5KYKA 5FOSA 1O87A 3BBPA 2WPDD 1JEDA 4EAQA 3EIHA 3QVUA 3W8RA 2FFBA 3MCAA 1N6NA 2GF9A 5EE9A 2F9LA 2QQEA 4RZUA 5CLLA 3QQ5A 2ZSBA 5AJWA 1D9ZA 3VNUA 2VP0A 2R6DA 3DZ8A 3GFOA 3MFYA 5DHAA 5JCPA 4BFYA 5TMPA 4TL9A 1AKYA 4PC2A 1G7RA 1KSHA 1VG1A 2NOAA 3B8HA 1TPZA 3MWJA 4RD0A 1P9RA 1KIMA 2WM9B 4JLKA 4CW7A 2PLFA 2IUTA 3H2YA 4JZKA 1E4YA 3PUVA 4XSHA 3FWYA 4A4DA 3L0IB 3AP1A 4CYMA 3QJYA 4Q9IA 1SHKA 5F9HA 1L4YA 1MABB 4KI0A 1FL9A 4URZR 3SN6A 5HPYB 3U44B 1KI4A 1TU3A 3EWAA 2GKSA 3FHOA 4JLPA 2GJKA 3CPHA 4EJSA 2ZRAA 4LJAA 1E2EA 2B6HA 2QM8A 3MUFA 4MKFA 4QNRA 5BN4A 3THXA 5K8UA 3AP3A 1GRRA 4Q4JB 3A1SA 4HB3A 4TL8A 4LYJA 5TB5A 3CW2A 2J7PD 2FSIA 3WNDA 3FMIA 1ZP6A 3NXSA 2QAJA 2E87A 3TMKA 3C5HA 1KO1A 4XJXA 3SNHA 4KLNA 5AUPB 3VKHA 2OM2A 2Z6VA 3PEVA 1QHGA 1R8SA 1Q44A 2CJWA 1MT0A 2HYIC 1WMSA 1IM2A 2QU8A 3HU1A 3TUJC 2VLIA 2A5YB 1T3SA 2F1RA 4DUGD 2F3RA 4E07A 4C0QC 1W44A 2O8BB 3EPKA 2IYRA 5FUWA 3WRXC 521PA 5JRJA 1OJLA 4A15A 2OAQ1 4CZ2A 4HYYA 1RYHA 3LO5A 3B60A 4LYAA 4TQAA 3N5CA 1T91A 4WZAE 4N0EA 2D7DA 4N1AA 3NIBA 2NMVA 4HAWA 3H0KA 4PC1A 3VU9B 4DLZA 2GEVA 3KUDA 4GRAA 3TR0A 1AS0A 4IDOA 4PQRA 2GZAA 5FTKA 3SJCA 1XMIA 4EQ6B 4HAUA 2CHVA 2CCKA 3U3KA 1ZIPA 4DLWA 3SBDA 2BHRA 3M6AA 2CLDX 3RDPA 4LHWA 4Q7JB 1NLYA 2GAAA 3SS8A 4XVRA 1S3SA 4M22A 1WXQA 2WIAA 3B1WA 1CR0A 2VPPA 2ZJ8A 3Q3JB 3MJRA 3L0SA 2TMKA 3KXLA 3SFVA 3ZD7A 1HYQA 1P9WA 4RKFA 2VTKA 2ZRGA 4DLRA 1RC8A 5LDDC 2O8FA 1W4AA 1BO6A 3O47A 2JLUA 1KY3A 2XOKA 3IHWA 1QRAA 1SKQA 1SXJA 2F43A 2J7KA 3IDQA 1Z63A 2P5SA 5JJIA 3C14C 3SE0A 2QM7A 3X1XA 1ZCBA 3O8DA 1W2HA 3NHAA 2F1JA 5EJEA 1ZM3A 1ZD1A 2Q9BA 2REXB 4OQLA 3PIRA 2W0SA 3U6KA 3KQUA 1GSIA 3FYHA 2QMUA 1CJTC 2WJVA 3R8FA 1G7TA 4HZIA 4LDJA 1JR3A 2ZREA 1UJ2A 3FOZA 1RRCA 4EPTA 1AKEA 1RRFA 2F6RA 3CF2A 3O8RA 3W6OA 5JEDA 2FA9A 2XZPA 2ZRNA 1ZW6A 5DI9A 3K70D 1JPJA 3CM0A 1RJ9A 1ZM7A 4JBXA 1FTNA 1M7GA 3EPHA 1FMJA 4PHTA 2IXGA 2QUZA 4DEYA 3U4QA 4C2UA 2PLRA 2GJAA 2VP4A 3OFNA 3SEAA 3SZRA 3LNCA 4H1VA 1EFRD 2ZQ5A 1NY6A 3AM1A 2QAGB 2YC4C 4EPYA 3RABA 3EPJA 1CP2A 4L9WA 4BZXA 4DRZA 1G16A 1E94E 3B6EA 2CEAA 3D6TB 3ZVMA 2VH5R 4YDHB 3BH0A 2UZ3A 2VRWA 4HDOB 4PSKA 2YWFA 1RPZA 3N2EA 4ESVA 2GJSA 1VPLA 3BOSA 3U5ZB 4XD7A 1XP8A 4BQSA 4KFUA 4B6FA 2D7CA 2Q3FA 3H1TA 1IOZA 3SJAA 1N0VC 4Q18A 1BS1A 3F0TA 4PQFA 3TE6A 1DAMA 1JJVA 3FKQA 3I8SA 3TQCA 4D4JA 3KQHA 1R0XA 2OAP1 3DM5A 4N3NA 5CK5A 1P2TA 1MV5A 1XD2B 3QXHA 4IOJA 1DARA 1MOZA 4TYPA 5FOWA 4OHXA 4OJKA 2GEUA 1G5TA 4PHFA 5CM9C 1E1QD 1OYYA 1Z6GA 4A1FA 3KKMA 4MKGA 2IUUA 3A37A 3QVVA 3GD7A 1MABA 3U44A 3VHLB 2H92A 1CXZA 4HB0A 1E2NA 5HKKA 2P6NA 1NL3A 2PL3A 5FUXA 3P4XA 2VP5A 1GL7A 1VCIA 4JJZA 1W49A 2OCYC 4QM7A 2WAYA 3WP0A 3SYLA 5EE5B 4C9BA 2BC9A 3WP1B 2W6JD 1PLLA 1XEFA 3U7HB 3A4MA 2C5LA 2ZI5A 3U60B 4Q21A 4S35A 4F38A 3ZJYA 4V03A 1Z22A 2QE7A 4M2LA 3W9YA 5J4LA 4QGAA 4YXWA 4RY2A 3WYFA 3THYA 3QUSA 3R7WB 2YJTD 3UMSA 2QBYB 4P3YA 2FZLA 4JMPA 1IN6A 2ZE7A 2NZ8A 3ZQJA 1Z0IA 2OV2A 1GP2A 3LBNA 3KKQA 1HH4A 2KJQA 4JVSB 4TZ6A 2O8BA 3ZH9B 2CLSA 4Q1BA 3BC1A 2P65A 3RVBA 1FPMA 1W2GA 1RZ3A 2BIFA 2ORVA 5CIWA 3IEUA 3K0SA 1YZQA 2ONJA 4L4UA 4NYIQ 1G18A 3KB1A 1EWRA 1KZ7B 2JDIA 3ECCA 4Q1EA 1GG2A 1KDPA 1G5PA 1E9BA 4GT1A 1GNRA 4WA7A 4LV8B 2CL7X 5EP2A 1NI3A 4EFMA 4BFVA 2C9OA 1KK3A 3FPAA 2GXAA 4WOPA 2CCGA 1S9DA 5LB2A 1JXOA 2J45A 1H8ED 4EQ6A 1KI3A 3IHLA 2A2ZA 1FQJA 1II8B 3A1WA 4DXAA 3T1TA 4EKDA 1KJYA 2ZSEA 3U61B 1NN3A 2ZRLA 2QP4A 5EE1A 3CNOA 2A5FA 5AJZA 4KV9A 2C03A 2Z43A 3KXKA 2ZSDA 1KAOA 1P75A 1TF5A 5AR1A 4LK2A 3K53A 2GILA 2EYQA 4FCWA 3DHWC 4V0LA 3D3QA 4BLQA 3U3RA 2W6ID 4QXAA 5CJPA 1T0HB 1KK0A 1R0YA 1KNQA 3S1AB 4KU4A 1S3GA 2RGNC 4DSTA 1NY5A 3DVLA 3A36A 1UBGA 3ICEA 1XMSA 2V54A 4JS0A 4DLYA 3IIKA 3CB4A 1W0KA 3RAPR 3UK6A 1XJCA 221PA 2PZGA 1J2JA 3QIAA 4JT4A 5K8IA 5FFMA 2A5JA 5B57C 1JPNA 2VYFA 3U3MA 2VEDA 4AD8A 5JWRA 1ZIOA 1OF1A 3ADBA 2ZRKA 4TQUS 1E9SA 3RRZA 3G5UA 1LVGA 1HE1C 2VO1A 4V0NA 2ODBA 3QNUA 4LJ6A 4LOAA 2AXPA 1II9A 1KSJA 4BZQA 4LUCA 2JASA 4HI0E 1E2KA 4BLRA 1ZUHA 5KDOA 1IJEA 5FTNA 3HYTA 2OLJA 3AQ4A 4YC7A 4B35A 1ZYUA 4HLCA 