4E07A

Parf-amppcp-c2221 form
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
205
Chain Sequence
MKVISFLNPKGGSGKTTAVINIATALSRSGYNIAVVDTDPQMSLTNWSKAGKAAFDVFTAASEKDVYGIRKDLADYDFAIVDGAGSLSVITSAAVMVSDLVIIPVTPSPLDFSAAGSVVTVLEAQASRKVEARFLITRKIEMATMLNVLKESIKDTGVKAFRTAITQRQVYVKSILDGDSVFESSDGAAKGEIEILTKEIVRIFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partitioning protein ParF
publication title Structural Mechanism of ATP-induced Polymerization of the Partition Factor ParF: IMPLICATIONS FOR DNA SEGREGATION.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Unknown function
total genus 56
structure length 205
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4e07A00
1G21E 2BOVA 5IHPA 1UPTA 1GAJA 4Y0AA 2P67A 4LI0A 3ZZUA 2WPDA 1Q57A 5KDLA 3RWMB 2PLRA 4NYJQ 1VTKA 3FWYA 4PPFA 3W5IA 3UIEA 3GJ8A 1KIMA 5FBWB 1BMFA 1XNJA 3ADCA 4B3CA 1MV5A 2Q6TA 1EESA 4M0LA 2ONJA 3WYGA 4PHFA 1KZGB 1E0SA 4BFWA 1ZM4A 1G3MA 4PPGA 5DHFA 3UK6A 2E1RA 1XD8A 4QOSA 2CL6X 2N42A 3SDZA 2FGJA 2ODEA 2WHXA 4A8JA 4EIWA 1GVNB 3CX6A 4Q4LA 2JAQA 2N1BA 2QM8A 3EARA 2ZRKA 5EE5B 1SZPA 1V5WA 2OT3B 1XXHA 5BXQC 1ZMXA 2RHDA 2O8DB 1A2BA 1US8B 1TQ6A 1UADA 3NIBA 1FPMA 5JBQA 2R2AA 5J4HA 1KI3A 3GLFE 3LW7A 3AGQA 5TXGA 2ZJ5A 4NYMR 1E3MA 1ZIOA 1KMHA 1ELOA 3IKJA 1N3BA 1NLFA 1VCOA 1I2MA 1XMVA 2WWHA 1T5LA 3NDPA 4G5OA 4ILEA 4O2LA 5JWOA 2VHTA 4LYAA 3U5ZB 1E1RD 2IL1A 1CR2A 5L3SB 1KI4A 1ZNYA 3L0OA 4CT4B 1X86B 1R0YA 2WIBA 5TVKA 2J46A 3AUYA 2X77A 3QBVA 2C98A 3QQ5A 4WZBE 2H1LA 3VQTA 4ZIRB 2FU5C 5TMPA 2ZANA 4JVMA 2NO6A 2ZRMA 3UPUA 3IILA 2CE2X 3U7FB 4TQUS 3H0KA 3ECCA 3L0PA 3S1AB 2PBRA 2Z5FA 2J5XA 4AYWA 2IYXA 2D2EA 5L3QB 5KSOA 1NL3A 1Z5ZA 2AN9A 2GILA 5DSZA 4G0NA 5KUTA 3G0HA 4CEJA 1JQLB 2QENA 3KJEA 5FPTA 1M34E 1P72A 4RKEA 4F4IA 4ZI3A 3LWNA 1A2KC 4QHSA 4CEIA 3TSOA 2NO9A 3K09C 3ZVNA 1EWRA 1F3OA 4Q02A 4B35A 3CF2A 5F2EA 1JNYA 2ZS9A 1L2TA 4P3YA 3GFTA 1JB1A 1N5LA 5HCNA 2OCAA 2UZ3A 4X8OA 3W3AA 3BRWD 2V8OA 1XEWX 1KYIA 2WWXA 1O87A 3CRVA 2IHBA 4JLOA 4MGKR 1OLOA 3PQCA 5UKDA 2P0EA 3I61A 3PG5A 1XMSA 4FMCB 4NMMA 2B8WA 4AKHA 2W58A 4DSUA 2C9OA 1CJKC 3LY5A 1NKTA 2R6DA 1P4SA 4CDGA 1ZJ6A 1DELA 2DPXA 3BH0A 4YMVA 3K0AA 3LLMA 4LGMA 4R2HA 1ZU5A 1C9KA 4RKFA 4XTCS 3CF6R 3B85A 4A8JC 4EPTA 4TMTA 1G41A 1HT2E 1Z22A 1YQTA 4KYUA 4L5BA 2NZJA 2GBLA 5GVSA 5CM9C 3U3KA 1QDEA 2V3CC 5KNBA 3F8TA 3IEUA 2OXCA 3Q8XB 3DM5A 5H70A 3RRMA 2D2FA 3LBHA 4G1UC 4Q48A 3HJNA 2A5JA 3IPXA 3VNVA 2CCGA 3WMGA 3BB3A 1ZNXA 3U3JA 1W2GA 1MO4A 1DAIA 1W36C 1Z07A 3C41J 4FCTA 3KB1A 5DNYB 1KJWA 2BVNA 4BEJA 4F4CA 4DDUA 4P4TA 2QMHA 1LF5A 1KI7A 5CB8A 3K70C 3BFKA 2BDTA 1IY1A 1UFQA 2RGEA 4LPSA 4WZAE 2GCNA 2N46A 4PZYA 1RVDA 3LH5A 1EG7A 2XOKD 3B1ZA 3GQBA 1XMJA 3QPVA 4LBZA 3QKTA 3W90A 1B0UA 5FTLA 5FTNA 1NVVR 2WSMA 2CLSA 2G77B 3L2OB 1AQUA 3I1FA 4L15A 4UXIA 1D2EA 4ESHA 2NGRA 3I5YA 1X3SA 1JAHA 5JSZB 1P61B 4Z1MD 3AH8A 4TMZA 3MGCA 5K8IA 1QHGA 1YZGA 1BYIA 2GA8A 3EPHA 3ND8A 1KJYA 1U2RA 2O0HA 3KJGA 2PH1A 3H86A 4LHWA 1NBMA 1YR9A 1A7JA 3HDTA 5CYPA 3THWB 3PJRA 4DIEA 1KNXA 1CKEA 4GFDA 4F7WA 2XTMA 4YXWA 4M1MA 4PXAA 1N6KA 4BPBA 1Z6YA 2PX3A 2ZRLA 2DBYA 3N5CA 4Q1EA 1UKVY 3NBXX 2CNWA 4K46A 1E2LA 5DH9A 4WZ6A 3QKUA 1KDPA 2GVDC 2J1LA 2ZI9A 3C16C 1T3SA 2JLYA 4C7OA 1Y3AA 3FTQA 3TGPA 4FXPA 6Q21A 1XPRA 5IK2A 1E9RA 3K9LA 4EPXA 4M4SA 5BQ5A 2YZ2A 3I4LA 3DDCA 1GSIA 1KO4A 1S3GA 4KVAA 1GNQA 2AD1A 3QKRA 2EWWA 3RRYA 3T1VA 5KNCA 1F2UA 4DB2A 1ODFA 1Z29A 4BWYA 3PEYA 4QJ5A 2GBLC 3RLFA 3LLUA 2FEMA 2W0MA 1CR0A 1P73A 4Y0VA 1KY3A 2W6JA 1CLUA 1CTQA 3QKSA 1IBRA 4TN1A 1X1RA 4MITA 4QJ3A 4Q1AA 4TTRA 3MCAA 2HXSA 1D9ZA 3Q5DA 4ACBA 4DHEA 3V00A 3WP0A 4GL2A 1DTSA 3K1JA 5FBQB 5F9FA 4AKIA 1N0WA 2BJVA 2J59A 3B78A 4A0HA 2G0NA 4I81A 1G5TA 2NO1A 4ZO4A 2VHCA 1XTRA 1XXHE 2I1VB 4LJYA 5F3WB 1G7RA 4BLPA 2XITA 3K0FA 2GZDA 3X1YA 3T15A 3TVTA 3GLGE 4BFZA 4PQYA 1KDOA 3CPJB 1Z6TA 1P62B 1AS3A 3CZPA 3IGFA 1OXXK 4B34A 1ZC4A 2V7QA 1N6IA 2FOLA 2CBZA 2C99A 3LBNA 4HAYA 4AYXA 1GKIA 2RGGA 1NIJA 3RS4A 2ZSEA 2R65A 1YRBA 4O25A 1DEKA 5IRCD 4XIGS 1JR3D 5HKKA 2QMEA 2IYZA 4XSGA 1YZUA 3K9NA 3VHLB 2WV9A 4DDVA 4YMSA 1GL9B 1W0KD 3CRMA 2H7VA 3PUWA 2ZUDA 3O8DA 2ZYWX 4P4UA 4QHYA 3JZMA 3SFVA 1MO6A 5EE1A 3HWSA 4JZKA 3SYNA 3KKMA 2I3BA 5JRZA 1IXZA 2HLDA 2VTKA 1KI6A 4WXRA 1ETUA 1RKBA 4Q9JA 1LFDB 1E2FA 2VH5R 5JI3E 4US2R 2Z4RA 5J47A 1H65A 5CJ2A 4M21A 3KX2A 4Q66C 1OT3A 1BH2A 2GNOA 3Q72A 1E0KA 2XB2A 1U8ZA 5AJWA 5DO9A 1MH1A 2DWOA 5DHAA 2CK3D 2YHSA 2AL7A 1Z28A 2FSFA 4HDCA 2ATXA 4MKHA 4IDPA 1VHLA 2IXEA 4D25A 4I1VA 3CLVA 3Q3JB 5LD2C 1YZTA 2Z6VA 3C8UA 4Q00A 5JWHA 5AJYA 2P2LA 1KAOA 2ZRJA 1AZSC 3SZRA 4NTZA 821PA 4CIDA 1LY1A 5C1BA 3EX7C 1XD9A 1FX0B 3NBFA 2ZROA 3B8HA 4OQFA 5FUYA 4QGFA 1R8SA 4MRNA 4OQNA 1DAFA 3K53A 1VG1A 3DMDA 2EYUA 3AF1A 2F43A 2WVJA 1G8GA 1IXSB 3PFIA 1U98A 4KSCA 2X1VA 4QRHA 1E2EA 4MA4A 3DZDA 3OFNA 3EC2A 3T5GA 2PZEA 3FFAA 4MDFA 4JJKA 3D7MA 4ZDJA 2JJ2D 3GP8A 4FMCF 2C5LA 1E4YA 1TL7C 3OEHD 3TBKA 3WP1B 4GSYA 3B1XA 5JI2E 2JLSA 4BEBA 4OI2A 2YC2C 3LQQA 2JIZD 2OFWA 4Q1CA 4M22A 2GHIA 5BYJA 3PCRB 3T1QA 1J7KA 4B71A 3QPUA 4DLVA 4KO8A 2ERXA 3WNBA 2XEXA 3ICEA 3K8YA 4ZDIA 4RZUA 3MMPA 4II7A 