4E11A

Crystal structure of kynurenine formamidase from drosophila melanogaster
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
300
Chain Sequence
HMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHSAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
molecule keywords kynurenine formamidase
total genus 116
structure length 300
sequence length 300
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e11A00
3WIBA 1GKLA 2C7BA 3QZUA 1PJAA 3I2HA 4X95A 3HC7A 1ISPA 1JJFA 4BTVA 1Z68A 3R3YA 1U8EA 2QZPA 3ZLVA 3HZOA 4DSAA 4BC0A 2XUKA 4X6UA 1J2EA 1W1IA 3DJYA 3JYHA 3W04A 1C4XA 1LPBB 4LXGA 4NZZA 5AK4A 2PU5A 3WK5A 4B81A 4UBIA 4AZ3A 5AM5A 4UHHA 3EBLA 2QRUA 2WFMA 5JZBA 3W9BA 4Y7DA 5ALNA 1WOMA 2H7CA 3L1IA 5AKHA 2PBLA 1UWCA 4J0IA 5FDFA 2JEZA 4JNCA 3V1LA 1AC5A 1GQRA 2G5PA 3STXA 5YASA 2ZJ7A 4X71A 3LLCA 5HCUA 5AI6A 4FNMA 4BAGA 4PF1A 1L7QA 2XUQA 3AZPA 1P0PA 1UT6A 1GKKA 1BN6A 3D2AA 1Q0RA 3NUZA 4AMZA 3VJMA 3VJKA 2PSDA 4YK7A 5JAHA 4IQ4A 1C7JA 3PE6A 1HDEA 2WG2A 5AHXA 1IUPA 1QIMA 4KE7A 5D7BA 3WKCA 1SCQA 3BL8A 3STUA 4X97A 5LKAA 3H2HA 4KE9A 5E2IA 5FOQA 1LPPA 4X6XA 3PF9A 1H2WA 4BVJA 1WB4A 1B41A 4G4IA 1CQZA 4J7AA 1R50A 1R88A 2C0PA 4BCCA 5ALLA 5DLPA 4UBOA 3STWA 1ACJA 2JGJA 3STTA 1MU0A 3GZJA 3NGMA 2VF2A 2C58A 1ODSA 3H04A 2ZSIA 4J0CA 5CTAA 5AI5A 4G4GA 2V96A 5ALRA 1LPMA 1FFCA 1QO7A 2WIDA 3O4HA 5AM1A 2HIHA 3C43A 5A7FA 4B9EA 1MTZA 2QKYA 1BRTA 4AO6A 4AO8A 3WK7A 4FLFA 2Y6VA 1AMNA 5K5EA 5DNWA 3WK8A 3QITA 1KEZA 3WWPA 4DNOA 4DLNA 5AKLA 1CUJA 1IMJA 1HLGA 1MPXA 3M3DA 1W6RA 3FYUB 1NX9A 1CUDA 2GBIA 3G9TA 4WY8A 4BDTA 3HRHA 1MO2A 5AOAA 5BWCA 2CUTA 3HJUA 3QM1A 4HXGA 1ZD4A 3F96A 3RLIA 4CG1A 3T52A 3OOSA 4GI1A 1QFMA 2QVBA 1GGVA 2GBGA 4KRXA 4DTCA 1ETHA 4LXHA 1EA5A 2HM7A 1A8UA 4FBMA 2Z8ZA 4BCBA 1NU8A 3DD5A 3W05A 4XJVA 4IH1A 5I7UA 2BGNA 2AJBA 2OGSA 3FYUC 4M0FA 2WHPA 2I78A 3ANTA 3UMJA 4X91A 2FJPA 3BE8A 3F97A 1XLVA 1CUZA 5BWBA 3FVTA 4RGYA 2Y1KA 2ZYSA 5JANA 3DL7A 3N0TA 4H7HA 4E11A 4G8CA 3WI7A 1JJIA 4HVTA 2OG1A 5AKXA 1K5PA 3QMWA 3VJLA 4ARBA 4C89A 1XZMA 2R8BA 4H7FA 4TPKA 3X3HA 1Y7HA 4MEAA 1YB7A 2HA0A 1YCDA 4ZGBA 3D4LA 2PX6A 4Y2SA 3EQ9A 2VAVA 4W1SA 1HQDA 4KAJA 4Q82A 5FPPA 3D5EA 2BUBA 4LXIA 5AKYA 3IIIA 5CW2A 2VEOA 4JUIA 5ALZA 2WFLA 1YS1X 2PVSA 3G0CA 3GA7A 3VKFA 3E0XA 4UHBA 4DSZA 5JAOA 1VZ2A 4OYLA 1WB6A 2B4KA 4O08A 5CH3A 1VLQA 3JWEA 5IVKA 1CUAA 5JATA 1EK2A 2EEPA 2HRRA 1QOZA 1XZEA 1JT2A 5AOCA 1CUGA 3C8HA 3A6ZA 2J3DA 3AILA 3AJAA 1GPKA 2WJ6A 4P9NA 3FBWA 1F6WA 1GT6A 2WQZA 5K3FB 4OYYA 3EIOA 5LYYA 3G8YA 1WHTA 2UZ0A 2WFZA 3FYUA 2VT6A 3SX4A 1UOPA 2Y2VA 5ALYA 4AN1A 5IH7A 3PICA 2WTNA 1CUXA 3Q0TA 3HSSA 3IB3A 3W06A 1X70A 4FDMA 3M83A 3LCRA 1JMKC 4OU5A 3AIMA 1ZICA 3Q8WA 2G4LA 2OLEA 5HQ3A 4V2IA 2CEKA 3O4IA 4P08A 5JAUA 2GBCA 4BC1A 5LZ9A 1E8MA 3G0GA 5DTJA 3WKEA 4EBBA 2JGMA 4DGQA 1E66A 2HADA 3IVMA 3R3WA 3G9ZA 1TCBA 4ZV9A 2RGUA 1ZD2P 1T4MA 1VXOA 4AO7A 3MUNA 4D9JA 5FPQA 4Y2TA 5BV7A 5AM2A 5LZ4A 1U65A 3ANSA 1RP1A 4BVLA 4UBKA 3C70A 1WHSA 4P93A 4F60A 3WJ1A 2BKLA 2H7XA 1TK3A 2VJAA 4H18A 1ZGCA 1WPXA 1DWQA 1WB5A 5JYCA 3KDAA 1CUUA 3O4GA 3AZOA 1CV2A 1YR2A 4UHEA 1BE0A 3B3QA 4IH4A 1L7AA 1LPSA 4Q05A 1XZBA 5AM4A 3DL4A 2V9ZA 2FJ0A 3CCBA 1YASA 3G02A 5D3ZA 5C8VA 2I03A 4X00A 1MT3A 3KSRA 3R3UA 2BFNA 4C01A 3I2JA 2DHEA 5D6OA 3MGAA 4UFOA 4BRSA 5HZGA 2VJDA 5EHZA 4EY8A 1BEZA 4H7DA 4K6KA 1XZFA 2XQIA 6YASA 2WUFA 1QZ3A 4AXBA 5IVIA 2X76A 4K6GA 1CRLA 3WK6A 4FNGA 4Y2VA 5AH0A 1XRLA 5CT4A 3AINA 3OM8A 2PSHA 4N8EA 5ALEA 2NW6A 1XROA 3WKAA 3FLBA 2HFKA 1A8SA 5AI8A 3BWXA 4N5HX 3R0VA 3WL7A 3C45A 5E4TA 2ROQA 5A7GA 4QLAA 4FTWA 2HDWA 4KRYA 3T4UA 2OQIA 3WA6A 4H7KA 2WHRA 5KWJA 4G9GA 1N5RA 1W4LA 5K3DA 1QIHA 1MN6A 3WJ2A 1EX9A 5KWIA 1AX9A 2HU5A 3E3AA 1VE6A 3I1IA 5K3FA 1QE3A 3O9VA 3BJMA 5CBKA 4OSEA 4K2AA 5DYTA 1VA5A 4YX9A 1DWPA 1TRHA 5HQ3B 4M0EA 1ODTC 1DWOA 4ZREA 1GPNA 4PSCA 3I2GA 1L7RA 2CKMA 4NS4A 3JW8A 2QJWA 4LYDA 5LIPA 4QDXA 1QIEA 1AGYA 1ZI9A 1QIFA 4MJ3A 3H0CA 5LKRA 2BUAA 5K3CA 4X85A 5AK3A 1TCAA 2DHCA 3FVRA 1DT3A 1H22A 3IUQA 2O2GA 2BJHA 2VATA 2VT7A 4C4ZA 1XRQA 1EVQA 3WWCA 5ALXA 3DS8A 3RKSA 1XZDA 5AK5A 2XUIA 5EIHA 5ESRA 1UK6A 1D07A 4Y2PA 3VXKA 3DLTA 3I2KA 4L0CA 2ES4A 1ZIXA 4W63A 4QZVA 5ISMA 2WIGA 2J4FA 2H9YA 3UUFA 5FRDA 4BATA 3HABA 5AI0A 3PFBA 4Y2XA 1ZGBA 5AKJA 2LIPA 3S2ZA 5K3BA 4UBMA 1XZGA 4B0PA 1IUNA 3S8YA 3IBTA 5ALQA 4BDSA 4S0XA 4FMPA 2YYSA 2XUPA 1CUYA 2AJ8A 4QWMA 1LBSA 1MNQA 4C4XA 4XWGA 2AJLI 2QJRA 4B84A 3ZLUA 2QMQA 4N5IX 1DU4A 3H19A 5JASA 5K3EA 4GLBA 2P8SA 4BP9A 4IO0A 2XT0A 5DYWA 3DYIA 3H1BA 5A62A 1O6GA 4KEAA 4J0GA 1YB6A 2XLBA 2HA2A 1CUVA 1G66A 3GUUA 4U2EA 3SK0A 2XB6A 3VISA 3TRDA 1EDBA 2HA6A 3W9UA 2XDWA 3TGLA 1MX1A 4BAUA 2CB9A 2XMDA 3WL8A 1LGYA 3WZMA 1H23A 5SYNA 3G0IA 3H17A 1RWQA 2VA9A 3QVMA 1TAHA 1JU3A 4X92A 1M33A 4H7EA 5F4ZA 3ICVA 5AIBA 4GXNA 5CH8A 2CJPA 2QUAA 3G0BA 4C4YA 2DR0A 2QT9A 4PNZA 2JGIA 3G9UA 5EI5A 3WWOA 2G63A 3FCYA 2HA4A 5T4BA 4Q1VA 1FSSA 3A2NA 