3HPRA 1VMAA 2VQSA 1ESNA 1D8TA 2V1XA 3KQLA 4Q02A 4GMXA 3BH7A 3N2IA 3TVDA 2VF8A 1TEVA 2B8TA 1OH6A 4Q4AA 1R4AA 3HR7A 2QT0A 3AF4A 4OHYA 3HDTA 2ZJAA 4ARZB 5FI0B 3JVVA 2WAXA 4LSGA 1NBME 1VCMA 5BXQC 1TQDA 1LF0A 1DAFA 1E79A 2AKYA 3CRVA 4KVGA 2OCAA 3EPLA 3RHFA 1XPOA 3HU3A 2XTZA 1AJEA 1XX6A 2WJYA 5M04A 1GITA 1RYFA 1ZBDA 2P6UA 2VSXA 4RSGA 4A8JB 2FU5C 2QEQA 2VBCA 1G8GA 3K8YA 1OXVA 1DS6A 3BIFA 3E2IA 1BMFA 1HUQA 2G0TA 4HLQB 2QSZA 2WKPA 1XD2A 2EWVA 3BFXA 4R9UC 2O8CB 2IEYA 3RYTC 4BFSA 1E1RA 4ZDJA 3X2SA 1PZNA 4IOLA 3B5JA 1XEWY 1A82A 4HUQB 2QG6A 4DDUA 3TVTA 2FEOA 4G1UC 4DSNA 5KTYA 1SULA 2ZRPA 4B3DA 3KFXA 4D25A 1L7VC 1Z0DA 5JSZB 1CR1A 1EX6A 2QPAA 4MYTA 4CVNA 1LTQA 2J0VA 3D31A 1VHLA 4DDVA 1M7HA 2B7BA 3SBEA 2RGDA 1A4RA 1V43A 4M9ZA 2ECKA 3VAAA 1QHHB 3GLFE 1W36C 1G3IA 1MO3A 2ZI4A 2QMHA 1OKKA 3CH5A 4FWTA 2FZ4A 1H8HA 5EZ6B 4WXPA 4PZLA 2ZS9A 3SHFA 3AUYA 4URWR 3U7EB 1IONA 4O2LA 1JJ7A 1OH8A 4ZDKA 4F91B 3CX6A 2KBEA 4ACBA 3K9NA 5BN3A 1ZM9A 2AWNA 5LB4A 4RZXA 1VCNA 1FZQA 3GMTA 4TTRA 1JAHA 1OFIA 2R44A 2SHKA 1M1YE 4M1MA 1BOFA 4C0LA 2QBYA 5F98A 4OYHA 2IA5A 4IFBA 3RLFA 4HZUB 3MSXA 4P4TA 2O0KA 4B75A 1OT3A 2AFHE 1TU4A 1P72A 3PVSA 3UXMA 1EXMA 4XVUA 3CRRA 5J4KA 2O5VA 4WXRA 2IWHA 3EIQA 1G7SA 4KSCA 2YC2C 2J87A 1PUJA 3OEHA 5KNCA 2IUSA 1UKZA 2QMEA 5L3QB 2P3SA 1RIFA 4E5UA 5BWMA 2GBLA 2CHGA 4PPGA 4OHVA 3VR5A 4D26A 4QC2A 2XOKD 4RKEA 3TQFA 5CYOA 1SXJD 4LJ7A 3ZIAA 4BFZA 4UNSA 1II0A 4ZI3A 1IY0A 5EE3A 1OIWA 2JLQA 3CX7A 3AKEA 1LS6A 1NF3A 2IYTA 1FFHA 5IRCD 1IY1A 2JLSA 1PJRA 1ZD8A 4KODA 1U0LA 5IDVA 1X86B 1KOFA 3AP2A 3GCGA 3LBHA 1N2CE 4FCTA 4FXPA 3QPWA 4Q19A 4D80A 4PX9A 5CITA 2HT1A 2OBMA 1AZTA 1NKSA 2QT1A 4LWZA 2LKDA 4BWYA 5KUTA 1QHSA 4O0MA 1NN0A 2PCLA 2NTYC 3NBFA 3L8YA 4Z1MD 3S1AA 2WWFA 1N6HA 3EIEA 4FMCB 3OZXA 4C30A 4MUBA 5E7IA 1Q3TA 2DBYA 4LC0A 5FBRB 4GMDA 5AUQA 4URVR 4C0BA 2O8EA 2FGKA 3RRYA 3RS2A 1B23P 4RFSB 3RS5A 5JJLA 1KI9A 4L5BA 5EXPA 1UAAA 2HCJB 1IXSB 1BKDR 1NIJA 2OFXA 3I3SR 2IS4A 3OFND 4V0MA 4PC7A 5EQTA 1FTSA 2ERYA 4Q9JA 4LBWA 4RCZA 4JL6A 3SJZA 4QBHA 1R6BX 2GTPA 3T15A 3THXB 2IYZA 3ZZUA 2D4HA 4LBYA 2Z0MA 4L8GA 4OI2A 4B3GA 1U0HC 2NO6A 3QXJA 2PEZA 2FPMA 2OXCA 4US1R 1OFUX 2R6GA 2VP9A 2J0UB 2GCNA 2UKDA 4PHGA 2RGGA 4XD7D 2XX3A 2H8KA 2QZ4A 3TSOA 4AC9A 4BUJA 3AKYA 3GEEA 2F55A 3BXZA 1OXUA 4MH0R 3BFVA 4WIAA 4WZBE 2G83A 4M53A 3KKNA 1WP9A 2CJWB 2RMKA 1XJQA 2P67A 1JALA 4DLTA 2IL1A 4CGZA 3EZ2A 3KTAA 4JLNA 5UKDA 4BLSA 1XXHE 3GFTA 3ADCA 2DPXA 1KI8A 2PX0A 5FL7D 3KJIA 1N6KA 1R8QA 3CWQA 3AVTA 4A8JA 1TMKA 3T5GA 3PITA 2JLVA 4II7A 3AKDA 3E70C 3UIEA 2ZRBA 2JLRA 1MH1A 5FOXA 1GFIA 2C96A 2O8CA 5TARA 1GVNB 5P21A 5B58C 5HKKD 5FPKA 1FQKA 4URXR 5D3MA 4HUQA 4BFTA 2YOHA 4A6XA 3WBKA 4BZPA 3QXCA 5FI1B 1VECA 1N3BA 5A0FA 1EK0A 2QA5A 5BYKA 4G5QA 4GOXA 4IVRA 5GJVC 1KHTA 1T5IA 1NVUQ 4DCUA 2YNMA 1NLZA 1QHHA 1IJFA 1Z0JA 1AQUA 3PCRB 4P31A 2Z4SA 4YXWD 2WKRA 3G82C 4V0KA 4JLDA 3O8CA 1G9XA 1KMQA 3RS3A 3K0CA 1MKYA 4YMWA 1KDOA 4FD2A 4NDZA 3LA6A 2FFHA 2ONKA 3OF5A 3QXSA 1TAGA 1UKEA 3DOEA 4NU0A 1NKTA 1P60A 2BMFA 3T1OA 1MO5A 4Q1DA 3AVXA 1MO6A 1WDTA 1P9NA 2BV3A 2V9PA 2JDID 3LQQA 2P6RA 4UQOA 2JATA 3TH5A 2XAUA 3THWB 3IPYA 4PAOA 1KDTA 4HLDA 5DLQC 4LGMA 1D2EA 4Y0AA 3FE2A 3IIMA 1N0WA 1G8PA 4LJ4A 2BKUA 4TSFA 1HQCA 2OFWA 3CIOA 4PTLA 1OV4A 4L9SA 5KDDA 1OW3B 2BMDA 5FBVB 1N6OA 3BK7A 4DT1B 3LXXA 4ZDIA 1UM8A 3GJ3A 1OB2A 4GOKA 2ZUCA 1Q12A 1RE0A 2X2FA 1XTRA 1DO2A 3LW8A 5G53C 3MD0A 2QQ0A 1NMXA 2JA1A 4B47A 4N0DA 4KO8A 2F1IA 2HF8A 3GLIB 4GOJA 2OBLA 4BECA 1LS1A 1OFHA 2QORA 4U5XA 2WV9A 2A7QA 2WMNB 3CWZA 2W2VA 1ZCAA 2BBWA 4TT3A 2YVUA 1OLOA 1TQ6A 1GM5A 4BLPA 3G0HA 1S0UA 3IGFA 2QTHA 5TVKA 2JJ1A 1Q1BA 1QZXA 2I1QA 1T0JB 2GXUA 3Q7PA 4CT5A 3UWKA 1AN0A 4D2IA 2A78A 1AM4D 4B3BA 2ZRDA 1JNYA 3LW7A 3W34A 1D2MA 3I72A 2QROA 2FGJA 3JZMA 2O52A 1SKYB 1IXZA 2XNDD 4DIEA 4A36A 4A0FA 4TYQA 3GJ8A 1YR8A 2Q3MA 2PEYA 2BBTA 5AWFC 2CVHA 2AD1A 2CNWA 1KI7A 2W2XA 4RFSA 2NO7A 3VNVA 4B3FX 4PQYA 1R0WA 4CRWB 1ZMXA 1VG9B 4X8OA 1CJMA 4YDSA 2G1KA 2RGBA 3TNFA 3PV0A 5SZHB 1D9XA 2YKGA 4IEEA 4D0GA 