3SR0A 1SVWA 1M7BA 2OZEA 5TDHA 1S3SA 2HV8A 4LBWA 1F2TA 1Q20A 2FPMA 1MR3F 5EXTA 4DLRA 1E69A 1NBME 4DLSA 4N1AA 1X1SA 1ZRHA 1G20E 2J0UB 2O8FB 1A5TA 3AVUA 1DAEA 4NZYA 3X1DA 4Q18A 1A82A 3VHXA 3E70C 2RGNA 4D0NA 4JT4A 1WCV1 5FL7D 4QFMA 3AKYA 4FMDB 3SJZA 2BBOA 3FHOA 3AP2A 2IX3A 2R6FA 4B2IA 3LW8A 1HV8A 1ESNA 2QPAA 5E95A 4DT1B 4Z54A 5EXSA 4HB4A 4JLVA 2FG5A 2QQ0A 5DIFA 1Q1BA 4UJ5A 1T6NA 3GJXC 4Q7LA 4YC7A 4G5SA 3B60A 1P6XA 3CO5A 3IQWA 3UWKA 3L82B 4R71A 5G53C 2CMKA 3DKVA 2HF8A 2ZM5A 3OE7A 3OF5A 5B30A 1G7TA 1E98A 2REOA 4DLTA 5GVRA 3GCGA 3NDBB 2QQEA 1W5SA 3B9PA 1PLKA 2ZI6A 1XCMA 1SHKA 2XSZD 4DB4A 1II9A 4D81A 1IN6A 4IOLA 1COWD 2QAGB 3CWQA 3QENA 2ZYUX 4DLUA 5CK4A 4P4SA 3EZ2A 3ASZA 2P65A 2RMKA 2VRWA 4Q7MB 1P5ZB 2UVQA 4RCZA 3B82A 421PA 4JLBA 4FCVA 5D3MA 5FR2A 2IS6A 3NBZC 3CONA 1GTVA 4C0LA 1Z0AA 1UKZA 4ZDKA 2B7CA 3DEFA 4TSFD 5E7JA 1G6OA 4AK9A 4HLQB 3M0EA 1FNNA 3EWAA 4JBYA 2PCJA 3NC1C 4V02A 3VKGA 2Z83A 4OJKA 1IOZA 2WAXA 3P4XA 5JFGA 2J3EA 4JBWA 2QGNA 4U5XA 1G1MA 1T8UA 3LXRA 4XWKA 3IIJA 1OFUX 1ZU4A 4EJSB 4B44A 3OAAA 3OEED 1R6BX 2IYLD 2PZFA 2JLXA 3AF4A 1YZLA 2CL0X 1RRCA 1YZKA 2GXQA 1ZUIA 4Q1FA 5KSZA 2QT0A 2CEAA 4BFSA 2AK3A 2F3TA 3ZVRA 1SXJD 2QP4A 2VP4A 2CLCX 3NTUA 3T1TA 5TY0A 4XD7D 2RGNC 2J41A 3U3MA 3GLFA 2YJTD 2C96A 3B7GA 4GP6A 3TMKA 4PSVA 1Z2AA 4F92B 1Q12A 3RS3A 4R9UC 2IS1A 2IWHA 3C14C 2BMDA 4D4MA 1U81A 4RCYA 3U4QB 4QG7A 4PAQA 4A0FA 4NYIR 3CUEF 5CLQA 2OBMA 1VIYA 2EQBA 3I92A 1HQYE 3SFZA 1SXJB 4PTLA 3AVPA 2X8AA 1MO5A 5CDFA 4KITB 3IO3A 1QBKC 4P32A 2J0SA 4MKIA 1NG9A 3ZIAD 1YVDA 3TQFA 1OHHD 1II8B 2NPIA 4EFNA 3DHWC 1N5JA 2A2ZA 2DWPA 2QSZA 1UAAA 3NWJA 4QBGB 1H8HD 1T0HB 2GTPA 2DFTA 5KDDA 5SZHB 4A2WA 4IOKA 1DOAA 2GF0A 1W48A 3NH9A 3QSYA 4BQSA 2A78A 4W9MC 4MGZR 4X8LA 3H2YA 4FMBB 4Q21A 4QKQA 4HZUA 3CRQA 2FPKA 4OHVA 2I1QA 2V55B 1IXRC 4JYCA 3CPEA 3CX7A 4TLAA 1YJ5A 2ZR9A 1FL9A 4TT3D 2ZRAA 3CW2A 4NYMQ 5JZVA 2FJUA 2J7PD 2AK2A 2ZE7A 1HY3A 3RABA 2G88A 2ZE5A 4Q9KA 3QG5A 2C95A 4CVNA 4ZV4A 4LYFA 3AB3A 4ZDWA 1ZAKA 4LK2A 4E03A 5DN6A 1DAMA 3BBPA 3LDAA 1PUIA 5FPYA 1GNRA 2EFDB 2KSQA 1XEXA 3VU9B 1D2NA 4ON9A 5FTKA 2QGZA 3AP1A 4CEHA 1AN0A 1JALA 1E2IA 5J4VA 1M6NA 3NG1A 2GESA 3WNDA 3A36A 3CNNA 4LJAA 1VHTA 2WJVA 1SHZA 3KZ1E 3KFXA 2IYWA 4JVLA 3W9YA 2XNDD 3P4YA 4D82A 3GLHA 1Q3HA 4FINA 2W0SA 4NU0A 4BFXA 4W7SA 1Z6GA 5CLLA 3WXMA 1R10A 3AVVA 1EX6A 4MRRA 2WWWA 3GJ7A 4JLNA 2WBLC 4NCNA 5C4GB 4OK5A 2IK8A 4M9SA 2IUUA 2JJ1A 2ODWA 5KSYA 1R8QA 3P20A 3GLIE 1XF9A 2KWIA 2QORA 1G7SA 5E7MA 2BKUA 2QE7A 2EU8A 4QGHA 2HYDA 1E9EA 4LC1A 3I5XA 1P60A 1W4AA 3TR0A 2GDJA 1Z06A 2HEIA 4H1UA 2VP6A 3AV0B 1IM2A 3WMEA 2IYVA 3U6KA 4US0R 4BFYA 4UXJA 5CIQA 4CRWB 2XAUA 5H8WA 4UXHA 5HCIA 1VG8A 3U3OA 2O8EA 3OIVA 1M1YE 3T34A 1GM5A 1LVGA 4LX0A 2ZR7A 2AKYA 1OPXA 4IW3B 4ESVA 2DHRA 3TLXA 3BAFA 2R9VA 4TLCA 3TUJC 3WRYC 4JLDA 1N6NA 4IEIA 5JECA 3QVVA 2IYSA 4WVFA 4MKGA 1E2KA 1LB1B 3CB4A 4ARZB 1Q3TA 1ZIPA 2WJIA 4RSGA 4V0LA 3DMNA 4HUQB 4C9BA 3TE6A 4C0HA 4FMDF 2BBSA 4XVRA 3AVYA 3BB1A 2BIFA 1ZINA 2OXRA 1G6HA 2R6GA 1CRQA 4XVQA 2ANCA 2RAPA 4US1R 2XZOA 3NVAA 2O8CB 2LWIA 5L8VA 4KHZA 4TYQA 1KO8A 2GEUA 5DISB 2WAYA 4KFSA 2RH5A 2FF7A 4JL8A 1D6JA 3RS2A 2V6JA 3IIMA 2IF2A 4B3FX 1CJUC 1WQ1R 3B5JA 1NVVQ 4RFVA 2CJWB 2XXAA 4POAA 1XTJA 1VKJA 4NDZA 5AUNB 2BM1A 2GK7A 1CU1A 1QHYA 4IXMA 1SVSA 4DRZA 1CBUA 1HH4A 3EZ7A 4BFTA 3A1WA 3HU3A 1GRNA 3RAPR 2RGBA 2RGAA 1CJMA 2NZ8A 3WNCA 3KUCA 2BMFA 4DC9A 2ZE6A 3TK1A 5JCZA 1J2JA 2GCOB 3L0SA 2QPOA 3BJIC 1AJEA 2GWHA 3PUVA 3THXA 1W7AA 4Z8YA 1BMFD 2WJJA 3CRRA 3WBJA 1G4UR 2YWGA 3GLGA 3QF4A 5FOSA 1G64A 1G5RA 1FW6A 2AFHE 2DY1A 3OZXA 2HT1A 3TNFA 1E1RA 5ANRB 1IJFA 4G5QA 5FUXA 1W0JA 4Z51A 4ZCIA 5C2JB 1DO2A 4RZ2A 4KV9A 3AGPA 1KK3A 2DB3A 2REBA 3CF0A 3MWKA 1Z47A 4A6XA 1T91A 4O3MA 2VIIA 1NMZA 2G3YA 1G9XA 3WBKA 5CDFE 1HURA 4LOAA 4HAVA 1WRBA 4OK6A 4RZ3A 2ORVA 2YNMA 2QSYA 3GEHA 5B57C 1OJLA 2WMNB 3PUXA 4DUGA 2Q21A 4UJ3A 4A8JB 4EPRA 2QU8A 3MG9A 4B73A 5KNDA 1VDZA 1NF3A 2ZSAA 5EP4A 4TTPA 2QAJA 1TPZA 3ZVLA 1DVRA 2IW3A 1NJFA 1OSNA 3K70D 4FI3C 4XH9B 5DI3A 2WKQA 4OL0A 1KKMA 4R98A 1JBKA 1M74A 3AEZA 1EFTA 5ELXA 3EZFA 2PEZA 2BEKA 4BLRA 5E3HA 1KMHB 4QM6A 3FMFA 1TUEA 2QT1A 2WWGA 4LSGA 3VX3A 2ZI4A 1YE8A 1YHNA 4B2LA 2E9SA 2F9LA 2GETA 4PAMA 1QHIA 3OIYA 4TYYA 4PC1A 4XVUA 3QXXA 1G3QA 4HYYA 4PC7A 5JLJA 4PC6A 3K70B 1IONA 3PEWA 4URXR 4LRWA 1S4QA 3CZQA 1ANKA 3GFOA 1KKLA 1C4OA 1RIFA 2F1RA 2P5SA 3F5FA 3TR5A 1ZCAA 2VSXA 3D8BA 4KCGA 1Z8FA 4IDQA 1G17A 3TRFA 2QROA 4XJXA 2B92A 3F0TA 2FFHA 2WSSA 3BFXA 4LYJA 3JVVA 4DDTA 1Z0KA 4YMWA 1IN5A 1XBTA 4HDOB 4M1YA 1YR7A 2VP9A 4CEJB 1OE0A 3GLHE 1UBCA 3X1WA 4BGDA 2VF7A 3SBDA 4C2UA 2VO1A 1OF1A 4KFUA 2F1IA 3KXLA 4OI4A 4CEIB 1RE0A 4RFSA 3W5JA 4JSYA 4IDHA 1ZYUA 5EE0A 4TLDA 5TV2A 4ZCLA 3UG6A 2OSBA 3W6PA 1OH6A 4KFTA 4DSTA 2JLWA 1PLLA 1RYHA 2GKSA 3NEJA 3FKQA 2XOKA 2KE5A 4N0EA 2OAQ1 2V54A 4Q01A 4Q47A 4QGGA 2DWQA 3Q7PA 5AK0A 5DYGA 3UMSA 4UNRA 2JASA 2VP0A 4LCBA 2VBCA 1E79D 3I73A 4GBMA 4KJZA 5DGXA 1KI8A 3HU2A 5KPJA 2NIPA 4HLUA 4P33A 2R6CA 4HEJA 1DPFA 3MJRA 4AWXA 2QTFA 4AG5A 3IBGA 3B13B 4TL6A 4RD3A 2ZRDA 2WOJA 3BWDD 1TAGA 4LHXA 5K8LA 4Q4JA 1SKYB 1JXMA 3CBQA 