2I3ZA 4PSUA 3R3ZA 1XQVA 3W2TA 1Q83A 1FFAA 3QMMA 2Z3ZA 1WCYA 2OAEA 2PPLA 5K3AA 3F9CA 5ALHA 4QDTA 3O4JA 3K9BA 5AIAA 4PSDA 4OU4A 4P92A 4CCYA 4CCWA 1E89A 2XUOA 3V48A 1UXOA 4PV7A 3PF8A 3TEJA 4M0MA 4AZ0A 1DT5A 1W75A 3BXPA 1J06A 2HA3A 3FYTA 3E1GA 1CQWA 5HFNA 2OXEA 4Q3LA 4B9AA 2O2IA 1UOOA 5SYMA 1ZD3A 1VOTA 4WCVA 5CMLA 4UUQA 3G0DA 3LS2A 1A8QA 3IURA 1AUOA 5HKBA 1UZAA 1THGA 3DQZA 3C8DA 5EHXA 1MX5A 2RAUA 3QMVA 1Q84A 3PFCA 2OPHA 4ZRDA 5IVHA 2PL5A 4FFVA 5AKKA 1EHYA 2GZSA 2VQ6A 2AXEA 2WG1A 4F21A 4I4CA 4OB7A 3M81A 4E46A 3DEAA 3H1AA 4Y9SA 3O9MA 4QNNA 2ZJFA 4QA9A 1XRNA 2VSQA 4QDOA 3CXUA 5DYYA 3FSGA 1FFBA 5T4HA 1BN7A 2H1IA 1ZD5A 1XLWA 4Z49A 1QTRA 4TGLA 3WZLA 4CG2A 2JGKA 2XMBA 1CUFA 3DOHA 4E15A 2WJ3A 5ALPA 4BP8A 1IZ7A 5FP0A 4DMFA 1XZAA 2PKYX 1E5TA 3AZQA 7YASA 2X8BA 2OGTA 3R3XA 3D0KA 3VDXA 2VJCA 1G42A 2WTMA 4X7BA 1JJBA 2WU4A 1QFSA 4K6HA 1TKRA 3YASA 1N1MA 3ZWQA 1P0MA 2AJDA 4EY4A 3V1NA 1J1IA 3B12A 2XMRA 1HL7A 3WQHA 1XZKA 1ODCA 2XQFA 1SOMA 2ACKA 2R11A 2XQGA 1Y37A 1BROA 1IZ8A 2PSJA 2QOEA 1KU0A 1PFQA 3F98A 1CR6A 4WY5A 5KREA 2ZYIA 1QIKA 1YA8A 1H2YA 1QJ4A 5IKXA 2VJBA 5LZ5A 4H35A 5JZSA 1ZJ5A 4GEGA 4BBZA 1XQXA 4L72A 5AICA 4B83A 3A2MA 5LZ2A 1A88A 2JIDA 5IVDA 2JBWA 2XQKA 3BJRA 5H3HA 3D7RA 4BE4A 1CUHA 3KOOA 4Q34A 1Y7IA 1USWA 5CXXA 2WUDA 1THTA 3QPCA 4OD0A 4L3WA 2RONA 3DKRA 3R40A 1NU6A 5DNVA 2ZSHA 3KWFA 2QXTA 4DNFA 4UBLA 3QBJA 1ZIYA 1ZJ4A 3H2KA 2OQVA 1EK1A 2QR5A 4WFKA 5JD5A 4W1RA 1EVEA 3WL5A 3C6YA 3QPDA 1DINA 4WDRA 1IUOA 4WFIA 2PUJA 3NOXA 4CIBA 5HK8A 3PUHA 5DNUA 4EY7A 2V98A 4W1QA 3QH4A 2XUFA 2XMGA 5AK6A 4UHCA 1LZLA 5A7HA 1MAAA 3I2FA 1YAJA 3KWJA 3OTQA 3DCNA 5C7YA 5JD4A 4FBLA 3U1TA 2WJ4A 5FUMA 2HL6A 1FFDA 5ALFA 1UK9A 4BRZA 5C8XA 1VJ5A 3TJMA 5AM3A 1WM1A 2GZRA 1ACLA 5D3KA 3AFIA 4RPCA 5BOVA 4FKBA 5E4YA 3I6YA 4Y2RA 2OAGA 3HI4A 2WIKA 2XMZA 1XQYA 2OCGA 4J0DA 4DMCA 1SCKA 3HXKA 2Z3WA 1CEXA 3WKBA 5ALJA 1LPNA 5ALGA 5T4EA 4AMYA 4IHAA 4JYPA 4AX4A 2GYUA 4BYMA 2K2QB 4ZXFA 1F0PA 5EHNA 5CT6A 4BTLA 3IDAA 4CFSA 1OCEA 3LIPA 4KACA 4ZWNA 1F8UA 2X5XA 1I6WA 5EHQA 1UK7A 4KYVA 5DJ5A 4RE5A 2O7VA 4BZWA 2PSFA 2PSEA 2QM0A 2HU7A 2D5LA 3EQ8A 3L1HA 2XUHA 1XKLA 1GQSA 1QGED 3WL6A 3WLAA 1T2NA 3BIWA 4ITVA 1K4YA 3F67A 2PUHA 1ORVA 5FLKA 1WPRA 5AKIA 1EH5A 1XZCA 2ONCA 5A6VA 2DHDA 4FFWA 4UHFA 4Y2JA 4HZGA 4CI9A 4J0JA 3WIOA 2C0QA 1CUEA 1FFEA 2YXPX 2G5TA 4LYEA 4MYSA 4L9AA 4ROTA 4XIIA 2OCKA 2GBFA 1BCSA 4DMHA 1O6FA 4LIPD 3OG9A 2B9VA 3RARA 2I3DA 3FNBA 3FOBA 1SFRA 3GFFA 2WHPB 5AP9A 4GW3A 2W6CX 4BZZA 1N5MA 2WIJA 4MWTA 2WUEA 4UHDA 1DTEA 4KAFA 1BCRA 1JU4A 4N8DA 2H7YA 2VTVA 1SC9A 3F8SA 4NMWA 3WA7A 3O95A 3IULA 1CVLA 5ALUA 4NVRA 1YSCA 4PQEA 2XLCA 4GECA 2XMCA 4X94A 3N2ZB 2WSLA 1EI9A 1F0NA 3WWDA 4HXEB 2HA5A 3DNMA 3C6ZA 3L1JA 4UFPA 3DYVA 2JEYA 3CCCA 5EGNA 1H2ZA 1R3DA 3C5VA 4G4JA 3A70A 1W76A 3M82A 5AI9A 2EDAA 1UKAA 1LPOA 3DKKA 2CMFA 5FV4A 3FLEA 2DCMA 4H77A 1R4ZA 4UBNA 2BUCA 2HFJA 3I2IA 3VVMA 4RNCA 2GYVA 1TQHA 4XVCA 5AM0A 4DMKA 1HKHA 5ALTA 1YAHA 2ZYHA 4N8SA 2IX9A 5EFZA 4HS9A 4X6YA 1UKCA 1GPLA 1ZI6A 1JI3A 3H2JA 4W9RA 4GDMA 1KU6A 5ALIA 2WIFA 4EUSA 4G8DA 5AJHA 4BVKA 5HFAA 3ZI7A 3DOIA 1XFDA 1XKTA 2YH2A 4W1PA 3HEAA 2RI6A 1DX6A 2J4CA 4HRYA 2Z8XA 5HKAA 4MQMA 4FHZA 5I8PA 1K63A 1CUIA 5C8ZA 2Z5GA 2XUJA 4WJLA 4CIAA 2Y2UA 2XQJA 2BAGA 1QONA 3C6BA 2XMQA 4HTAA 4KR0A 2DFPA 5JD6A 4K5QA 1C7IA 1JMYA 4EY5A 1EDDA 4FLMA 3HLKA 3R3VA 5CT9A 4BE9A 3LP5A 5EIEA 4CCYB 4PO3X 5HF6A 3O0DA 3A2LA 5JAPA 2RHWA 1Q0ZA 5CT5A 3BDIA 2DSNA 2ZYRA 3IUNA 3I1YA 3H2GA 5T4FA 3C5WP 3ICWA 2B20A 5I9IA 5AO9A 4B6GA 3WWEA 1UKBA 4WDQA 5EIAA 4G1FA 4Y2UA 1OILA 5HF5A 2WUGA 2HHAA 1X2BA 1CLEA 2HU8A 4ETWA 2V97A 3U0VA 2YASA 2XUGA 3OURA 4FWBA 2WILA 5CRIA 1QIJA 2O7RA 2IIVA 1XRPA 5ALVA 4EA6A 4INZA 5FXMA 1LNSA 4Q3KA 1MNAA 1DQZA 2FUKA 1XZHA 4GHWA 2ORYA 2QS9A 5CT8A 4C6HA 4U2DA 1E8DA 5JALA 3AIKA 4QEKA 4JH0A 4UPDA 4JYMA 3P2MA 1B6GA 4I19A 3D2BA 3HYSA 1ORWA 1X2EA 3C87A 3C6XA 4BAZA 4MYDA 1MJ5A 3K2IA 4B80A 3IUJA 3I6ZA 2C4HA 4H7JA 3MUOA 3WK4A 5HK9A 1EXWA 3RM3A 1BEEA 1GZ7A 3ESBA 4X90A 3RK4A 2WKWA 2ZJ6A 2WM2A 4DYHA 2XUAA 4Q3OA 4YASA 3ILSA 3SWWA 4B85A 3DDUA 5HF8A 2CBGA 3FWHA 5DTIA 1LBTA 3FAKA 4XX1A 5AKGA 2ACEA 3ESAA 1EB9A 4MQLA 3AUKA 4KE8A 3EQ7A 1CUSA 3V9AA 3STYA 4AN0A 5AKZA 1P0IA 4UFNA 5ALKA 5JZ9A 1QIDA 3HACA 4QWWA 5CXUA 1BS9A 3V1MA 5J3JA 2XUDA 3BF7A 3FLAA 3K6KA 3OPMA 1E3QA 1PV1A 1CUBA 1QTIA 4H0CA 3SC2A 4C88A 1QIIA 1JKMA 3I28A 3WKDA 2W22A 4DIUA 3B5EA 3WK9A 1TCCA 1UOQA 4A5SA 3BIXA 1DX4A 4DNPA 1GXSA 5KBYA 1P0QA 4I3FA 1CIJA 2JGFA 4B7ZA 3ZPXA 2WU3A 2QTBA 3EF3A 1G4HA 3QPAA 4JEIA 3AIOA 1CPYA 3ESDA 1XZIA 2IITA 3VVLA 4Y2QA 1ZI8A 3GELA 1VA4A 2J3QA 1TIBA 4EZIA 1MAHA 2JGLA 4B0OA 3FSGD 1EB8A 5JARA 2VAXA 5LP1A 1XLUA 3G7NA 3LIIA 3D3NA 5AOBA 1EINA 3ESCA 4OCZA 1R9NA 5ALOA 1RYYA 3H2IA 1YA4A 4FLEA 4F5ZA 2Q0XA 4HAIA 2WHQA 4J3JA 4KJXA 4KAAA 5CH5A 3OC0A 1VZ3A 3PUIA 4J03A 5LZ8A 3E4DA 1N8SA 4AQDA 1CFJA 1J07A 1LLFA 5A71A 1K6EA 1VE7A 5A2GA 