3F5FA 1XCGB 621PA 4NKRA 2H17A 3CRW1 3TJZA 5EXTA 2D62A 2VHJA 4DC9A 4DSOA 1UF9A 1NJGA 4IOKA 5E95A 3W3AA 4MA4A 4A2QA 4KITB 4MKIA 5KU1A 2J0UA 4KXFB 1NRJB 3AF3A 4B6EA 3UPUA 2FF7A 2NO0A 1ZUNB 2ZYUX 3GJ6A 1PUIA 4NMMA 2ZR7A 3TLXA 3CNNA 3THYB 4IVQA 1BMFD 3ZVLA 5JJKA 1EFTA 1E1RD 1G7CA 1T8UA 1XB2A 4OQXA 1GNQA 3B9QA 2RKOA 3QKSA 5FBWB 3I32A 3VHXA 4M8NE 4NYMR 1Z6XA 3LLUA 1BYUA 1AA9A 4KFRA 4LCBA 3JVUA 2EFGA 2EYUA 1G6HA 4M21A 2GHIA 2ZRJA 1JEEA 1OYWA 4KJZA 3NBYC 1VKJA 5FUVA 1LF5A 1N25A 1VG0B 2FX3A 4JKYA 5EUQB 3T61A 3EA5A 1U2RA 4DDTA 3NHBA 4X8HA 5ANRB 3AVQA 5LPNA 1OKKD 4BEJA 1H8HD 4UNQA 2GESA 2GRJA 3WHKA 2IYUA 3L2OB 2XJ4A 5GJCA 2NIPA 2PJZA 3SQWA 3KB2A 3AEZA 3WMEA 4C3ZA 2FN4A 1TQ2A 4IJMA 4KSBA 1YVDA 4R2HA 1XNJA 5AUOB 1KYIA 1D2NA 1ZC3A 2FNAA 1WRBA 5JRZA 1T5LA 3NEJA 3GLGE 4OI4A 3LVQE 2ZAOA 5JWOA 2CL6X 3PG5A 4NH0A 1QVRA 3C5CA 4GSYA 5EXSA 1OH7A 3K0FB 1CJKC 2C8VA 3NVAA 4YMSA 3J81k 1S96A 5E3HA 3FDIA 1VG8A 2CXXA 3UANA 3CZQA 4G3XA 4W7SA 2ZYTX 1W7AA 421PA 4ASUD 2ZJZA 3LH5A 1HE8B 4OQMA 4I1VA 3T06B 1X8KA 3T1QA 1G41A 4EPVA 2DFTA 3OEHD 3THWA 2WVJA 5FBQB 1TL7C 4U00A 2ZRHA 3IQWA 2VP6A 4B71A 4DB2A 3QEOA 2R62A 2YINC 3QY0A 3V4RA 4DT1A 1CU1A 4IXNA 1V5WA 1C4OA 1SVKA 4JLBA 1DPFA 1UEIA 2AD5A 4HLUC 3VR1A 5L8VA 2IYLD 5F2EA 2QENA 4A0RA 1U8YA 2GVDC 4X8MA 1Q1ZA 4BRWA 3GLIA 4PO8A 4Q4AB 2CK3D 3QENA 1LNZA 3K09A 4IRUB 2ZJ2A 1LB1B 2GZHA 1T3LA 4UXJA 3BGWA 1Z28A 2IK8A 4LHZA 1QHXA 2J59A 3CKLA 3DM9B 5GVRA 1Z3IX 1CBUA 1FP7A 4S2EA 5G41A 5KNDA 4A9AA 1R5OA 2WJHA 2ZXUA 3AVWA 3PJRA 4LZZA 1WE2A 2C77A 4DCSA 3ZGXA 4Q66C 4D4KA 2QNRA 1OE0A 1U94A 4PO1A 4U7DA 3U7GA 4UJ3A 3Q5EA 2BKEA 1CRPA 2ZVQX 4MYUA 4Q1FA 3B1YA 4JSYA 5A4JA 3OIUA 1CF4A 1U9IC 1GRQA 2IXFA 2ZE5A 1S9HA 3P1JA 2G9NA 4GDFA 3WHLA 3GLHA 2V1UA 1KTVA 1WF3A 1LW7A 4V0OA 2MSEB 2RGNA 1KI6A 5GJWC 3KUCA 2RCNA 1YKSA 2D74A 3EA0A 3WXMA 5H1YA 4UNPA 1ZU5A 1YRBA 1W48A 4BASA 4RZ3A 2ODNA 1KO5A 4MKHA 5JECA 1Q1EA 5BN5A 2IS6A 1E98A 4Q48A 3ONWA 5JFGA 2GDJA 4K8OA 2I3BA 2QL6A 4WZ6A 3W8NA 3A6PC 1W4RA 2BCJQ 2FEMA 5IF9A 4XTCS 1JB1A 2FSFA 4G5GA 4Q9KA 4ZKEA 2ZM5A 3BAFA 4MDEA 2X1VA 3GPLA 2RB4A 2C78A 2AFIE 2CDNA 1R2QA 1W1WA 2KE5A 5ELXA 5C46F 3VR6A 4Q00A 1OXTA 1SXJC 4Z8YA 4FCVA 3AV0B 2FFAA 1XD9A 2NG1A 3I92A 3VR4A 1DAKA 2GAOA 3WMGA 4RZ2A 4YMTA 4P4UA 4MDFA 3W5IA 1BH2A 3AUXA 3L0PA 4AK9A 4RD2A 5KPJA 1SVOA 1P3JA 1Z2CA 2Q21A 1X1SA 4C4PA 4MRSA 3TRFA 1XPRA 5CB6A 2B21A 2J41A 1YR9A 3ICQB 4TLDA 1G21E 3GEHA 4AKGA 3V4FA 5HR5A 3U7FB 1ESMA 4GZLA 1XFAA 1DAIA 2R65A 2IYVA 5H70A 3TW8B 4NHOA 3W90A 1NP6A 3FKSA 4QG7A 3I4LA 4C0KA 5L3RA 4PSVA 4ABYA 3BD9A 1E2JA 1EX7A 1SHZA 3TIFA 4HUTA 5B64A 2JLZA 3NC0C 2WTUA 3OIWA 3EX7C 2ZRFA 4DHEA 2ZSFA 4JVLA 3TAHA 5CDFE 3OAAA 4O2RA 4GP6A 1NVXQ 5JWHA 4DIDA 2G0NA 4ZDWA 2HXSA 3UG7A 4JL8A 4MRPA 1ZAKA 1COWA 3C4JA 4LV5B 1UBCA 4AY2A 1G3UA 1E0JA 5DYIA 2GEDA 4IVPA 3VR3A 4I99A 4MQBA 2W00A 3UMRA 3K0FA 5G3YA 3MG9A 4HAXA 4IHQA 3ADKA 4C0AC 3MWYW 1W5SA 5J47A 4Q03A 4FN5A 3UG6A 2WWWA 2KWIA 5EZ5A 1M34E 1UDXA 3AH8A 5DISB 2O8EB 3VTKA 2WZQA 3PEWA 2JJ8A 2GXSA 4PANA 4FMCF 4KFTA 5J40A 2Q9AA 3OEEA 4TMKA 2RHMA 3SQXA 4JVMA 3RSOA 5KSZA 2VHUA 3NG1A 4NCIA 3HR8A 2ZETA 2HXYA 2ZTSA 2BWJA 3F3YA 5IT5A 4I1UA 4MRRA 3SJBA 4LRWA 5KPDA 2GK6A 3ND8A 2X77A 3E5HA 3OIVA 4NE2A 4TT3D 2VSFA 2B7CA 1O3YA 2KI5A 4DVGA 2A5GA 2ERXA 4EFLA 1T6NA 4D4LA 4A82A 2JJ1D 2ODWA 2GCPA 1QBKC 4KHZA 4G5RA 1XCPA 5KSPA 4CEHA 3R9IA 4JLMA 1P5ZB 1E96A 1HURA 2HJGA 3WNBA 2FV8A 3B85A 1E3MA 1F2UB 1DG1G 2UVQA 3FVQA 4AURA 2WWHA 3KTAB 4M0LA 2EFEB 4PO9A 5HCIA 2J46A 2FH5B 2Q9CA 2G88A 1G20E 2BMJA 4HAZA 4LYHA 2BDTA 3BERA 4OK6A 4RCYA 1E2LA 2ZU0C 2CNWD 1EFUA 2GA8A 3B78A 1G3QA 5DH9A 4DDWA 1K8RA 2IYQA 4RD4A 4F92B 2NO9A 3PQCA 2X2EA 1OXSC 4MRVA 3IUYA 721PA 4UKDA 2QP9X 3I1FA 3K9LA 121PA 4TL6A 5D3MB 2NPFA 2ORWA 1RRPA 1W4BA 1ZNZA 5JEEA 4TMZA 3A4LA 4HDQB 4LJ8A 2X8AA 4MGYR 2OG2A 2NPIA 4Z51A 2ZI9A 1CJUC 1XD8A 2ZI3A 4TLBA 2ATXA 4TLCA 3AVOA 3RANA 4BEBA 3QE0A 4C7OA 4K46A 3QOFA 1DBSA 5AK0A 5FOUA 1HTWA 1X1RA 2FWRA 4EPXA 3KL4A 1W0JA 5G40A 3GLGA 3BS4A 2ASEA 1E2HA 