3WYAA 5AJZA 4QNMA 5HZHA 2OFXA 4D4KA 5J4YA 3W6OA 2P6NA 3EIEA 2QTHA 4AI6A 3UXMA 3SHWA 4AURA 4HB3A 2ZU6A 4DXAA 2A3RA 1JECA 4YXWD 2ASEA 4LWZA 2W6IA 5EP1A 4JBXA 3QBTA 3U7HB 3QY0A 1WF3A 2D62A 3ZZ0A 1G8YA 1TUIA 2YOFA 3SS8A 2QPTA 2ZUCA 2VP5A 4PZLA 2OM2A 5JS7A 2WTUA 4A15A 1JJVA 4I99A 2W83A 1KSHA 1GKYA 1Q21A 3RS5A 2P3SA 1E2NA 3EC1A 5IK2D 1P7CA 2LKCA 2HJGA 1P9WA 3VKWA 1SVIA 4DBLC 4URVR 3R9XA 5J5CA 1E9SA 1OXVA 2F1HA 4EDHA 1P2SA 1IN8A 1EFRA 4XOIA 4D4LA 5JEEA 1II0A 5BWMA 5BN5A 1BO6A 5JEDA 1S8FA 2NO0A 1GP2A 4LJ9A 1CEEA 1F5NA 2EW1A 3EWSA 2W6JD 3TSWA 4C7OB 2Y8EA 2VHUA 2CCKA 1KI2A 2HUPA 4RD6A 4YONB 2IWRA 1Z08A 3JVUA 4J0QA 3I62A 5JRJA 2EWVA 5FBRB 3AF2A 3QJYA 4QHTA 2ECKA 1GL6A 3THYA 2HCBA 3QKRB 4Q1DA 1F2UB 1S1MA 3MWLA 1D9XA 2ZSDA 3DOEA 1JR3A 5GJCA 1ZVQA 2AX4A 2OFOA 1NG1A 2ZU0C 1AM4D 4TWZA 1L4YA 1W0KA 4HLUC 3HR8A 4DCNA 3QKSB 5G41A 3LNCA 1YR6A 4WXPA 2CDNA 2V7QD 3C5HA 1JEDA 2DR3A 3BGWA 1YU9A 4BLQA 1UF9A 1NI3A 2IUSA 2ZEJA 1NSTA 3C4JA 3AUXA 1RFLA 4BFVA 2ZYTX 4ERNA 1OXTA 1AQYA 1DG1G 1TQ4A 2WWIA 3KKNA 5HKKD 1K8RA 1A4RA 1N2CE 4IFEA 4K8OA 2WWFA 4D80A 4MYTA 1N6LA 5EXXA 3SU8A 1G19A 2GJKA 3K0FB 4A9AA 2FX3A 4PC3A 4Q7JB 4DEXA 4X8HA 4DLZA 2IBMA 3CH5A 2J45A 5IDVA 1XTQA 3U44A 1QVRA 1XB2A 2CK3A 5FPKA 1U94A 3GLIB 4B43A 4KODA 3VR2A 1P2UA 1UDWA 2HLDD 1FP6A 2A7QA 2VHJA 4GNKA 4LC0A 1P9NA 2CLDX 2JEOA 3A8TA 3UKDA 1D2MA 2QA5A 3LFUA 1FUUA 2IS2A 5JJLA 3P1JA 3RWOA 3ZGXA 2PT7A 4MH0R 3ZYCA 1CRPA 4MYUA 5EZ6B 2R6AA 2G0TA 4QNRA 3EA0A 2YC4C 3RHFA 4YMUA 4FWTA 1P2VA 4F38A 4D0GA 1X8LA 1XP8A 1H8EA 1VG0B 1KO1A 5FOVA 1OH5A 1AGPA 1NKSA 2Q3FA 1ZUNB 4KXFB 1UDXA 4FN5A 1P2TA 2J0QA 1FQKA 2MMGA 2GVZC 4B75A 3QPWA 2ZJOA 2KB0A 5KOYA 3U61B 5JS8A 3CR8A 3OIWA 3ZD7A 2JJ2A 3I8SA 1ZM9A 4NYIQ 3OEHA 3EPJA 3ZLJA 3ASYA 4JLAA 1NN0A 1KDTA 1T9HA 2D7CA 1XPUA 1XPOA 2JLVA 2P6UA 4I4LA 2WJYA 3PXGA 2O8FA 2JATA 1E96A 2WOOA 3RYTC 1NN5A 4TLEA 2BKEA 1CXZA 4O2RA 2NO7A 4C0JA 3TAUA 4FW9A 1BIFA 1GZSA 1E4VA 1NVWQ 5TB5A 1NY6A 3RANA 3FPAA 3N2IA 1SGWA 1VCNA 2OBLA 3KXKA 1UKEA 1E9CA 5FUWA 4DLXA 1DARA 1AGRA 2OG2A 4MKFA 2Q9BA 3T1OA 5G40A 1AK2A 1EFUA 1G291 2F43B 2H18A 5TARA 2QP9X 2GJ8A 4OQXA 1JPJA 2JLZA 1OKKA 3T35A 2OLKA 4A92A 4B74A 5H68A 1G8PA 1Z83A 2VEDA 1DS6A 3FKSD 1W49A 5FL7A 2LCFA 3OESA 4F91B 1LS6A 2GJSA 3D6TB 2WJHA 5KTYA 2ZRPA 4Q4HB 1HEIA 4PQFA 3VR4A 2QRZA 3KJIA 3KQHA 2YKGA 4BLOA 2HF9A 5K8TA 2SHKA 3THOA 1TF2A 2FGKA 1JR6A 2EYQA 1R5NA 1XEFA 1XX6A 1XFAA 1Z0JA 1HE1C 2JJ8A 3BORA 2BBTA 1MO3A 1E1QD 1E6CA 2Z43A 1G18A 4GMXA 2CHQA 3BH7A 3JZAA 1E9DA 3X1ZA 5C46F 3BS4A 4QBFA 2ZPTX 1HYQA 4Q1BA 1QVAA 2ONKA 1ZCBA 3EIQA 4JSTA 4Q03A 2PZGA 1IN7A 4ZI2A 1P3JA 2B8TA 2GJAA 1E9BA 4GRAA 1W1WA 1VCMA 5E7IA 4W5WA 1F48A 3AVTA 5JJKA 1EK0A 2XSZA 4XTRA 1RRFA 1EXMA 1JAIA 4OQMA 2IUTA 3TKLA 2BCGY 3PUZA 2FFAA 1COWA 4JKYA 4RY2A 5DI9A 4MDEA 5LDDC 4JLKA 3OE7D 4EFLA 3VKHA 4KSBA 1JJ7A 3TUIC 3V4RA 4JS0A 2EFHB 1JXOA 1FOEB 3QE0A 1RW4A 3AKDA 4DWJA 3BXZA 2ZQ5A 2B7BA 4K81B 1OH8A 1G3UA 2A9KA 121PA 1G16A 5KDOA 3A1VA 2NTYC 3SJAA 3OEEA 3RC8A 2OO7A 3IUYA 1DADA 1N6HA 4M1KA 5DE3A 3EPKA 1JR3E 2W2XA 4AKEA 3IHWA 4HZIA 3HR7A 3P26A 1IAQA 4NH0A 1XJQA 5BYKA 1HQCA 5AR1A 3BE4A 5EXPA 5FBVB 3DL0A 4KLNA 3GD7A 5CIWA 4LHZA 5KHOC 4FD2A 4OYHA 1R7RA 3QIAA 1SKQA 3OAAD 1W46A 1XD2A 2QTVB 2IYYA 4P4SB 4D2IA 1ZP6A 1TX4B 3RDPA 3UG7A 2FN4A 4G01B 1T3HA 5J40A 2IA5A 5KU1A 5D3MB 3R9WA 1NP6A 1JQJC 1W4RA 4Q9IA 3U7EB 4S2EA 3MWJA 4YMTA 1GWNA 1CJTC 1KK2A 4LUCA 5DYIA 2C78A 2D4HA 2ORWA 1KSJA 2D74A 1KOFA 3U3RA 5GJBA 2RHMA 4A6PA 1E2GA 3AVWA 2RB4A 3ZIAA 2EFCB 4LV8B 4MRVA 4ASUD 4EQ6A 1OHHA 3KQNA 3R20A 3B1YA 1NIPA 1WBBA 1R0WA 2FDCA 3PVSA 5H1YA 5A0FA 4QBHA 3SJCA 1QHXA 3CRW1 4WAUA 4UNNA 3GJ6A 3KTAA 3NBYC 2ZI5A 3DVLA 3NXSA 1DAKA 1ZD8A 2QN6A 2J0VA 2FFBA 1OB2A 1DBSA 2NQ2C 2VSFA 2PJRA 3A37A 4U7DA 3QI2A 4IXNA 1WBDA 3WHKA 3GLFB 1YKSA 1CULC 2ZI3A 2QUZA 1SULA 1T0JB 1K5DA 3SEAA 2FZLA 4G3XA 2PMKA 3RRNA 4PO1A 2OAP1 3QF7A 4D26A 4C0KA 3T06B 5KPDA 2J7PA 3ZQ6A 3Q7QA 4V0NA 4HUTA 5SZKB 3BERA 3DPUA 4NKRA 3AVQA 5AJXA 2QP3A 1MRNA 4PAOA 1QHHA 4PANA 3R9IA 4BZQA 2X19A 1I4DD 2O52A 3A4LA 3Q9LA 2ZE8A 4URZR 1HUQA 3A4MA 3D31A 4CW7A 4E5UA 1X8KA 3GFPA 3TH5A 1QF9A 4QXAA 4LJ8A 3REGA 3A1TA 1RJ9A 4DLWA 2JCSA 5BW8A 1XU4A 2AXNA 3KJHA 3SC3A 1D8TA 1OFIA 1SXJC 2R8RA 4TQAA 2VPPA 3FE2A 3O8BA 1HT1E 4LJ7A 4B3BA 2IEZA 4WW0A 1E32A 3LVQE 4M1SA 4NHOA 4IKEA 1WP9A 3L8YA 2IC5A 3KXIA 4W5JA 2IT1A 5DN6D 2XGJA 2ZJAA 3C5CA 4HZUB 4YDSA 1OB5A 4HAUA 2IS4A 4IJMA 2KI5A 3UWOA 2EFGA 2RCNA 1FTSA 1SVKA 4M8NE 4BE7B 4M2LA 1FMJA 2O0JA 5FOXA 5L3RA 5HE8A 1SVMA 2O8BB 2EFEB 3K0SA 2WM9B 2QEQA 1G3RA 1IJEA 3SE0A 1ZM2A 4NL4H 4BUJA 5F98A 2OESA 1F6BA 1QHNA 3MUFA 1QZXA 1G8FA 4V0ME 5HTKA 5FOWA 3I8XA 4ARZA 2IHYA 4Q4AA 4BLTA 3R7WA 2F7SA 2RKOA 1XEXB 2HCJB 1GG2A 2C2HA 3LX8A 4PHGA 4NCJA 1NJGA 4CEHB 3A6PC 2JJ1D 3IO5A 1P9RA 2J87A 1U8AA 3H1TA 4JLMA 4TMXA 3GJ5A 3HPQA 3LVRE 2XZLA 4IVPA 2W2TA 2BBWA 2FA9A 1V43A 4OK3A 1PZNA 2VHQA 3GLHB 3FMPB 1OFTA 2WZQA 2VP2A 2ZITA 4HB0A 4KLZA 1L8QA 2VYFA 2QBYB 4OHXA 4WA7A 3VR1A 3V9PA 2ZYVX 2JDID 3N2EA 4UNPA 1ONBA 3UMRA 3B9QA 2JLQA 3O8CA 1RC8A 1BS1A 1VYTA 2ZETA 4JVNA 1MABB 1WE2A 3BIFA 4BASA 3TVDA 