3WMRA 3WYNA 4G9EA 1XRMA 2RIPA 4LHEA 4CG3A 4F0JA 2ZVDA 5ALDA 1QLWA 1SCIA 4OPMA 4QDZA 2OCIA 3R41A 5AKEA 3PI6A 4OUKX 1R9MA 4WFJA 4C87A 3KXPA 5FKJA 2BGRA 3STVA 2D0DA 3UUEA 4U2FA 2BCEA 3FCXA 2WG0A 5CURA 2PM8A 3G9XA 3BF8A 3NWOA 2C5FA 3MVEA 4E14A 1U4NA 5ALWA 2DQYA 4ARAA 5E4JA 2XI4A 4OB6A 4H7IA 4EB0A 4IH9A 1AQLA 2RHTA 1CUCA 2B61A 2Y6UA 3IUMA 4LKOA 4AB1A 4J0HA 2E3JA 5C81A 1FJ2A 3V1KA 5ALMA 4MWSA 2ECFA 4G8BA 3PDCA 1A7UA 1QIGA 4B82A 3D59A 2O2HA 3CN9A 5AI4A 1OXMA 1DQYA 5ALSA 4X93A 4EHBA 2GYWA 1AURA 1VXRA 4U2BA 4A16A 1AZWA 1H2XA 1CUWA 2EDCA 1UK8A 2C5GA 2DQZA 4HRXA 4BCDA 5LLSA 2FX5A 2QXUA 4EY6A 2CZQA 1XZLA 1E8NA 1LPAB 3CN7A 4U2CA 1XZJA 1S8OA 2JF0A 2XE4A 1W52X 1JFRA 1MX9A 3D2CA 5LZ7A 3H18A 2OGZA 4HXFB 4DNQA 4RE6A 2PU7A 4GBGA 2HA7A 2JGEA 1XQWA 4FOLA 1QO9A 4BB0A 4MEBA 3ZV7A 4U2GA 1IVYA 2WLSA 4G5XA 4Y2YA 5JADA 1ZOIA 4UBJA 1U2EA 5DWDA 4TVKA 2QUBA 4KE6A 4GWLA 4QDUA 5JIBA 3GBSA 2WFLB 2XMSA 3IA2A 1XRRA 4QLOA 4QE3A 2AJCA 1K8QA 3QYJA 1LZKA 1EDEA 1HBJA 3BDVA 1G5FA 4PW0A 3I6MA 3KD2A 1AKNA 4X3CA 1R1DA 4J0KA 4ZV7A 3WYDA 1BU8A 3GROA 4A23A 3ED1A 3ZLTA 4YPVA 1YS2X 5HF9A 1VKHA 2OCLA 4ZI5A 2HRQA 4OB8A 4MXDA 4DM7A 1UFOA 1HPLA
chains in the Genus database with same CATH superfamily
1ZRSA 3EZ7A 5B1HA 4QJ4A 4DPMA 1O08A 2O7QA 1GKLA 4NX2A 2C7BA 2ZIWB 2BDEA 2IY9A 1PJAA 4RHFA 1UR5A 2P9HA 3I2HA 5C8YA 4X95A 4BFUA 3AR8A 4WA7A 4HDSB 1U0NA 1RIIA 5ANRB 4ENRA 2DT8A 2B7LA 3MWDA 4Q9AA 1P5FA 4NRDA 5G3YA 3TGWA 3ZE6A 1DQRA 1JJ7A 1JJFA 1S7GA 1B3RA 2Y1LA 2EBHX 2GN1A 1XNJA 3R3YA 5CA0B 1M66A 4XUDA 5EXXA 3GFPA 1A4RA 3U3XA 4RVGA 4R40A 3DEIA 4XEUA 2ZZNA 1DRWA 4TWJA 4L9WA 5ITWA 1VYHA 3QFTA 1HEYA 2KPOA 3E9ZA 3A4LA 4LX8A 4BZXA 2J6BA 4B6OA 3W2HA 3G17A 3CVXA 3TW6A 2VXOA 3ZD7A 1QQ5A 3JYHA 3W04A 1C4XA 3FN4A 1KNQA 4MS4A 3SX0A 3HO8A 2ZYWX 3JR7A 3U9LA 1XK7A 5IKMA 3KXDA 4NZZA 4HSEA 3U44A 1E4YA 1FQKA 3N8DA 1M0TA 3WY9A 2PU5A 2X15A 3UC9A 1SKYB 3S3TA 3CTMA 4RQBA 1RIFA 4UKDA 5EYPB 3OA0A 3VDRA 4Y1FA 2HBYA 1R5BA 3BMQA 3G13A 4PSVA 1T1JA 4UVIA 4DLYA 1C14A 4DZRA 4YUXA 5DHAA 4ZYZA 2Q2NA 1KO8A 3B8HA 1W2GA 2YQ4A 3LVQE 1Y98A 2H6EA 3NHJA 1C0LA 1E2IA 5EKUA 5HPYB 3UJ6A 4YAKA 5JCJA 4BNNA 4CJXA 3FJYA 1XPUA 4MINA 4BFLA 5EINA 3OEEA 3MM4A 4NK4A 3TB6A 1RLMA 3DOJA 1NXVA 3F0TA 2YYAA 1GR0A 3JQAD 4K87A 4TQAA 3QV1A 4TZTA 4BUZA 4F5WA 4C6TA 4RUKA 5JV5A 4NAVA 4J0IA 3ZXSA 1YS6A 2WAOA 1GUDA 4MQBA 5FDFA 5AVSA 2JEZA 4U1RA 1V96A 4LX0A 2H5LA 5ED4A 2PD3A 2C9YA 5EJ2A 4K9KA 4KQMA 4MV0A 2HV9A 4OYRA 2F8SA 3A11A 1VG1A 3CONA 4IQ0A 1W9MA 4I2NA 1Q95A 2ZJ7A 5AVWA 5HHTA 1V5WA 3S2GA 3AEQB 1KI7A 1CJBA 2M9MA 5EFOA 5K1ZA 3UH1A 2YJGA 5DK4A 5AI6A 2BFFA 3LUGA 3IVAA 2D13A 5A06A 3QOFA 4PF1A 2NNWB 2XUQA 3G8AA 1Z35A 3FHJA 1F3LA 1GKKA 2Q8NA 2DULA 4HAZA 1Q0RA 3TK1A 4V38A 4GOXA 1KR5A 2FSVA 2CLMB 1GGNA 1VFNA 1FX0B 4RXTA 5EPUA 3UV7A 1DRJA 5L9AA 4HNQA 3CWZA 4CM9A 5JAHA 4IQ4A 4MP3A 4ZVUA 2I91A 3PE6A 2ZP1A 4XSVA 2WG2A 1N3LA 3DB2A 1QIMA 4QC2A 4KE7A 4C7OB 4DV3B 3WKCA 1ZGJA 3BL8A 2V55B 3STUA 4EW2A 3OAAA 5BW4A 1MIHA 1PJRA 1JT9A 1XMIA 1V8BA 1Z7BA 2ZI9A 4O5AA 1BCRB 3RSGA 1Z38A 3QVJA 1CVRA 2IU3A 5FOQA 1LPPA 5LOVB 4QBKA 1JR3E 1SU6A 4KUEA 4KH0A 1VE5A 2IF2A 2O8EB 1ICEA 4N3AA 5G41A 3ZXXA 4BB5A 8ABPA 2A33A 4BVJA 2VP2A 1BKYA 1W2WB 4QVGA 3LDHA 5LB4A 4R7ZA 2VF7A 2P7IA 1K4MA 3JYQA 5DT9A 4X8OA 2ZT8A 3UKJA 1HT1E 1SHZA 1ZSVA 3EUWA 2A4KA 3KYIB 4RPGA 1A8HA 4J7AA 2V0CA 5DTQA 4B6SA 4IOMA 3B1KA 9GPBA 2C0PA 3H13A 3BGSA 2DFLA 3C74A 2BMEA 4DLUA 3ABQB 1SN7A 1KH2A 3E23A 2XMPA 3G0OA 1Q77A 1FDSA 3IJPA 3O8LA 4UBOA 3RS5A 1X1SA 1VJGA 3SC4A 4BEWA 2YV2A 4XD2A 1RYBA 4HI0E 2YJ6A 5DISB 2JGJA 1EM6A 2SBTA 3H87A 5HJ5A 1Y1TA 4MARA 2J5BA 3NP9A 4HATA 1LRLA 2B35A 3K16A 3R5TA 4KKXB 1C3JA 4AJKA 4DLKA 1EWRA 1SCNE 5DSXA 1C9EA 5IJWA 1Z5GA 3DVLA 2EGGA 2ZSIA 2Y1OA 1NQOA 1WSAA 2JI7A 5CCBA 1Z6XA 4LYJA 2V96A 1U2GA 2JZCA 4QFBA 1VM6A 2MSDB 5ADVA 1VPDA 1I1HA 2QD5A 2Z1DA 5JMTA 1LTHR 2I54A 2ID7A 3OLZA 2ZULA 3O4HA 5AM1A 5HOQA 2O7NA 2OLKA 4LCJA 1UQRA 2W2XA 2HIHA 2XUZA 5TMEA 1LBIA 4A6PA 4B32A 1IHPA 2EX4A 4K0KB 1WUKS 1MJHA 1ZNYA 1E3WA 2R1ZA 2YN2A 4GX1A 1MTZA 2QKYA 2I76A 4CKZA 3V8VA 3OQ1A 2OXTA 3JPYA 4I36A 4FLFA 4TWZA 3MOSA 4DRZA 3GLSA 2XVZA 5KTTA 3SOZA 1AMNA 2A0WA 2EBWA 1RCTE 3S0JA 2VJMA 1J6UA 2OP0A 3AV3A 2VYVD 1MIOB 2XSZD 4KK4A 1GQYA 2CCGA 2P6NA 4UAUA 4C0LA 4DNOA 3H2BA 4EQ6B 1IWPB 5AKLA 4EEZA 2XVXA 3KJGA 3PJFA 1XWFA 3DZDA 3EFEA 3LRPA 3OQIB 1CUJA 1IMJA 3LKVA 1K08A 1A2KC 1AKEA 1W6RA 2PL1A 1V16A 2V7QA 3EF0A 3H9GA 4N5MA 4KPFC 3ZW8A 4EHIA 4S24A 3BFPA 5TC4A 5LJLA 4CR6A 1CUDA 1U1IA 4R54A 2GBIA 5EMNA 3COYA 4WY8A 5A3SA 5T3UA 3ZDRA 5BQFA 1MO2A 3CMMA 1GG8A 3LQ2A 5AOAA 1ZIDA 2AQ8A 3C7KA 4QJ3A 5KEIA 1EBUA 2QAGA 5D1NA 1ML4A 1PU2A 1U8XX 3KKOA 3NH9A 5TDHA 3T34A 3VYUB 4E3WA 4EP1A 1ZRHA 1BWPA 3AF0A 3IUBA 1I0IA 3G8CA 3FWYA 3HFJA 3OT1A 1JS1X 4KTTE 5FI0B 3IH5A 4GM4A 5FT9A 3G1WA 1GNLA 1REQA 2D1YA 1N2GA 4HDOB 1ZWKA 2H92A 3F6RA 4X1KA 5FI5A 1IWOA 3T52A 2E82A 4PX2A 1OLUB 