4E07A

Parf-amppcp-c2221 form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
205
Chain Sequence
b'MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQASRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
molecule keywords Plasmid partitioning protein ParF
source organism Escherichia coli
molecule tags Unknown function
total genus 56
structure length 205
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e07A00
2ZRDA 1J7KA 1BH2A 3WP1B 1U2RA 3FHOA 3PV0A 1OYYA 4LDJA 1AJEA 2DYKA 1JXMA 3DM5A 2NOAA 1E2LA 1NLZA 5FOWA 1J90A 2C9YA 4EJSC 2B7CA 4PC3A 1DAIA 3LQQA 5AUPB 2GHIA 5KPJA 1U94A 4B32A 4MDFA 4RJLA 1G21E 1YVDA 3EC1A 1D5CA 1Z08A 1TQ4A 3SYKA 3PG5A 3GJXC 2A5YB 1LS6A 1OYWA 3EARA 5JJLA 1G7CA 1ZD9A 4JYBA 3N2EA 3NBYC 4KFUA 1XF9A 4RCYA 4UNNA 2IX3A 1RJ9B 3BE4A 3RLFA 1SXJE 3UK6A 2V9PA 4WZBE 1AS2A 1KDRA 2ZAMA 3AKCA 3RWMB 3GMTA 4PR0A 3DDCA 1P9NA 1UBFA 4LUCA 2H16A 4OK3A 3THYA 3PEYA 1GVNB 521PA 1VIAA 2FSFA 1L4UA 1SKYE 2IUTA 1W44A 4GOXA 3OE7D 2ZE5A 1IAQA 1G41A 1X6VA 4DC9A 3VR2A 4C9BA 2HF8A 1G3QA 2BHRA 1KZGB 2V3CC 4ASUD 2J87A 5CLLA 1NLFA 4Q1AA 1Y3AA 3TLXA 1TEVA 4FWTA 2PJRA 1NJFA 3IEVA 3MAAC 5KSPA 5CK4A 2ZVPX 3EPHA 4LY6A 1QHSA 1W5TA 1S1MA 3K09A 1XP8A 1DEKA 2O0JA 5FTLA 2CVFA 1OW3B 1TUEA 4OJKA 4MKIA 3NKVA 4LJ6A 4L9WA 2JA1A 4D26A 1OH6A 2K5UA 5F98A 1SQ5A 2OCYC 1RRGA 4B43A 4FN5A 3RC8A 4JJKA 4Q9LA 2LWIA 2P0EA 2YWEA 3AH8A 4GOKA 3V00A 1U0LA 2ANCA 2WKQA 3WBKA 2J0QA 4DB4A 4LHVA 1CIPA 3HYTA 4Q9IA 1G8GA 4R71A 2WICA 2A78A 1PZNA 1U0HC 3QXCA 3GP8A 1IJEA 1N0UA 2JJ2A 3B5JA 2HJGA 3LVRE 3W3AA 1U99A 3WYGA 1ZUHA 1XJ0A 2F1RA 3VKWA 4TLDA 4WXRA 1NP6A 3K0AA 1TU4A 1E2HA 4OQLA 1HQCA 4JVNA 2YVUA 3TH5A 1XD2B 2BV3A 2IF0A 2Z83A 2WWHA 4TYWA 1Q57A 2OFXA 4ZV4A 3RSLA 4I1VA 1E32A 4QJ4A 2IYRA 2QBYB 4Y0AA 2ZI6A 4CDGA 5FTKA 3EASA 1TNDA 2YWHA 2YINC 4EJSA 1M1YE 3EW9A 3QQ5A 1XTJA 2PZFA 3SEAA 2W2TA 5EZ5A 1D2NA 1XTIA 2CCKA 4RZ3A 2H17A 4B47A 3T1QA 4Z54A 1ZINA 1LTQA 3QXJA 4TMTA 1RYFA 5GJVC 3RS0A 3ICEA 5FBLB 2F6RA 1COWA 4MKGA 5FTMA 1A5TA 3KXIA 3H2YA 1NVXQ 4NHOA 3U3MA 3CZPA 1HH4A 1KOFA 4RD6A 2ZRJA 3FKSD 2PH1A 2DFTA 4PSKA 1UDXA 1ZUIA 4JLVA 1G8FA 2O52A 2HUPA 3TR5A 3AVVA 1XRJA 4XWKA 2C98A 4Q7JB 3A1SA 5ELXA 2ODNA 2AWOA 2BBTA 3G82C 2XITA 5HTKA 4FI3C 3EX7C 4QGHA 5B64A 3VU9B 5BW8A 2XGJA 1KO8A 4URXR 3KKQA 4EPXA 5HZHA 1E2NA 4LBVA 4RD0A 3SDZA 4UJ5A 2CL7X 3D31A 3A37A 3LNCA 4DLTA 2XB2A 2WSMA 1XNJA 1RRFA 5JSZB 4YMVA 1Z83A 3X1WA 2V8OA 3WYAA 2DHRA 1FNNA 3WMFA 2NTYC 4UXJA 5SZJA 3K9GA 4X8LA 1N25A 1YZLA 1Z6XA 1G3MA 1VCIA 2ZRPA 3WY9A 2OUKA 1EFHA 3RRMA 2GJSA 1UPTA 3LAWA 1I4TD 3BOSA 3FB4A 5HCNA 3SJZA 2DB3A 5KUTA 1FX0B 3FTQA 4JBYA 4LC1A 1E96A 4TMWA 1KI1A 2A5DA 4K81B 2WTUA 4EPVA 3L8YA 2WJJA 1M6NA 3TSWA 4A4DA 3EPLA 5J4LA 2EYUA 2QMHA 1ZU4A 4KXFB 2ZJYA 2ZREA 3PUZA 4I1UA 5AR1A 3PENA 2Q9CA 4S35A 2JDID 2GA8A 3VQTA 3O8CA 2ORVA 1OIXA 3FHTA 1P72A 5F3WB 4R98A 4D4MA 1G8HA 4CW7A 4F91B 5KDDA 1AS0A 1E2KA 1QHIA 2CCJA 2Q6TA 3QXHA 1KI7A 3U3JA 5FL7A 1G8YA 1P2SA 1CJMA 3SN6A 1NIPA 3EA5A 1NBMD 2VHJA 3BFXA 2JGNA 1UEJA 2CCGA 2J0UB 3H4MA 3OZXA 2EFEB 4KI0A 3ZGXA 1W2HA 1T8UA 1ZC3A 4DSUA 2RGDA 2YOHA 5JCPA 5JSZA 4NDZA 2UZIR 2F9LA 4LSGA 2VHUA 4ACBA 1G5PA 2WJVA 4XSHA 4NU0A 1XJCA 2YOFA 4URWR 4KFSA 2WWWA 3VKHA 1E1QD 3P27A 2ZSAA 3ZYCA 4C0JA 1K8RA 2WWGA 5CDFA 1KAGA 1P9WA 1FX0A 1ZD8A 2GZHA 2WVJA 2XX3A 4KSBA 4PAQA 1GRRA 2CLDX 4OKSA 3NTUA 1II0A 4HAVA 4TSFA 3ADCA 1Q1EA 1Q3HA 1T3HA 3HPQA 5DYIA 1MH1A 2CE2X 1IN6A 1QHXA 5GJCA 3PFIA 1V43A 3LW8A 4AC9A 5JZVA 3MLEA 5FTJA 1E98A 2RH5A 2BBWA 2ZR0A 4EFMA 3MG9A 1HV8A 1DVRA 1DS6A 2NO1A 1G7SA 4JKIA 4M1OA 4AYTA 4TT3A 3ONWA 2JJ1A 1W4AA 1OSNA 2A2ZA 3H86A 3THXA 4CEIB 1G3UA 2C8VA 2IL1A 4TYPA 3QBVA 3CBQA 2J3EA 1QHHB 1QVRA 1OF1A 4M8NE 2CLSA 2GJAA 1LY1A 1Z3IX 4FMCB 5JMTA 5LDDC 4L5BA 1CRQA 2FGKA 3AKYA 3CR8A 5TV2A 4D4JA 1XDBA 2NIPA 1OE0A 2W58A 1XTRA 1Z8FA 3BB3A 3IBYA 4J0QA 1EFTA 3OHMA 4Q5IA 1ZW6A 2ATXA 4Q4JA 5KDOA 5HE8A 1CJKC 3QF7A 3GLIB 4QM6A 3CPJB 1VYTA 1AS3A 3B1ZA 1T3SA 4N1AA 2ZRBA 3FVQA 3O8DA 4UXIA 1GM5A 1F48A 3BORA 3DZ8A 1VECA 1WXQA 3LBIA 2MMCA 3ZLJA 1Z0FA 3WYFA 1DAHA 4TMXA 4IDHA 3M0EA 1P7CA 4PAOA 3QJYA 4JT2A 1KSHA 5AWFC 1QRAA 4Q21A 2Z6VA 3GLFA 2AK2A 4PTLA 5JJIA 2CL6X 1A2BA 3NH6A 4EQ6B 4Q66C 1QBKC 4QBIA 1KSJA 2ODWA 5LD2C 1E2FA 3TQCA 4Q01A 4DLRA 3DPUA 2XNSA 1JR3E 2NPIA 3CRQA 2GZAA 4DBLC 1RVDA 3HP1A 1E9RA 3WNDA 4BEJA 5SZKB 2HYIC 2CMKA 2ZE8A 3OFND 1W0JA 2HT6A 4IFEA 3T35A 3GEIA 4P4TA 4OQXA 3QKTA 1ZNYA 4CEIA 4TMZA 2CK3A 4WZAE 2ZEJA 4TN1A 4V0OA 5E95A 1OFIA 1AKYA 4C0SA 2BIFA 2ZXUA 4PHFA 2WV9A 2QROA 4US0R 1MO5A 2VSFA 1MRSA 3NDBB 3ZH9B 4B3BA 2OESA 4XVQA 4D0GA 3QEOA 4F7WA 2Q9BA 3A4MA 3T1TA 5BN5A 4URUR 1XEFA 2QMOA 3QXXA 1TF7A 4O3MA 3TR0A 2D7CA 1NVUQ 4NYMR 2GK6A 3U7EB 4B74A 3QF4B 4XIGS 5FOSA 4IOLA 2VTKA 3CNOA 3EZFA 3DMNA 4C7OB 1G291 4DCTA 4E07A 3IUYA 2YWGA 4GZMA 2CDNA 3I72A 4BRUA 3Q85A 5LD2B 4IJMA 1N0VC 3KQNA 1KSFX 1WBBA 1KIMA 3VR6A 2J1LA 4JMPA 5FUXA 3U4QB 3BXZA 2QP4A 2QA5A 4D4KA 1FUUA 5EE0A 3CRVA 5D3MA 5H68A 3AVOA 2EW1A 4QL3A 4HB2A 2W6JA 4QHYA 3D3QA 1GZSA 4PO8A 5C2JB 2QAGC 3QVUA 4BPBA 2BOVA 3NWJA 3U61B 1Q22A 