2AWOA 2ZVPX 3GQBA 4AYTA 3PFIA 5JHHB 3PUYA 1M7BA 3OE7A 3QXXA 4Q1CA 3BB3A 4PR0A 2V8OA 4H1UA 2QP3A 2H1LA 3LV8A 4C0JA 2L0XA 2W0MA 4CIDA 1JECA 4O3MA 5FPTA 2AN9A 2WKQA 3ZS8A 1P4SA 1F48A 1E9AA 5SZKB 3EC2A 2AR7A 1NN1A 2VHCA 1UFQA 1AZSC 4AG6A 1WQ1R 1XTIA 4JT2A 3O8BA 3Q5DA 4WBSA 4P33A 4D0LB 2Q0HA 2D2EA 1T4GA 4M1WA 2WSSA 3TSZA 2REBA 1XEWX 2IF0A 3A1UA 5FL3A 2WMOB 1Z6YA 4P32A 4IW3B 4FINA 5EE0A 2PZFA 1JR6A 2ZJBA 4M9SA 4PXAA 1KGDA 4D4MA 3KQNA 2QGZA 2DY1A 1DAEA 4WW0A 4QFMA 1P2VA 3HYRA 4G5SA 4KBFA 2OUKA 4TMTA 3IEVA 3CF6R 2YOGA 3RC8A 3Q72A 3I61A 4AKHA 4NCJA 1MRNA 1KDRA 2BM0A 5J5CA 4DLUA 4CT4B 2CE2X 3ZYCA 2C9CA 1TUIA 1CRQA 2ZAMA 3QSYA 4MGIR 2QAGC 3V00A 1VHTA 1VYUA 4GI7A 4LI0A 1YZLA 4KLZA 1WBBA 1OXXK 2BBOA 3KFVA 3BRWD 3VKGA 2WJGA 1KKMA 1XCMA 2YOFA 1JR3D 2BCGY 1K5DA 3C7KA 3K9HA 4L15A 1GRNA 3BE4A 4B2PA 4PZZA 4RVCA 1XMVA 3TUIC 2QPTA 4MUAA 2R6CA 3IBGA 4G5OA 1GWNA 4HEJA 4QM6A 2OESA 1DELA 2WHXA 3ND9A 4B44A 5GVSA 3QF4B 2BJWA 3MRSA 1OPXA 5L3SA 4I1SA 1FUKA 3RRNA 821PA 3DDCA 1ODFA 2Y8EA 4QJ4A 1BIFA 1ZRHA 4LX0A 1S1MA 2OZEA 5FBLB 4B48A 3FHTA 4BPBA 3GLFB 1EG7A 3R20A 1SXJE 1KO8A 1YZTA 4TMWA 1X6VA 4LY6A 4LJ9A 3RC3A 3QPVA 1WB9A 2ZIAA 4PPQA 5AJYA 1TF2A 2IXEA 5KO2A 3BB1A 2OXRA 2DR3A 3R9WA 3IIJA 2A30A 2R2AA 2XNSA 4FW9A 4OK3A 2B92A 2CMKA 1JR3E 2OHFA 4QRHA 1J8YF 1QG2A 2IX3A 1HY3A 1KNXA 3BJIC 1F2UA 2ZITA 3NH9A 4JLAA 3QKSB 1UKYA 1XF9A 4Q4HA 5EP3A 1IHUA 3GJ5A 4NZYA 2ZE6A 4A0GA 4KCGA 3CH4B 5BW8A 3QKTA 2ZI6A 2NZJA 1G8YA 1E4VA 2ZRCA 4URUR 1FNMA 5HCNA 3RWOA 4NYMQ 1XMJA 4M1TA 2PT7A 2ZEJA 1QHYA 4YMVA 4M1KA 4CF7A 2E1RA 3IBYA 3IO5A 3KKPA 3U3OA 5C18A 4JYCA 3Q8XB 2AK2A 4OKSA 4OI0A 1R0ZA 4QGHA 5EUMA 3HWSA 4EPRA 3CUEF 2H5EA 1W4CA 1KSGA 3QG1A 5KNBA 1S1CA 4HSEA 3L8ZA 1XTKA 4HAVA 4Q47A 2V7QA 3RS0A 2XXAB 2IHBA 5TY0A 1D5CA 2HT6A 2IYXA 2QE7D 3K70C 4EPWA 1CEEA 2O8DA 1P2UA 5FOTA 3AGPA 5K8LA 1T3HA 3VX4A 1M74A 2QTVB 2QI9C 4BE7B 2RGCA 5DIFA 3CR7A 2OE2A 3TK1A 5AJXA 3SI7A 3MWKA 1ONBA 3BWDD 4NCKA 5F3WB 2EFCB 1E9DA 3EZ7A 1NVWQ 4QHSA 1I2MA 2C98A 3QBVA 2A5DA 4Q1AA 1D6JA 3KZ1E 4QBGB 1Q21A 5AUNB 2C95A 2Q6TA 3SOPA 4G01B 3CBQA 3SDZA 2IT1A 3FKSD 4PPNA 2ATVA 1FUUA 3P20A 1NN5A 4G0NA 2CLCX 2D3WA 4B2LA 4Q01A 1SVLA 3Q85A 4US2R 2JLYA 4ON9A 1P61B 3LAWA 3CX8A 3DOFA 5J4YA 3OAAD 1W47A 3W5JA 4X8LA
chains in the Genus database with same CATH superfamily
4AI6A 1TADA 1NJ5A 2HHJA 3KLOA 3DDSA 1AB6A 5HG0A 4YRQA 1UJMA 4PGGA 4NZZA 4BFXA 5LOVF 5LQCA 3B7GA 3LX4A 3ICWA 2Q3CA 1C4XA 4WBNA 3AY3A 5L4SA 4Q82A 4DTIA 2HQRA 3UYKA 3EVAA 3FBGA 2H59A 4IMIB 1I1OA 2CNDA 4WZBB 1M1ZA 1CP3A 2IJGX 3I30X 3COJA 2XEXA 3BTUA 2FPUA 4NECA 1U2SA 5L51A 3LRPA 1W8IA 1IVSA 5HW0A 1U9ZA 2MYUA 4E4RA 3KK0A 3VH3A 4TWZA 4FMPA 4RABA 3ZWNA 2G80A 4KTVE 1GFWA 2QDXA 3DT6A 3A1TA 5AKKA 1ZNYA 2WBLC 2BFFA 1RWPA 4LYEA 5ECDA 3UATA 1K7FB 4FFRA 4OQNA 5DZSA 4GC9A 3TG8A 3OZRA 4DW8A 1CRLA 3OEED 1T9GS 3QLTA 3I39X 4XZ3A 2C7QA 4G8JA 1MC4A 3PUHA 3DDOA 3EQ8A 1DC5A 2JARA 2JFNA 1ZM2A 3PEEA 4PPYA 4KDCA 5BQOA 1LLUA 1XC7A 3I76A 3ZNQA 4FFLA 4B46A 1G8HA 3NP9A 1QO0D 4YAGA 1QZZA 1YHZA 3SSNA 1QS0B 2HA0A 3DPUA 2R6R1 3ISTA 3NBXX 4X3PA 1BXKA 4ZIRA 1H2HA 3GDFA 3HA7A 3KDSE 3L49A 3NNNA 2IS2A 4YJ2A 3ED1A 4HTFA 5HRUA 1YU9A 3B1XA 2BN4A 5TDHA 4IQ8A 2F59A 3P71T 4WOCA 5CLFA 2FSGA 3LVFO 1MPTA 3ZCQA 4DQVA 1HFKA 3MMPA 4O08A 1CZOA 3M5CA 4H4CA 2RHDA 1EGHA 3AWIA 4BLWA 4CFZA 3OU2A 1JZSA 2IV2X 4ZU6X 3GLFA 1NYLA 1TUEA 2XITA 3N2KA 5L40A 2IVZA 1P73A 1SCUB 3FYUB 4EG4A 3IPXA 1QHIA 1ZK2A 3HB0A 1BVHA 1E79D 1M8PA 3MFQA 4ITRC 4F72A 2PD4A 1M5TA 1BGVA 1T24A 2GXQA 1Y34E 2VZEA 3PDUA 4K6CA 1GCAA 3MHTA 4EHBA 1C3LA 1SZJG 3EBLA 1KQOA 1ZJWA 1E99A 3UAGA 1QTQA 5DX0A 7ADHA 1PEAA 3I23A 3IUJA 1WTAA 2DWUA 3C70A 3NWBA 3OC6A 3LT2A 5DN6A 3K0CC 3TLYA 1ABFA 3S8MA 4C06A 5AKGA 4DUPA 2WTEA 4HLUA 1L3BA 2OCDA 1XO1A 2R8EA 2WU1A 3TNLA 2PJUA 3E22A 4YV1A 2V3WA 5KJEA 4Y2YA 4BX2A 2P69A 1Z8FA 2JLWA 4W5HA 3N70A 1FFYA 3BD6A 4RVDA 2R8YA 2EWWA 1QHNA 2DWPA 2XXJA 4IRXA 1UUFA 3VUFA 2B8NA 1XLUA 1MAAA 4IBOA 2C3UA 4N40A 1RP1A 3VDRA 5MN5A 3ZDAA 2UXDB 1B26A 2NYRA 4PHCA 2W5UA 