1N5KA 1GNPA 4LDJA 2NG1A 4MUAA 4URWR 2A30A 4JJZA 4C0SA 1AIPA 4MGYR 1TU4A 4L8GA 4C0QC 4NCHA 4AC9A 1NMXA 4GP7A 1Z0IA 2MSEB 3QEJA 3ZS9A 1XDBA 2AWNA 1IY2A 1RYFA 2A5YB 2XNSA 4L9SA 2O8EB 4TYWA 2O8DA 3DOFA 3R8FA 2IEYA 1US8A 2AR7A 3DKPA 3G82C 1NLYA 3AF3A 1RPZA 3PV0A 2F55A 4KI0A 4MQBA 1S9DA 4LHYA 1D5CA 4JKIA 1VYVA 4A36A 3BH6A 3MLEA 2B21A 1QG2A 4AD8A 3ONWA 4IRUB 3ICQB 1U99A 2J7KA 4ZPXA 3TJZA 4DCVA 5L3SA 2OUKA 3VAAA 3W34A 1BOFA 2ZAMA 4TTQA 2WPDD 4TMKA 4LBVA 521PA 3EG5A 5CITA 2MMCA 1SXJE 4ZIRA 2YVUA 2NPFA 3WY9A 4LPKA 4JVSB 2V9PA 4YLGA 1NLZA 2ZS7A 1N6OA 4ACAA 3B6EA 3BD9A 4DCUA 1DAGA 3S1AA 2ZSBA 5L3QA 1A1VA 4CYMA 3KFVA 4V0OA 5P21A 1OYYA 2Q3MA 2ZJYA 4CT5A 5BN3A 5EJEA 2HJVA 3HYRA 2ZREA 4Z8XA 1DE0A 5CM8B 1L4UA 1GFIA 1PV4A 4M1TA 2XJ4A 1CIPA 2XXAB 2QZ4A 2OE2A 3FMIA 2DFLA 5EUQB 3U2QA 1JI0A 2XTNA 5E4FA 3CM0A 2CVFA 4JL6A 4E09A 3DM9B 1G5PA 2OILA 3H4MA 2H57A 4L9WA 4DVGA 1W36D 1XZPA 1OW3B 4DDWA 1U90A 2FMXA 4A4DA 1W0JD 1UM8A 2BV3A 4OJQA 4QGAA 2D7DA 2BJWA 4PSKA 1TU3A 4U00A 1N0VC 3EZ9A 1NNEA 1QHSA 1XXHB 5BN4A 5HE9A 3THXB 2WKRA 1U8YA 2B6HA 1IY0A 2ZJZA 4HLCA 4PPQA 3GLGB 2GRJA 3MD0A 3QF4B 4L4UA 1ZM7A 1TADA 3KDSE 4W5HA 4TQ9A 4KBFA 4TLBA 3K0CC 2BMEA 4GZMA 1W36B 4DUGD 3CH4B 3VX4A 1XCGB 4DLYA 4KYIB 1GUAA 1W44A 4EPVA 4OKSA 4DCSA 1M8PA 1UJ2A 4E07A 2FFQA 2O5VA 2WMOB 1E2HA 3FFBA 1U0JA 2ODBA 1E2PA 1GILA 1EFCA 1M7GA 2FSHA 1E0AA 4LZZA 5D3QA 3K9GA 1N0UA 1NY5A 4FCWA 4QM7A 1OIWA 3OHMA 4HAWA 5FL3A 1KTVA 1ZM3A 3VR3A 4OI0A 1KI1A 5B2ZA 4C30A 3E1SA 3GJ3A 3SQXA 1RRGA 3B1VA 5EE3A 5LD2B 2MSDB 1I2DA 3QUSA 2ZS8A 5DI3B 1UEIA 5LB4A 5DLQC 1K6MA 2PL3A 4NCKA 4Q9HA 2BHRA 4HSEA 1XWIA 4NONA 1QRAA 2DFNA 5JSZA 1RZ3A 5HPYB 2ODNA 1OXUA 2WSSD 2GXSA 4PO8A 3QEOA 3IQXA 3SI7A 5EP3A 3THWA 1R5OA 4XSHA 1DG3A 3REFA 4BECA 5K8UA 4HI0E 1IN4A 3PITA 2JLRA 4LYHA 3SQWA 3LXXA 3TUZC 1Q44A 2PCLA 2L0XA 2D06A 1VYUA 3NH6A 4B32A 5FI0B 2JLUA 2ZVPX 2C8VA 3K0AB 5AUOB 2X2EA 3E2IA 2R62A 1ESMA 2YOHA 4Z1MA 2D3WA 1E79A 4KAXA 2BEJA 2PMDA 3IDQA 4CGZA 3TW4A 2Z0MA 3VMFA 4A2PA 4IOMA 3IEVA 4ITRC 3T61A 1XRJA 4B3DA 3VR6A 5FOTA 2ZRFA 1MOZA 3U6BA 4NYJR 2I4IA 2J9RA 3RS7A 4E22A 4LY6A 4YQFA 1GIAA 2Z4SA 5AUPB 4TYNA 1J8YF 2Q9CA 4RFSB 3X2SA 4RZXA 3L8ZA 4TL9A 1OYWA 4AG6A 1UBGA 1VECA 3QXSA 1R0XA 4MRSA 2KJQA 2X2FA 4P31A 1GITA 1E0JA 4WIAA 1ZD9A 1W47A 2WJGA 3FVQA 1SQ5A 3HYTA 1NBMD 1W5TA 4GT1A 1FP7A 1WA5A 1G8HA 2G83A 3HPRA 3PEUA 4B2PA 1FTNA 5IT5A 1Z6XA 3C15C 4NCIA 2H5EA 3V4FA 1KY2A 5G3YA 2CNWD 4MYCA 1AS2A 1VG9B 4M1WA 4C2TA 3LBIA 4JLJA 4C3ZA 3GPLA 4EAQA 3AKCA 5GJVC 1XZQA 1N6PA 2F1JA 3K0EA 621PA 1W4CA 3NHAA 5LPNA 4RVCA 4B3GA 3C7KA 1KNQA 3M4YA 3SYLA 5FTJA 1NVUQ 2JGNA 1J8MF 2FPLA 4X8MA 3VFDA 1Q1QA 2W6ID 2W00A 4TMVA 3KQKA 1R2QA 2XJ9A 3DO6A 1OIXA 4IEEA 4WOPA 2IF0A 3M1IA 2OEPA 2RGCA 3O47A 4NPHA 2NMVA 4Q4JB 5JHGB 4A0GA 2GEVA 3IIKA 1KAGA 2FWRA 3PIRA 2YYZA 1FMLA 1XJCA 1NRJB 1S9HA 2VF8A 2ZJBA 3CPHA 3KB2A 2ANBA 4B47A 4GPTA 2OLJA 4QL3A 2FSGA 2CCJA 5GADl 2ZAOA 4M1OA 2ZRIA 1E2QA 3FHTA 1J90A 1YRAA 2QI9C 1KK0A 4N0DA 1EFRD 3GMTA 1OH7A 2WWYA 1CR1A 1WXQA 3KKOA 1L7VC 2F9MA 1N25A 1TNDA 3HP1A 2FEOA 4M9XA 2UZIR 3RSLA 5CJPA 3CNOA 4DZZA 1OIVA 2QNRA 4MUBA 3CIOA 3EW9A 5FTMA 1YZNA 1OFHA 4URUR 2AHOA 4S35A 4TL8A 4L16A 4UNQA 3NHBA 4A1FA 3GLIA 2F6RA 2YWHA 3SBEA 3A58B 2CE7A 1FNMA 4GMDA 4EPYA 5JJIA 1JPNA 2IXGA 4Q5IA 2YINC 5FOUA 4B3XA 2V1XA 4GOKA 3FGNA 2ZSFA 2GAOA 4CF7A 3SNHA 2JA1A 4KBGA 3ADBA 1XMIA 3AF0A 8OHMA 2ZRCA 3LQRA 2DYKA 1GOTA 3I32A 4DSOA 1P75A 1FX0A 3L0IB 3EAQA 4BRWA 3EXAA 4GI7A 4ABYA 1M7HA 4PPNA 1ZNWA 5CYOA 3THYB 2VA8A 1LTQA 2OHFA 1YZQA 1XJ0A 2IYQA 4B6FA 1ZUHA 1Z2CA 1TF7A 4BZXA 1F60A 4EUNA 3LRPA 3T5DA 1AKYA 2GCPA 1Z0DA 1G4AE 5EZ5A 1LS1A 1WB9A 2G1JA 3QOFA 1T5IA 3BK7A 3QXHA 4NE2A 2CL7X 4RD4A 1NVXQ 3MRSA 1ZD1A 2QMUA 4N3NA 1TTTA 4R7ZA 2K5UA 3UMFA 3FYHA 3TIFA 4BZPA 4FWIB 3RC3A 2OCPA 4PHTA 1UBFA 2P6RA 2TMKA 2VSOA 1KI6B 3OIUA 3W8RA 4IVRA 3IHLA 1S2MA 2C9YA 3WMFA 4A2QA 1S1CA 4KVGA 4A82A 4I1UA 3A1SA 2F3RA 3FHCB 3LA6A 4IFBA 4JL5A 3M6AA 4GDFA 2V1UA 1W2HA 3H84A 3QXCA 2ZI7A 3U44B 1T8TA 3U7GA 4HDQB 4I1OA 2FSIA 1ZC3A 1H8ED 4IDOA 2JIZA 1EWQA 3WHLA 1MKYA 4RD2A 3CWZA 2J0UA 3I72A 5SZJA 4XWAA 3A4NA 3O8RA 3CKLA 4P0TA 1U9IA 2KBFA 5A4JA 2GEDA 5FUVA 3OFND 5HR5A 3MSXA 1Z63A 5HZKA 3MJHA 1I4TD 2ZRHA 3ZD6A 1X6VA 4TL7A 1G7CA 4HATA 2HXYA 3VTKA 1OXSC 2CHGA 2O0KA 2FE4A 2W2VA 2Q9AA 1SKYE 5LBIA 3RVBA 3W3ZB 2AD5A 4Q4HA 1ZBDA 3RRZA 4MRPA 2DCUA 3FB4A 2H16A 4AIIA 4DT1A 4LJ5A 4PX9A 1O3YA 3Q5EA 4AY2A 1Z6AA 5JWRA 3X1XA 1G3IA 4WBSA 1E2MA 1EFHA 5J4LA 1FUKA 1IQPA 5FPSA 3UANA 4B33A 2C03A 4EFMA 3FKSA 1KJZA 1DAHA 4C0BA 5C4MA 4V0MA 4HAXA 2A5GA 1KK1A 2LKDA 4GZLA 2YWFA 4AYTA 2PEYA 3KQLA 1I4LD 2AKAB 2OBNA 4TZ0A 3ZZTA 1E2JA 3B2EA 3SOPA 1RRPA 2WKPA 4JLPA 4IHQA 1E1QA 1OKKD 1FZQA 2ZR0A 4M9ZA 2QAGA 3ETLA 1K5GA 1S0UA 3P27A 1TEVA 1YR8A 3R8CA 1EGAA 3QXJA 4JMPA 1X8JA 3SHFA 3SJBA 3FOZA 4UNSA 1F2TB 2QM7A 5FR1A 2AFIE 4C4PA 1B23P 4RD1A 1KSFX 5SZIA 4U02A 2XX3A 3LX5A 1IHUA 3NC0C 2G6BA 4ZKEA 2G1KA 3IPYA 1E9FA 4BRUA 2H8KA 5AJVB 2WICA 4EJSA 4V0KA 3W6NA 4ZKDA 2BMJA 1OV4A 1VPLA 2QY9A 3PUYA 2PX0A 2QMOA 4B76A 5F9HA 4TSFA 2BM0A 4ZCMA 1U9IC 3FDIA 2ZJ8A 2ZTSA 