2A30A 2ZANA 1TQDA 2P6RA 3AP2A 1G8PA 4QGGA 5DGXA 1XU4A 1OFUX 2J5XA 1WE2A 1AZSC 2J45A 2VRWA 1Z06A 4JIMA 5J5CA 2VSXA 3I61A 1HE1C 2BKUA 1GP2A 4PC6A 4TTQA 2HXYA 3WMEA 4A1FA 1XD9A 4PPFA 3L8ZA 4D81A 3NG1A 2KSQA 2N1BA 2FE4A 3K1JA 3A1WA 1SVMA 4OL0A 4BFZA 1PVOA 1KI8A 3HJNA 4RFSB 2J41A 2V55B 3GLHE 4DSOA 3QF4A 1M34E 1NLYA 4Q19A 1CP2A 2KB0A 5FUVA 1NN0A 3PUXA 2XJ4A 4PC7A 4DLWA 2ORIA 1P3JA 1LF5A 5AJVB 2WOOA 4X8MA 2R2AA 2L0XA 3VFDA 1QDEA 2D74A 1K5DA 2QSYA 4QM7A 3BB4A 5CITA 2QPAA 1G5RA 5KDLA 5L3RA 3LWNA 4YDSA 4LHYA 3X1DA 3EIHA 4PXAA 2R62A 1T8TA 1RC8A 4C2UA 4AG6A 2JJ2D 4WXPA 4QHSA 4DKXA 1CLUA 4IDQA 3RS3A 3B82A 1S9HA 2BM1A 2IYVA 3D8BA 3CLVA 3IO5A 4QGAA 2RGEA 2DWQA 3SU8A 1G1MA 1IQPA 1SVOA 1Y63A 2QAGB 2ZYWX 3KDSE 4M1YA 4Q1CA 3ZVMA 1GOTA 5SZIA 4ARZA 1XMIA 2A5FA 1GKIA 2MSCB 1ZP6A 3OEEA 4KYUA 4BFUA 4A6XA 4JKYA 2G88A 2DBYA 3Q7QA 4MYCA 3NBZC 4EFLA 2X2EA 3MWYW 4FD2A 2H5EA 4BQSA 3CX8A 2GF9A 4B2IA 1E1RA 3NC0C 1Q20A 3K0FA 2C99A 3I8XA 1XXHE 3PUYA 4D0LB 1E2PA 1NIJA 1W4CA 4DLUA 1IONA 5EP2A 3LVQE 3WHLA 1JJ7A 4G1UC 1OIWA 1B23P 3HWSA 2YV5A 3HR8A 2ZM5A 3U7HB 4M9XA 1R0WA 1COWD 2JIZA 1GTVA 5J4KA 4M21A 4A2WA 1CTQA 2FSGA 1XZPA 1OV4A 4QHTA 5L3QB 3GQBA 1NMYA 2GNOA 3VNVA 2KWIA 3L43A 3B9PA 3GCGA 1TF2A 2CLCX 3U44B 3C14C 2GF0A 2BJWA 1YZNA 4OQNA 4ZDJA 1E9BA 3DMDA 4HLCA 1EG7A 4HEJA 5A4JA 2F1IA 1XX6A 2X77A 3Q7PA 5CLQA 3AUXA 4U7DA 2OEPA 3IEUA 1YHNA 2VP6A 1BYUA 2QM8A 5DH9A 1ETUA 4NL4H 3ZQ6A 2F3RA 4XTCS 3SJAA 5FBQB 3QY0A 4MITA 5GVRA 4HZIA 4XTRA 1ZNZA 4FWIB 2GEVA 2PLRA 4N3NA 2ZI7A 4BLOA 3AKDA 4EAQA 1VG0B 2FSIA 3DKPA 5AUOB 4PQYA 1U90A 2RGXA 2YOGA 2QGZA 3ASYA 4LJYA 3MJHA 4EKDA 4S2EA 1TTTA 3E70C 3KJHA 5KSOA 3SQXA 4BGDA 4BUJA 2O8CB 3T12A 3I92A 5L3QA 3TAUA 2FPKA 1JECA 3C5CA 1XTQA 3Q3JB 621PA 3WMGA 3UG7A 1IBRA 3SBEA 1DBSA 2G9NA 4TTRA 2Y8EA 2OM2A 2EVWX 3U44A 4MQBA 1H8EA 2JLUA 2AFIE 2KBFA 2VO1A 4RZ2A 3VMFA 2QG6A 5FL7D 2QMUA 3VAAA 2GCOA 1XPUA 4URVR 3QI2A 3MD0A 4AYXA 5BYKA 3A4LA 1Q44A 3BD9A 3K0CC 4B2PA 3THWA 1CXZA 2IK8A 5J4VA 4BZPA 2P6NA 5AJWA 3BFKA 4TYQA 2VQSA 2OAP1 4A0FA 3AVYA 2ERYA 2PT5A 2FV8A 1CBUA 1KTVA 4HAXA 2BMJA 3KFVA 5LB2A 4QBHA 1CRPA 4DUGA 2NO9A 1VYUA 3AUYA 5FI0B 5H70A 4P3YA 3U3OA 4GZLA 2FEMA 4OHZA 4DSNA 3RHFA 2QP3A 1ESMA 2GJ9A 3U7FB 1XEWY 4TSFD 5BN3A 1LFDB 4B73A 2Q3FA 2BVNA 2IYLD 3O8BA 3VTKA 3P26A 3A1VA 4UNPA 3DVLA 3SS8A 4BLPA 3PEVA 1U98A 2OBLA 2ZS7A 2CNWA 3HYRA 3IKJA 3KUDA 5JLJA 5KU1A 4D6PA 1R5OA 3B7GA 4NCIA 4BASA 1Z0JA 1A4RA 2JLWA 3GEHA 2IS1A 4DIEA 2FH5B 4DDWA 4TT3D 3IIMA 1G3RA 5FOUA 1QG4A 1T3LA 2JJ1D 3LXRA 2YHSA 2OXCA 4KBFA 4V03A 4MYHA 2ZJZA 4O0MA 1HA3A 3P4XA 4MRNA 2PCLA 3KUCA 3B85A 2ZJ5A 1AA9A 1KO4A 4I99A 4B6FA 2Z43A 3CPEA 1DAGA 4LX0A 3TVTA 4QKQA 4PX9A 4NKRA 4PQRA 4PZZA 1XEXA 4TTPA 2R6GA 3VKGA 2GCNA 4GFDA 3TW4A 2NO7A 5EQTA 5JCZA 3B2EA 4U00A 3FMPB 4JLJA 4AKIA 1P5ZB 2DFKB 4C4PA 4UNSA 4E5UA 3NDPA 2OO7A 1XMJA 4LHWA 2R6FA 3AKEA 3GLIE 2GBLC 3RVBA 5HZKA 1KK2A 2C03A 1F5NA 2VA8A 2O0KA 4TLAA 5CM9C 2J7PA 5CK5A 2I1VB 1OB5A 1GL6A 2QM7A 3CRRA 1LF0A 4QRHA 4YMUA 4MRRA 4DLVA 3MUFA 3MRSA 1TQ2A 1G6OA 1VCMA 5B58C 5FOXA 2PCJA 3BRWD 1XCGB 1VG1A 5B57C 1Z5ZA 1YZTA 1A82A 1Q1ZA 4LPKA 4TZ6A 2EU8A 4JYCA 1SVKA 4TLBA 4L16A 1W0JD 3K0AB 4Q4AB 4Z8XA 1WBDA 2WWIA 1NVWQ 2ZJ2A 2O8BA 2CK3D 1SGWA 4CEJA 4OK6A 4OHVA 3DOFA 2FOLA 2BEKA 1XWIA 2I1QA 3QKRA 2VSOA 1G20E 5HKKA 1T5IA 3L82B 3UANA 1DAMA 2ZI9A 3K0CA 5SZHB 4HUTA 5DYGA 1E3MA 2D2EA 1YQTA 1PLJA 1G5TA 4IEEA 4JLOA 3SQWA 3L0PA 3W9YA 4M1MA 3KXLA 4AYWA 1KO1A 2OBNA 2AKYA 1RYHA 2OG2A 4O2LA 5FPKA 4EJSB 4I1OA 1WDTA 5DISB 1HT2E 2VPPA 1Z6YA 3PEWA 1XMVA 3AEZA 3OIWA 4ABYA 5DIFA 1SZPA 2IW3A 3E2IA 2REOA 3ND8A 3ZQJA 1X86B 4FMBB 2GK7A 5JFGA 1KY3A 4B48A 2H57A 3TUZC 1E2IA 4PC2A 1Z6AA 4RSGA 3SI7A 2VHCA 3QOFA 4L9SA 2DWOA 4ZIRA 1GNPA 3M6AA 1OHHA 5JS7A 5J47A 3R9IA 3ZZ0A 2CHQA 2NO0A 1DOAA 4CT5A 5FFMA 4Q4AA 2IUSA 1NMXA 1J8MF 1TMKA 2EWWA 2WHXA 1II9A 1GRNA 3QPUA 2CXXA 3SJBA 4IDOA 2PEYA 3AP1A 2W6JD 5EXPA 3TSZA 2ZRMA 5K8LA 1E9CA 2BDTA 2REBA 4YQFA 4Q4HB 4NH0A 1OXXK 4LJ5A 2NPFA 4JL5A 3MWLA 4A0RA 1D9ZA 3NHBA 5DI3B 2JLYA 1R7RA 1SVWA 4JLMA 5JEDA 1CR0A 4YDHB 1WQ1R 2ZRGA 2BC9A 4M53A 3CF2A 1VG8A 4R7ZA 1YR8A 4KLZA 1KDOA 1J99A 1CU1A 3B9QA 1MO4A 1IXRC 1VDZA 4A8JC 2FFHA 2NO6A 2DR3A 2RB4A 4KFTA 2ODEA 3A36A 3B1VA 3ZDQA 4Q1BA 2GBLA 1L4YA 3OEHD 3CB4A 3OIYA 4GOJA 4IVRA 1UF9A 5DHAA 2WIAA 1KMQA 4W5JA 1VHLA 2BM0A 2AR7A 2RGAA 1E2MA 5BN4A 2OV2A 4UNRA 1P9RA 1RPZA 1OLOA 4GL2A 2QQEA 3OIVA 4JJZA 4P4UA 4AG5A 2QE7A 2VBCA 2HJVA 2X1VA 2AX4A 2H7VA 3HPRA 4RKEA 3SJCA 4A0GA 1W5SA 4AIIA 2QZ4A 1ONBA 1NRJB 1FZQA 3KJIA 2O5VA 2ZUDA 3CW2A 2VP0A 1ZAKA 2FF7A 1NJGA 1YZKA 2VP9A 3LLUA 4B71A 3DM9B 2EWVA 1TUIA 1AQYA 1Z28A 1MO3A 1MRNA 3H1TA 1Z29A 1R6BX 1NBME 1ZM9A 4C0KA 4Q4HA 1Z2AA 1UBCA 2XZOA 2QMEA 2MSDB 3B6EA 1G9XA 1E6CA 4QFMA 5TVKA 3VR4A 2EFGA 5DI3A 3WNCA 3GLGA 3W5IA 3A1UA 2WJHA 2H18A 4NCJA 4DCVA 3OEED 4JT4A 2N46A 4G5GA 2Q3MA 1XMSA 1E0KA 2GAAA 4LV5B 4D80A 4HB0A 2PX0A 1NMZA 3KL4A 2V1XA 4A8JB 3P32A 2IWRA 3AF3A 1E1RD 1YZGA 2GTPA 3EWSA 4G0NA 2JLVA 3AVPA 4Q00A 5A0FA 3BWDD 5E7JA 1NI3A 3MFYA 1XXHA 2D62A 3RRYA 2VIIA 5AUQA 2FPLA 1KI4A 