3K71B 3A2KA 1PZHA 3N75A 4JCOA 4X93A 5F5XA 4D82A 4ZYVA 3C15C 1PWXA 1JQLB 1SVMA 1VHJA 2QN9A 1RWMA 3A1VA 3N3BC 3OX1A 3STUA 1W0JD 3I0ZA 3GYBA 1DAPA 1NW7A 4QUEA 2YTZA 3JQBC 1ECPA 1E3DA 1E9FA 3A58B 4H0FA 1DC3A 4L7QA 5CPFA 3TSCA 3NFYA 3WYBA 1SXHA 1UWVA 1TC1A 4JU8A 1CS4C 2PX3A 1KYXA 1U9IA 1V7CA 4EY5A 2ZCUA 1VE7A 3W6PA 1USWA 2XMGA 4TQ9A 4B7AA 1GZDA 3BXXA 2EARA 8OHMA 3TOSA 1Z0ZA 2EKBA 3EZGA 4YCMA 3PEFA 3SFZA 4DCNA 1E6WA 2QRPA 1C4KA 2YHBA 3NRCA 5AVTA 2EC5A 4FI3F 2AK3A 2EDAA 5EWMA 1B6GA 1E7MA 3TN7A 4F3NA 4CETA 3E5RA 5KOHA 1QV7A 1N2CA 2CBZA 1KVQA 4R9SA 3ETJA 1KO4A 2D5CA 4L51A 1DHTA 2Q49A 4DIOA 2P5TB 1W36B 4DQUA 3UHOA 1NQAO 4MB6A 1N5LA 4W1RA 3RSGA 1VJCA 2HMUA 4C4ZA 5M7EA 3HXOA 3B6JA 2QYSA 1OVGA 2HTFA 3GP5A 2GVZC 1SU6A 3B6ZA 4PHHA 1FUYB 4C2TA 2GF0A 3ZTWA 1TTPB 2AOTB 2CXPA 4RNCA 5IS2A 5E7MA 4ECAA 3ENQA 4XSVA 4D6PA 2LDXA 1EK5A 1YZUA 1NJSA 2XOXA 1N9GB 5TMDA 5EMMA 3R5FA 1G5FA 2C9BA 1JHUA 2KYRA 3EVZA 1FDVA 2R8RA 3QKUA 1YL6A 3QM1A 2HC9A 4NBLA 3CNLA 4OA8A 4UTNA 2VSOA 2QRVB 4ZAVA 1G3MA 3QLVA 1Q7GA 3RG2A 5E6SA 3RS8A 3D54D 4MUXA 1R6DA 4WINA 4MULA 1I3OA 3L8DA 2FJ0A 2COKA 3DFZA 4EJSC 2QSYA 1HX7A 1W0CA 2J5XA 5EXXA 4Z9YA 4KNYA 3GEIA 1EA5A 5IULC 1Z5GA 4D3DA 5BSVA 4FOLA 2BD0A 1MMFB 4R3WA 3S6JA 4RULA 5CIQA 4EATA 3E9RA 4Z49A 5PNTA 4RH1A 3G8AA 1YZFA 5JYDA 3EEBA 4KDEA 5JBQA 5D3QA 5B37A 3W2TA 3MJ4A 1W25A 2OV3A 2PRIA 3W5VA 5L6LB 1P9LA 3CLHA 1ND5A 2B2XA 1UFRA 4GFDA 3BQ9A 2JFYA 1DQZA 1RI5A 3PNBA 2AOWA 4ARAA 1ZO8A 3VO8A 4KSYA 3WL3A 4BU0A 4LRSB 5EYPA 3IMGA 2F17A 2ORIA 4HX2A 4NYJR 4UM9B 3IKJA 4HEQA 5A5EA 2FWIA 1V5EA 2PX4A 5KC8A 2KSQA 3KZVA 1ZSYA 3E4CA 2Y76A 1YK0A 3STVA 5I4BA 4F9EA 2BZSA 3C8MA 1EJBA 2EX0A 4QPDA 3SICE 4U2KA 4F96A 3IEIA 4L9RA 4M9QA 4UBKA 1TW2A 2W6CX 1QHFA 1UPTA 3ZH2A 3URKA 3HB1A 3QHPA 4U2GA 3WG9A 3IMFA 5FJJA 4CI0B 2GJ9A 2PSSA 2ZYHA 2O57A 4MAAA 4MPDA 1EQAA 1ENPA 2VHVA 4WFQA 2AJDA 3GRUA 4KVAA 3HKCB 3L7KA 3ITKA 4MAMA 3UHJA 2IHZA 4E09A 1VDMA 1IDN1 2FN3A 2X19A 3FYDA 3PPYA 3CLVA 1UJNA 4FYWA 4KQFA 4UPDA 4WE3A 2H16A 1UMBA 1FW8A 3BB4A 3QH4A 2NTNA 3AZQA 1SZPA 2BEWB 1LX7A 4ENRA 1QG4A 2ODQA 3MCWA 1ANKA 3PVCA 1E2DA 2ISSD 3TGPA 2G72A 3GRAA 1UBRS 1YE8A 1U8XX 3WBJA 4BP8A 1BOOA 4CKEB 1HDGO 2XB8A 1XLTC 4IH4A 1SBZA 3WGMA 2H7VA 3PPVA 5K03A 1SVSA 1SO8A 5BNIA 4UULA 2FHSA 3H6HA 1SU7A 5C4GB 1F2TB 4MYCA 3PZBA 3S1LA 3IP7A 4PWYA 2IYAA 5DGTA 4FGKA 4N5HX 4RY9A 4YT8A 4PC6A 4YP0A 1P1HA 2C3YA 2V96A 1L5HB 4BNMA 3ZQ4A 5BYBA 3T95A 3FA2A 2GBIA 4OEHA 4BUZA 3AEKB 4P4SA 1LPBB 3ZWPA 4O63O 1Y9EA 1XKTA 1P5HA 5IK2A 4R98A 3TJRA 2FWBA 3S40A 1GG9A 1KAHA 3AK4A 4MQ4A 4C1BA 5AM5A 2D06A 3H5LA 4DBZA 1W19A 4Q4JA 3UMFA 4R51A 3ZXSA 1RCTE 3HZZA 4ZT5A 4M0EA 4AYXA 5LDHA 1A1VA 1XEXA 4Z8XA 4RD3A 3E18A 5J23A 5I4CA 4LJRA 1N5IA 1ZM4A 2AG1A 3ZHXA 1NJFA 4CIBA 4EDHA 2QV7A 1CC1S 3D4OA 2AH5A 2XTNA 1IUKA 2WWXA 2PUHA 4HDCA 4HP8A 5A9RA 5CFMA 4RYDA 1LLFA 1WCYA 5C35A 3LQYA 5I48A 3FFWA 4MRAA 4C0WA 1SN7A 1N2OA 3M6VA 4GZ3A 4Q34A 1TNDA 2FX2A 4LFBB 4QJBA 1AK9A 4RDCA 1SC6A 1PJSA 3EC1A 3PNMA 1V2HE 4Q6WA 4RKQA 2ZPUA 3NBZC 5B55A 3FAKA 3SBOA 1VIAA 1Y7TA 2J32A 2WWGA 4KOAA 3VKWA 1KF0A 3UFXA 2GWHA 3VZPA 5AVYA 2FEKA 1QOZA 1RAFA 4CR8A 4EJMA 1K5GA 2I54A 2G3YA 3HKBB 4LQCA 4QX6A 2R7MA 4U7HA 5FNZA 1DEKA 2P79A 5JS8A 3CZ9A 3OE5A 5JI2E 1MB0A 2WHYA 2QXTA 3QVXA 3V1YA 2IHNA 4FEYA 1EQUA 1KSFX 3OX4A 2IVFA 5C8ZA 3LCRA 1E64A 2GCOA 3AX6A 4KIFA 4MW2A 3NTVA 3OQBA 4I3FA 3RRMA 1Y6FA 1FTYA 3NOOA 3QRWA 1FRVA 3FOWA 5CH8A 1VL0A 4P22A 2AW5A 4PBTA 4W9NC 3W1VA 4C01A 2HIHA 5CX1A 2NTVA 3SF0A 2HLDA 4GEKA 5F2NA 2ZE8A 4B87A 1N2SA 2CXUA 5LXTB 3CHYA 1V26A 1MHTA 2C94A 2CDCA 3R7LA 3N2GB 2YCBA 4ES6A 2GFHA 5LM3A 3DL4A 1ZZGA 3H3FA 3DZHA 4ZVKA 4LPSA 2YXPX 4TWRA 3FGZA 4X95A 2EJVA 1P4RA 5KNBH 3RODA 1RW4A 5JYCA 1XN1A 3OQIA 4Q5IA 3OOEA 4DKXA 1GYPA 3PFWO 4PR3A 2B1QA 5DCWA 2ANCA 1HT3A 2H4JA 4MPRA 3ER9A 4QBTA 1CQXA 3O3CA 4KR9A 2DHQA 5LC1A 4OHZA 4EIWA 1SBHA 5BR1A 1L5NA 2NUBA 1SBQA 2BJHA 2I33A 4EA8A 5H68A 4HB2A 4BBAA 1U0BB 1GZSA 2CWWA 8ABPA 3RSZA 2C5GA 3IT2A 4R1SA 1TA9A 4CDNA 3FOCA 2WPDA 4EKGA 2N42A 