1P9WA 5CW1A 3MB5A 1MO3A 4YJHB 3ZDDA 4DTCA 2GCPA 3RIMA 3K8QA 3OE4A 1ETHA 3LTEA 1QHFA 3B1WA 5FWDA 4BNWA 2IPMA 4JOBA 1EA5A 2DEUA 4X44A 1LUAA 2C31A 1A8UA 1D1QA 4FBMA 4TRJA 5CITA 1HEIA 2ASEA 2CMGA 2Z8ZA 3C3WA 1MJGA 4BCBA 4ZQCB 4KNYA 1NU8A 4WFQA 4M8KA 2VKTA 5I5GA 3RFCA 3T7KA 4ND2A 4DILA 3K0HA 1C9JA 1CDDA 3HU2A 5H3LA 3JZFA 2BGNA 4G23A 4WY2A 3FR8A 2AJBA 2EIHA 5AVTA 1KJ9A 1TGYA 4WN3A 1FNCA 1G7RA 3EPHA 3GAFA 4IIYA 5IH3A 2PDAA 5EUQB 2FPUA 3ANTA 4GM0A 4IKPA 4YREA 2FJPA 3F97A 2VJPA 3GWZA 4GOMD 5GV8A 2G71A 5KHLB 4PGAA 1KKMA 1J1ZA 4BFCA 1YVEI 2HMVA 1GYRA 2ZSUA 3SYTA 4WNAA 3N0VA 4G97A 3SC3A 4J2TA 2Y1KA 4J76A 1EFLA 1PSDA 2GN2A 4V0RA 4DPLA 3CVJA 2D5AA 1P18A 1YIDA 4H7HA 3WOHA 4RAQA 4HVTA 1ONPA 3JZMA 2FMKA 5JMPA 2OG1A 2PFKA 2XVYA 3L0YA 5AKXA 4M1MA 3X1MA 1D5WA 3OJLA 4LJYA 5L6LB 3MGGA 1BWQA 1SEPA 1AGRA 2VDRB 5J9FA 3X3HA 1NGSA 1I2DA 3QEOA 5EWMB 2VR1A 3LJKA 1F12A 3WGMA 4B31A 2HA0A 2F3QA 2IWRA 2ZRNA 3TVYA 2V1XA 2HDNB 3EUEA 4ZGBA 2DFVA 2FN3A 3U48A 1GTJ1 2IPOA 1X0VA 3ZE9A 2JFOA 4DDWA 6CHYA 2WY2D 2XKKA 4KR7A 4O4LB 2VAVA 2BWJA 4CQLA 1OT3A 2IOFA 4BL5A 2PMBA 5KQSA 2OZEA 1NI3A 2QM8A 2X1MA 2G77B 2VDQB 2YOHA 4LXTA 3RH0A 3FW1A 3ESZA 4QOGA 3EEIA 5CDFE 2H07A 2HNBA 3DMTA 1V4BA 3T0FA 3SJAA 3C7DB 4EG7A 3IEUA 3H9CA 4LPSA 2BUBA 3S2IA 4QXPA 3N0WA 2CLOB 2ZYAA 3TRJA 4ER0A 4AXXA 4NV3A 5CW2A 1Y8ZA 4ZEVA 3UJ3X 1E1KA 3ZHCA 3NFYA 2DRIA 1L4EA 4FXOA 2LCIA 4MDYA 3T94A 1J2JA 4OP3A 1T36A 2WFLA 3VV2A 1K06A 3CZ4A 1TKBA 4PZCA 1WWKA 1BGWA 1M2VA 2QSYA 3IHWA 4AULA 1VYUA 4Z0HO 3LPMA 4MO9A 4J0QA 3G0CA 1RQPA 5JLJA 1XJCA 3PVZA 5DX1A 4DSZA 3GT4A 4UHBA 1LJUA 1QHIA 2YS6A 3BORA 2LRHA 3IKJA 3M6VA 5DHTA 3VI4B 1K27A 1VZ2A 3K72B 4OYLA 1OE0A 1CNFA 2J9GA 1WB6A 3ETDA 4CCAA 4FPXA 3RU3A 3T41A 1OGJA 2J09A 4O08A 3AUSA 2BGUA 4KBFA 2UZ3A 4CQJA 4UU7A 1AOXA 1KOFA 1GSOA 4KU4A 1YRBA 3OCYA 3EVEA 2VZ8A 4W5JA 5P21A 4EX7A 3RAPR 5FUQA 4BQRA 3CINA 1G5RA 3WICA 3OQIA 1JHAA 1R37A 2IXGA 4C0HA 1Z2CA 1JDPA 3HCRA 5TVGA 1OX4A 2IZ6A 4MV9A 3OE1A 3SQDA 4CV3A 5K4HA 2PUEA 1NYRA 2HIGA 4MH0R 4XWTA 3RNOA 4Q4AB 4RELA 1JT2A 3BTOA 1RW4A 1CUGA 2WWRA 4QJIA 5FO1A 4XRGA 2R6JA 4EEKA 3AILA 3AJAA 4DIMA 1GPKA 2WJ6A 3CEAA 3FBWA 1RXIA 1F6WA 1HQKA 1V95A 4KLRA 1AQJA 2WQZA 2Z0MA 3EGEA 3GIDA 5K4GA 2ENUA 4HWKA 5FUXA 2E85A 5BSEA 4TZKA 1OBFO 1NM5A 4OYYA 3B70A 1K5HA 3EIOA 4GR9A 1OVGA 3T5GA 1JHQA 2DLCX 3OT4A 4OQQA 4FGUA 4RM2A 2C92A 2R8OA 3CZQA 5JPCA 5I8ZA 1MF7A 1C8KA 2P4SA 1T2EA 2BMJA 2HJGA 3KD3A 3MCUA 4IR7A 3FF4A 1SC3A 2Y2VA 4AAYA 3O74A 5ALYA 1UKYA 4CT5A 5BWNA 1J5EB 4AN1A 2W90A 3GMSA 1F8XA 1WV1A 4ZPXA 1T29A 2X42A 1U7TA 2OO3A 4AD8A 4DF3A 4LJ8A 1TVCA 3EXHC 3WADA 1Y1KE 3CW8X 3PKJA 3T8YA 2Q5LA 3P52A 3Q0TA 3WL4A 3HSSA 4LHSA 3H65A 3IB3A 4TYPA 2Z6VA 4EJSB 5KX5F 2Q1SA 4RTKA 2I4RA 4RTMA 1A5AB 2AEFA 4HDMA 3GEEA 2VP6A 3E7XA 5PNTA 4OU5A 4LSMA 5A5DA 1JEAA 4CF5A 4IQ8A 3EXG2 1EIZA 4EJFA 2JFBA 2XIQA 3BXGA 5HQ3A 3D7MA 3IUYA 3Q4GA 2O8DA 2GESA 4Y1RA 3Q8LA 1UJMA 3PDJA 5LZ9A 1SBQA 4YO8A 3G0GA 2G4CA 3P4XA 4NF2A 2JJ1A 2MTBA 5JTUA 4YMHA 5SY9A 3W5JA 3NBAA 4OQMA 1DG9A 1AIPA 2AOUA 1JYFA 3C0KA 3K7EA 4GYWA 3TZLA 4ZZ3A 1DCTA 1Y3DE 1KJIA 4NJMA 5J23A 2PKXA 2YUIA 2ZTSA 3T15A 3FPJA 3N70A 2W5UA 3SZGA 1SQFA 4H4CA 4GC9A 2IPXA 2AMYA 2C04A 2CYAA 3G9ZA 4GR5A 4JQOA 4C0JA 2H7VA 3ITDA 1TCBA 2H4WA 1FTGA 2NZ2A 5GGYA 3QW4B 3W1VA 5AMXA 1GCAA 3EVTA 3HR8A 3TTYA 5I4KA 1VPWA 3FPSA 1W93A 1VXOA 4C78A 3TVDA 3MUNA 4K1LA 3GARA 3LHSA 4UEKA 5EESA 4EW3A 4D0SA 4LJSA 3HVKA 5LZ4A 4HEJA 1U65A 2BSXA 2GFQA 2IQIA 4IXNA 4URHA 5FL7D 1G21A 4PZDA 2ZWOA 3QVVA 4PANA 4ZQHA 2QRMA 3T3DA 1MB4A 1QWOA 4WINA 1N0VC 4CQMA 1QE0A 3C70A 1N3IA 2L2QA 1JNYA 2QTZA 5F1KA 3HB5X 5TPZD 4E03A 3GLIA 4P93A 4F60A 1D6SA 1VYTA 1JX6A 3HU5A 3NGLA 1L4KA 3ES9A 4MGIR 5BR4A 2IV3A 1F5NA 1E7QA 1N25A 2B21A 3AR3A 1M6NA 3NONA 3B78A 4LJ9A 4PC3A 2PS1A 4QD3A 4HGQA 1ZGCA 1DWQA 1WB5A 1WJGA 1BJRE 1X1DA 1ZUD1 1CUUA 3AQIA 4ERNA 1K7EB 1YR2A 1Y5IA 1ATIA 3DAPA 3DFKA 4MMXB 4NONA 1BE0A 1Z26A 3GAZA 3M9LA 3PNQA 3V4VB 4QGFA 3B3QA 1GQ2A 1CE8A 2MYUA 4D3XA 3V80A 4PZ9A 1C1YA 3GQBB 1Y6GA 4JBWA 1LPSA 4Q05A 3QWHA 1YL5A 4IDDA 4X8HA 5BSUA 4MICA 1V35A 2YX1A 4GXTA 5GINE 1W35A 2ON6A 2FLWA 2NYAA 4YVFA 5TQVA 2J9XB 1ILEA 3DL4A 3DOEA 5KI6A 1SVOA 5ICCA 1CDOA 2C1ZA 2FJ0A 3KKMA 3UZUA 2JLVA 1YASA 2FN4A 2QN3A 1U80A 4RLFA 3O92A 3WXBA 4BB6A 1MT3A 3TKAA 1AF4A 1L4UA 1DAEA 3K0CA 2B82A 1WTAA 3MW8A 3R3UA 1E2FA 1H5UA 1KKLA 4HWSA 1NT4A 1ONNA 3CKYA 1JBQA 4GL4A 4D56A 4DAEA 4E6EA 3O2JA 3UAXA 3AKZA 4AUMA 1QP0A 3U4AA 1A71A 2X23A 3V8RA 4BRUA 1ZVJA 8MHTA 4O5OA 4PLFA 4EK9A 4BRSA 4Z4IA 1FIUA 3HI6A 1DXOA 3LYAA 2HQ1A 1OR8A 1GNQA 4HUJA 1A8IA 1U0GA 5C7IO 5CCXA 1R8YA 1S96A 2EP5A 4L4SA 5EHZA 2E1PA 3VKHA 1FYDA 1QG0A 1T36B 1GY8A 3PHBE 4FFOA 4QULA 4A0HA 4D9BA 4NMMA 1XZFA 2GXQA 4OIMA 3WGOA 1O54A 4ME6A 2IL1A 1RVV1 2O3RA 2XQIA 4BX3A 4EW6A 1KYIA 3DOCA 2Q41A 3GG9A 3R5JA 3RRFA 3PNYA 4ARZA 2HWUA 4DC9A 5HKKA 2PJDA 3NXKA 1L7OA 1RJGA 4K9SA 4I4NA 1HEUA 