3IHWA 4UXHA 2IYXA 2BBSA 3T5DA 2QSZA 3BFVA 2J0VA 2ZTSA 3C15C 2NG1A 4M9QA 1T91A 2BEJA 3A1TA 4TYYA 4II7A 3NEJA 1L7VC 4O2RA 3G5UA 2V54A 4IDNA 4UJ3A 2JIZD 4WIAA 3THXB 4DCSA 2ZSEA 5KOYA 4HAZA 4P0TA 3JZAA 3F8TA 1N0WA 1MT0A 3KTAA 1AZTA 4IVQA 2YWFA 3CH4B 4BLQA 1U0JA 2C96A 2OCAA 4L4UA 5JI2E 1D6JA 4Q4JB 4ZCMA 2AXPA 2UVQA 3K70C 3PIRA 1F2TA 4LWZA 2W6IA 1IOZA 4LJ9A 2MMGA 2BKEA 1WP9A 3K53A 2GXSA 3QPVA 3AF1A 2ZQ5A 1M7GA 4FMCF 2YC4C 1YKSA 5DO9A 3I3SR 5FUWA 1U8AA 4RVCA 4A8JA 4MYTA 4DJTA 1EFRA 1S4QA 4H1VA 3GLFB 3SE0A 5EE1A 3V4FA 4W7SA 1FMJA 1KJWA 4GP7A 4QC2A 4V0ME 4F38A 2QP9X 4A2PA 1MV5A 3LDAA 1SXJC 3W8RA 1Z47A 5JS8A 1TPZA 4MRVA 5JRJA 2QUZA 4EDHA 2IS2A 3FWYA 1HT1E 4ZDWA 4M9SA 1BKDR 4WW0A 4LYAA 1YZQA 4AURA 1WA5A 2IXEA 4BRWA 3PEUA 3RS2A 1ZCBA 4JLNA 1I4DD 4KYIB 3ZS8A 1H8ED 1ZYUA 2V7QA 2CVHA 4A6PA 3U5ZB 2ZRHA 4Q03A 1FL9A 1NSFA 1P2VA 2WIBA 3EC2A 4W5HA 5IHPA 4PQFA 3PXGA 5EE3A 4QJ5A 2ZRFA 1W0KA 1WCV1 1I4LD 2QTFA 4L8GA 3TBKA 1D9XA 4KSCA 2Q0HA 2PX3A 3K9LA 4BFSA 2G1KA 2KJQA 1UKEA 5GVSA 1VTKA 4RY2A 2Q3HA 4C0AC 2D7DA 2ZRNA 4DUGD 2DPXA 2OLJA 3FYHA 4KLNA 3TUJC 1VPLA 3FFAA 1M2OB 3SR0A 4B33A 3AVUA 2ZR7A 2GVDC 1I2DA 1P75A 2ZJBA 3CKLA 5J40A 4P4SB 4HYYA 3PUVA 4Q18A 4HLQB 1WF3A 5FOTA 2FFBA 1SXJB 2WWXA 3CRW1 3QNUA 2JEOA 4OHYA 4TL6A 2CNWD 3T5GA 5D3MB 2C9OA 3X2SA 3W6PA 4DLYA 1BMFA 3TQFA 3I62A 1XCMA 2VLIA 2NZ8A 1EWQA 1W1WA 2VF7A 2ZAOA 2ZSFA 4OI4A 5P21A 1LV7A 2WPDA 1IN5A 1IN7A 1N6HA 3LBNA 4PHHA 1TX4B 3BB1A 3SYLA 3K0SA 1MR3F 5ANRB 2XXAA 2FU5C 4DZZA 3U60B 4QXAA 1N6LA 4FMDF 1N6KA 2D3WA 2ZJ8A 4OHWA 4EPRA 2IYYA 5H8WA 2G77B 2XB4A 3LQRA 1ZD1A 2JLRA 2D06A 3LD9A 4RD3A 3UXMA 4FIDA 2WAXA 1M7BA 3W3ZB 3OAAA 5AK0A 1KYIA 2REXB 2B8WA 2IEZA 3IBGA 4CGZA 1JAHA 3JVVA 5TDHA 4NONA 2OHFA 3TW8B 3W6OA 2WOJA 1H8HA 2PMKA 4XVUA 3TE6A 3DZDA 1GILA 2EFHB 1J2JA 1NG1A 4F4CA 2D2FA 1R5NA 4M9ZA 3LV8A 4NYJR 2J7PD 3FOZA 1YRBA 3QPWA 1N6RA 3GJ8A 4LHZA 4P4SA 4PSAA 5AJZA 4B34A 4MKHA 1DADA 2IWHA 2RHMA 1XTKA 3WBJA 4DSTA 1SXJA 2BMFA 4H9GA 1CEEA 3VX3A 3KQKA 1OKKA 4JBWA 5GJBA 2QNRA 1VIYA 5HCIA 1Q3TA 4A2QA 3C16C 2F7SA 4HI0E 2JLXA 1C9KA 1OXSC 3NHAA 1PLKA 1VKJA 4XOIA 3EZ9A 2J59A 1K5GA 2FJUA 3D6TB 5TY0A 4DDTA 1JQLB 2GJ8A 1OXTA 3JVUA 3BC1A 2I4IA 4YXWA 1Q1QA 1NKTA 2ZJOA 4JSYA 3ZVLA 2O8FA 4PHTA 1OJLA 3EPJA 2R6CA 1E9FA 4ARZB 5EJEA 4WBSA 4PZLA 4E22A 5HKKD 1NVVR 1KMHB 2OSBA 2R8RA 4LK2A 1PJRA 1IY1A 3TAHA 2EQBA 4I4LA 3U2QA 4MH0R 1QHYA 3K0FB 2DFLA 2ZUCA 1P2TA 3AQ4A 4ZDIA 1JJVA 2WMNB 1HEIA 5AJXA 3UPUA 4AI6A 4IDPA 4IEIA 3P4YA 3CZQA 221PA 2LKDA 8OHMA 2F1HA 1DPFA 1AQUA 4FCVA 3W6NA 1HE8B 1US8A 2WWYA 2G0TA 4KVGA 2XOKA 4WOPA 1BOFA 1X1RA 3N2IA 2Q21A 4MYUA 1JI0A 3GJ3A 2ZRCA 2IS4A 3UATA 4NYMQ 1N5LA 3WHKA 3ZZTA 1X8KA 2CHVA 1Z0KA 1W36C 2JCSA 1OHHD 1KDPA 3CF6R 4MGIR 3TIFA 3ADKA 2PBRA 3KKPA 2EFCB 5C1BA 3C7KA 2XZPA 4JLPA 2KBEA 1X8JA 2F1JA 1A1VA 3FMIA 3LX5A 1KMHA 1QF9A 1OPXA 4WA7A 3QVVA 2YKGA 3I8SA 3F5FA 3QG1A 4V02A 5FPYA 3AM1A 1RZ3A 1NY5A 4QOSA 5KNBA 5CJPA 5EUMA 5DSZA 4V0LA 4P32A 3AP3A 4GMXA 4LV8B 4OJQA 2ONKA 2FG5A 2RKOA 2HDNB 2AL7A 1W46A 4JVLA 1CR1A 2QENA 2V6IA 4I81A 5JHHB 1FQJA 1NG9A 1ZNXA 3Q8XB 5TB5A 3GJ6A 4GPTA 3B13B 4XSGA 3U6BA 3PR1A 1Z0IA 3KB1A 4HAYA 4NTZA 4K8OA 2QE7D 1ZMXA 1VCOA 4TZ0A 1KI9A 1KI3A 4ZI3A 1LS1A 4HATA 1ZRHA 4OQMA 3REFA 4IHQA 5DN6A 4EUNA 2V1UA 1XPOA 2GCOB 3T1VA 1W36B 3AVTA 1AGRA 1KSGA 3I5YA 3BERA 3RS4A 1Z0DA 3AGPA 3THWB 1SHZA 2QU8A 4JVMA 3L0SA 4C3ZA 3CRMA 4E03A 1RW4A 1CR4A 3R8FA 5KSZA 3QIAA 4LPSA 3HU2A 4CYMA 2JASA 3GPLA 1R8QA 1OH5A 4WVFA 3GJ0A 1HQYE 2FN4A 4MUBA 3RRNA 1GAJA 4TQUS 2QT1A 5CYPA 3VHXA 2IYZA 3FMOB 3WNBA 3RNLA 4Q48A 1SHKA 2PMDA 5K8UA 1BYIA 4FINA 2OCPA 2DWPA 4Q02A 5CDFE 1U8ZA 1Z22A 5JWRA 4C2TA 2VYFA 1FOEB 4GT1A 4X8HA 4PC1A 2O0HA 3CWZA 2XTNA 4XD7A 4B3XA 5CB6A 4PHGA 3VR3A 3TGPA 1E0AA 2QEQA 4NE2A 4TLCA 3EAQA 2YJTD 3HU1A 3KQLA 2BMEA 4Q9JA 2C2HA 3R9XA 1ZIPA 3KXKA 1U81A 1JBKA 4OI0A 2RGGA 1LW7A 1JB1A 2JLSA 5EXXA 1M7HA 1CR2A 4HZUA 4M1KA 1GKYA 2YZ2A 4TWZA 1N5KA 1L8QA 4E09A 3MSXA 3PUWA 2ZI5A 4PSVA 3SFZA 2VH5R 2XSZA 4B44A 1XEXB 3G0HA 2LCFA 1R5BA 3WP0A 3CUEF 3U6KA 1F60A 3VNUA 3MJRA 2WAYA 1W49A 2W6ID 1E9AA 1ZNWA 1ZM3A 4DRZA 5EXTA 5K8TA 1W4RA 1SVSA 2KI5A 3E1SA 3F3YA 3SBDA 5CIWA 5B2ZA 3T06B 3ZD7A 5TXGA 4PPNA 2AHOA 1FMLA 3U3RA 3RABA 1ODFA 3TJZA 3CX7A 5EP4A 4JLKA 5KO2A 4Q4LA 2ODBA 1E9EA 4Q1DA 3A4NA 1EFRD 2FEOA 3EZ7A 4HB3A 1IN4A 821PA 2ECKA 4OK5A 4HDOB 3L0OA 121PA 2R6DA 4V0MA 5EXSA 4LV6A 1VYVA 4CEHA 2P5SA 4CRWB 4MKFA 1KO7A 5L3SA 4BEBA 1CS4C 5F2EA 3EXAA 2GILA 2N42A 4Q7MB 3IGFA 2O8BB 4QBFA 1F3OA 4CEJB 3PJRA 1DO0A 3EIQA 1E2GA 3OFNA 3QKRB 2ZJAA 3GFPA 3S1AA 2BMDA 4ZDKA 1TF5A 1DG3A 2ATVA 2ZE6A 4LGMA 2V7QD 3IPXA 2IF2A 1PUIA 1QVAA 3UWKA 1FFHA 2W2XA 3ADDA 1JEDA 4R9UC 2HLDA 1RKBA 2V6JA 1W0KD 4DLZA 4ZCLA 3RYTC 2GEUA 1EFUA 1KHTA 3N70A 2OE2A 4G3XA 1L2TA 3FMFA 4ZKDA 1YRAA 5KHOC 2CBZA 3B60A 4Z1MA 3AV0B 1ANKA 4M1SA 4HLUC 4OHXA 4WZ6A 2ZS8A 2ZSBA 4F92B 4RD1A 3OIUA 2IYSA 4M0LA 3QUSA 4BFYA 3AVXA 4GI7A 4KVAA 2FX3A 2KE5A 1KZ7B 2WKRA 2FA9A 2G1JA 4MRSA 2UZ3A 3KKMA 4MGKR 5FI1B 4HDQB 1WRBA 4LRWA 3TNFA 3NC1C 2F43A 5EUQB 1G7RA 3A6PC 1KAOA 5FBVB 