4OHYA 3AP3A 1Q1EA 4LV5B 3AM1A 2EVWX 4H9GA 3EZ6A 5CK5A 5G3ZA 3U60B 2YOGA 2BC9A 3NKVA 3PEVA 3CX8A 4HB2A 2OV2A 2UKDA 3P32A 4D0LB 3LD9A 1TEXA 3Q85A 4DCTA 1M2OB 3PENA 3U4QA 1NN1A 4IOJA 1AKEA 3D3QA 4Q19A 2A5FA 2C9CA 4OHWA 4H1VA 3AVOA 1N5IA 3LV8A 2HDNB 1N6RA 2BWJA 4HAZA 2HT6A 1SXJA 2MSCB 1CS4C 2FZ4A 1NN3A 4KFRA 3GEEA 4XD7A 3CNLA 1CJVC 1LF0A 3FMOB 2FH5B 4PSAA 5FH9A 2GZAA 5L3VA 1MRSA 3EPLA 2Q0HA 2CHVA 1TF5A 1NMYA 2OCYC 1Q22A 1KZ7B 4IVQA 2PT5A 1II8A 3G5UA 4OHZA 2QG6A 1TQ2A 2C04A 3TSZA 3ZDQA 721PA 1HA3A 3BB4A 1TQDA 4EPWA 5LB2A 4F4JA 2HYIC 1VIAA 1HE8B 2GXUA 1AZTA 2H17A 3GJ4A 4LHVA 4OI1A 1T4GA 4DEYA 1GDDA 1KDRA 5CB6A 1E2DA 1E9AA 2FV8A 2ORIA 1VMAA 4GOJA 1GKUB 1VCIA 1GRQA 1R4AA 2H92A 2QAGC 4ASUA 3K9HA 4PHHA 5EQTA 2REXB 2YV5A 2PLFA 4G5RA 3B1WA 4Q7KA 4XWOA 4TZ6A 2ATVA 1H8HA 4M53A 1UEJA 4IDNA 2RGXA 4PO9A 4JIMA 1CP2A 2QRNA 3F3YA 1J99A 3KUDA 2P5TB 2A5DA 4FIDA 3WRXC 4EJSC 4KU4A 4AKGA 3MFYA 3BFVA 3NEYA 4UQOA 3TAHA 2GAAA 3T12A 3VU9A 3VR5A 4LJ4A 1R5BA 5J4KA 4DKXA 3IBYA 4NP6A 2V4ZA 3A1UA 3QVUA 1XD2B 4TT3A 2ZRNA 2ZUBA 4R2IA 4RD0A 4EKDA 4QJ4A 4DSNA 3KQUA 2WIAA 5IF9A 1GRRA 5FI1B 3EASA 2G9NA 2VLIA 3N70A 2GXAA 4TMWA 3ZS8A 5B64A 2OCBA 5AUQA 4LJ6A 3SN6A 4CZ2A 4D6PA 2ZXUA 5FBLB 4PZZA 3ZH9B 2IYUA 4EQ6B 3UATA 4B48A 3MWYW 2ZJ2A 4LBYA 2IYRA 5M04A 2VL7A 4JT2A 2AXPA 2O8BA 4HLDA 3KTAB 3SYKA 2XNDA 2PJZA 2GF9A 2XZPA 4RJLA 4O0MA 1MT0A 1SVOA 4G5GA 5B58C 1HTWA 4Q9LA 4QC2A 3GJ0A 5A5GA 4UKDA 5GJWC 2FNAA 2E87A 1KGDA 3VNUA 4I1SA 2GZHA 5FPHA 2ZRBA 1S96A 3MAAC 5KSPA 2RGDA 3KKPA 4GOXA 3RNLA 1ZW6A 4DIDA 1Q0UA 1AS0A 1XCPA 2DFKB 3QG1A 4MYHA 1E94E 1LW7A 1XTKA 2NOAA 2V6IA 2YWEA 4HUQA 1BYUA 2IXFA 1QHHB 1NSFA 2IYTA 1KI9A 5EUMA 1TMKA 2QBYA 1Q1ZA 1ZNZA 1XEWY 3L43A 4TYPA 3RSOA 4F93B 4YDHB 3ADKA 3AKEA 4URYR 2CXXA 3DZ8A 3RS0A 3ZQJA 5C18A 2ZRGA 2O8CA 1PLJA 4BFUA 1GL7A 1U0LA 2Q3HA 3BOSA 3AQ4A 1MABA 4B6EA 1RJ9B 2QE7D 1QG4A 3J81k 2CVHA 3PR1A 3CR7A 3TQCA 3LAWA 4C0AC 1KMQA 1JEEA 2XB4A 2VQSA 3LO5A 2QL6A 1BKDR 1PJRA 5AWFC 4V03A 4JYBA 221PA 3E5HA 3HU1A 4QBIA 3ZJYA 5JCPA 4PQRA 5EE9A 1U0HC 2GJ9A 4D4JA 1W4BA 1C1YA 5KO2A 2KBEA 2JDIA 2XTZA 2CJWA 1CR4A 2BCJQ 4BLSA 2ZIAA 3W8NA 2C77A 1AA9A 1Z0FA 1LV7A 3I3SR 3ND9A 5FFMA 4PFSA 1KO7A 4PC2A 3KKQA 1WDTA 1XTIA 5JHHB 3KL4A 1Y63A 1EX7A 4DJTA 1E99A 1XTSA 3GEIA 3QNUA 4Q4AB 4A0RA 3K0CA 2ERYA 3R7WB 3AVXA 1FQJA 1PUJA 1WMSA 2GCOA 1UBEA 1LNZA 1KO5A 3EIHA 3TW8B 2AWOA 2R44A 1DO0A 1T3LA 4OBEA 1SVLA 5EP2A 1CF4A 4PR0A 1J70A 4LV6A 1KSGA 5JMTA 2GK6A 5KYKA 3WYFA 1Z3IX 1FFHA 2ZVQX 4OQLA 1UKYA 1KHTA 3BC1A 4MGIR 1R0ZA 4M9QA 1PVOA 3K09A 3ADDA 4NBSA 3ZVMA 3EA5A
chains in the Genus database with same CATH superfamily
3ZTTA 3HL0A 5JMWA 1RZRA 3H04A 2J31A 3I1JA 4BNKA 3RBAA 4DNQA 4PLVA 2IX9A 5FLYA 4G41A 4K0RA 4PPFA 2EJUA 2PUTA 2BZ1A 1V41E 1KIMA 2OV8A 3VPXA 2YYYA 3LHSA 3LY9A 1BMFA 4B3CA 2UUAB 4F3TA 4A8HA 1EESA 4PHFA 1DB3A 4W6QA 2X0FA 4PPGA 2JHCA 4XPZA 1HE4A 2CL6X 2HU8A 3BHJA 4YV1A 4LCJA 3WKDA 4RK5A 3SDZA 3SYTA 4C14A 4AIRA 1UR5A 3II6X 2UYHA 1F0NA 1CV2A 2ODEA 2WHXA 3STXA 4ILKA 3H13A 1U3VA 2XKJE 4X6YA 4Q4LA 4DMHA 3ONFA 3O8OB 4OHKA 4OHOA 1DOZA 1LQUA 2QM8A 1G1AA 2FRXA 2Q4OA 1V5WA 2ZYIA 1XXHA 5BXQC 2O8DB 1A2BA 2IZOA 3CZMA 1Z17A 1J0AA 3GXBA 3HTXA 3W4KA 1XQ1A 1ZH0A 2GYUA 3GCWA 3LW7A 3Q8WA 3AGQA 4K9KA 2P4UA 4NJMB 1ELOA 2XB6A 1NLFA 3E8MA 4ILEA 2FQWA 4KRXA 3UT5B 1T5LA 2ZTUA 1UBRS 4PCVA 1O95C 4LYAA 3U5ZB 1DV1A 3GC6A 3ZWDA 5JFTA 3LBAA 5F12A 1BD4A 2ZTHA 5CX1A 2C5HA 1FFSA 1SC1A 2WIBA 3FUUA 3CY6A 3QBVA 3IQFA 2JZOA 3W4JA 4YV7A 1W25A 3KD3A 2FJPA 1LD3A 2A9RA 1P0QA 4JUDX 5DTEA 5CB0A 3CVVA 3LZDA 2ROQA 3ADOA 3F3MA 5HXAA 1C0IA 2DY0A 2ZRMA 1X77A 1Z6PA 3ZE2B 4P3NA 4TQUS 1ZN9A 7GPBA 2J5XA 2FDRA 3T54A 2IYAA 1JRLA 1ZMTA 3WADA 5KSOA 1HNWB 3K6JA 4RPLA 5DSZA 1MJ5A 1NQUA 1CP3A 2ICAA 4G0NA 1C3VA 4FKZA 4QDZA 5EC8A 3V1MA 4DPLA 3W79A 1P72A 2AXQA 1BHQ1 3G2PA 3ETJA 3G2HA 4QHSA 1MTOA 3TSOA 4XW2A 2NO9A 5BWNA 3TZCA 5CEEA 4I50F 5DBEX 3ZOKA 3P9YA 3ZVNA 1HYHA 1YRWA 3GVXA 2VSYA 1SQ6A 3WLNA 3AFIA 1VMDA 4QUGA 1Q83A 4KQEA 4NZZA 3OD1A 2E3JA 3GRFA 4BNXA 1N5LA 3ONEA 2EIHA 1X7DA 2Z57A 4X8OA 3SR4A 4G0UA 3AZQA 5ALYA 2NUAB 2V8OA 1XEWX 3WTCA 2WHYA 5ES4B 2GUGA 5G4LA 4ALNA 3PQCA 5UKDA 2P0EA 4REOA 4O5OA 2P9EA 5BN4B 4E3ZA 1TJPB 4N3GA 1X1DA 2W58A 3QEKA 2MSLA 1CJKC 5HJEA 1NKTA 1CB0A 5H4HA 4TSKA 3DV9A 2DPXA 2YJ3A 3BFPA 3BH0A 3K0AA 4EP1A 4XTCS 1ZU5A 1C9KA 5IYZA 5K0FA 2FLVA 3B85A 3CF6R 3C8ZA 4TMTA 3SF8B 3DZBA 4YJFB 3VNBA 3IDFA 1N2IA 4XUEA 5JALA 3VR3D 3UK7A 1FUIA 3MWEB 2PMBA 1CQXA 1T9ZA 2WQ6A 4HGPA 5CM9C 1NX9A 1P45A 2LW7A 1MHTA 4KOAA 4XGQA 2BEUA 3FJYA 3HE3A 3ZV5A 3SC4A 2WJWA 2XUJA 3LBHA 5IPFA 3DJYA 4Q48A 3HJNA 1PK9A 3IPXA 1XU7A 3PIIA 3KB6A 3DBRB 4U2EA 2AIRA 1J42A 1VGVA 4HJRA 5CTAA 3ZWQA 4MIKA 4ZCTA 4K3VA 4CKBA 3LZCA 1IULA 2GPTA 3KB1A 5DNYB 2VTDA 2E4XA 2QMHA 4PCLA 3U81A 1KI7A 4ZAGA 1XXLA 3S7ZA 2V0GA 2IJGX 3WDLA 4C88A 1IY1A 1UFQA 1RADA 3F4BA 2DFVA 4GX5A 4IJQA 5AD1A 1HEUA 1GU1A 4YRKA 2N46A 3AMVA 4PZYA 4RPKA 2XOKD 3GQBA 4Y1EA 1X7XA 4LBZA 3QKTA 2AHRA 3CEMA 2EGHA 3QFFA 5F78A 3PR3A 3ASVA 1M3SA 4AUNA 3KBBA 3MS4A 2G77B 4UXIA 2ZVDA 4MB0A 1P1IA 4A23A 1XCOA 1X3SA 3C3XA 3BCSA 3IEIA 4CLXA 