4X5OA 2IKSA 2YWXA 3LO5A 4FNGA 3VNVA 5AW5A 5GIOE 1Y80A 2R65A 3I9MA 2DH5A 2I1WA 5TNXA 1P45A 2JW5A 2Y4NA 3TTVA 4DDTA 1EUZA 1MW9X 1K86A 2YRXA 3QU9A 2Q28A 1TM1E 4WZZA 3LLVA 4TTPA 5ELMA 3WRXC 1AQYA 1OA0A 4Q1AA 3AW8A 4A26A 1Q7RA 3H7AA 1CEQA 1FEZA 4QBFA 5KKAA 2BGIA 3KEQA 4RU1A 3VM6A 4UM9B 3FOCA 4WSOA 4C0AC 1JAZA 2W2KB 3MJTA 2O2XA 4K6MA 1UBJS 3B60A 4KDCA 3PI7A 3D6HA 1GADO 4JHLA 5AJVB 3ZIDA 3QKRA 5ICFA 4Y0AA 3UWDA 4GT1A 1LDNA 4PIVA 5TB5A 4C1BA 3AKYA 3KJHA 5BPHA 1RYHA 3CO0S 1VMEA 3GC6A 3L8CA 5K8CA 3BWXA 3WRWA 2OFXA 2BBOA 2JG3A 2VK2A 3OHPA 4KMSA 5GIPE 2JFYA 2ZI6A 2MYNA 1X19A 4A82A 3L8FA 3TMYA 1DJQA 2HDWA 2ZJBA 2V7TA 4REQA 1T6NA 4KRYA 5K8VA 2Q3CA 3REOA 4C30A 4AZSA 1UBEA 4CLOA 2F3UA 5K0FA 1X39A 2O52A 3BE5A 4AMVA 4IGEA 3OFKA 1G7SA 1FZQA 3W5HA 2SHKA 1DZIA 1JP7A 4XI9A 1X7ZA 3SYMA 3DPIA 5KWJA 1C80A 3U13A 4FMCB 2FMXA 1ZIOA 3O8DA 1R8XA 5BR8B 5IJ9A 2D59A 2Z4SA 2RAVA 3FKQA 4QQRA 3LSYA 2GF2A 3F6CA 4Y6OA 5IUJC 5ERYA 4QTYA 1PCXA 3AI7A 1K2VN 2WAXA 4CR7A 3I1IA 3P45A 4DUYB 2A84A 1QE3A 1OWPA 1NNI1 3FZNA 1P5ZB 4S3MA 4AX8A 2CEAA 1U9IA 2ZRGA 3RHFA 4DXAA 2JAHA 1EDZA 1UC5B 2J8ZA 4OSEA 1ZLXA 1VJRA 4FJ1A 1Q50A 3WV4A 1CIPA 2VHVA 3MJDA 4JI1B 4YX9A 1PVOA 4C7JA 2PGLA 2ABWA 1Q44A 3D6MA 1QDEA 3EUFA 5J2TB 2Z2JA 3T5CA 4V1CA 3DBRB 2LW7A 2AHOA 1Z8HA 2QDXA 2AK2A 4R0MA 4ZREA 5GOZA 1U2PA 1C0IA 1ZUHA 1NXQA 5BYKA 1DNPA 3PPYA 3HKEB 4COOA 4C2AA 1VKJA 3KB2A 2GNPA 4F4UA 3HCAA 3OEWA 1NV9A 2QX4A 3QEMA 1FTWA 4NS4A 4MUHA 4QU9A 4CUZA 3KFXA 2FWPA 4WXMA 2IS2A 2HMTA 1NBWB 1X0XA 1E99A 1MFPA 2QJWA 3ASUA 5HE8A 1QK5A 5JDIC 3FOEC 5KU7A 5LIPA 2ZB2A 3NVDA 1BAPA 1O87A 2BOVA 4QRHA 5F35A 3H0CA 3QBTA 2YZKA 1RPAA 5DBGA 5LR6A 4LBWA 4W82A 2V7VA 5AK3A 3OIGA 4OJNA 4B4VA 4CKYA 1NBME 5JD3A 1BDIA 5AQ1A 2X9GA 4BO9A 2V58A 2GKGA 3MT0A 4OLJA 4UTVA 3CUUA 3ADKA 1RYDA 2AKEA 1OROA 4UOEA 1GG9A 3F1KA 5EL0A 1P7WA 2YJTD 3G79A 4IYJA 1N6RA 4F4DA 1D0VA 3D7LA 4TXJA 3DEYX 5IEJA 1HDXA 2EAUA 2RIRA 1MORA 4OHKA 3ZNPA 2VT7A 1IULA 3NKFA 2JVKA 3OWOA 1Q7CA 2HNAA 3GP8A 1EVQA 2C9CA 3OCZA 3UA3A 3TOXA 3WWCA 3G3EA 4LOLA 1IBMB 1G1MA 2LIVA 1Y33E 1R5JA 4XYMA 3VZCA 4C2BA 5BMVB 5J5CA 3DLCA 5C5CA 3AEZA 4W6QA 5AK5A 1NG1A 4P5EA 4WADA 4PRYA 2A9VA 3N8KA 4EENA 1IBKB 1DTWB 3GRUA 2GERA 5HIAA 3Q72A 3UG6A 1U2QA 2DZDA 3U3ZA 3MTDA 4MP6A 1T9GS 3FNIA 1LFDB 3NDPA 4HGYA 4L0CA 4BLPA 1TJNA 3SSAA 5DNEA 3HPRA 1XD2B 4YHBA 5SZIA 1DAIA 1CNMA 5K8JB 3H11B 2H9YA 2AKYA 4B40A 3QJ5A 1YBHA 4BVKA 3RW9A 1DIOB 4MS1A 1WXQA 2H5IA 1W0KA 2JAXA 3M6UA 5P8WA 4KDFA 1GGKA 3A10A 5ITZA 2LIPA 3Q0EA 3HP4A 4RYLA 5K3BA 2DCUA 5I7OA 4UBMA 4BMVA 4A6DA 1QNLA 1XZGA 3CRMA 2PIDA 2PCJA 1KFJB 2FUG1 2RGEA 4XJXA 4CTNA 4OBEA 4HX5A 3PJRA 2DVMA 3PNOA 1QYDA 1G9TA 1WF6A 4BDSA 3RODA 2XOEA 2W37A 4NECA 2CB0A 1AXRA 2ERYA 2B1GA 2YYSA 2CVHA 4TSFA 3OTHA 4XXHA 2XUPA 3AYZB 3BK1A 4CMKA 4B79A 3A32A 4D9CA 2ZETA 2Z08A 3WLQA 1ZMTA 3GYBA 2AJ8A 2VL7A 1N5LA 2QYHA 3QX3A 3AERB 1I8TA 3BSWA 4C7XA 1LBSA 1ZD9A 4HY3A 1XN4A 6PFKA 2NXJA 2JKYA 4XWGA 2CL5A 1I7LA 4ID9A 3UMYA 1BSVA 4HF7A 4B84A 1A9XA 5H0IA 4YR9A 1PD0A 4CIYA 3COSA 4HH0A 1W85B 4JJAA 4XLZA 1CF9A 2FFHA 2Y76A 4HGPA 3HVUA 1DU4A 1HYHA 3H19A 4NENA 1X7XB 1Z37A 5B5SA 2D1QA 5J4LA 5KTPA 5FNZA 3DUFB 4HH1A 3V8EA 1U1GA 4EMUA 1VL5A 2P77A 2NO1A 5JAMA 4JI8B 4WKBA 1SU8A 1P19A 3KOWA 2QTNA 3UF0A 4D8TA 5ITVA 3NWPA 1SA0B 4LRSB 5DU2A 3H5TA 1F8YA 3KOMA 3VR6A 4JVSB 2NT4A 4G36A 1O6GA 4JFRA 3B9BA 4Q1CA 2HRZA 3H9JA 5FHQA 3ISVA 1IJEA 1R5OA 5IAJA 5FFMA 4TXNA 3USZA 1TZJA 1MAWA 4RJJA 4DJAA 3HA2A 5CB0A 3V8NA 2F8TA 2QRPA 1T6BY 1QK3A 1G66A 1EM8A 2C8KA 2WW8A 2XB6A 5DGCA 3SQLA 3VISA 1EDBA 2XYRA 1E92A 2QPOA 5IASA 1KZ6A 1LF5A 3KQSA 4UTOA 4XA8A 4YT5A 3VC2A 3TGLA 5K2OA 2V65A 3CUVA 4F2DA 1W4RA 4IF6A 5LMUB 3QI2A 4IIBA 4TV8F 2G25A 1NWHA 1PGPA 1W96A 2BD0A 1H23A 3NHWA 4NCIA 4P33A 3VVCA 3FH0A 5CYOA 1IYZA 1EK6A 3G0IA 3MBOA 1XXHE 3Q0IA 1BX0A 4HWRA 4RKFA 3UJAA 4EDFA 3KAJA 3QVMA 2WJZB 1CW2B 3MSXA 1JU3A 2NU7B 1L7PA 1FLNA 4EB8A 5I7FA 5JHHB 3E7PA 1M33A 4GUDA 1IRIA 4H7EA 3UHJA 1WBBA 2RAFA 3AFHA 3ICVA 3OQVA 5F4ZA 3V8QA 5KJFA 1VE1A 5CH8A 1K0FA 2YJ5A 3HDVA 4CLRA 2ADMA 3EXHB 4JI0B 4PQGA 1QMPA 4JJIA 2J6HA 1VGRA 4CQNA 2APJA 3L8YA 3PVCA 5IG2A 1CRZA 2JBAB 4WLUA 1KPGA 5TPWB 3ITKA 4PNZA 5F7OA 4MWGA 2JGIA 5EI5A 4F9EA 4L7VA 2G63A 3PL5A 3WWOA 1JEJA 5JXGA 3D1VA 3TCNA 4Z1OA 4XIJA 3WFJA 4H27A 3T1QA 1Z2DA 4ZMRA 2XNSA 4LSGA 2C2GA 1GHTA 1JQLB 2JJ8A 2Q45A 3L6UA 1JLHA 4TROA 3WDKA 3QF4A 5JSZA 2OC4A 2NO4A 4EMBA 2XCIA 3AHGA 1QE5A 4ZPJA 2P9EA 1CZLA 3BQNB 4CTJA 3HHEA 5HXAA 3AVWA 4JWTA 1FXUA 2CV2A 4I50B 1FFAA 2ZEJA 4RZ3A 3ICEA 1YULA 2LCFA 4PLZA 3WBBA 5CA0A 1EMDA 1SKMA 3L82B 3D3WB 3IVRA 3L7IA 10MHA 3F9CA 3A36A 2IE0A 3AM4A 1DBIA 4PE5B 4R8KA 5ALHA 3T38A 1JFSA 3CIFA 3HK2A 2BDUA 2OYRA 4QDTA 4CKBB 5JO9A 3UGJA 3K9BA 4XQCA 2V7XA 2YMLA 2ZXEA 4JOSA 3BWMA 2DQKA 3ND5A 3K0BA 4OU4A 4O8CA 1V39A 1GDHA 3JQAB 5G0WA 4CCYA 4JIMA 4RVUA 3JTMA 1AO3A 1X7YA 2X4LA 1TA9A 2VHWA 4CCWA 4W5OA 2AH5A 