1JR3A 4ZIRB 2JLZA 2HCJB 1ZVQA 4DCUA 1YR9A 3TRFA 2CHGA 5EE5B 1F2UA 4A36A 1BMFD 1E0SA 4DCNA 4JL6A 1LB1B 3FHCB 3DHWC 1G64A 3B78A 4H1UA 3DEFA 5E7MA 1NN1A 2WPDD 4B3CA 4LBZA 3PVSA 1VCNA 4LBYA 5C46F 1E2DA 3KFXA 2CE7A 2IYWA 1R10A 3ECCA 3SYNA 1PV4A 2IBMA 4XH9B 4IOKA 3K70D 2FMXA 2P6UA 2GEDA 3EZ2A 4PANA 2P3SA 4ERNA 1T9HA 5E7IA 1P61B 2SHKA 3AVQA 3OAAD 4NPHA 1XB2A 5EE9A 1MKYA 1DARA 1AK2A 1QHGA 1NKSA 1R4AA 1D2MA 3GLHB 4Z8YA 3RC3A 1H8HD 2B7BA 1G7TA 4MGZR 3RS5A 2ZYUX 4KODA 1J8YF 1HTWA 2IA5A 3SFVA 1RIFA 4KBGA 4AWXA 1X8LA 1FNMA 2EFDB 2IC5A 4N0DA 1GITA 1OFTA 2B21A 2R44A 2R65A 4AK9A 1DO2A 1Q1BA 3PCRB 2WSSA 4QNMA 5HR5A 2QL6A 5IDVA 3H84A 1EESA 3SHFA 1SXJD 2E87A 4ON9A 3CNNA 5E3HA 4GMDA 3SC3A 1KK0A 1OKKD 1RJ9A 3AVWA 2WBLC 2BBOA 4LZZA 3RS7A 3LA6A 5KNDA 4V0NA 4ESVA 4KITB 4EIWA 1W7AA 1YR7A 4Q47A 2W0MA 4NP6A 4BZXA 2HEIA 1N6OA 4YXWD 4DT1B 4YMWA 4GRAA 3RDPA 4QNRA 3GLGB 2W2VA 3AF4A 1IY0A 1ZBDA 5CJ2A 1P6XA 4MRPA 4TLEA 1GWNA 3ETLA 4GNKA 4NZYA 2C95A 2OXRA 4IVPA 5IK2A 2B92A 3QBTA 5UKDA 1OH8A 2FWRA 4EPYA 2GRJA 1S8FA 1KI6B 3D7MA 1S9DA 2IYUA 3VX4A 2J9RA 2ASEA 3CONA 1E2JA 1E79A 5GJWC 1UKZA 3C4JA 2FPMA 4A9AA 4DLSA 1MABB 2GCPA 3SZRA 5JI3E 4B6EA 2X2FA 1JALA 1XXHB 3L0IB 4HLUA 3BJIC 3GLHA 1N3BA 1NL3A 5G40A 1Z6TA 3ZIAA 2ZRIA 1Q21A 1E94E 2GXAA 1JR6A 2AN9A 2RMKA 1LNZA 5KYKA 2HV8A 3R7WB 2W0SA 3LLMA 1R0XA 1MOZA 2AK3A 3UG6A 1E2EA 4PAMA 4A82A 2XOKD 4B3FX 1NNEA 1XBTA 4DEXA 2D4HA 4JLAA 4W9MC 1SVLA 3KTAB 2F9MA 2QAJA 3EIEA 2ZU6A 1W48A 4PZYA 4DEYA 2O8DB 2H1LA 1RE0A 4P31A 1QHNA 4X8OA 2V4ZA 3LH5A 5JEEA 3ZS9A 1N5JA 1FUKA 4LJ7A 4BLTA 3C41J 4RCZA 5JRZA 4D0NA 4TL8A 4BLSA 2ZI3A 1GG2A 4DT1A 1J70A 1F2TB 4B2LA 4URYR 2GWHA 2ZROA 3UMSA 1BO6A 4O25A 1KJYA 1XD8A 4C0QC 4N0EA 2OLKA 2ONJA 2IT1A 3AGQA 1JXOA 4C0BA 1XD2A 1KI6A 5CYOA 4HAWA 3FFBA 3RWOA 2CJWB 1MABA 3K0EA 2IHBA 4AD8A 3QENA 3TKLA 4Q1FA 2ZI4A 2BJVA 4CT4B 2WM9B 1XEWX 3ZJYA 1NN3A 2PEZA 721PA 2QBYA 5DLQC 1FP6A 4UKDA 3ZVNA 4Q7LA 2PZGA 2Q9AA 5M04A 1G19A 1T6NA 3R7WA 1CJUC 1N6NA 4BFWA 2ZPTX 1IN8A 1P73A 3IHLA 1E4YA 4HB4A 4POAA 1P60A 3AF2A 3NEYA 1ZCAA 3J81k 3B1YA 1KO5A 3K8YA 2ZYVX 4MUAA 2ZIAA 5FL3A 4A92A 4U02A 1RRCA 3M1IA 1UADA 1GSIA 2O8DA 1Z0AA 2ANBA 3CR7A 4B3DA 4B75A 4HLDA 4DXAA 5JWHA 3BK7A 3FE2A 5AUNB 4DLXA 2J46A 3MCAA 1ZM2A 4IW3B 1IXSB 1CKEA 5DN6D 4PO1A 2RGBA 3H0KA 4OI1A 3RRZA 1ZU5A 1ELOA 2A5GA 3TUIC 3AB3A 1JNYA 2R6AA 3B1XA 3I32A 4WAUA 3SOPA 1SULA 3VU9A 3W5JA 4BZQA 4DHEA 2IXGA 1VHTA 2XNDA 4KFRA 4NCKA 4AKHA 2QT0A 2RGNC 2B6HA 2VP4A 2OBMA 2ZRKA 1FP7A 2A9KA 3ZZUA 1DAEA 2CJWA 2Z5FA 3MWKA 3ND9A 4RD4A 2PT7A 2I3BA 1ZJ6A 5FOVA 2G0NA 6Q21A 4RZUA 1WB9A 3IQWA 1D2EA 2P2LA 1P4SA 1FQKA 4RZXA 3LW7A 3R9WA 2FNAA 4I1SA 2FZLA 3QG5A 5E4FA 1IJFA 2F3TA 4AKGA 1A7JA 4KHZA 1DAKA 3K9NA 4Q1EA 3EG5A 5FR1A 4KJZA 2O8EB 1R8SA 3CPHA 1AN0A 1KJZA 4XD7D 2QY9A 1F6BA 1AGPA 2FZ4A 1KKLA 2NZJA 2VHQA 3NH9A 3TSOA 3MWJA 3SNHA 2ZYTX 5BYJA 1UKVY 4KO8A 5C4GB 3IO3A 4YONB 2OILA 3OF5A 2J7KA 2XXAB 3WRXC 2XJ9A 1R0ZA 1UM8A 4PPGA 2YC2C 1W36D 1II8B 1Z6GA 2WJGA 2DY1A 4LJ4A 2HF9A 5C4MA 3K70B 1G6HA 2GXUA 3GJ4A 4UNQA 2ZUBA 1EK0A 1E2QA 2XSZD 4M1WA 1Z07A 1HURA 1C1YA 4AY2A 2GKSA 2J0UA 4ILEA 2NGRA 2R9VA 3CM0A 1NY6A 2ERXA 4BFTA 2GZDA 2XTMA 5LPNA 3DOEA 4JVSB 3W8NA 1TEXA 2VEDA 3GJ5A 3HDTA 4PFSA 3TK1A 4F4IA 3BS4A 5G3ZA 4BFXA 4DVGA 2RCNA 2IS6A 2BCJQ 2WMOB 2JLQA 4MGYR 4NCNA 4IRUB 421PA 1YE8A 3B1WA 4YLGA 1U8YA 2AFHE 5DE3A 2XAUA 4XVRA 1PLLA 4K46A 4LYJA 3UMFA 2RHDA 3R20A 5KSYA 1RRPA 4FCTA 4DB2A 1C4OA 2O8EA 2H8KA 1W47A 3RAPR 3VHLB 2ZS9A 4Q7KA 3TVDA 4BECA 2OFOA 4LJ8A 3LBHA 2HT1A 3PQCA 3I73A 5BXQC 4ESHA 1AM4D 3U7GA 1SKYB 4TQAA 3KQUA 2IHYA 3ZD6A 3HR7A 1XTSA 2O8FB 3NBFA 5TARA 5A5GA 1II8A 2WKPA 5IRCD 3WRYC 4Y0VA 3OE7A 2XTZA 5FBWB 3Q5DA 1D8TA 2A5JA 3BAFA 3GD7A 4ASUA 2VL7A 2GAOA 4CVNA 5IF9A 3GJ7A 4DIDA 1QHHA 1TQ6A 4A0HA 3GEEA 1KI2A 4URZR 1XJQA 2H92A 3BBPA 3KKOA 2MSEB 4L15A 1AIPA 2RGNA 2PJZA 4NYIR 2YNMA 3RANA 1Q12A 2HLDD 3ICQB 4IOJA 4G5QA 4G5SA 5K8IA 1T5LA 4LYFA 1RFLA 2XZLA 1N6IA 1Z63A 5J4HA 1JEEA 4HDCA 2QGNA 2WJIA 3GLIA 4KAXA 5F9HA 3VR5A 1JQJC 1OT3A 4Z1MD 4R2IA 2VHTA 1PUJA 3OESA 3LRPA 1US8B 2RAPA 3GFOA 2C77A 5JWOA 2NMVA 3KQHA 1I2MA 4NBSA 4TYNA 5L3VA 4IFBA 1P62B 1CJTC 1G16A 2C5LA 1OFHA 1HUQA 2E1RA 4M22A 4B3GA 2EYQA 1N2CE 2IEYA 3AF0A 1EX6A 2XEXA 3T61A 3R8CA 3T1OA 2TMKA 3CH5A 3CWQA 2OT3B 1JR3D 2G6BA 2OFWA 3QE0A 4IKEA 4W5WA 4EQ6A 4LYHA 4Z51A 3THOA 1LVGA 3FKQA 1WMSA 2QPTA 1KDTA 2C9CA 5G3YA 3QXSA 2FFAA 2QQ0A 5LB4A 1YJ5A 2IYTA 3ADBA 2AD5A 1GNRA 1DE0A 1TL7C 4TQ9A 2ZE7A 3KKNA 4RKFA 4US1R 1E69A 5H1YA 5JECA 3DO6A 3KJEA 4FMDB 1GFIA 1KNQA 5CB8A 4GDFA 5B30A 2WJYA 3JZMA 4C30A 4KCGA 4TMVA 5FH9A 4F93B 4D2IA 1EFCA 1FTNA 3Q9LA 4JSTA 3BIFA 4JL8A 1BS1A 3W34A 5KTYA 5DI9A 1E99A 2QRZA 5G53C 1S96A 2G83A 3BH6A 3UIEA 2OZEA 4QBGB 1ZC4A 1UBEA 1IXZA 1NN5A 4IXMA 5GADl 1UBGA 2J0SA 1VG9B 2G3YA 3GFTA 5L8VA 1CF4A 5DHFA 2UKDA 3BH0A 1KGDA 4TL7A 1ESNA 1IHUA 1JAIA 2QORA 4LHXA 3WXMA 1XFAA 3OEHA 3X1YA 1HY3A 5HE9A 5F9FA 1S3GA 4NYIQ 3IDQA 4V0KA 3T15A 1IY2A 1OXUA 1CULC 5FUYA 3QSYA 3QKUA 4ZPXA 1K6MA 3F0TA 3FKSA 2WSSD 2ZRAA 4EPWA 5C18A 4C7OA 1GRQA 5FBRB 1UEIA 