4BOYA 3ELYA 4LF7B 2HF9A 1W5TA 1PX2A 1YA4A 2A3RA 4QBFA 3VKFA 1Z2OX 3FTCA 3BK2A 1N5OX 1DO0A 2QMOA 4FILA 4EJFA 2PBZA 2GRUA 2HH9A 3KU4A 4K88A 3LKDA 2EW2A 1T36A 3PGLA 1J0CA 1OQAA 3LX8A 4MIEA 4P53A 3L6DA 2VCYA 3NTXA 2LD4A 2R97A 3AOEC 3L8EA 3Q7RA 2O3TA 4KDFA 3ZI7A 2FPKA 2IOQA 1KYWA 3KO8A 2PQ0A 3H7IA 4IXMA 4Q4HB 4BO6A 5LJIA 2EFJA 2RHRA 1PP4A 5DP2A 4E08A 1OPRA 2OTCA 2VYVD 1FRQA 3CN9A 4FMBB 4F4JA 1US8A 3ADPA 1G64A 2EW1A 3GGGA 5FUYA 1OXMA 4N6OA 3KPWA 4FBGA 1R5NA 2QMZA 3QUCA 3D9QX 1O4VA 2QAGA 3EHDA 3KUXA 4B6QA 1HNWB 1WD7A 1MRSA 2JFHA 1GEGA 1L4UA 3NJ4A 1K68A 4YP9A 3UMBA 1N9KA 3VR0A 1KMHA 3OO0A 1LSJA 4RY0A 1QM5A 4PSDA 2HO4A 2Y1FA 2ODEA 3T1VA 5L7YA 5FLEX 3G9TA 2AG8A 3THOA 2J7PA 4BQPA 2PMDA 5JBNA 1QP0A 2WFAA 3PFFA 4E33A 5KAMA 1Z26A 1N57A 4MPJA 1U4NA 4WKGA 3RSLA 2X5NA 4CDMA 5AVXA 1CUIA 1CTQA 4GPTA 4LMPA 3Q40A 3KHSA 3QITA 2IYWA 5CJJA 1SIUA 5DN6D 2PT9A 5B58T 1TO6A 5KTRA 3B1KA 3CRQA 3Q2OA 3D7LA 3M6LA 4ZCIA 3MUNA 4Q4LA 1NQWA 1EH5A 4UE2A 1YNSA 1V7PC 1UKCA 1RQRA 2H00A 2PQ6A 2Z1DA 3NM5A 2FAXA 3M1AA 3PT5A 1T9HA 2H1CA 4EVSA 4DUGA 2H29A 1VRWA 3QF7A 4DR3B 4U6QA 1U90A 4UUNA 1RJWA 4AXBA 4KBGA 3EVFA 5TGTA 2A1TR 5B7GA 3B53X 4A2PA 3DULA 1O5OA 1PJTA 1WXFA 5CM8B 5C5DA 5ALGA 3R3UA 2FMHA 3BQMB 4FGWA 1NTOA 2W9XA 4EH1A 3DBHB 3G9UA 2UUCB 1TD9A 7ABPA 1T35A 1YWGO 3ESBA 4MGKR 4HZGA 1GD1O 1XAHA 5CXXA 8LDHA 3ADDA 3DCIA 2JKZA 1BDIA 2H06A 3B6KA 1Z06A 3RASA 4B4KA 1NUTA 3BUSA 1V35A 2FVYA 1VPTA 3DOUA 1UMCB 3CF0A 3REFA 4N4AA 4PPFA 3Q7SA 1TYBE 4R31A 4XR9A 1MBZA 1P0FA 2EWMA 5EPEA 2AMYA 2MHCA 4MICA 1XKQA 2CHFA 3P2EA 1A27A 3SSMA 2ZKIA 4C3VA 3C7AA 1U3VA 2GNAA 3DJYA 4GLFA 4XLLA 3L8MA 1NMZA 5DSZA 1L8LA 4PSUA 4YJHB 5ADUS 4MQ5A 2ROQA 1JHVA 1JHPA 1WZUA 4TMVA 4JDUA 3T9FA 1Q92A 3B52X 2X4IA 3RJ5A 4D81A 1UP7A 4E5YA 3SYKA 4M1OA 1FP6A 4J9VA 1R6UA 5E9WA 3R7WA 3WKDA 1F0YA 4R2IA 3MYRA 3GLQA 4YP7A 1DBWA 3VMFA 4KEAA 1XYYA 2XF2A 3D4PA 1F1JA 4L3VA 5IW8A 2L42A 1ZC4A 1E2IA 2O3UA 3M5PA 3EIOA 3DVAA 3PS9A 4GP9A 4LYDA 4NONA 4UHHA 4C43A 2NGRA 2NVBA 5ER9A 2HIMA 1Z29A 4S1PA 1J8VA 3GP3A 2VC2B 3TVYA 1QIIA 1RRGA 3GOHA 2CYCA 2ALJA 1ABBA 3BREA 1ZU4A 1NMEA 1ZGCA 2YJGA 3DEHA 1GL6A 3HPQA 3PQ5A 4KV7A 3NKLA 4IDQA 4EI2A 2HK8A 1CUVA 1Z7YA 2WM8A 1UBUS 1IB0A 2EOAA 4A5SA 3FUTA 3O3MB 3OI7A 4CQLB 4RK0A 3VI4B 5LQNA 1ZKDA 3LPDA 4BFUA 1XYGA 2X3FA 2PMKA 2PMFA 4UBMA 2CJXA 1WBDA 2J9XB 3DBLA 1ZI6A 3FWKA 1X7XA 1CUBA 1VYTA 2H51A 2J67A 1QOQB 3CLSC 1LV8A 1E3EA 1P7CA 1ZK1A 4V1CI 5DK4A 1U99A 3OFVA 3ZHOA 4FHFA 5K09A 4OLAA 5ARDA 1EVZA 1KI2A 1VE9A 4WJZA 2EU8A 4GX2A 3P2OA 3MJCA 1U2TA 4QBIA 1UADA 2CZQA 4XOUA 3WJ7A 3A3NA 3WMWA 3PNOA 1R16A 2C4TA 4GXQA 5HFJA 3B7PA 4L85A 3ZVRA 4ERNA 2PPVA 4EB8A 9ATCA 4MS3B 4BRUA 5KNDD 2EERA 3OKPA 2E48A 2OORA 3HVJA 4QU8A 1SB8A 1A2BA 2YX1A 2GD2A 1K2WA 3KLPX 3U7RA 3KOMA 4YHHB 5LA6F 5DCUA 5BSTA 3ZDQA 4V2UA 2Q2VA 4R71A 2XUZA 5KYKA 4NCNA 5EMNA 1SIOA 1VLVA 3CT6A 4DRYA 2MSDB 3GI1A 1DO8A 1KZYC 3HKDA 1AKWA 4J2TA 4X20A 3A1EA 5KWJA 2VZ0A 5K20A 1FXSA 3A4TA 1JYSA 3ONDA 4LHXA 2QQ5A 1YQTA 1GPH1 4I5DA 4P1ZA 5IVIA 1HDZA 1YOVA 4D45A 1IZ9A 1KR5A 1NVVQ 3EF0A 4FGLA 1I4OA 3PE4A 4QUKA 4CUZA 3H2SA 1ZRNA 1WULS 1GUZA 2BF7A 2BP7B 1YL5A 3NLLA 5KQSA 3HCWA 1JP7A 3OKFA 1IG3A 1ND6A 1G21A 2OFOA 1OH5A 2Q4DA 1RQNA 2VN8A 3W8DA 4CFYA 1XRJA 1JHDA 1HQKA 2PD6A 4MPPA 3GYGA 1Q91A 5K8TA 4DM3A 3KCQA 3LRTA 4MKXA 4WT7A 2C4MA 2OZLB 1ZIYA 4OK5A 4RGYA 1BD4A 3OT1B 3TZQA 1YQWA 4B2IA 2D5AA 4RETA 1E2PA 2QY6A 2YMQA 4FIDA 3B12A 1JSRA 3PC8C 3DE5X 4GMFA 2IXTA 2JH3A 1Z5VA 3BKWA 4C78A 2SCUB 4XTRA 4OL9A 1AK1A 4AKEA 3O4HA 3FNQA 2ZBUA 1VKHA 5BQ5A 3R9XA 1WSWA 2NPOA 2BUBA 2GETA 4NABA 1PVOA 2GBLC 2YY5A 3UJ3X 4E3ZA 3I0MA 5KKNB 3QU9A 3BWBA 2G77B 4OAPA 3L1JA 2GFIA 3O74A 4TN1A 4DLVA 1R88A 4DOMA 5JRDS 2HR1A 2IC5A 3L43A 4DCTA 1XELA 1TZ2A 1E69A 2JZCA 1KVRA 4FI3C 4Q9DA 1K8ZB 1EFVB 1SKYE 2P62A 4JP5A 1G6OA 2O6HA 2QVYX 3H8SA 3ZZ0A 4CDGA 3KJGA 4DCVA 2H1RA 1V48A 1JKXA 1LJUA 2GLTA 1I9CA 1NQVA 2XGGA 4OI1A 5KVCA 1S02A 3G2QA 4O25A 1Y6GA 2YHSA 1YR7A 3UKJA 3WGJA 4AKTA 1KWGA 4I9UA 5JSZA 2VUIB 2ZJOA 1PG0A 