2LXNA 2A57A 2FMUA 2JGIA 2PO7A 3M2PA 4KMSA 5HJ7A 5C0OE 1WPGA 3BWEA 3R3SA 4L85A 4MS1B 3JQ7B 3P0JA 4TMZA 1GQ2A 1YZGA 1BYIA 2ZB7A 2UXDB 1GYPA 5CX4A 5EPEA 1U2RA 3PZBA 5MFZA 3EPHA 2IW1A 2PH1A 5BXYA 4QUBA 1P81A 2PPVA 1YRHA 4QX6A 4J75A 1YFZA 1BHO1 5C3UA 1CKEA 2AOWA 4OGKA 3V9AA 4GFDA 4F7WA 1VDMA 4M1MA 1SG6A 1E7YA 3ZHBA 1CX9B 4NQZA 2PX3A 4RSHA 2H48A 2ZRLA 3GNSA 1R4MA 3MTAA 5B7GA 3WWYA 3N5CA 4Q1EA 3FFXA 3NBXX 4L3OA 3JZFA 4BQRA 3I2KA 3O4HA 1CDEA 1FXSA 2JVJA 4BNUA 4PSUA 4GKAA 4X44A 2J1LA 3FCXA 1W85B 3KRTA 4YJKA 5LFAA 1Y3AA 3RYIA 1ZLXA 2GEKA 1EM8B 6Q21A 2MYUA 1XPRA 3F96A 5AKKA 4BO1A 4EPXA 3T9BA 4L2IB 4MUJA 1NQAO 2YZ2A 2Z04A 3DDCA 1KO4A 4BB0A 2V65A 3ZBPA 3R4VA 1JLMA 1PG2A 2AFVA 2YW9A 2C20A 3G68A 3HJBA 1GNQA 1MN6A 2AD1A 2EWWA 2ZBQA 4KVAA 4RIFA 1F2UA 2X1HA 3SKXA 4DB2A 3PEYA 3HVUA 1EXVA 2CNOA 1YQUA 1ISJA 2GBLC 3L46A 1C29B 1WDWB 2FEMA 2ADFA 3L7BA 3DLTA 3HA2A 5JY1A 3A11A 3ZWNA 4JJ4A 2WWTA 5IXSA 4TN1A 1G8JA 4MITA 3ZBTA 4Q1AA 1CS0B 2J3KA 4C3UA 1KYYA 3NBMA 1ZGCA 3JW8A 4IUDS 2F8TA 5TF4A 3BGDA 3WP0A 3QYAA 1ZXXA 4LMBA 3IVMA 4FIZA 5HMMA 4LS3A 3IDSA 2J59A 3BBLA 4CCAA 3GGSA 3E6AA 3HBFA 3U7QA 3ZY3A 4ZJYA 4DGSA 2YRFA 4L5IA 1WX1A 2MINA 2I1VB 3PT9A 4BE4A 5JMPA 4C1BA 1G7RA 4KN5A 3W6ZA 5F3WB 1N2GA 4OQQA 2XITA 4KNWA 2R47A 5THQA 3KPVA 1YQXA 2FQXA 2OBBA 2NVUA 3FVTA 4MV4A 3T15A 3GLGE 1KDOA 1JTFA 1P62B 3CZPA 1OXXK 1ZC4A 1Z75A 3UF0A 3UUGA 1G9SA 3H3JA 3ZBQA 3OE5A 5DHQA 4CDMA 4MUFA 5JPIA 3W6UA 4HAYA 4NCBA 1XZCA 2QTGA 1F8FA 2Q2OA 3O5AA 4G81A 4UUAA 1FYVA 1DEKA 4XIGS 2EXXA 3G8CA 3LLSA 4FYYA 4XWGA 5HK8A 3R5HA 3COJA 1M9NA 1Q0SA 2IYZA 3PU6A 1LBSA 3MELA 3K9NA 2WV9A 4BO6A 1GL9B 1W0KD 3CPSA 2AEJA 1W88A 2XPCA 3V1YA 2XMZA 4DMUB 1YF3A 5JS1A 2ZUDA 4QO8A 4RTKA 1K86A 2JA2A 2ZYWX 1MO6A 1E63A 5T67A 3HWSA 1F4VA 3HBAA 4IFIA 5C8YB 5AKEA 1Q16A 5A05A 1VMKA 4KRFA 1DJNA 2FE1A 2GZMA 1WKVA 1D0SA 4PGMA 2LCIA 1DCKA 3VPFA 3KJZA 2FMKA 1VA4A 4MQFA 4GPAA 2C1ZA 2P75A 4Q9JA 3PC8C 1QG6A 2G1AA 1GARA 1VLVA 4M76B 4UMFA 4US2R 4MS3B 1H65A 4M86A 2O07A 3Q87B 4BMCA 2RHHA 2BGIA 4IZHA 1TUBA 1OT3A 1VRVA 3TD9A 1NVBA 1E0KA 3IUJA 1YDFA 1YCFA 2I54A 5DHAA 1MOSA 1QYRA 5I7UA 1DIRA 1Q6YA 2LV8A 2Q9UA 2YHSA 3ADPA 4U7TB 3KEQA 4RMJA 1L5OA 4HL6A 3AUKA 4OHBA 4U0KA 5FJJA 2SKCA 3OT1A 5CVUA 3CXRA 2XBLA 1EAMA 1GFWA 3Q3JB 1YZTA 4H35A 4ENRA 1BU8A 1TKBA 2P2LA 1AZSC 2ES4A 3JVIA 3SZRA 3TX6A 1EX1A 3GARA 1LY1A 3GDWA 2VQEB 2VS1A 3LF1A 3PWSA 4WPGA 3PNQA 1FX0B 1E4EA 1RHQA 2VQ3A 5LNK1 3EE6A 3UTDA 4N18A 3JQ8B 1VFPA 4QDOA 4JGGA 1QSGA 4F9FA 1MC1A 5KHLB 1Y7IA 1CG6A 1R8SA 2Y66A 3PNYA 3S2IA 5B55A 3ZZMA 1SZCA 4WNAB 3OIGA 5D5QA 5CDUA 1C8BA 3B89A 5KHAA 1ES9A 5JH7A 5HWSA 5AVYA 3AEUB 2Z9DA 2VQDA 3N8DA 3W9UA 4AQ7A 1EIWA 4X85A 1TI7A 1QDUA 4LY0A 4MA4A 3OFNA 3PHIA 1X80A 4JJKA 1BE1A 4KH0A 4BNJA 3WP1B 3NKLA 2TRSB 5FLEX 2JLSA 2YZGA 5TEWA 4RY0A 4JYMA 1MEJA 1NWHA 2GBFA 2HMWA 3WLEA 2YC2C 2H85A 3OECA 3OT5A 1NR1A 2GAFA 3E3MA 2CZGA 4Z49A 4QZVA 1ADFA 2GHIA 5BYJA 2O5CA 3PCRB 5DNAA 4B71A 3W5UA 3QPUA 3UV7A 2K6GA 1FFDA 4DLVA 4KO8A 4X90A 3O1HB 4PY2A 5EIEA 4UZEA 2OGSA 2VQFB 4GMKA 1DEOA 3MMPA 1SVWA 3F5SA 5ALNA 5JD6A 2OZEA 2W71A 1JG2A 3RJ5A 4DR7B 1G59A 4ZOBA 3QFCA 4JB8A 4IDBA 4LBWA 4UUBA 2FPMA 5HRAA 1FX1A 2ODQA 2P9YA 5EXTA 2O7RA 1E69A 3C0KA 2YICA 3M70A 3IUEA 4XM1A 3UOAB 4B7CA 4FOTA 4R2MA 1Q7RA 4H16A 1JI3A 1PSWA 5BNIA 1Y1TA 1N92A 4G84A 1QZTA 2E49A 3UVEA 3CJRA 1QFMA 2WVAA 1W52X 3KDPA 1XZLA 3JQCA 3PQ3A 4IRXA 1ZH8A 2V45A 4B2IA 2IXDA 4RZIA 1HV8A 3DE3X 1Y6FA 1JH8A 1QE3A 1K6EA 1O97C 1T8SA 1WIWA 4QQKA 4CR6A 4JLVA 1FDIA 3KXPA 5DIFA 1YA6A 2DHDA 1GDHA 1NFRA 3GJXC 3B60A 1X7YA 3LYAA 1ISGA 1P6XA 4WFQA 4YVFA 3HXKA 5DX0A 1LX6A 4R71A 3ECSA 4QM6A 2CNDA 3I0ZA 3MEQA 3N8NA 4DJDC 1M2OA 2DULA 2Z5GA 1XFDA 3H42B 4FEGA 1L7NA 2ZM5A 4ZRNA 3LJKA 1RWKA 2RC5A 3AJAA 2QZJA 3K15A 4ZYWA 2A9PA 1ZI9A 4S1PA 5GVRA 1JDBB 3DE0X 3U62A 3HCFA 2PYDA 4DCPA 1SKUA 5K51A 2QQEA 1B73A 3RFXA 5LZ9A 2BLLA 5K01A 4M0KA 2D0PB 4JJ6A 4QIHA 3P0FA 3N0TA 3C3EA 1F8GA 4HDSA 4G07A 3K0HA 3H5OA 3Q1LA 4P81A 3RARA 4BNVA 1MB9A 2FWJA 3SC6A 1GGVA 2QAGB 3P9NA 1Z2NX 5DBIA 2PSJA 5CT8A 1RMQA 2PS1A 3EZ2A 3BF8A 2OGUA 4Q7MB 2RMKA 2VRWA 4RCZA 1P5ZB 3ZG6A 3GZNB 4PQEA 3W2EA 1GZ6A 5D3MA 2V4MA 3ONDA 3EULA 3TPFA 4PQGA 1SBNE 1Z0AA 4A16A 3DEJA 4C0LA 1XLTC 3CLUD 2WF7A 3ZY5A 4HLQB 3M0EA 4M7OA 3EWAA 5HF8A 1THZA 3NC1C 1U2TA 1WULS 1LEHA 2WAXA 3G88A 4DCJA 2Z1DA 1LUAA 2G1UA 3FBGA 1T8UA 1QAQA 1QO0A 2QTZA 4JB3A 1ZU4A 1FB5A 2PGLA 3QLVA 4MI9A 4B44A 1AMUA 1SOAA 1X9GA 1XRPA 2PZFA 4N5MA 3TFQA 3NDJA 5KWVA 5C7LO 3Q8KA 2CL0X 1FZTA 3WICA 2D13A 1KZHA 4DIOA 4Q1FA 2QLBA 1JFFB 4FXOA 1V26A 2OM6A 3ACDA 3DT9A 3P9KA 2AK3A 4NFYA 3F6EX 2QP4A 5FULA 4QUKA 3DEHA 3NTUA 4ALKA 4UEJA 3FSEA 2N3ZA 3CJTA 2B4QA 1PJBA 1H9CA 3RFTA 3PQDA 1YCGA 3INTA 1DQPA 2XUIA 6NULA 1XCLA 5LP6A 1BVHA 3A0RB 5EAIA 1NONA 4EGSA 1FRNA 2C3OA 1WCYA 1Z2AA 2II6A 4F92B 1G60A 3IAS6 4R9UC 2IWHA 1W9MA 3C14C 1M6VB 3U4QB 1OLUB 3ONNA 5HM6A 2NT3A 2AVDA 4NFHA 4NYIR 3IUQA 4FLEA 3GW8A 5CLQA 2EQBA 3PX3A 1ZMRA 1I1HA 1BMQA 1SXJB 3AVPA 5I8ZA 4DLWA 1MO5A 3A6GA 3ZV7A 5BY2A 1YCHA 3QX9A 5KJ6A 1KGSA 2J0SA 3RJMA 3L7LA 4MKIA 4RF3A 4P98A 1JN0A 3IOBA 4F9TA 3RGWS 1HLGA 