2I3AA 2Q5CA 2XBUA 4JHXA 2AXNA 2H08A 2RGNC 3LYUA 4R01A 5E1OA 3RYHB 2C95A 4ALIA 2ZS7A 3AB8A 4PV7A 1WDTA 2ETVA 4CLXA 1E5DA 1JU9A 2P67A 1MIOA 1Y3HA 3VR3D 3PEUA 3WFZA 3A58B 1LWNA 4KO8A 2PN1A 2XYPA 2GBPA 2GTPA 3HVIA 3PQFA 1QCYA 2OXEA 1WZ2A 3ZHUA 3G88A 1Y8CA 2PLWA 1PT9A 3EDYA 2E6UX 2VUHB 5IKEA 4V0LA 4MW2A 1XE3A 1SVUA 5B7PA 3WJAA 2A9KA 2X3UA 3FJ1A 5HCNA 1A27A 3CF4G 2XDYA 5BQ5A 4UUQA 3V4RA 3I52A 3BG5A 2X6QA 3N8GA 4S1OA 3ZR4B 2VN8A 2J30A 1G7TA 2VYNA 4KLCA 3BZWA 3T3IA 1AUOA 2FPRA 2NZUG 5CG2A 3Q1KA 3FTNA 3ORFA 5JNVA 3GIWA 2AFHA 5EJ5A 3C8DA 4JLSA 4UVGA 5EHXA 4PC1A 5LD2B 4H7PA 1N2CE 4HC4A 5ESXA 5AVYA 3CW9A 1N32B 1ZN8A 3KQTA 4ERXA 3SQNA 3THYA 4ANFA 2XRFA 1BVRA 3LT5A 2RKWA 2IKQA 1M7BA 1DKQA 1B8VA 3CLUD 3GJXC 1Z07A 1YZLA 5HZMA 5CX1B 1TQ4A 5DI3A 4B3JA 4D8XA 3FCUB 5JJBA 1U31A 5KTNA 4D99A 2BKEA 1B8UA 3H1EA 3S6JA 2DR2A 3RC2A 4E1VA 1ZLYA 4HX2A 1ZUWA 3WLIA 4G0VA 1N7JA 1C0KA 1OFVA 2R751 1ZX1A 3FIJA 5KNBA 2HMSA 2AA3A 5KYXB 1VP3A 2AXPA 2WG1A 2BLNA 3ZY4A 5CGZA 4RQAA 3JQGA 5DI9A 3ZHBA 3VC3A 5JEDA 4JP8A 3IELA 1G3QA 4K9PA 4HLDA 3F7MA 4ES6A 1JJVA 1RSZA 3H83A 4RETA 4Y9SA 3SC6A 4BLVA 3IJEB 5EJ6A 1MO6A 3HV2A 1N0IA 1NHGA 3F9RA 4XUCA 1X1RA 3R8XA 1YNSA 2AI3A 3BMCB 1D6NA 3CZRA 2A2ZA 1P60A 4GI2A 4EI9A 4QA9A 3ZDYB 1N1DA 3OE5A 4NARA 5CIYA 3KQOA 4AY2A 2ZE7A 2GPYA 5DYYA 5HILA 2QVLA 4PTZA 4BNXA 1Q91A 1F5SA 2PYDA 4LNAA 1Y3FE 4I7EA 4CKCA 4LBYA 5F76A 3QLTA 2H5EA 2VHQA 3WYEA 3HJAA 2VBGA 3TQTA 3EJWA 2WVAA 4MPPA 2ZI3A 4NYIQ 4IJQA 5L95A 2GGSA 3HN2A 5DCUA 4YWHA 3ZTWA 4I1SA 1NBMA 1YH3A 2C82A 2X2FA 1U04A 3WZLA 4YJGB 1KSGA 4F8YA 4OK3A 3TINA 1MXFA 4CG2A 2Q3BA 3P9XA 5DVZA 4D8YA 2JI6A 1CB0A 1EZ1A 3B3AA 1NAHA 1XR3A 2IYLD 2XMBA 4NMLA 3ZX4A 2FMTA 4R1LA 4OFXA 2WJ3A 3D6TB 1OIXA 1OASA 2JRLA 3B3GA 1ST2A 3REGA 3TX6A 5GM1A 2PKYX 1R6VA 5F64A 3A1UA 4WUTA 5FWAA 1IC6A 2O3SA 2X7HA 5DM2A 2BSQA 5IEBA 4DDKA 3BUSA 4YCCA 3OUTA 4JI5B 3HJHA 1ZK3A 4KYIB 3EULA 3FTDA 1J0AA 4BQOA 4Y1RB 5F5XA 4RDCA 4Z7NB 4DMLA 3VDXA 2QU7A 4X24A 2C2MA 2X4IA 3RC7A 4LV8B 4GE0A 3FAZA 3OTOB 1G42A 1XMOB 2DWUA 3AGPA 3FGPA 2JHCA 4HTFB 4KODA 4KXYA 5ARBA 4WTOA 4Z4GA 3TIVA 4DEVA 1K6XA 4HMQA 3IEMA 3UMVA 2ZVQX 1QFSA 1TK2A 4QPZA 5C32A 3EGXB 3Q6MA 4K6HA 2NU7A 2QIPA 1T43A 3E48A 4QPJC 1ZQ1A 1Q21A 4WUVA 2O8BA 1W5AA 1N1MA 2C5EA 2YN0A 1NDHA 3ET5A 1PS9A 3O8NA 3DMDA 2M6RA 4TLDA 5KDDA 2NXWA 2NSLA 3PX2A 4EY4A 2AJDA 1Z4NA 2BM0A 1J1IA 3V1NA 4LS3A 1H66A 4UZEA 3PWZA 3GBVA 2VF5X 3INYA 2DWCA 4KLNA 5BVHB 2PXXA 4NBVA 3RU2A 3HMKA 3C85A 3QUCA 3DONA 1REQB 3NDRA 4R16A 1YHNA 3HCFA 4NBWA 2G8NA 4EKGA 1N78A 2ACKA 3C8ZA 1Z4PX 4E2FA 5KPJA 4MQUA 1EFTA 5JCZA 2DPHA 3ETHA 5KYUA 4EDHA 4GX5A 4KRFA 1D8TA 3HJTA 4BEVA 1VGQA 4FI3C 4Z0NA 1FZTA 2WSYB 2PIAA 2C88A 3P97A 4QUEA 2PWPA 2PSJA 4FDTA 4YAWA 1F38A 3VDMA 3ABSB 4AQ7A 4CV2A 1S3SA 4H3KB 4A8JB 1U81A 4QRIA 1PFQA 3F98A 4JC5A 5EXDA 4A4DA 3GRVA 4NXNB 1M2OA 1LRJA 1RKUA 2XCLA 4WY5A 3RVOA 1AHHA 1PJCA 2NVBA 5H9VA 5EWJB 1RLIA 5JWOA 1T9ZA 1H2YA 1IHOA 1WCIB 2ZUDA 4RHYA 1RAGA 1SBYA 4R3UC 5D8DA 1WMDA 1HFEL 1MCZA 2YNMC 4XM1A 2VJNA 3TW4A 3GI1A 4DMRA 3VMFA 1Q3TA 2H4YA 3HN6A 1XQXA 1IEVA 3EZYA 3A2MA 1Y6FA 5JJLA 1A88A 5BWOA 4N3BA 5ER6A 3U0BA 1Y3CE 3M6FA 1CR0A 2XQKA 3BJRA 1FQJA 4IXMA 3M5DA 4L0MA 5H3HA 3RSLA 3OCUA 3D7RA 2ZB7A 3PQ3A 4N7JA 4CN8A 1DAGA 3S1AB 1D4AA 5FEMA 4NYJR 1ZJZA 3N8NA 4MRAA 4QOSA 4CMJA 4YMWA 3RRMA 5IFLA 2R5FA 4HKTA 2NZWA 2ZRCA 4UHJA 1RHUA 4MW1A 1M0EA 1P7ZA 2GBLC 4HPWA 4LWZA 4QO8A 4R1OA 1THTA 2Q5QA 1VLMA 3QPCA 3RTDA 3V8PA 1G3MA 1GO2A 1CY1A 2BONA 5I7VA 2FRDA 4ZOLA 4ZDWA 4D57A 1WP4A 1DEKA 2NV6A 5IT0A 5I51A 3ZZ0A 3AO0B 2J7KA 4C3ZA 2X86A 3IA7A 4FFPA 4F4HA 4CEJB 4IIJB 2ZLBA 2W2VA 4Q4JB 3SR0A 4UBLA 4EATA 3QBJA 1SCUA 3LQ4A 3VYVA 1ZIYA 3FGZA 4ASUD 3M6LA 1UXKA 4BQIA 4IDCA 5JYDA 2H63A 2RI1A 4O2AF 3WNZA 4C1NA 1EK1A 5EUCA 4EFNA 4XJTA 3I01M 4LF4B 3P19A 5KYXA 1P5JA 2B4AA 2V3WA 4W1RA 1I4TD 2PRZA 3NNDA 5ADUS 1SXJB 1XA3A 3LQ1A 1GPMA 3D6FA 1OV4A 5JS8A 5LYJB 3NOXA 4CIBA 1EBFA 4B74A 1NBEA 1PGQA 3PUHA 1RC8A 3O84A 5L3SA 4L5AA 5E0OA 3Q8KA 5DI3B 2A59A 1TJ5A 1JQJC 4H6VA 3RAEC 3HPQA 3LUPA 3LHKA 3E8MA 4DA8A 2PS0A 1ETUA 3WHPA 3T9CA 2FPLA 2PT5A 4ZYLA 1SD2A 2GK6A 3C16C 4YRTA 1LZLA 3C3EA 3URKA 3ZU5A 3C6KA 4Z1MA 2ACWA 3M6AA 4OQPA 4BOYA 5L7WA 2P9FA 2C42A 1FJHA 2GEKA 4Z3KA 3HEBA 5T6BA 4DLWA 2YINC 4NPCA 4O63O 3OQOA 4XDGA 3Q40A 1V9SA 3E9DA 4HL6A 3CLSC 1SKBA 5IDVA 3PXUA 5FBRB 4U39A 4AKHA 1QH8A 3DNPA 1YBMA 5B12A 2WJYA 1YQGA 1VG8A 4GI7A 1K0UA 2V0NA 1FFXB 1JDSA 3GUVA 4O4IF 5C8DA 3SQXA 1MW8X 4NATA 4R0VA 1W4ZA 3QTTA 2PZFA 3N58A 1Z4JA 2ZSKA 4JUCA 4RPCA 5FFFA 3TSWA 2N42A 2YXBA 2UZIR 3FKJA 1P7CA 2R48A 3AY6A 3N59A 4FKBA 1PNRA 4B47A 1UXJA 3N2KB 4HAXA 5E3IA 5JC1A 4CL0A 4IOLA 4Y1GA 5EUBA 3E4CA 2OENG 1W5FA 1Z0UA 2EJCA 1FRVA 1P2FA 2HZ7A 5DTEA 1VHDA 2AOTB 1PO7A 2FQYA 3OZTA 3WLLA 4DMCA 1SCKA 2Y0CA 4KOAA 3JZAA 3KAQA 5DEIA 1JA1A 1QANA 2D54A 4M7OA 3WKBA 5HBGA 2JLYA 1IVSA 2OK8A 2WJVA 4XDZA 2P0YA 3G1UA 1E4EA 