3BWVA 3W6NA 4IL5A 5KKAA 5FTMA 3SHWA 2ZS7A 2PYDA 3GB9A 3R77A 1QDEA 3N74A 5EIBC 1AQYA 2IF2A 4UUQA 2AE2A 2Y92A 3RVDA 5JARA 5EJAA 4RV5A 3E84A 3RNLA 1H8EA 1R64A 2F43B 3CGWA 3IAM1 4ZVNA 1D5WA 4AVYA 1OX5A 1RYYA 5HF9A 2PUWA 1O7JA 4L6AA 5BMVB 4ZJPA 2QN3A 3DNFA 1HV8A 1SC1A 3L05A 1FYXA 1TT7A 5C0OE 3HP1A 1YJQA 5BVGA 1LFDB 1KJWA 3EW9A 5K0TA 1PFKA 4Y8VA 5K0NA 2J5KA 1KAGA 4Y18A 5G1OA 4C03A 2W6QA 3ZY2A 1Q3HA 4UU8A 3KEFA 2G9VA 1U3CA 1UXHA 2ACWA 1FX0A 3DTNA 1IN8A 1NSFA 3FBTA 4MV6A 2FMTA 2EP5A 4I9GA 4MUGA 2W6IA 3VR3D 1U4SA 1FP2A 3F78A 2JGDB 3B3FA 1P39A 1NMYA 1E63A 2G08A 2N3ZA 2V55B 3E7PA 2XCQA 4ENVA 2HLDD 3WJ1A 4BGDA 5IJ0A 1GZVA 1RJ9B 4HGPA 5A4MS 3PCXA 3JQBA 1KZ4A 2VPYA 3K72B 4KW7A 1L4HA 1Z83A 3WK8A 2FJPA 4D42A 2H2FA 5IAEA 3UXEA 1AF4A 2XDAA 1XRPA 4WFJA 4IDNA 5CYPA 2GYUA 1I2DA 3GUUA 2V7BA 3QKRA 5LFAA 3O7MA 1XPJA 2LUOA 1D4ZA 4EGJA 2B3DA 3GCZA 4UPVA 1C1XB 1G8SA 4W5JA 1M1NA 1MNQA 1KZGB 3F5MA 3INTA 2COUA 4NJEA 3WI7A 3LU1A 1X9HA 2MU1A 4CI9A 3NBKA 4UAUA 1KGSA 2CUKA 1NT4A 4QNMA 4WAUA 2N1BA 2P41A 3KKEA 1YC5A 4X0EA 4ZEWA 1K6XA 3BGSA 1O87A 2FUNB 1MJGM 3VHRA 2WPDD 4UMDA 1JEDA 3EIHA 3GUYA 4IS3A 3KSDO 1ZH8A 1N34B 5C8YF 4LRYA 5ALFA 5CLLA 3D6NB 4H1TA 3ICOA 3WIDA 4HC4A 3QQ5A 1P44A 1NP3A 5E9AA 1A50B 2IDJA 2VP0A 3TD6A 5I9LA 3GFOA 5F7OA 2QX7A 3MPOA 4R84A 5LJLA 5LU8A 2GZSA 1J2EA 1JQKA 2JJMA 3RVPA 3HB7A 3TEJA 4KQ9A 4AJ1A 4CW7A 2PLFA 4EB6B 2CXHA 1D4OA 1RDFA 4EY7A 1YJCA 3O4IA 4O1MA 1GAXA 3F5QA 3K35A 3PUVA 4QPPA 1D2HA 3FWYA 3KZOA 4LWQA 2P8JA 3ZI4A 4O2AB 4LN1A 3CLUD 1MABB 4ZJZA 4CLRA 1Q1NA 3EWAA 3R6TA 4RGBA 3EVGA 2DU8A 1PF7E 1VMDA 2CVQA 4EJSA 2C59A 1LI5A 2FZGA 3JQDA 3K5HA 3MUFA 4P3NA 2VRBA 1BXRA 4F2GA 1PK7A 3NWPA 4AXXA 5K8UA 3AP3A 4N01A 2JNWA 2ZJ7A 4RANA 4BV2A 4LYJA 3QVJA 5TB5A 4YMGA 1M8KA 2J7PD 2EZUA 1Y4ZA 1W75A 4Y98A 5D1HA 3WNDA 4EI7A 1AH2A 1A95A 4BNJA 3NXSA 1YONA 2ZZKA 2XXBA 4C9BA 7YASA 4D9GA 4M86A 4CHTA 4KLNA 3A3YA 4ICIA 2YWJA 2OXEA 2XD4A 3PEVA 4UEWA 3ZWKA 3A7DA 5ALXA 2OPBA 4R69A 4AMVA 2CJWA 3IT0A 2C88A 4MWDA 4XYMA 1M6EX 3ZY4A 5JAOA 5L45A 4E70A 2VSQA 3FFXA 2REQB 4DV6B 1QIJA 4G67A 1Y7LA 3TUJC 3RVMA 2E4YA 5DBEX 4E13A 4DUGD 5JXHA 1H2EA 2VK1A 1V4NA 3ES9A 3MILA 4GX5A 2O8BB 1NW4A 2B0JA 2IXDA 2B34A 2XVAA 5FUWA 3TEFA 1JIKA 5JRJA 5IKXA 3D1JA 4D02A 5FWYA 4JI8B 4GSLA 1G66A 3N5CA 3O1HB 3OOHA 4IILA 4RAOA 1LDYA 5EQFA 4D99A 4EGSA 4H08A 2QUIA 5I8ZA 4BO4A 3DYVA 3NIBA 4QD3A 5ECWA 3F8SA 4GZ5A 3JQGA 1ZFNA 3PJFA 3WJ2A 3VU9B 1ESDA 5LQAA 4DLZA 2IEGA 5A02A 2RJOA 4S12A 5H3HA 4P3KA 1AS0A 1D2RA 1FNCA 4BUCA 3B20A 2PO7A 4YRFA 4CNBA 1ORTA 4PTYA 3U3KA 1FYFA 1ZIPA 3BG5A 4L50A 5ALOA 1GQOA 3SBDA 3R3JA 4CTKA 2BHRA 1GPWB 2VI5A 3NR2A 4Q7JB 3OHPA 4RMGA 4XVRA 5HRCA 3ESCA 4M22A 5M2QA 3WAGA 4CMHA 2IIPA 1QVZA 4RGVA 4HGZA 4F21A 1CRZA 3SFVA 2B4QA 2PL9A 3GT4A 2IQ5A 3OZWA 4DLRA 1UBMS 3M4JA 2O8FA 3WWCA 4BAZA 1BO6A 3O47A 2JLUA 1J9ZA 1QRAA 4J8PA 2IU0A 1SXJA 2BI4A 5NLLA 3UOAB 5JJIA 1QQ7A 3E4DA 3ZX4A 1ZA1A 2HMAA 4Z53A 3H5RA 1ONNA 1PJ2A 3FM9A 3PL5A 2QM7A 4BVHA 4H27A 4AW9A 3TB4A 1ZCBA 2WTBA 2FZVA 3O8DA 2F1JA 2V98A 5HA5A 4JI6B 4CJXA 1F8FA 3GGJA 3LT5A 4D9MA 4B80A 1DX4A 2REXB 4H16A 4Q3LA 6PFKA 4ZHQA 1FYDA 2WFLA 5C4IA 4LF4B 3U6KA 3KQUA 1GSIA 1I5EA 4QAJA 3I6ZA 3HHEA 1U28C 5B1HA 1UC5B 1QLJA 1YB5A 4HZIA 3PWTA 4B6GA 1UJ2A 3FOZA 1NAHA 3AYXB 4IDCA 2DLDA 3GVIA 3O8RA 4QTXA 2JHGA 1BCSA 3O4RA 5JEDA 2CLLB 2VXOA 1DUVG 1XJWA 2EKQA 2ZRNA 3K70D 2A1IA 3IP5A 4Z0PA 1BWPA 3NVDA 4ZI7B 1XQ1A 4JBXA 2APJA 3L1UA 3L7LA 3UBTA 1V1RB 1DB3A 1XRLA 2QUZA 4W1QA 2XHEA 1Z4QA 3NAZA 2WF7A 3BL5A 2HHLA 2PLRA 3QW2A 2WE7A 1CB0A 3BIOA 4S1NA 5J2UB 3ZUPA 3BMOB 1JKJA 1Z75A 3KZMA 3JU3A 2ZQ5A 1NQOA 3N2YA 3OQJA 4YPOA 4F2HA 2ZSJA 3NORA 5EKXA 4L9WA 2OGSA 4BZXA 2H54A 2CEAA 3PT9A 3BH0A 2O8VA 1ACJA 2XVZA 5GOZA 4I4IA 2UZ3A 4GPIB 2IPNA 3OMXA 4IZOA 5JQGA 3KEGA 4TS4A 2YWFA 5DB4A 2GJ4A 3N2EA 4A27A 3FUXA 3E9MA 1CEXA 4GW3A 4DMHA 5TX7A 3RBZA 3TEMA 3DAPA 4YP5A 1P2GA 2Q3FA 2GPWA 1IOZA 1KHHA 2WSBA 3H1TA 1BS1A 1J09A 3LCUA 4JODA 1DAMA 1NULA 3FF1A 3KQHA 2OAP1 1L5QA 1PSWA 1XVVA 1V41E 2FQQA 3AILA 4B8ZA 