2DCUA 3HU3A 1N6PA 1T0HB 4MDEA 1W4BA 2FFQA 3LY5A 1UAAA 5IT5A 4NYJQ 2W00A 2ZVQX 1GNQA 2HXSA 3KB2A 4KU4A 3NVAA 4HUQB 2JAQA 1E0JA 1E4VA 4XJXA 4CF7A 2HYDA 4HSEA 3U4QA 2Z0MA 4M1TA 1G3IA 1XCPA 5FR2A 2BWJA 2GXQA 1GIAA 4HAUA 3I5XA 2GESA 5EP1A 1QG2A 1UFQA 1UKYA 2AD1A 2QTVB 2A3RA 4TMKA 3W90A 3KJGA 1S2MA 3ASZA 2QPOA 3LFUA 3CF0A 4ZKEA 4FW9A 1EXMA 1E9SA 3EPKA 1DG1G 4ZCIA 5IK2D 4QGFA 1O87A 4IOMA 3GLGE 4GSYA 4D4LA 3NIBA 4DDVA 4Q9KA 1CJVC 1TAGA 2GVZC 4OYHA 2ZITA 5JJKA 3IPYA 1E79D 1OB2A 5FPHA 2HCBA 3IIKA 3Q5EA 5J4YA 1YU9A 4FXPA 3DKVA 5LBIA 1AKEA 3E5HA 1NVVQ 3I1FA 1SKQA 2YYZA 3LXXA 1OH7A 2X8AA 1KK3A 1G17A 2GJKA 1ZM7A 3ZIAD 2C78A 2BCGY 5HPYB 3X1XA 4RFSA 2PL3A 2PLFA 1DAFA 1DELA 1S1CA 4MA4A 3QKSB 2AXNA 2ZRLA 3DL0A 2JDIA 3EZ6A 1EGAA 2OAQ1 2W83A 3BH7A 4AKEA 4BE7B 4HZUB 4YMTA 5FTNA 4P33A 1B0UA 4FCWA 4U5XA 3EWAA 3CO5A 4LCBA 5TMPA 4LI0A 1S3SA 2RGCA 4HUQA 2F55A 1NBMA 3B8HA 3BGWA 2JATA 5CIQA 1S0UA 4D25A 4A15A 4G5OA 1QZXA 4LOAA 2IYQA 1U9IC 1ZUNB 3C5HA 1YR6A 1KNXA 5JBQA 1R0YA 2OCBA 1H65A 1E9DA 1OIVA 2QAGA 2P67A 2AWNA 2C04A 1E1QA 5BQ5A 2E9SA 1M8PA 1X1SA 4JBXA 1GDDA 1N5IA 3FDIA 1JPNA 5FPSA 3IILA 3X1ZA 4OI2A 4LBWA 5KNCA 3RSOA 2FGJA 2PZEA 1X3SA 2A7QA 3K9HA 1HYQA 2CL0X 3ZVRA 4G01B 5AJYA 2IUUA 1GL9B 1T0JB 5EZ6B 1P2UA 1UDWA 4NMMA 4JS0A 2VF8A 3CNLA 1SVIA 4XWOA 3QKSA 4CEHB 5L3SB 2NQ2C 3MGCA 4ZO4A 4CZ2A 4DWJA 4F4JA 1G4UR 1IM2A 3T34A 4QJ3A 3M4YA 3NXSA 1A2KC 4B76A 1V5WA 5DNYB 4UQOA 1OXVA 3UWOA 3O47A 3Q72A 4GBMA 1ZM4A 3S1AB 1BIFA 4BWYA 2GDJA 3QEJA 1W2GA 4YC7A 5FPTA 2ZSDA 1R2QA 4JZKA 4OBEA 5CM8B 1ZIOA 3TMKA 2B8TA 3UKDA 4C0HA 3V9PA 1YZUA 4Q9HA 4RD2A 1EX7A 4ZI2A 3IQXA 2QN6A 2ZU0C 3VR1A 1KY2A 1FTSA 1M74A 1G18A 2GETA 3FPAA 2Z4RA 1GUAA 2IXFA 3KX2A 1VMAA 1FPMA 4PPQA 5EP3A 5G41A 2XNDD 3A8TA 4YMSA 3U3KA 4ACAA 3SHWA 3CX6A 4GP6A 2QI9C 2QTHA 2Z4SA 3K09C 1XZQA 3REGA 3PITA 5D3QA 1T4GA 2VP5A 4EPTA 5JHGB 4LJAA 2VP2A 3CIOA 3V4RA 1UJ2A 2QRNA 1Q0UA 4NCHA 1KKMA 2WZQA 3NBXX 3L2OB 2WWFA 3GLFE 2F43B 2ORWA 4EFNA 3N5CA 2ZR9A 1G4AE 3MMPA 4G5RA 3KZ1E 1FW6A 4M2LA 3IIJA 3C8UA 5KPDA 2X19A 4B35A 4JLDA 1O3YA 4BLRA 1F2UB 3LO5A 3LX8A 1JPJA 3UMRA 4US2R 2JJ8A 1Z2CA 1XPRA 2DFNA 4PO9A 4LC0A 2P65A 1EWRA 4JLBA 4DDUA 4KV9A 2O8CA 4BFVA 1DTSA 4RFVA 4C0LA 2LKCA 4M4SA 4D82A 1MO6A 2AKAB 3P1JA 4OQFA 2P5TB 1TADA 5BWMA 4QG7A 4XWAA 1GKUB 2FSHA 4ITRC 3THYB 1NSTA 2FDCA 2CEAA 1TU3A 3FGNA 4IXNA 3P20A 3O8RA 4R2HA 1KK1A 3EA0A 3I4LA 2ZETA 3A58B 1U9IA 1NF3A 1GL7A 4CIDA 4TL9A
chains in the Genus database with same CATH superfamily
2XEDA 2VN8A 1EFKA 1GEGA 3OJ0A 1BH2A 2QRJA 4QT0A 3WP1B 3WAKA 1I3KA 3N2KA 3OHPA 2ON6A 1J1ZA 4R1NA 2BUBA 1PWEA 4TKVB 4UZFA 1ZQ1A 4LTDA 3ZQUA 3DM5A 2IZ1A 2YICA 1B2RA 1POWA 2I7VA 4MAAA 2JVJA 1EU1A 2DC1A 1Y8ZA 2ODTX 2H2GA 1DAIA 3LQQA 4IL5A 3IESA 4D4HA 2I4LA 1QX3A 4RJLA 4EMSA 4RPCA 4W9NA 2XHZA 1XZMA 2OFPA 3EC1A 3G2QA 3T54A 1VE9A 4MMXB 4WXHA 3DHVA 4YAGA 3TAXA 1OYWA 2WD7B 4YRBA 4KI7A 4Z9FA 4G1EB 4CCAA 2VXOA 4JYBA 5LZ5A 3N2EA 3NBYC 1M5TA 4KFUA 3R4VA 4YUAA 2IX3A 5BWLA 2FN7A 4HGPA 3SSOA 3FHJA 1X7DA 1GKKA 1DKNA 3NKFA 2A1TR 3ZJ5A 4EENA 3M5PA 5HFNA 3CUYA 4QICA 4BO4A 3NHLA 4EHFA 2WJAA 1L7OA 3A6JA 2ZUUA 2CJYA 3D8SA 3ICPA 4LCJA 5IXSA 1AS2A 1XEAA 2PUGA 2ZAMA 2B20A 2QL9A 3ZNNA 2KS6A 2PAAA 4ZOAA 3H8VA 1VIAA 2G9QA 1E3LA 1SKYE 4FBMA 3FCOA 1GUBA 4I50A 4GOXA 5L45A 1IAQA 1R0RE 3LS2A 3BPSA 3RSQA 4LSWA 1AD2A 3LPCA 1VLZA 4KRXA 1KZGB 4D99A 1S6YA 4ASUD 1Y33E 1T2NA 1C4XA 2YIVX 1TVEA 2HIMA 4J4BA 3E82A 4O4IF 1TEVA 4QU9A 4FWTA 1XZCA 3HKEA 4I14A 3HDYA 1P0QA 3MAAC 4TT8A 4PRLA 1GSHA 2ZVPX 1X77A 4ZVSA 5K8JB 3K09A 4LA4A 1SUCA 1XZIA 2QIPA 2YZGA 4KGZA 4EAAA 2O0JA 2GT1A 4FFBA 4FSDA 3PNQA 3RD5A 3DLIA 1GZDA 2BTOA 2R8PA 2AMJA 4OJKA 5F3RA 2IY9A 4YASA 3S55A 1OAKA 3HL4A 3I6IA 2BT4A 4MWCA 2LDXA 3E9ZA 1PD0A 4LJ6A 3VR5D 4DF3A 2RD2A 2WUWE 1SCNE 3DBOB 4J4TA 3HXLA 1NQ5A 5LQMA 5C8DA 4X5OA 2HHLA 4M54A 2Z6AA 2Q1YA 1LPNA 3STVA 5JATA 1W581 1RRGA 2ZG6A 4YRSA 3BVPA 1XCLA 2X8JA 2P0EA 4CMCA 2V59A 3PI6A 1TLLA 5DBFA 1BHO1 1O08A 3WBKA 2C2MA 4LHVA 1C7IA 4X63A 1CIPA 3HYTA 4DBLE 5AVYA 4HDKB 3WMRA 4JI3B 4DMRA 5B7PA 1LDYA 1VPWA 4U0KA 1FTYA 1JG3A 3B36A 3W2GA 5HA5A 5ECWA 4RULA 1EUDA 1FVFA 4HLNA 5AYVA 3RYIB 4J16C 4CKEA 3FWZA 2WUFA 4IJKA 1EJ6A 4JSRA 4IQ0A 4QDXA 1JMKC 3FSEA 4RF2A 4HRAA 4HRYA 1T3ZA 3VKVA 2G1PA 1TU4A 2H1VA 2HA7A 3SMQA 2JGRA 1Y7TA 1NRWA 4AY5A 1LBEA 3TI9A 1MQ8B 2BV3A 1FY2A 3M49A 4YUYA 1ORVA 3Q0TA 4LIPD 2EZTA 2C2YA 2IF0A 2Z83A 4TYWA 1T2VA 1SXHA 3GQVA 4HY3A 1Q57A 2F3UA 4X94A 5EIEA 2OFXA 3B48A 1E32A 4AO6A 1TMOA 1L1FA 1KXZA 3N0TA 2BEVB 2P4SA 4Q9AA 4Y0AA 4QSHA 2LRHA 3ETCA 1RACA 1MJNA 3DLTA 5L7YA 1TNDA 4LF7B 1JN0A 4MQEB 3WL4A 1TM3E 3SZOA 1M1YE 4BBAA 1XTJA 2NSLA 5EZ5A 1XTIA 3DDWA 4B47A 2H17A 4ZI7B 1YDWA 1BE0A 4G1VA 1LTQA 3SP1A 4X6LA 3CF4G 3ICEA 4CF3A 4L8LA 1COWA 5DEIA 1Z5GA 1RAAA 4C7JA 3K71B 3KXIA 4NHOA 1NVXQ 5K9ZA 5JT1A 2ZTVA 2VRBA 3I58A 2H2WA 3C2QA 1GZUA 2PH1A 2O23A 1WEHA 4N0QA 4PSKA 1UDXA 3CSSA 1LC0A 5ESWA 3UJ7A 3AVVA 1LPOA 3H5WA 4H6VA 2OXTA 3A1SA 2ODNA 3OBIA 4ZV7A 4BNUA 2XITA 4PZAA 3AR7A 5LM3A 3EDRA 5DBOA 1VOTA 2NWQA 4YAWA 1REQA 1SEPA 5HUJA 2OORC 3DXXA 