1YVDA 3GRZA 3E58A 2FWBA 3ZHOA 1ZK4A 2JBAB 3DHWC 5JSQA 2OCGA 2DWPA 1UAAA 2GB4A 1EJBA 1O6BA 3CCFA 3AEXA 5KB3A 4MPDA 1I5RA 5SZHB 4UAVA 1DOAA 3D4IA 1W48A 4KPEC 4OFWA 3C4VA 4TUYA 2P8JA 3NH9A 3QSYA 4BQSA 3ZCUA 1GQRA 2VUUA 2FFJA 2WMYA 3H2YA 3WRYA 4Q21A 4QKQA 3CRQA 3DLPX 5D5HA 2V55B 5A06A 2VZLA 2HJWA 4DABA 1YUNA 1EE2A 2YASA 4TLAA 5LZ8A 1YI8A 1AK9A 3Q6IA 1RXYA 1MPTA 4TT3D 4A26A 3CW2A 2V6FA 5IFKA 5CFQA 2FJUA 3K4HA 2XDYA 3FCAA 1T1IA 2ZE7A 4ZT2A 3B2NA 4BTLA 4CVNA 3C3MA 4U6NA 1UOEA 4YRFA 4LYFA 2PS0A 2GFIA 3R7AA 3MM4A 4MWGA 4E03A 5I7HA 3SICE 2FEWB 4GXQA 4HYTA 1NJ2A 4DV0B 1I5OA 3RC2A 3LDAA 1E3SA 2QKYA 3BL8A 4K2AA 1GNRA 1TRHA 1UP7A 4YLEA 4L95C 3VU9B 3ZCQA 5JAMA 4CEHA 1U5CA 1YOVA 2AKEA 4D7AA 3JWJA 1NTOA 2GESA 1EUCA 2QLLA 1M8FA 3CNNA 4QRIA 1VHTA 1PDVA 2GKOA 2WJVA 1NLUA 1YIDA 3KZ1E 1KEEB 1X7ZB 3I1YA 3WL8A 3P4YA 4DFDA 3UJNA 4NU0A 4OUDB 1JDSA 1JPUA 3DAOA 1Q7GA 4PZDA 5DXAA 4R41A 4BCDA 3EDRA 1Q5PA 2XD9A 3WXMA 3E5NA 1R10A 3IJPA 3PS9A 1MPXA 2XECA 3F9IA 5EMLA 3CKYA 4NCNA 4AT1A 2O1SA 3F49S 4OK5A 3QVSA 3WYBA 2YV3A 3OQNA 1EGVB 4BNIA 3IE0A 2JJ1A 1U9CA 1VBNA 3B8EA 1ZUD1 1RBMA 1XF9A 2QORA 1G7SA 5CPFA 5E7MA 3WS7A 3ZW7A 2P9QA 4J94A 3I5XA 1NW9B 5EMHA 3TR0A 3VR6H 1GGEA 4TKZA 2VJPA 5EEGA 4J2HA 5CG2A 1N34B 1L7EA 4QXOA 5F77A 1A2OA 1W581 2CUZA 3FWHA 1IM2A 4MEAA 3WBFA 2IYVA 3UT0A 3EVTA 3A3NA 2C2GA 4US0R 2OTCA 3IKMB 2ZUUA 1XVAA 1GPH1 2HRZA 3JQGA 4CRWB 5H8WA 4YCDA 5HCIA 5AVQA 1VG8A 3RYHA 1FSFA 4CIVA 1Z0UA 3E61A 2O8EA 1LI5A 2FSSA 2Z8ZA 2BFAA 3MT0A 3E9RA 3RUPA 3VU1A 4IMPA 2AKYA 3N05A 3IBSA 2RJNA 2R9VA 4JLDA 3HQ4O 4NDAA 2OAGA 2X40A 4WVFA 5T6BA 4G0WA 3HMKA 2XWSA 1LB1B 5EWJA 1K0FA 1ZIPA 2BJHA 4JXKA 1DJLA 4FDUA 3WGUA 3CURA 2JIBA 3JSAA 4TXMA 1L7QA 1Y82A 2Z6UA 3BB1A 2R6GA 4XVQA 1G6HA 4QEKA 5K99A 4US1R 3NVAA 3VC1A 1N3LA 4YROA 4J1TA 2LWIA 1CR6A 3O38A 4KK4A 3IP8A 2FCRA 3QM1A 4WUVA 2I87A 1CQPA 5DISB 4BAZA 2W2PA 4KO4S 1V5EA 2RH5A 2FF7A 3QWBA 3U4DA 1DCFA 5C35A 1EXDA 4DLAA 3A4IA 2NZVG 2V0CA 2JIQA 3CTMA 1KWGA 2FR1A 2RHTA 3D43A 5E9QA 3WC4A 1WQ1R 3A10A 3FWZA 4X0EA 3T99A 4B3FX 4P7GA 2JRLA 5THKA 3KPJA 4RFVA 3MCZA 1PNOA 2CJWB 4I66A 3DAFA 5K4AA 2BFWA 4POAA 1XTJA 1FMCA 1OTYA 1GCGA 1VKJA 2GK7A 1NW8A 1GNLA 4ARSA 2C2ZA 3OH8A 1QHYA 3KAQA 3LPCA 4G0MA 2HIAA 1AN9A 3UJPA 2F64A 1OOEA 4Q3KA 2QDKA 1HH4A 3INGA 5ICFA 1CERA 2OQIA 3DLHA 1GRNA 3BD8A 4GI1A 1H5UA 4H6WA 1P3DA 2I65A 2YN0A 3WNCA 1HTBA 2R3SA 3PL1A 1G2PA 1PJTA 2POQX 2EZ8A 3FZNA 3OLZA 2CMGA 4I14A 5HW0A 3HCCA 1AJEA 3PJFA 3BIWA 4JXJA 4G56A 4Z8YA 5K0GA 1T0UA 3HWWA 4NSNA 1PX0A 1CUWA 1H3NA 3U48A 1WB4A 1SD5A 3QFTA 3QF4A 2Q0XA 1G64A 4YRDA 4YO7A 5EJ8A 1FW6A 3NOVA 3X1JA 5DWDA 1MF7A 3OZXA 2QTCA 2DUNA 5ANRB 4NLLA 4HXGA 4CQJA 4HQKA 4ZCIA 3D0QA 4E14A 4KV9A 4BQOA 1TU0A 2REBA 4BZWA 1ISRA 4NATA 1UKAA 2WP0A 5ALSA 3L5OA 4G23A 4FGJA 4LOKA 5H7XA 4BBZA 4BX2A 5KVVA 5CDFE 1J0XO 1HURA 3FNFA 3GAZA 4EHDA 2HKIA 4JEUA 5KVSA 1M6EX 1WRBA 4HAVA 2YXEA 4PX3A 1NBEA 5EJ9A 3KB8A 4C29A 2YNMA 3GEHA 3PUHA 3DONA 2VDRB 4HR7A 1OJLA 1ATIA 2FN9A 3N2KA 3GWZA 4MAAA 4GD3Q 4B84A 3M4XA 1PFQA 2Q21A 1SCJA 2GJ4A 3CLTD 3LYHA 1KVSA 1UK7A 3MG9A 1FDOA 4KWHA 1NF3A 2ZSAA 5EP4A 3HXTA 3MC1A 5EKXA 1BJTA 5FBHA 1WNTA 1XVTA 5IJ0A 4FI3C 4EB6B 3DL7A 1KKMA 3GROA 4HNGA 3DGFC 3V46A 3VTZA 3EEYA 2VT7A 4LSZA 4NICA 5GAJA 1AV6A 1A5SB 3EZFA 2GCIA 4BB5A 4BLRA 4XIYA 5E3HA 4D3XA 3EGXA 5A4DA 3DR3A 3VZBA 2VPXA 1Y1KE 3ETEA 3HFJA 4OH7A 1TFRA 4LSGA 5AK3A 4B2LA 1YE8A 3BJRA 3BA1A 3KETA 3ZWKA 1O89A 4KHPB 1I0LA 3R3HA 1G3QA 4PC7A 5JLJA 1KH1A 1WD5A 3PHJA 2GM3A 1GNVA 3IV6A 2DUJA 2V03A 3QUAA 4QUEA 4ZEOA 5IN4A 3K70B 3ORSA 1IM8A 4LWPA 4KO3S 5KOHA 1Q0ZA 1HGXA 3O4RA 1VSUA 1FXWF 2F1RA 3F5FA 2VN8A 5AKIA 1ZCAA 1UT6A 2XDWA 3D8BA 5CP8A 5L3ZA 1R6TA 1TZ2A 1UPCA 1YB7A 3DAYA 1JKXA 2QROA 2B92A 3IVCA 4LRQA 5EJFA 3USZA 1NJ1A 2RE8A 2H3HA 4NS4A 5C8XA 4KACA 3ZHYA 3VNSA 4CJXA 5A9SB 3Q98A 1TVKA 2HPAA 3WL6A 3KV1A 5J5VA 3W7AA 3T9AA 3AHEA 4M1YA 4J4TA 4XLZA 1KZ9A 2VP9A 3FD8A 3GLHE 3X1WA 2VF7A 3AB8A 2JAUA 5EGNA 3PC7A 2DOKA 4GPIB 2WUFA 4G1MB 1BFUA 4KFUA 3W5CA 2L82A 4ZVKA 1Z5NA 3GRCA 4NS1A 3GV0A 1RE0A 3R5XA 4Q15A 4RFSA 3THRA 1FVXA 1O96B 2FMFA 2C61A 3TLZA 4WOBA 1JJAA 2CVZA 1C30A 5EE0A 1DSSG 4CQMD 2G08A 4TLDA 4R8LA 3IBCA 1HFWA 1U5AA 5E0OA 5EYPA 4ZCLA 2CD7A 3UG6A 5IKPA 1E3QA 4RORA 5LBTA 3KNZA 3V5NA 3PFFA 3LK7A 4I2NA 5HK9A 1QB7A 2JLWA 4RDIA 3I6IA 4EVIA 4GC9A 5KNBD 3F47A 1C8LA 2NO4A 5C51B 1TQ8A 2IOQA 4HZGA 3V7YA 3TM5A 3FPSA 4N0EA 2OAQ1 4Q47A 5EXEA 4D92A 1C1HA 2FKNA 3GJYA 3O91A 4EI2A 4F2PA 3HN6A 5AK0A 1B43A 4ZEWA 4UNRA 1NYRA 4BX3A 7REQB 2VP0A 3NB0A 4JX8A 2JAPA 2MU1A 4LOJA 4W5RA 3V4SA 1IXKA 1NI4B 4KNVA 3V7WA 4E2ZA 5LDHA 1Q1GA 4JELA 1VL2A 2HWKA 3DLCA 5CFZA 3K5WA 1LK5A 1O2DA 2JFWA 4ZT3A 1R27A 3HU2A 2ILTA 1AK1A 1ID8A 1G20A 2CWDA 3QVGA 5HUJA 4HTFA 4HLUA 2BGLA 2J3IA 1V48A 4OM7A 1OMOA 4HEJA 4HNRA 1TM4E 4XQCA 3LHIA 5LQJA 3WIDA 3MJRA 4FKBA 5I7OA 4B4UA 4G25A 4GE0A 4JASB 4AG5A 2DETA 1V35A 2OHXA 1GUZA 2AR0A 2WNHA 4TL6A 4IYJA 3TO5A 4LHXA 3HFRA 4NAUA 4DRXA 4Q4JA 2OHOA 4PYJA 5K8LA 4FYWA 2MYTA 1EZ1A 5K3CA 5AJZA 4QNMA 5HZHA 1KEPA 5J4YA 3QBEA 3W6OA 4R7GA 2P6NA 5H9WA 2NUPB 1JIUA 1YS7A 2ADMA 2PKEA 3DTNA 1PGQA 