3SQNA 2XIJA 4DPKA 3UCFA 5JSHA 4N9WA 4YCCA 5JPIA 1MOZA 1PVVA 1FDTA 3D4LA 4WCVA 1Y3IA 1IIRA 3DE4X 3EVEA 1A4IA 1EB8A 3HBMA 3O26A 5CM9C 1PG5A 2NU6B 3SR3A 3W5DA 2NU7B 3ILSA 4F12A 1RM0A 1YQ9A 3VU0A 5EHNA 1YB4A 5LWQA 3ROQA 3FOEC 3IEPA 1YCHA 4MKGA 4OFWA 2IUUA 1T2EA 2IV3A 3HO8A 2X5OA 2GD0A 3QVVA 3GD7A 1EXWA 2EP8A 2QMYA 2R7LA 4MP6A 5EJGA 3SG0A 4BJ1A 2H1FA 3KYCB 5IFKA 1X7ZA 1P5FA 1TU0A 1F6DA 2FMIA 4UAJA 1UR5A 3UQZA 2IZ5A 2WM2A 4LA4A 4IRMA 4Y6LA 3TLBA 4JI3B 5JAZA 5FUXA 2DX7A 1XL1A 3WJAA 3P4XA 3OQVA 3I2IA 4PXSA 2QTRA 1GR1A 4INPA 2VP5A 1VCIA 4JJZA 3RHZA 3C45A 5TVGA 3SE7A 4F1JA 4CKWB 2F4VB 2QHXA 3AETA 3SOZA 3TCKA 4QG3A 4QM7A 2Y1KA 3AERA 4JKOA 2GKGA 3RHTA 3SD7A 3V46A 2QM3A 2PV0A 3LK7A 5KYUA 3KOUA 3HA2A 4WXMA 2MSWA 3WP1B 1PLLA 2J3DA 3AOEA 3DDWA 4C1NA 5B4VA 3U7HB 3A26A 3HDQA 4QXOA 5EWLA 3EVCA 4FM9A 1Y7PA 2G70A 1DKPA 4F38A 4V03A 1HE3A 4PLPA 1Z22A 1T9AA 1YAJA 5J4LA 3W9YA 3Q11A 3DLIA 4DLNA 1CQIA 1SZDA 1T1RA 1G5HA 3OX2A 3WYFA 2QR2A 1C9MA 2QBYB 4C14A 3EMKA 2LIVA 1ODSA 4JMPA 1IN6A 3RC9A 1TUBA 2G9RA 3II6X 4HDNA 1W76A 2OV2A 3FPSA 5CH3A 3O90A 1VL1A 2VFAA 3GPCA 3KKQA 4HGQA 4BATA 2P0YA 2H48A 2PK3A 3ZH9B 4U9UA 4E1AA 4Q1BA 1UEXC 1RTKA 3GVXA 3RVBA 5C37A 1RU3A 1W2GA 3I83A 1UL1X 5EQJB 2XCSB 3KBOA 1JX6A 4KL8S 5JCJA 2ONJA 4HFRA 3R5XA 1RYMA 1G18A 3KB1A 1EWRA 4Q1EA 1EM6A 4E15A 2BGRA 3EGOA 1Z4MA 1GNRA 4WA7A 2H0QA 2FWAA 4FIZA 4LOIA 4EMTA 5LZ9A 1KK3A 3FPAA 4O2BB 5DSXA 5C8DA 2RDMA 2CDBA 1ZLYA 6AT1A 3SM3A 3OLXA 5LB2A 5HILA 2PKQP 1H8ED 1HORA 1SVUA 3KJFA 1ACMA 1KI3A 1RAGA 1RHRA 3IHLA 4FB5A 5JSFA 1L1EA 2FKAA 3CB2A 3ZHRA 3EJ6A 1UWCA 2HCTA 3L9XA 4DXAA 2Y9PB 3QUTA 3TRKA 4EKDA 2DSNA 4K9KA 1E5LA 4UCWA 4B85A 1M8GA 3CNOA 3WWDA 2WWVD 2WTMA 3IB3A 4MVJM 1ULHA 2ZSDA 2ORED 1Y5IA 1KQFA 3KOOA 4ML3A 4RORA 4CM4B 1P75A 1IXKA 1GY8A 3CEAA 4ZOLF 5F3DA 5JSYA 3I2KA 4ZMRA 2FR8C 4CLOB 1PR9A 4V0LA 3DHWC 5K8CA 3OZTA 4BLQA 3BVPA 2W6ID 1VE1A 4TZKA 3U3RA 2HLHA 1KNQA 4RV4A 1S3GA 2XB9A 3FPFA 3U1VA 4DGSA 1FMFA 1JHYA 4CL3A 5B3KA 1IBKB 1NY5A 1L5RA 2IPAB 1RHMA 4KQGA 3F90A 1NX9A 2ZUSA 3U7QA 4CGYA 2Z3VA 1OBOA 2RSLA 3UTDA 3HZHA 4EMSA 2V54A 3IVMA 4JS0A 3IIKA 3GLSA 1XJCA 10MHA 3BCRA 1VSUA 5SYNA 1JPNA 3C48A 2VEDA 1ZIOA 3OPYA 1OF1A 2ZZMA 4DSZA 5K4GA 5G02A 1HE1C 1Q0ZA 3H1EA 2ODBA 1QMPA 2GM4A 5KWSA 3ZWAA 2AXPA 4BZQA 1Q7CA 2Q3LA 5LOVA 1SK8A 2H7XA 4K0RA 4TROA 2ZBRA 5L53A 1P1IA 4WESB 3LQ1A 2OCIA 1I3LA 5JYBA 1UJBA 4MQEB 4YC7A 3D6HA 3EYAA 4CTJA 1R4NA 5CA0B 3U80A 3K2BA 3LXUX 2YN2A 1O58A 3BQNB 2YUTA 4JR2A 4OJTA 3PGA1 2PQ2A 4F4UA 5AKYA 1T26A 2QT0A 2ZUEA 3HDTA 2ZJAA 1QK4A 4L0DA 4NBWA 5ICFA 4CUJA 5GY7A 2PKQO 2WAXA 4ARIA 1H4VB 1J42A 2R1TB 3ENZA 3CRVA 5ICSA 4KVGA 5MF6A 3DW3X 3GVPA 3HU3A 2ISCA 2XTZA 3S81A 1L4KA 1O77A 3RJTA 4YRAA 2GN9A 3IAS1 4GBED 1JTEA 1GITA 1ZBDA 1IYZA 3GJZA 3RWBA 1SG9A 4E6PA 3WFIA 1MJFA 2QEQA 3K8YA 4KQMA 5TRTA 4Q7QA 1OXVA 1DS6A 2HQ1A 3BIFA 3E2IA 3K1TA 5LQRA 4OLJA 1HUQA 1P3Y1 1UZLA 4HLQB 1JS1X 2HA3A 2WKPA 3O3OB 5FV7A 2EWVA 5IH7A 4GVLA 1TLLA 4N8EA 5DPMA 1E1RA 2C83A 2H1SA 3OEWA 2AA3A 2BTQB 4OXYA 1XEWY 1P33A 5B6PA 2A0YA 3EMDA 1ZY2A 1K75A 3K31A 1C7FA 1QTNA 3IOMA 4DDUA 1JDPA 1TCCA 2W11A 3EF1A 2V59A 3MCZA 4DJJA 2QTGA 2JEYA 1Z0DA 2C7GA 2BMAA 2XA9A 2JCYA 5TMEA 2P2GA 5JC1A 4DCGA 1ZD5A 4MYTA 4C5BA 1R1DA 3WGLA 2ET6A 3D31A 1U0RA 1YQGA 3BM5A 3FWNA 3L6BA 3T3HA 2B7BA 3C1UA 3K0KA 3QFHA 4NCAA 3SZGA 5FFNA 1QHHB 3GC6A 3OUZA 3K9CA 1G3IA 2ZI4A 1BWRA 1ESCA 3LHKA 4IGEA 1FB5A 2FZ4A 4UOZA 3LQ2A 4QSHA 5EZ6B 1VKOA 4WXPA 1PGQA 3T9EA 1BGXT 4TV9B 3HI4A 1ULTA 1KRWA 4FDTA 2B82A 4BTLA 1Y1LA 1U5BA 4F91B 4KQKA 1UBJS 2WF8A 3CX6A 5FFFA 1DHRA 1URPA 2KBEA 5A5VA 1ULAA 1X2BA 1N2EA 1PSZA 1ZM9A 4KIUA 3OPMA 4RZXA 1VCNA 3WIVA 4I50F 1FZQA 2WJ6A 1XTTA 4HK4A 2HPAA 5HX7A 5FKJA 1M1YE 3P2KA 1BOFA 2V5AA 3CF4G 3ONVA 3FCEA 4A6DA 4EKEA 1HNZB 4HRYA 4I3HA 3WDSA 1RC0A 4IFBA 5IKPA 1WBJB 4KLAA 1T0PA 1XZIA 2CC2A 1GLGA 2Q1UA 4G0PA 3ZHCA 4B75A 1TU4A 1N4DA 4LIPD 1EXMA 4LMAA 3NC4A 5JSUA 1W34A 4X7BA 3CRRA 1WUHS 3PC8A 4JBGA 1HK7A 2O5VA 4G4GA 4WXRA 3TSAA 2WU8A 5GGYA 1W8DA 3LL7A 3GT3A 1NR7A