5BW8A 5KWJA 1KO8A 1RP1A 4PWZA 3GR6A 1Q17A 3AFOA 4RQBA 1FJHA 2CLEB 1NFQA 1T1IA 3EY4A 3OX4A 4GWKA 2CL7X 3D31A 4UJ5A 4UM9D 3ZE0B 4UBIA 4IGFA 1K0FA 4DLTA 3FWKA 4KN6A 4L76A 3LK6A 4DBZA 2XD4A 1HKHA 2FPPA 2V8OA 5I7RA 1N3IA 4WLOA 4NENA 4CIBA 3FYTA 3WKDA 2D2XA 2BFAA 2JI8A 5TGZA 5CFPA 1Z6XA 4FE4A 1YFJA 2X0JA 2OUKA 4EG7A 4CL2A 1EFHA 2GFHA 2GJSA 3X1KA 3LAWA 1I4TD 4EVRA 5HCNA 4YAIA 1NT4A 3FTQA 3BJEA 4LC1A 4TMWA 1E96A 1KI1A 2A5DA 2Z04A 3OUZA 1M6NA 3EPLA 4JB3A 1QTIA 2EYUA 1ZU4A 1U6JA 4KXFB 2WTAA 4UCFA 4WXMA 2DHCA 3NORA 3PUZA 1U2PA 1ULBA 3IBTA 2HI0A 4S35A 4UUAA 2C5GA 2F2TA 1E3IA 2VJYA 3HHPA 2C5HA 1P72A 3WK4A 3FHTA 1X8XA 3MLAA 3R6GA 4R98A 5GZ1A 1A9SA 4F91B 1TT7A 4KRYA 2CF6A 4P92A 4CL0A 3OOSA 1SHUX 2Z58A 1QHIA 1WSAA 3QXHA 1KI7A 1M2NA 2TECE 4RF3A 2XY4A 3N2YA 5EWMA 1GQQA 4YJDA 4UEKA 2UVPA 1NW7A 2P91A 5DM1A 3SN6A 3EA5A 3ROQA 1PEKE 4PG8A 4BXOB 3BFXA 1X1DA 1UEJA 2JGNA 3RU7A 2ZAGA 1JEQA 4N8SA 2MT9A 2IODA 4IIVA 2E5LB 5AM4A 4BO0A 3ZWXA 5JSZA 1J8VA 2UZIR 3FUTA 3K9QO 2Y1WA 3BWBA 3QELA 4FDMA 4YCJA 4TTVA 1ZOSA 3BL6A 2H4FA 4MSUA 4ACBA 1R8JA 3RIEA 2XCIA 5EIWA 2YS6A 2ZJ1A 2CMHA 2IU0A 1SMKA 5THKA 3RC1A 3VKHA 2BN4A 5AVJA 4DGSA 1UBMS 2V74B 3ZYCA 5CEJA 1K8RA 3V2IA 1KYTA 2WWGA 4ICIA 4RTQA 1N2BA 1ZD8A 1P9WA 1KVSA 1W93A 2WVJA 2ZJ3A 3U49A 1PK7A 4ANFA 1GRRA 5K3EA 4CF5A 3KJXA 4OKSA 3C3EA 1GCGA 4TSFA 5CVTA 2NPOA 4BVFA 2JLAA 1Q3HA 3HPQA 1G8MA 1V7QA 3LK7A 4YHBA 1MH1A 2MSKA 3GEDA 4EA9A 4GW3A 3SZ3A 1HQKA 1VGVA 2B7LA 4J29A 1RMQA 4AC9A 3SAJA 1T29A 2FP4B 3HB7A 4KDRA 4YO7A 4ZK2A 5JZVA 4FK8A 4GIBA 1JI3A 2AT1A 5G4KB 3D02A 2G67A 1JTEA 1BWQA 1SOAA 3TZKA 3JAMA 3MPOA 3PXCX 1HV8A 1DVRA 1JKMA 3FTCA 4NI5A 4WINA 2A14A 2WTEA 5T8KA 1G7SA 1JU4A 4RM3A 1RLTA 3LUBA 3ONWA 2XUJA 3HUUA 5C9ZA 3OFKA 5KIAA 1L4FA 5KVCA 3B3FA 1NJ5A 5AJHA 4I55B 3H86A 5MN4A 2IITA 1K06A 3V2HA 1IULA 1D4ZA 2IL1A 3IJRA 1MB2A 3U4HA 5JMOA 1A8QA 2EDAA 3GDHA 1QHHB 1VLHA 3SIXA 3L0DA 1J9GA 4QU5A 4AZ3B 2D1QA 3SKYA 2FFJA 3D4BA 4L5BA 1CRQA 1K4YA 2NV6A 2FG6C 1D3AA 1QCCA 2Z5VA 3CR8A 1JSRA 1OE0A 2NIPA 3GT4A 2H0AA 4W1PA 3GFGA 5DOZA 5EPEA 1XTZA 5DASA 2JB9A 3H9QA 2ZJ7A 4U7HA 4RH1A 2H7CA 1ZOLA 2ATXA 3QIVA 4RV5A 2ISSD 3EB9A 3QF7A 5K0ZA 4ZQHA 3ZLVA 1J9ZA 1JWAB 2C4HA 3B1FA 3JSXA 3BQMB 4XFJA 5AW1A 4ENVA 1GM5A 1C80A 2GO7A 1F48A 3BORA 1T9CA 1VECA 4I9HA 2MMCA 5C81A 1P0IA 2Y0PA 3AR8A 1TT5B 3BTVA 1WMAA 3JW8A 3LUPA 2J8ZA 4NV0A 5LP1A 3M0EA 4Y1FA 5GM1A 3UA3A 2ZBFA 2X1LA 3PXAA 5ICGA 2FLKA 4RQTA 3W5DA 1G0NA 3PQ7A 5TRTA 1Q2XA 1C50A 2AK2A 2V97A 4ZQFA 2CL6X 4Y9DA 1XGKA 2ODWA 2TYSB 1A71A 3EQ2A 4OQQA 4CCYB 1AKVA 1V7ZA 3TQCA 2GJ4A 4Q01A 5G0VA 1E64A 1YCFA 4GRIA 2NPIA 4EL5A 2GZAA 2Z9DA 4OHMA 5JVDA 1E9RA 4DR3B 1NAIA 2I2CA 2BEWA 1W0JA 3WVNA 3IALA 4ZVNA 4P4TA 2DBVO 1IUPA 1XMPA 1NMEA 3L6BA 4KR0A 2RI1A 5G0TA 4EH1A 3ZOZA 1MUUA 2B5VA 1ADJA 2Y1XA 3D3EA 2EZ4A 2BIFA 4IO0A 4LRTB 2EBFX 2O2IA 1R0LA 1XROA 3WDLA 4Z7JA 5IG2A 1MO5A 3F1KA 2X4LA 3QPDA 5AKZA 1MRSA 3ZH9B 3D7LA 4B3BA 4O5OA 2C83A 1B1CA 1UMBA 1QG0A 2DKFA 4H7PA 4M0CA 3D54D 4EGAA 5JANA 3NIWA 5TIIA 1E3SA 3H0EA 4AS3A 3FTDA 1VL5A 2RBEA 5KYWB 1RQNA 4AS2A 3E6AA 1JMVA 4BMXA 1OBCA 1TF7A 4YWJA 4PLTA 4E14A 5FLYA 1ZSNA 2J9YB 5TLSA 1X7YB 1C3XA 1GZ5A 3OTHA 4MIEA 4JI1B 4ZREA 1M6VA 4BPRA 3QF4B 1XP5A 3ZCRA 4RTKA 3CNOA 4IMIB 3EZFA 3DMNA 3TEFA 4D3ZA 5GIOE 3VKFA 4K9KA 5T7BA 2PX8A 3Q4GA 4GZMA 3EAFA 4JT9A 1NQUA 4MQLA 1E7QA 3EZXA 2DUWA 2A6PA 2EHDA 3NNSA 5ESDA 1GPLA 1JHPA 4YRQA 1AKQA 4EB0A 2GN6A 2J1LA 4LE1A 4EW2A 1WXGA 1V1RA 2Q2NA 2WB4A 5DXFA 4Y9SA 3BXZA 1PS0A 1JTFA 4D4KA 4DAOA 2HBZA 4PXYA 1FFXA 5D3MA 1VP9A 2ZAYA 3MTBA 5ITSA 4FYHA 3WL5A 1Y89A 4M8LA 4XEUA 5ER9A 3D3QA 1SXQA 5C7YA 1ZG3A 4J3JA 3R74A 2HW8A 2BOVA 1A9TA 3COZA 1IU9A 3U61B 2A30A 2BGMA 4OQDA 3VR2D 3AP2A 1NGSA 1PKEA 1SELA 2VPQA 4OXKA 4Q24A 3A3PA 3KRTA 4JP1A 1OFUX 4RL6A 4ZD6A 3WWCA 2P78A 4YV1A 4X61A 1Z15A 3I61A 2G80A 4QD3A 3HJBA 1EH5A 4MICA 1NM5C 2C2ZA 4TTQA 2CL5A 4A1FA 2ERCA 2IUFA 4PPFA 2PV0A 4CE6A 4D81A 1E4OA 1MDFA 1R0KA 2ZAIA 2KSQA 4WZZA 1PDWA 4LZOA 2N1BA 3E3OA 2YHIA 3CT4A 3H5LA 1PR5A 3K1JA 3VOBA 2PN1A 2DT5A 1PVOA 1M8FA 4L2IB 4RJKA 3HJNA 4RFSB 5DTMA 3HKBB 1RJDA 2E48A 2QR5A 3QA3E 4J8PA 4P08A 3A2NA 4ARIA 1M34E 4M89A 2Q62A 4I46A 1ZJZA 1NN0A 2H2IA 3E22B 3ZTYA 1H2FA 4PC7A 3SM9A 1LF5A 3WLFA 5EZSA 4QOHA 4PONA 3RSGA 4AMYA 2QPAA 3E7DA 1C3JA 3QE4A 4FYKA 2A1TS 3LTEA 4JZYA 1ECFA 2H8GA 3LWNA 4WOKA 4ALNA 3AIIA 4YDSA 1ZLYA 4CKWB 1SIUA 3RF6A 4K0KB 3FNIA 3Q40A 4W63A 4PXAA 3AERA 3ABZA 4QYXA 2VDJA 3T94A 4C2UA 4AG6A 1OWPA 3H87A 2VDNB 2PS3A 4MVJD 1XZGA 2JJ2D 4FQ8A 3LY7A 4G4JA 1Z26A 4HQFA 4QHSA 4FKBA 4RE6A 2QRVB 2HA3A 4YCSA 1ENPA 3RS3A 3LUJA 2I7XA 3TTSA 2IYVA 1TYDE 3CLVA 5LUAA 2RGEA 3QFSA 3SU8A 1IQPA 1SVOA 2H07A 3PC2A 3TYXA 3ICOA 4HX5A 5LP6B 1XCBA 3H3XA 4E5MA 1GOTA 4OGGA 2Q6VA 5HF9A 4ARZA 1B8OA 2HOQA 2PBFA 3OEEA 1ZP6A 1CUFA 4A6XA 4JUAA 3ETEA 3GBVA 4JY7A 1C3EA 1NLUA 1AK9A 2O2YA 4HQ0A 4MJ3A 4MYCA 3RTBA 4AMUA 1ULSA 5IJAA 3ROTA 2WAMA 1K0UA 2GF9A 2KW5A 3AU8A 3PDIA 1E1RA 3UJ6A 3R23A 2QS9A 7REQB 4BV2A 1K75A 5ARCA 1SD2A 5JPIA 4Y6RA 4D0LB 1BXGA 2V96A 3I05A 1YDHA 3OPYB 5HSGA 1M1YA 1C0PA 4DLUA 3NP7A 3DUFB 