1RLJA 1VLLA 2HWKA 4OHVA 1PEKE 4EHLA 5KJCA 4C20A 4LJ6A 2Q49A 3CG4A 3GHYA 4KBGA 4AWBA 2D1RA 3AI3A 4L8YA 3JATB 3VU9A 4AX4A 1OTXA 3KXKA 2K2QB 4HN4B 2Q2QA 3FHCB 4KGZA 1F0PA 4G0ZA 4DQDA 3IO3A 2Q1WA 4BBAA 2IDJA 2VHZA 1PEYA 2NO7A 4ESOA 5FA5A 4C5AA 4F85A 5T67A 3IDAA 3IR7A 1F2DA 3F3SA 1HYBA 3RT9A 5A4DA 4ZGGA 2XEXA 3MCTA 4CE6A 4URXR 2UYHA 3LIPA 5AJZA 2WD7B 2ZYGA 5TRTA 4A7PA 5KZMB 2XB9A 1F8UA 4YFVA 1NPDA 2X5XA 4DHEA 1NOIA 5EHQA 3QE2A 1UODA 3UT6A 4PZPA 3R7LA 4YPOA 1Z18A 2O7VA 3MWLA 2PSEA 2PZJA 1UJ5A 1ZEJA 2FU5C 2HLNA 2HU7A 2QM0A 2VDOB 4YUVA 3ZCPA 3E35A 4D0RA 2D5LA 2AS0A 2NOAA 2OV2A 5AUNB 4ZTUB 4ZO7A 1GQSA 3AQ4A 5CYFA 1H69A 2MINB 2Y71A 1IK4A 2D1FA 1DEOA 2AOTA 1T2NA 3E2MA 1Z0DA 3PD0A 3P9SA 4L5IA 3NO4A 3BIWA 4UAGA 1NXOA 1YZHA 5HUJA 2R7MA 4L27A 2FFJA 1E2BA 1W0JD 2YIMA 3U5TA 3RF7A 3R3HA 1KJYA 5AKIA 5LQUA 3BWCA 3E81A 3C97A 5IDXA 1L4GA 1HETA 1L7XA 5KVQA 2VYCA 1E9BA 2ONCA 4E5MA 3JQQA 2R4QA 4ZANA 4FFWA 3EIUA 5KCMA 4JLOA 3RTAA 3F49S 2WKPA 4Y2JA 3ZD9A 5J59A 1XHLA 1YIOA 2CMKA 2PRJA 5EJIA 1QYVA 1UBRS 2WB2A 3QPVA 4EJSA 2GZDA 4LHVA 2YXPX 4MVCA 3HP7A 2M98A 3S2FA 3IESA 4RHXA 3KLPX 3GCWA 4LBZA 3QNMA 1EHCA 4FYYA 4IX9A 1LW7A 4JP5A 4M9QA 2OHVA 4Q93A 2WM8A 3KTAB 4ZK2A 1M34A 1KQNA 4WKCA 4HNGA 1XNHA 3EMKA 3HBJA 1E7MA 2A4MA 2XDAA 2AFVA 2OCKA 4QIHA 4FXPA 4ECEA 3ZVNA 1LNZA 4TKVB 2TMDA 4AZWA 5EJEA 3WGQA 3H42B 1GNRA 3AC0A 3CGWA 4XWOA 1GYPA 4HB4A 1AO0A 4DWWA 4D9HA 2RHOA 5IF9A 4DMHA 1O6FA 1J0XO 1GU7A 1ZK2A 1TT7A 2PD6A 3COPA 3OG9A 4HUQA 2R44A 4KC0A 4ZAZA 5LXTA 4LQLA 1DJLA 4RSHA 2UZ1A 4YECA 5C1IA 1SFRA 3L7YA 2HD4A 3AVOA 4BMOB 4IX1A 2PEYA 3RYIA 3ZGYA 2WHPB 5FPHA 3TAUA 2GNAA 2W6CX 1U4SA 2PGIA 1SC6A 4BZZA 4UUBA 3IAXA 5D3MA 2EEZA 4X7MA 4YH1A 1MRZA 4KGDA 2ZE6A 4HAYA 3ZIUA 1PR5A 4MWTA 3GA0A 4QASA 1A72A 3CNLA 4RGBA 3KYBA 4BFWA 2JA1A 4M89A 1BCRA 4I0WB 4K2HA 1MD9A 3LWDA 4N8DA 1VL1A 2R6HA 1FJGB 3V1YA 1SC9A 4GS5A 3FWZA 2JZOA 1TFRA 1QV9A 2J6IA 2RHHA 2J9RA 2PX5A 4TWRA 4KGVA 2GLUA 3ET4A 3HU1A 2ZUTA 4R84A 4D42A 3VR0A 2PQ0A 2F48A 1T9KA 4YR7A 2YWDA 3WFIA 4OHRA 1MJFA 3D4NA 4QQFA 3FI9A 5ERGB 5ABPA 5MF6A 3IILA 2GLTA 1YSCA 3RS9A 1EFKA 3HUUA 4LOKA 1CQIA 1YL6A 2UYGA 2XLCA 3D5QA 4G0QA 4GECA 4OAQA 1YGPA 4R41A 5EMMA 3WLSA 3N2ZB 2WSLA 2PUGA 4FR5A 1EI9A 1V4NA 2D06A 3FNRA 3ODGA 1F0NA 2F2TA 3AONB 4TQUS 1EGAA 4FI3F 3DO5A 3HSKA 3SBEA 2QTVA 4ZAVA 3P9RA 4GPEA 4HG2A 1YZ3A 3EJ6A 4F2WA 3NCHA 1GPDG 4PHHA 2R6FA 4FDAA 4RMJA 3J7TA 3C6ZA 3F9IA 2WICA 4N3GA 1JDNA 1QGZA 1CQJB 3NHKA 5EGNA 3RFXA 4RZQA 3KKPA 1WG8A 1R3DA 1GQOA 1I7NA 3P9KA 4D0NA 1LC0A 1XCBA 4YLGA 4PX9A 4BKPA 4D6PA 1PR1A 1O8BA 3MBIA 3TMAA 2IEDA 4P32A 4BJ6A 1XU7A 2O05A 5CTJA 1UKAA 4UZFA 1JEYA 3FLEA 3GEHA 2QY6A 2R66A 5LQMA 2EKZA 1RWOA 3GOHA 1PNOA 1R4ZA 2FJUA 1N4AA 2CT8A 2C7OA 4LF5B 4TTIA 3FMPB 4E0BA 4R0NA 3NJ8A 4MA0A 4OHZA 1G8YA 3UAVA 3VHQA 1WVMA 3DW1X 2H54A 2P0AA 2AXQA 3QA9A 3NJ4A 4XOIA 3ZOZA 2V6BA 1VB5A 2PXCA 4OH7A 4F11A 5DH9A 3FGOA 1N5KA 2EW2A 3OZRA 4FKZA 4KRGA 3ZHQA 5FJJA 1YI0A 4C0QC 4CM7A 4Q1EA 2IX9A 2AG0A 4HS9A 3K8YA 5I9TA 4DUGA 2EVWX 1JI3A 2YOFA 1L4MA 2PX3A 3BD9A 1GN9A 2WWIA 4FMDF 5U1PA 4ABYA 3SHQA 4ACAA 1KU6A 2ZRQA 1N8NA 4FS3A 4GGPA 2VJOA 2JNWA 1ST3A 2UUPA 2WIFA 4UXJA 4P7GA 1ZM2A 4M9RA 4EGSA 5KTSA 3NW9A 1JHDA 1V4VA 2X9NA 1OD6A 2BGKA 1HE1C 2WA2A 3L6CA 3LY9A 3L7CA 5HFAA 1N77A 1QF7A 5JH7A 2MSLA 2Y1CA 4ZCSA 3UATA 4Z54A 3NUGA 3KZNA 3O8QB 1TK9A 1KVRA 2PKCA 2PX2A 3G8BA 2XNDD 1IJKA 2GNOA 2RI6A 3HEAA 3QVOA 4G0NA 5AK0A 1CR1A 2J4CA 1N5OX 2XEDA 3RVMA 5LYJF 1ZSNA 3DSRA 5AJWA 4HRYA 1O6CA 1WXFA 2HEGA 3RUCA 4R8MA 4OBWA 4RFVA 5CYPA 3V2IA 2YRFA 3B5JA 4H1UA 5KVCA 3JRNA 3E3LA 3CEMA 2PRSA 3PC3A 1Q1GA 3U40A 4PFJA 3HWSA 4M8IA 4QUHA 1EGVB 3PDIB 4WJKB 2D2FA 2OO7A 4NJEB 5DCWA 3T0GA 2HJ9A 2KM1A 3GFVA 1P2VA 1XQ9A 3L77A 3PWTA 2Z5GA 1RCFA 1T25A 4KIJA 2QN6A 5C8ZA 1JDBC 3GRYA 4BNTA 4FGWA 2J9ZB 2ZG6A 1WBDA 2RCYA 2ZAYA 2I34A 4WJLA 5BWMA 1SZPA 3W9SA 2XQJA 3WDLA 1KIAA 1UJCA 2OT3B 3I04M 3KJZA 3MRXA 1XTRA 4KIUA 3M0EA 4ZT2A 4OLBA 2RD2A 4Z2YA 1RKBA 4HTAA 1EX1A 4PZ0A 4F72A 1PP4A 2Q62A 1JSZA 1YO6A 4UE2A 4O4IB 1NR5A 3QFCA 3DHYA 3QX9A 1G0NA 2OHIA 3HWWA 2IUTA 2LE0A 2GTHA 3LZCA 1X1CA 1FNNA 4OM8A 1F2UA 1PGOA 3AKCA 3OLYA 5EVCA 4CCYB 4B43A 3CF2A 4RFSB 1X7YB 3H6KA 1H2FA 2XZTA 3O0DA 4QOHA 2G82A 2FZCA 3GLHB 3V7WA 1C8BA 4BNGA 4V1CI 1SKUA 4QJBA 5BQPA 1E1QD 1TPZA 3PHIA 4MRNA 3THRA 3Q8MA 1Q0ZA 1WQ1R 1IPFA 4TYMA 5CT5A 5I9NA 1UZLA 1WQ3A 3U6KA 2OHHA 5CA1B 4W8GA 4PQYA 5JNSA 4PGGA 5M3BA 4TRNA 1BVUA 2Q0QA 1D04A 2PWBA 1YZYA 3ANNA 2YR0A 3C5WP 3ICWA 1QOPB 2F59A 4YIKA 5AO9A 1NQXA 1Q16A 1UKBA 2IDZA 1AT1A 3GY0A 2X0IA 3RABA 3BTVA 3U17A 4PIPA 4KXQA 2QMHA 5TIIA 1Z12A 2FSVC 1EP1B 1HSZA 3TLGB 3A28A 4CF4A 4WBNA 1NZFA 4O1IA 1TZBA 2HHAA 1X2BA 4Y9RA 1EBBA 4BMZA 4HLUA 2LR0A 3R8CA 4AVYA 3RT7A 1M0SA 1DFIA 1VCOA 2OXCA 2V3VA 3KQPA 4Z86A 5T3YA 3T6KA 3TRHA 4EPRA 5AFSA 2HDOA 1H5QA 4FBGA 2EYQA 5LP6F 1CZRA 5CX1A 1SURA 3OQPA 1MRSA 1QC5A 4YDSA 1TFUA 3UPUA 