2JH3A 2PZKA 3RVSA 2IZ5A 4MPPA 4PZ0A 2A3RA 4UQLA 2BF7A 3L0ZA 2C5EA 2UYOA 3KJNA 4MX8A 1E8DA 3QBTA 3U7HB 4PX2A 3QY0A 4BNLA 4DWVA 4W9RA 5GTDA 4FQ5A 3C3PA 1EDOA 1MAWA 2XLBA 4ZOEA 2XKAA 3OOWA 4FYVA 3U5TA 2VP5A 4PZLA 2LIVA 2OM2A 1JLHA 1QGUA 4FE4A 3ORFA 1LJLA 1Z4JA 2W83A 4I99A 1KSHA 4BAGA 1QH0A 1ISFA 1GKYA 1Q21A 4ZGWA 4ER6A 1E2NA 3H8VA 4X1YA 1ZA1A 4OFXA 2CJXA 1MIOA 4BVJA 4D6XA 1DDOA 4YTEA 3A7DA 1R1DA 3NPAA 3R9XA 5J5CA 3G89A 1JPVA 1OXVA 5FNZA 2F1HA 2PJDA 1K97A 2PFGA 4LN1A 2YJ4A 2R85A 4KQKA 1JYSA 1P2SA 2IDMA 1C1XB 1IN8A 1EFRA 1I3KA 2OO5A 5A3SA 1RT9A 4N5HX 5A3JA 5BWMA 1A8HA 2HSDA 3IAS1 1TC1A 2PS3A 1S7GA 2GO7A 5BSGA 1NQVA 1K0UA 3PX2A 3UGTA 2NO5A 3EWSA 4EB8A 2W6JD 4C7OB 2P6OA 2VHUA 2CBGA 4JA0A 3L04A 5GWXA 4UTNA 2IWRA 3JVUA 4J0QA 3I62A 2Z58A 3NTVA 2EWVA 3PUJA 3CSSA 1ENYA 4F2HA 2EWMA 2RHBA 3T41A 2R8YA 2Z6QA 4RHEA 4ND3A 3E0XA 3H9JA 1ORHA 3KLOA 4OQ4A 4MWDA 4XR9A 4Y1RA 3DOEA 4EGCB 1JR3A 5GJCA 1CVRA 1V8BA 5JNUA 3FCCA 1AM4D 4TWZA 1XP5A 5CRIA 1NSYA 3TTXA 4EZIA 3PT5A 3HR8A 1P1KA 4DCNA 4ZXPA 1YR6A 4WXPA 1LPSA 1NUAA 3C5HA 1V7PC 4PFKA 3HMQA 1WETA 1VKZA 2C8KA 2C94A 2K2QB 3NV9A 3H6GA 1Q0RA 5A4MS 4QQ8A 3DEIA 2FSVA 2GPBA 3C4JA 3V1LA 5LMNB 3GAAA 1DG1G 5HKKD 2WWIA 4ND6A 2G9RA 2ECOA 4K8OA 4MV7A 5JXWA 1N6LA 1DRWA 3OP1A 1ZCJA 1DKLA 1R15A 4YYEA 4DLZA 2HK6A 3E9DA 1YH3A 2HQOA 5ALLA 5IDVA 1JS1X 3KM0A 4GS5A 1QVRA 4RETA 3MJFA 3MT9A 3P9SA 2CK3A 4Q05A 4WKGA 1BXKA 3DJFA 3MBKA 5A7GA 1QO9A 5M3BA 1VRWA 1Y1SA 3I9LA 2A7QA 2VHJA 1SUCA 3D4OA 3OJ0A 3F6RA 3ZYZA 1KRHA 1NAIA 1P9NA 2CLDX 1RPJA 2HSEA 4G6ZA 4ZODA 1Y5RA 3PD0A 4WDRA 3LGAA 1FUUA 4GWLA 3NEPX 5JJLA 2B78A 4MYUA 5EZ6B 2ID9A 4FZRA 1PGNA 2QZ9A 2J67A 1YQEA 4ZTUB 3LUCA 2NU6B 4QNRA 4UUPA 3LLVA 3SIRA 3H18A 3L1JA 3DLBA 1V4NA 3QU5A 3WB2A 1E2BA 1CW2B 3F8SA 4FWTA 4JR2A 1Y5LA 1V4VA 3OLWA 1K68A 3DAPA 1KO1A 3T1HB 1OH5A 1TMGE 1VSBA 2AOUB 2QRKA 3OA0A 1G8AA 4IUCS 1CJCA 1UDXA 5AW2A 3O4JA 1FQKA 1CEXA 2B4TO 4G0YA 4D8WA 2MMGA 1IFXA 2GVZC 3IMEA 2ZJOA 2AZ4A 2YXBA 4BMXA 4EG5A 4GICA 4MAMA 5C80A 3OIWA 2JJ2A 3E9MA 1ZM9A 5KJEA 5HJ5A 3SHTA 5KYXA 3EPJA 2G80A 4HAOA 5F1OA 1HBJA 2QX6A 5LMUB 4EKGA 1XPUA 4MICA 5JJCA 3F90A 4G85A 3NP9A 3CKKA 5DNVA 3UJ7A 5ER6A 3UPDA 2O8FA 1E96A 1Y6RA 3I0MA 4HN2A 4JT8A 4Y3UA 3DOOA 2P6MA 1ZOOA 5DTRA 2ZSKA 3QTTA 3VPDA 4R1PA 1JGTA 2G5CA 2NO7A 4BNDB 1A71A 1E4VA 1KOJA 3N2IA 3KXKA 1HFEL 6REQA 5T3UA 4BLVA 1GTZA 2W98A 5FUWA 1DARA 2JI7A 4CQLB 4DLXA 2BSQA 3BEOA 5F1YA 2BFDB 3AEKA 4O4JB 3C48A 3ENVA 5L9AA 2CHUA 4IR7A 3EXEA 1I7SB 4DWWA 2F43B 2GLXA 2H18A 2VZEA 4HCJA 4G0OA 4IQ0A 5DBFA 3WK4A 1JFTA 4RTLA 3N39C 1OKKA 2PVCA 3T35A 4A92A 4CU2A 5H68A 3OO1A 2FEKA 1ZPDA 1Z83A 3P0IA 4HX9A 1T0IA 2EKLA 2HHAA 2J3DA 4MUKA 1LPPA 2ZBEA 3U9TA 4ZFNA 4PFQA 1J09A 4EK9A 4F91B 2XNKA 1LS6A 2JIRA 3CVJA 2XMSA 2EGUA 1SB9A 3URMA 1SG9A 1XF1A 2F8MA 2ZRPA 1RC1A 4MPJA 3UHFA 3L06A 1HEIA 4LPSA 2YKGA 2HF9A 2V0NA 4CM1A 1YS6A 1N2EA 4YJGB 3MRXA 3THOA 1JR6A 2FZVA 2EYQA 3S5JA 1XEFA 3WLIA 1XA4A 2BBTA 1MO3A 2RIPA 2QVCA 1E6CA 2YZNA 2Z43A 3OCCA 1IMOA 1T9GS 2QXUA 3FR7A 3WRWA 4ZN6A 4ENSA 3MMNA 3RFUA 2CWWA 3K71B 3MK31 3EFEA 2QMQA 3CEJA 1LV8A 1T36A 4IZOA 3KAKA 2GEFA 3F6BX 4KDFA 1ZCBA 3UUFA 4Q03A 4FONA 1ISMA 4LE1A 4R7TA 1NBHA 1T2VA 1VL6A 2CUKA 2ZOSA 3GZTB 4P1ZA 5FT9A 1F48A 1Z34A 2PSDA 5JJKA 2VPZA 3IUMA 1V3TA 2P3LA 2XSZA 1U2GA 3M4NA 1IY9A 1IM5A 3A3OA 1EXMA 3DVRX 3TKLA 1OA0A 5BRJA 2BCGY 5DTQA 5LMCA 5EQJB 1O0SA 1NYTA 3D5EA 2VXYA 4JKYA 1N7JA 4ZO6A 5DI9A 5KVQA 2IEGA 4F3CA 1DCMA 3P9PA 3QLUC 2H1IA 5LDDC 2XWQA 2HCTA 2QVZX 4EJ6A 2CLHB 5I8WA 1J9GA 2CL5A 1JXOA 5ECYA 2X8WA 3QE0A 1H1LA 1RW4A 3N0VA 4ZVVA 1JHAA 2R1UA 5T5QA 1A69A 4IKPA 4MHSA 2CUNA 4ICIA 1NX6A 1ZGZA 2GD1O 2Z9BA 4DDHA 1OH8A 4H3SA 3QJ5A 1G3UA 1KS9A 5AQ1A 1U1IA 1KXJA 2B0JA 3IPRA 2ZYDA 1I24A 3NONA 3QKWA 4A27A 2NTYC 3LCMA 3OEEA 1B0AA 4ZQGA 3A6DA 2OO7A 2HTEA 3SJAA 1N6HA 1X9IA 4GPD1 5DE3A 1P44A 3NIFB 2O3RA 2R7NA 2F17A 4WLVA 3K1ZA 1Z16A 3LZ6A 5LBUA 3IHWA 3UMVA 1AKTA 4E0BA 1IAQA 3W2HA 2H59A 5AM4A 1Z9BA 1KAQA 2H1WA 5CT9A 4AO7A 4KQIA 5CU7A 5HJ2A 1RS0A 3MT7A 4NPCA 4U7FA 1T9BA 3MLBA 4B6GA 1EX9A 3G17A 3P0HA 3HXLA 1VBFA 3OTOB 4FD2A 3T4XA 1R7RA 1XTBA 1SKQA 1EVQA 5EHNA 3R5FA 1MHPA 3I9KA 4P4SB 2GPNA 3MRVA 2Z56A 3H75A 3TLKA 3UHAA 1TX4B 4BMVA 2PZBA 1JDBC 4G01B 5KU1A 1NP6A 1VLJA 1W4RA 2H9AA 2OXFA 5A3QA 5KYNA 1Y7TA 4HEA1 2OD2A 4AF8A 1WXEA 4XEUA 5C81A 1U0NA 1WVMA 4EKNB 1ZRNA 3U3RA 1U9YA 3CH6A 4PS1A 3AEQB 1H6BA 3H5VA 4IQ8A 4A6PA 1IJKA 3AVWA 1OHHA 3R20A 1WXWA 2BDEA 4I55A 1EG2A 5A0FA 4OIFA 4QBHA 1J0EA 4WAUA 4IGFA 4N12A 4ZA2A 3SJCA 5C7OO 1QHEA 3NBYC 3AHDA 3CUKA 5KS2A 3DVLA 4RTMA 1HE5A 4K6HA 4RNDB 1IUPA 2QUKA 5CBKA 3IAHA 3I0NA 2C0CA 1OB2A 2PJRA 4RANA 4U9IS 3BICA 1Z4KA 3R0VA 2X9VA 4YJ2A 3RADC 2FETA 2QR2A 2REQA 3K9FC 1FQWA 1YKSA 1CULC 1G0NA 1OA1A 1XL0A 1SKAA 2P9HA 3DTTA 4GX0A 3LS2A 1T2UA 4GQIA 1Y1QA 1YDHA 3VR5D 2VDWB 1YNSA 5SY9A 1Q15A 2IOFK 1NE7A 4GVPA 3RSZA 2FDXA 1JLKA 4W1SA 3OZRA 4LDRA 4J2OA 4D26A 2QD1A 4PNHA 3EF3A 4G4GA 4P58A 2NU8B 1PR0A 4NPAA 4M0FA 4HUTA 3TKAA 4RACA 3HKEA 3FUWA 1NJ8A 1UJCA 5EJ6A 5DOZA 2OZKA 3CVWA 2I7CA 3MMZA 4M6WA 2PWPA 1TCCA 4MWBA 4PAOA 3UK2A 3E3AA 4TMYA 4YI3A 1I4DD