3WHLA 1D1PA 3W6UA 2X40A 3ZKAA 1ID1A 1P1JA 1M6WA 4HVAA 4NV3A 2YV5A 1ACJA 4P83A 2ZB2A 1WVMA 1ZESA 4M9XA 3GRAA 1XZKA 1GTVA 1MH9A 3LY8A 4A2WA 1CTQA 2RONA 2Y2UA 1W2WB 4WNAB 1KMIY 2I67A 3BWMA 3C24A 4QHTA 3H0CA 4UUMA 2SECE 2KWIA 4ESOA 3F71A 3AJ8A 3B9PA 3HCOA 4F1JA 3AC0A 5FEMA 4GMKA 1WO8A 4I4IA 1ORWA 1PTJA 3CUKA 1YZNA 3R3HA 4OMDA 2CB9A 4K5QA 4ZDJA 2BGIA 4HLCA 3K16A 4XJSA 4LX8A 2W71A 3GFQA 4QATA 3ECAA 4BAZA 5EMHA 3A05A 1IVSA 2ADMA 3W9SA 3OZ7A 4YAOA 2H2DA 1X7XA 1PGOA 1RM0A 3DVAA 3N8IA 4RDHA 3IEUA 4U7DA 5ER6A 1DBQA 3RM3A 4MW2A 3L3BA 4JOBA 1ML3A 4XX0B 5DH9A 1F0PA 2BM8A 4NL4H 3ROGA 4CM7A 3MTQA 4XTCS 3SJAA 5ICCA 4KZPA 5FBQB 2N9UA 1NX6A 5DHQA 1J23A 1T15A 3KOOA 1BMDA 5GVRA 1QS0B 5M34A 2PTGA 2PLRA 3F90A 4N3NA 1K7XB 4NMLA 1UMCA 3AKDA 1V5GA 2WHYA 4Z3OA 2HU7A 5TVGA 4OA5A 2C88A 4C5AA 2QGZA 2XNJA 4Q16A 2I87A 4I0WB 4UAUA 1L6IA 5LQJA 4EKDA 3G2JA 5LBTA 4ZC1A 1NNUA 3PXEA 1ABEA 4RK0A 1TTTA 1MA3A 1FFBA 1F8UA 3E70C 3JQAA 3KLBA 3P9SA 5IASA 5KSOA 5E0KB 4PYMA 5KMGA 3I92A 4MVJM 4TKUB 4OXNA 5EJ6A 3WGYA 5C8XA 1XTQA 1P1HA 1INLA 2NVUA 2X9GA 3H1FA 3MQFA 3Q3JB 4U63A 3SYRA 3WMGA 3SBEA 4EKNB 4TTRA 5EXEA 5F4ZA 2GZ3A 2EVWX 4N0MA 4AP6A 2ZVDA 2UXBB 4RZ2A 1GLVA 2QG6A 3V4SA 5FL7D 2QMUA 3VAAA 1MAAA 1A7UA 5E2IA 1YR3A 4FFSA 3L1IA 4RNCA 4URVR 1EGVB 4AYXA 2RGWA 2PJDA 4Y0NA 3OD1A 3LKVA 3CZRA 3TOZA 2Y0DA 4BZPA 2VCHA 2P6NA 2A33A 3CGGA 2AOXA 1O1YA 2NM0A 2WQZA 3BFKA 3GLVA 5D85A 2FPXA 3AVYA 2PZKA 4EFNA 4HAXA 2GH1A 2BMJA 1U6KA 1GYPA 1H0HA 2HDWA 3O84A 3PNMA 3KFVA 1TKBA 4L3VA 1L5QA 3ONEA 4MEBA 1SU8A 4MWSA 2I8LA 3AUYA 4BCDA 3HB9A 5LYJF 4P3YA 1WZUA 2AFHB 3K30A 3WIVA 4GZLA 4HP8A 4F06A 1FDRA 1LJ8A 2V6FA 4CTMA 4BNXA 3THRA 3I45A 5ERXA 3BILA 4MQ4A 4LOKA 1D5WA 1OLUB 4XQ9A 2Z1NA 5KYNA 3O8BA 3P26A 2WFLB 3A1VA 3UJAA 1MIOA 1VHDA 5K1ZA 4UFPA 4JI7B 4WN9B 2BONA 3TQIA 4NU6A 3OLYA 4ZZ2A 3NIDB 3B7GA 1ZITA 5HW0A 1A4RA 4P0QB 1VZ2A 2DH6A 3A0RB 1QC5A 4NF2A 2ORED 2J3MA 4DDWA 1JL3A 1TC1A 4ZAYA 3LXRA 2PNFA 4BMSA 4F3TA 1D6NA 3R09A 3SSNA 2FZWA 3SVZA 1DFHA 3F3SA 3NYQA 1UWLA 2VEOA 1D4AA 1EX9A 1YB7A 3TIVA 3HJCA 2Z43A 2ZJ4A 3REQB 5HIMA 3AM5A 2QUAA 4JCOA 1D0IA 1DAGA 1KJNA 3SF0A 4BO3A 3JQ9A 3NT5A 4PZZA 5BSGA 4TTPA 1WD5A 5K7SA 4RTMA 1RLUA 1KP3A 4D98A 1BMTA 4GFDA 3OECA 4WKPA 4C2AA 2VFAA 5EQTA 3B2EA 1DIOB 4U00A 3UYKA 3FMPB 4AKIA 4XVCA 4OHUA 2XF2A 3FMVA 4BGIA 1OAOC 2OO7A 2ETVA 2X8BA 3MM4A 1KZ6A 4LHWA 3GLIE 3VAYA 5HZKA 2C03A 2HZBA 2VA8A 2WABA 1XZAA 3WRVA 5CM9C 1L7QA 1Q0QA 1J22A 1YXMA 3B7PA 2JCGA 4ZA2A 4ZEVA 5K09A 3AU9A 1JIXA 2P35A 1GL6A 1NHWA 3I2YX 1QE3A 4QRHA 3CWCA 4DLVA 4W8HA 2EX1A 2BM9A 4RX1A 1JRLA 1H5NA 1R6VA 1NBHA 1QF6A 1G6OA 1VCMA 3Q1LA 3SSAA 4DTIA 4E46A 5FOXA 1O8BA 3SICE 3BRWD 1MNQA 1Z5ZA 2IEGA 1YZTA 3PZBA 4LYGA 1A82A 1WXEA 1GGFA 4F9GA 5C5IA 4LPKA 4LZWA 4Y1GA 1UXOA 4EEZA 1OZ0A 1THGA 4L16A 3OIFA 1LA2A 4M9CA 4YHHB 4Q4AB 2Y05A 3KSDO 1UQUA 3W05A 5ALVA 1WBDA 2WWIA 4RVOA 3U3XA 2CK3D 2Z30A 4CEJA 1JG7A 2DPYA 1EGQA 2XQJA 1G20E 5I9BA 5HKKA 2G09A 1T5IA 5JSFA 3ANLA 1ST3A 4BN4A 1QUEA 3K0CA 8ADHA 1C81A 1CZUA 4PCLA 4NMHA 1N3LA 5L4NA 1DBWA 4EI8A 2AF3C 3HK2A 4H4DA 3QBDA 1PLJA 3JQCA 3GPCA 3HYLA 5HRCA 4XIYA 5DBEX 2AKYA 2OG2A 5FPKA 3WZMA 4GKJB 1MX9A 2XUKA 1QOPB 1FYXA 1SUWA 3Q11A 3QVKA 4FIZA 5E38A 5J43A 3U3ZA 4CR7A 2GN0A 2VPPA 4WBNA 1ZN8A 1GLNA 1V6AA 5EQJB 3UOWA 1RWNA 2DE0X 4CMAA 1QE0A 4XRGA 1XMVA 2ZT8A 3AEZA 3OIWA 3HGQA 1IAVA 4TVKA 1ZPDA 1SZPA 5C8VA 1X2BA 4NFLA 2REOA 3ND8A 3HC7A 5BWOA 1Z33A 3DYVA 2GK7A 2XXBA 2HA5A 3Q2IA 4G26A 1YQXA 3FFTA 5JD4A 2OV6A 3DA8A 4TROA 1SXPA 2AVNA 4Z3KA 4ZCRA 4BLVA 2V45A 1F6DA 1KP9A 4H31A 1KQGA 1ZZGA 2V7UA 2QTGA 3P71T 3B6MA 4FT4A 4ZIRA 4ZQCB 4BCBA 3VR6D 4JEHA 3U4AA 3OOWA 5J47A 2GTIA 4QXOA 4CKBB 4TRRA 1YAHA 4BGEA 2YJ3A 3MTGA 3GDFA 2PZJA 1F8FA 2HK7A 2NUPB 2P4QA 2EWWA 4OXYA 1YS4A 1TB4A 3QPUA 2A7XA 2QM0A 4RIGA 4PLGA 3SJBA 4NK4A 4AO7A 5I7EA 4WXEA 1KMNA 4C7BA 3LRXA 4JX8A 2W6NA 2BDTA 3NVMB 2REBA 4CQMA 3UK2A 1WXFA 4G25A 1I3CA 5BUSA 2BCEA 2GPWA 3ULKA 2FEWB 3AEQB 1PZGA 4IICA 5J59A 5KOHA 3U7JA 5AXDA 1JVNA 4A0RA 1D9ZA 1RWXA 3NHBA 2WYOA 1SVWA 3P9QA 1NUTA 4JLMA 1TCBA 5JEDA 2A0YA 4ATNA 2BC9A 1HOTA 1UJBA 3CF2A 1OFUA 1VG8A 3M6UA 4M53A 2R0QC 2E4XA 2Q0QA 1U5AA 1CU1A 4KXNA 3S3TA 5E6RB 2FFHA 2W90A 3NHMA 2FR0A 4KFTA 3TDNA 3WJ1A 2WWTA 4ZV9A 1AQ6A 1CZHA 1L4YA 2JPDA 3CX3A 4IVRA 4KUHA 4NNOA 4QLAA 3WB1A 4CV3A 1EDBA 1KMQA 2ZPAA 3EE6A 2BM0A 3EBOA 3W1EA 2O3UA 4C14A 2ETXA 4GUDA 2QN8A 1E2MA 1ISGA 1M34A 2OV2A 1TQ8A 4RVUA 1U9JA 4X62B 3HB4X 2QVYX 3T5BA 2VRCA 3FPLA 5CVUA 5DIZA 1ULUA 5J5VA 4JI5B 2QQEA 3DMRA 4P4UA 5HFAA 3R7BA 2FWJA 3ZCPA 3JWJA 5E1MA 2AX4A 4ZICA 1W5SA 1K7EB 4AIIA 3WX0A 2VDKB 3QWHA 3PNYA 2AC4A 1BU8A 2I4NA 4Y2HA 1C2TA 2ZUDA 4OFXA 1DFGA 2I33A 3RVJA 2OP0A 3FZGA 4QTYA 3PT5A 4DHWA 3PHJA 4GX1A 1R6BX 3H2JA 1EB9A 1YQ9A 2PR7A 3SF8B 4QTXA 4J49A 2JGKA 1R9NA 2PVCA 4JXJA 3PHBE 3FYUA 2QMEA 2MSDB 1YIOA 3B6EA 3K5WA 1HRKA 1E6CA 5CHYA 3TPZA 3GIDA 4G4SP 1JLLB 4QFMA 3VR4A 2YBDA 4MVJG 3FW1A 3C45A 3GLGA 3W5IA 2Y1EA 2H18A 2F90A 5GP1A 1GA6A 1BVRA 4JXXA 3JRXA 2IGBA 4JT4A 4MARA 3ZR4B 1PSDA 4D80A 1SKMA 1N1DA 2RAFA 4HPWA 5B3KA 5C1PA 1FUYB 3QXGA 1NMZA 2ODAA 2IFTA 1E20A 3A1EA 3FI9A 4MINA 2P8JA 3AF3A 2IWRA 1YZGA 2Q1SA 3EWSA 4YJ2F 1T4DA 3BWDD 1CZNA 1N0IA 3RRYA 4M1EA 2FPLA 1NVGA 2B3TA 2QYHA 3KQYA 1KI4A 3ZXYA 4FDUA 3V4VB 1K3FA 5ED4A 1PR9A 3K15A 1GHTA 3DJFA 3NI2A 2BEJA 4O2RA 1EXNA 1L5FA 5IT4A 3TB4A 3CVWA 2JIZD 3ELUA 3G8YA 4JP8A 1RHQA 1H6DA 4LHSA 3ZU5A 4BX0A 3MS2A 2A9VA 3ZGNA 3AI3A 3ICCA 3ITNA 4P84A 5KOYA 3F8TA 1QHEA 1RLOA 1U28A 4KP7A 4HG2A 4WSOA 5FFNA 2W6QA 3LYAA 2YASA 5EMNA 2OYRA 3Q1KA 5I9LA 2GYYA 2HHCA 1QX4A 2GAFA 1BEZA 1CDOA 4IIHA 1E6UA 4BKOA 3OQMA 1U0JA 2H11A 1ENYA 2B69A 3H1EA 3IRUA 3STYA 3UICA 1D6JA 2AXPA 3FWNA 4ZT4A 1Q2UA 4C1BA 1F2TA 1Z4OA 2GZRA 2HJSA 4LWZA 1IOZA 2MMGA 3A4YA 4EGFA 1UZNA 1Y5MA 2Y3IA 3UHOA 3P8ZA 4NDNE 3AF1A 1BXZA 3E53A 1M7GA 1NDHA 1UODA 1XC7A 4QXQA 2O2SA 3N6VA 4FMCF 4DBVO 5KYYA 3RV3A 1G4HA 1YK0A 2BTQA 1L3IA 1G0OA 1M6EX 4A8JA 3WBFA 4MKRA 3ZBTA 2JI6A 1ZH4A 3PDCA 4I2NA 1KC1A 5KSWB 3IH5A 4JLUA 3WC4A 4WKOA 2FKNA 1J0BA 1GXSB 3KEFA 3ZWNA 5DM70 1FMJA 2FEXA 4IV8A 3A6GA 4R41A 5JZMA 1YA6A 2GPJA 2I8CA 2QAIA 2V8BA 1D2AA 1EFLA 2PGJA 2BL4A 1SXJC 5A5EA 3W8RA 1U8EA 3EN0A 3WICA 3WL7A 4B3IA 1TPZA 4MRVA 4R1SA 2RC6A 3FTFA 3TXXA 1TIKA 4CU2A 2IS2A 1WQ3A 4UTRA 4M9SA 4WW0A 2O0LA 3UT0A 3FLBA 1N8KA 3CH6A 3EPPA 4N7BA 1E6MA 1RM4A 2IXEA 4H7JA 1N9GA 4L6IA 5DWQA 5IS2A 1I4DD 2DFVA 4G9GA 4MEAA 5JD5A 2CVHA 1P74A 2ZRHA 2QV7A 4Q03A 3EC2A 2WIBA 3KHSA 3KWFA 4FYVA 3O4FA 2X9NA 5IHPA 4PQFA 2H1OA 3RBXA 5MF6A 5AM5A 4IXWA 3OC0A 4N76A 4HYEA 4DLAA 4Z53A 1D03A 2QZSA 4LJLA 3ER9A 3D6UA 2CYCA 4MAFA 2QD5A 4QO8A 2I5PO 4FOPA 3RF7A 1ZQ9A 4YRFA 3ORSA 5BNTA 1JLSA 1T9KA 2OB2A 2Q0HA 2WMYA 1VL1A 3EJ6A 1U7UA 2H2AA 1GAEO 1XO1A 1AKNA 2G1KA 2KJQA 1C9YA 3OH8A 3Q7SA 4RY2A 3ND6A 2Q3HA 1RJEA 3SCZA 4DY4A 1AQNA 4DUGD 4EYSA 4N9QA 2H0QA 3CX4A 4PG5A 4BN5A 1G21B 2DPXA 2OLJA 5G1NA 1QQBA 1Y7IA 1VJ1A 1LBQA 1VPLA 4HNHA 4KLNA 4OG2A 3HEMA 4QBTA 3TUJC 1CQJB 4BE4A 3KKEA 4O4JA 1KA9H 2GBPA 2J6IA 2ZR7A 1I2DA 1P75A 2ZJBA 3PUVA 2O54A 1A0OA 2IEBA 2IIVA 1EA7A 4HLQB 4P4NA 4WHMA 2JBWA 1SXJB 4QEKA 3IP1A 4OBXA 5FOTA 5IAKA 3SJ7A 3TX2A 3ZI4A 5JAMA 1DT5A 3QSGA 1GRVA 2Q6KA 4OHPA 3BXXA 2O7NA 2CNWD 2PJUA 3E84A 3INRA 2C9OA 1L8XA 3T5GA 1QH1A 3W6PA 1BMFA 3X2SA 2I22A 2R1TB 1S2DA 3MTEA 4L4XA 1B8PA 1HI9A 3QVWA 4HJRA 4WK4B 4BU0A 5C35A 5K0GA 1EWQA 2ZAOA 5IM5A 4ZYVA 3V80A 1LV7A 3LBNA 1N6HA 1WKBA 3R7LA 3X1MA 1ECJA 3I6QA 3KOMA 1S2OA 1Y1QA 1YKFA 1ZA2A 5TQJA 2O1XA 1O4VA 1VKZA 2RJ3A 4G5FA 3NPMA 4DZZA 1KH2A 2W7TA 5D1NA 3U60B 3K7EA 1N6LA 1NJ1A 3H11B 2JGAA 2ZK7A 3LKBA 5EZYB 4ROSA 5EQFA 4C03A 4N5MA 1TO6A 3S2SA 3MT7A 4OHWA 3HBLA 3LOQA 3EUEA 4EPRA 3ZE1B 3PL5A 5H8WA 3OFSA 1AGYA 3GC6A 2Z98A 2PLAA 3L7YA 3AETB 3LD9A 2C82A 4NR0A 4DKJA 1FIUA 2FRXA 3W2FA 2BP7A 2WAXA 1GA4A 3W3ZB 9LDTA 2Z2XA 1KYIA 2REXB 1O5IA 4FUQA 1JAHA 2AMVA 3JVVA 4C3VA 5TDHA 2WTXA 3QU4A 2FPGB 3R5KA 4XVUA 3BTSA 4JI4B 4FOSA 4EZBA 4PZPA 1EP9A 4B7UA 1WETA 1ZW1A 3ZHBA 4HBZA 4ZAXA 4G0UA 1GVHA 4TVBA 5IULC 2E1PA 1VBFA 4NYJR 2J7PD 1ZNQO 4LHZA 3GJ8A 1T26A 4PSAA 3WWOA 3GJTA 1JSXA 2FOIA 3U56A 3Q8MA 4WESB 1XTKA 5TNXA 1R4NA 3STHA 1DAOA 1TM5E 4ZOLF 3DV9A 2G7MC 3CN9A 3VX3A 1DBRA 1OKKA 5GJBA 1DMRA 2QNRA 2EZUA 4JJIA 2AE1A 2F7SA 5F7XA 2NVBA 3NHAA 3ZE6A 1MAWA 1QGYA 4N6GA 3PIDA 3D6TB 5AW3A 1PK9A 1ZO8A 5TQ2A 3HP4A 1I6LA 3DO8A 1OXTA 1R3UA 2AOTB 2PGIA 3HI6A 1XL1A 1DBIA 3IQHX 1NW3A 1SRRA 2ZJOA 3WR5A 2O8FA 2WYHA 4H7EA 4PHTA 1TVKB 1YJ8A 2YDYA 3DE2X 4HFNA 4M0PA 4DTCA 1L1EA 2VHZA 4N4AA 4ISCA 4C1NA 3R5JA 2D2IA 3ETDA 4CM5A 4PZLA 4AJJA 2GKGA 2HH9A 2VYCA 3EXIB 2GZMA 1G20A 3DZJA 1H4QA 2R8RA 2NUBA 1PJRA 4QIHA 3L0YA 4I4LA 5JH7B 2GHQA 3IOMA 2XLBA 4ND8B 2XQFA 3CEMA 5BQPA 3UB3A 5DCLA 3BSYA 4W1SA 1P2TA 2DHEA 3AQ4A 2ACVA 2PKWA 2C4UA 5KC9A 2NNWB 4ODIA 4IDPA 2QY6A 4AI6A 3BDVA 4DDMA 3UY4A 1QMPA 1Y0BA 3BMNB 4IDBA 5ALFA 3C85A 221PA 3BHIA 1OREA 2LKDA 3DB2A 5KAMA 4BRZA 5GONA 4IG4A 2C4VA 1HFEL 3VOSA 1Q0HA 1O9GA 4B40A 1LBHA 4JJGA 3NKLA 5JBNA 5DLPA 3E9DA 2WWYA 1PFVA 5K0EA 1X9IA 4F1KA 4DPLA 1VHJA 3AESA 4PW0A 3WSTA 4QA9A 5B5SA 1CDDA 2YMMA 3GQBB 3SBOA 2IUEA 1IPEA 3RVPA 2CUZA 3G88A 5TMEA 2ZRCA 3TG8A 4Y2UA 3BIJA 2NO4A 1PJCA 1V9SA 4C4RA 3CKMA 5BY2A 2CHVA 4R1UA 5LZ8A 3W1WA 4GG1A 2AG5A 1Z0KA 1W36C 5I9MA 4LJRA 2JCSA 4NDAA 4NJMB 1UFRA 4J9UE 2DQKA 5HF8A 4MGIR 1YQDA 1UK7A 2HHAA 1X7GA 3TIFA 1KORA 2L42A 4WD3A 4D7AA 3B3GA 3AY6A 3ADKA 2YXLA 5JISA 4X97A 2RGYA 4ADSG 4JLPA 2A35A 2KBEA 3NWEA 4HX2A 2F1JA 1XZ8A 2A4KA 3DLCA 1PJ2A 3CVOA 1NXSA 3LX5A 4MRMB 2OA0A 4AF8A 3LU1A 4DNXA 4C20A 2CMFA 4TXJA 2HNAA 2Q5CA 3KU4A 3Q3EA 5FOQA 2YKGA 3F5FA 3D1JA 3QG1A 4V02A 5EMLA 1Q6ZA 2AZ4A 1Y8QA 1WCIA 3UJBA 3RAFC 1D2HA 3F6RA 1N34B 3AKZA 2WU1A 5KTYA 2Y9PB 5COBA 2Z95A 2PQ6A 1CY8A 3UFXB 5DSZA 3LC0A 4V0LA 3KHKA 3UF0A 2YZMA 4N0PA 2IP2A 2WFAA 3L7JA 4FCCA 1HZZC 3GLQA 5AW8A 4RTRA 1R64A 2RKOA 4Y1EA 4BATA 2AL7A 3K9LA 4GO1A 5JCOA 1ZUWA 2QENA 2V6IA 3RSFA 1JEYA 3NONA 4RW0A 2R68A 4Q1VA 3ZEAA 1FQJA 2F3SA 2FKAA 4KG7A 4NULA 3GPBA 2FLVA 4G0QA 3GJ6A 1L4LA 1MPXA 1Z0IA 5WRFA 1M2FA 1JEAA 1F0YA 1I6WA 2ILTA 4HAYA 4EG3A 3DAGA 4K8OA 2QE7D 2XF8A 1ZMXA 4ED9A 2G9RA 5DNCA 2IRWA 1KI3A 1T9ZA 2IU4A 3QJ5A 4MQFA 1XKTA 4R8VA