2H51A 1U6KA 3MS4A 1GUFA 3T7JA 3EIWA 4DOMA 1M1XB 1E0JA 3N0RA 5FTKA 3HKCA 3EZNA 4S1NA 1NAIA 2O7RA 4A5OA 2O57A 3TI7A 1SU4A 1CQPA 1CS4C 5ALVA 4MUNA 3VZQA 1SULA 4FHGA 4EA6A 3ZZNA 4INZA 3UWSA 2CHQA 3JQFA 1LNSA 1YU9A 4S05A 1WDWB 4Q3KA 1HQCA 5KNCD 5A0TA 1POXA 4PQRA 3ODPA 1DQZA 3TLJA 1YFLA 5A0FA 3H11A 2C3YA 3CNOA 2ZIXB 4R5MA 4P7KA 4F6CA 2ORYA 5B4TA 5CT8A 5KNDD 2R8YA 3PZRA 4FB5A 3IPAA 5BQ3A 1G20E 5JALA 3ADBA 2CFRA 3BXEA 4M60A 1S9HA 2CUZA 2B98A 2GUGA 3EE6A 4QOFA 4E30A 4XYLA 5MHTA 1LK7A 2JFPA 1W0CA 3S28A 3CWCA 5L40A 3M2TA 1MB3A 3HYSA 2CJXA 4Q39A 3RSOA 1UBCA 2E4YA 4DDVA 2R85A 4G56A 3J80A 3NHFA 1H8EA 1T9HA 2CFSA 3F90A 2YV5A 4FOSA 3VVBA 1NMYA 1BJKA 2WJPA 2YUTA 2E48A 1M72A 1N2HA 3MSCA 1J97A 4Y6GB 4B48A 4QGGA 1ABBA 1M1YA 2R86A 2PUFA 1CFZA 3D6JA 2V7WA 3JQ8B 3K2IA 4OQ4A 4EGJA 3H7IA 2H1OA 1I4OA 3GLVA 3EODA 3CR3C 5KMGA 3I6ZA 3F3YA 1X8XA 3KYDB 4IIGA 1E1LA 1YDFA 4N82A 1KO7A 5HK9A 3C7TA 4LGVA 4NENB 1EXWA 2K7ZA 1AH2A 3Q8XB 4O29A 7ABPA 4CV1A 4PLYA 3WS7A 1BEEA 2XHZA 1XDUA 3CA8A 4RJLA 2H31A 2EWVA 2R8PA 4IOJA 2YMQA 1I80A 3M70A 4WGFA 1E6MA 4JBYA 2GJ9A 1HORA 2YVUA 3BIOA 1V11A 2ZJ6A 3NV9A 2WM2A 1J20A 4F5YA 1Q0LA 4DYHA 5JNWA 1TM5E 3GPCA 2IU4A 2KS6A 1DO2A 1MC4A 1SCAA 2XUAA 3VSEA 4PS1A 5GADl 1Y9AA 4TUYF 3VPGA 3QYAA 3SWWA 4B85A 1KS9A 1XAJA 2JHAA 1YT5A 3DDUA 3HCOA 4RS4A 4A73A 4DMMA 1UWLA 1UZMA 5HF8A 2PUWA 3FKSD 3EH2A 3OX1A 1O94D 3FWPA 4MPDA 4FGJA 5EN4A 2ACEA 4QKQA 1KP3A 5L45A 4YYZA 3ZJTA 1XI2A 3TO5A 5F33A 4RD2A 4HAVA 3OF5A 4HX9A 3EQ7A 1EEHA 1UDWA 3BB3A 3GZNB 4ZC8A 5BNTA 1RWPA 3CX8A 1JECA 3CX6A 3DV2A 5A9TA 1ZW6A 2J45A 3RJZA 3UWKA 3DV9A 3EIEA 5EIWA 4Q12A 5FWXA 4EPVA 5ALKA 2WT9A 3F6SA 1NYQA 4YRMA 1XTQA 3D8HA 4X64B 4JR1A 3I01A 3O8RA 3LM8A 2CHVA 3DZJA 2VP9A 4ZVKA 1T1RA 2GO7A 1YCHA 3RVBA 3D4PA 1QIDA 2IXAA 1K7SN 1UCFA 4RZIA 5JO0A 3IDFA 5KOJB 2IODA 1DAMA 4M0CA 5D86A 4UVEA 4RHEA 2VZEA 3MOGA 5J3JA 2J5QA 121PA 1KMQA 4D92A 1A9TA 4DEXA 4WNYA 3UOGA 2IOFK 2VHCA 3RO7A 3ZWNA 3PE4A 1TTHA 2R00C 3OPMA 3UGQA 5BUSA 1SCDA 3LUCA 4JB0A 1E3QA 3UTCA 3W6PA 4BNYA 3SU8A 1JFVA 2H1RA 5J1SB 1QVWA 2VA8A 1ZMBA 1GA6A 2H4FA 4NBUA 4P4UA 2A5YB 4Y8VA 4F2GA 1PHRA 1GVHA 3BM5A 2JLUA 2YXDA 2SKCA 3IIMA 2ZT5A 4WZBA 1RAIA 5LQDA 4KN6A 2QTGA 1RS0A 3RTEA 2QL9A 4PTYA 3SKVA 3HVRA 5A9RA 1UM8A 3RLFA 4J0EA 1WUYA 2HF8A 4UHKA 5ICSA 4GMGA 2F17A 1ISSA 1T3LA 4YI5A 5UKDA 4CDNA 2YWJA 4GKKB 3TF5A 4JEUA 2YHAA 3PZBA 3DE1X 2PSSA 3T0IA 3PD7A 4A5SA 1RQRA 3GMIA 3M4YA 1RTKA 3EIXA 1Q22A 5JSYA 3RIYA 5F3WB 1OQAA 2QW0X 4AMGA 4AF6A 1PBNA 3GG2A 4DA7A 5HUHA 1SQSA 3VR5D 5KBYA 1WAMA 2XE7A 4QUKA 4BVHA 1ZJ6A 1IOVA 4D8VA 3W6NA 3JWGA 4DADA 5IJAA 4RK5A 3RKUA 3RYHA 3ZPXA 4CU2A 3NIFB 4P0TA 3U1VA 4JL8A 4MB2A 1IM5A 3AUTA 1BJTA 1U2ZA 1T8UA 2Q5EA 2Q5FA 3GEBA 3NTQA 4OXYA 2EFDB 1JUDA 5J63A 4JEIA 3AIOA 4JLDA 4MB0A 3NT5A 2ZITA 1H3NA 3ESDA 3GFOA 2QD4A 5THQA 1XZIA 1KK0A 1UP4A 2RC5A 3GZ4A 3NHSA 3A7DA 4DJDC 4XZ3A 5FBKA 4H2DA 4Q4AA 1FUYB 3EZ6A 1ZI8A 2W8BA 1IZ9A 3GELA 2IC5A 4RVDA 4AJEA 4Z6KA 5BOSB 1BZYA 4K40A 4YT4A 4A8TA 5D85A 1QBGA 4Z7OB 4HUQB 4NMHA 1V45E 4J90A 3I45A 4ZKEA 2YZ2A 4IIJA 2JGLA 3LDUA 5JARA 1QX4A 4NXMB 1RZUA 2HQRA 4KCGA 3DP9A 3W5AA 1Z7EA 4MSUA 3WGYA 1IUKA 3KJFA 4IHJF 4WOPA 5H59A 3G7NA 1VFPA 1I7PA 5AOBA 1Q2XA 2AG5A 5BVGA 3O26A 1EINA 2J0UB 1QHXA 2Q29A 4GX0A 4H6PA 4I55F 1RWNA 1ZW1A 4BUCA 5ALOA 2L19A 4ZZIA 1QG4A 3HHPA 2OVFA 2RAPA 4UHEA 3UXEA 3HBLA 3FSRA 2QZSA 2WSMA 2YS7A 2W2OA 1X80A 4IJKA 5LQNA 3NGXA 2BW0A 4Q02A 4OUDA 3QKSA 4KJXA 4LCEA 2QX9A 2GXUA 3DMYA 5IXSA 2NU9B 3UW1A 3WVNA 4DB2A 1KI3A 2FKNA 4TVSA 1U6JA 3K70D 4FZ5A 3V9PA 4FFRA 2C1XA 2MT9A 4BO2A 3SBOA 1II9A 4YJHA 2COKA 2C2BA 1A69A 4HDCA 1CFJA 3RF6A 4AQDA 3B48A 1DJMA 3DZ8A 4P6VF 3ZIAA 3V4OA 1LLFA 1NL3A 1TD9A 3HFRA 3O91A 2M6KA 2VJMB 3UPDA 4JB2A 5A71A 4B71A 3UJPA 1SXJC 1VSUA 5KSYA 3KSAC 1I3CA 2G72A 1Z47A 2ZIGA 5AT1A 2OKGA 1CS0B 2H4ZA 2JRCA 4DLSA 2H5JA 1H6CA 3ZHTA 2RBEA 5EMJA 1S3FA 3PCXA 3NM4A 2HWYA 3RGGA 3ISJA 1NXWA 3R77A 2E87A 4G9EA 3TIGA 5AW4A 1O58A 1WXXA 1X94A 3AFGA 3LV8A 2RIPA 3HZHA 3CSSA 1BQ4A 2JD0A 1VJDA 2AFRA 4JC0A 1GRNA 1BXKA 1N5JA 1P2TA 4C5BA 4F0JA 2GK7A 4ALJA 4I2VA 1KDVA 4PLVA 4JVMA 4YROA 1IE3A 4G2TA 3EX7C 1UZUA 3BXHA 1ECCA 4B4UA 2Z6UA 1K89A 1NV8A 4OPMA 2IEAA 3W90A 1QORA 4KQ2A 3OPYI 4QDZA 2OCIA 3AHDA 4JL6A 1ZINA 4U6QA 3VHRA 4ER7A 2B8NA 3PI6A 1NMQA 2Y99A 4WOBA 5J2UF 5DKFA 2FCRA 5TEWA 4QYXA 5AW1A 4WFJA 2C7PA 3UFXA 1C3OA 1RM0A 3ZU2A 4F1JA 1CBUA 4OOFA 1CP3A 1SKAA 1T5IA 3IKLA 1XPJA 1L5NA 2WPDD 4U2FA 1Y7PA 1E4EB 4QECA 3JD3A 2Q3HA 3KQKA 2IW1A 1I0LA 3WYCA 1M6HA 3AIIA 5A9SB 3A9VA 1TAUA 5IW8A 5EIBC 1K5DA 1E77A 3BF8A 3I0ZA 2I2CA 3CZMA 4C4AA 1NG9A 2P2DA 2HMAA 3DQQA 3NWOA 2VUSA 2ZAIA 1PR6A 1Y1PA 2FZ4A 2A92A 3BERA 3MWFA 3ND7A 4TXLA 3RIHA 4E14A 3AJRA 1U4NA 2OZLB 5ALWA 1YVUA 4ARAA 5JNRA 3OFNA 4KUHA 4M9ZA 2XI4A 1C7FA 2I71A 4DCSA 1L4FA 4ITRC 1JKIA 1NM5C 2QT0A 4IH9A 1MENA 1PZHA 2B61A 3IUMA 3JY6A 4LKOA 1W30A 1V5IA 4AECA 3TLAA 4F5DA 2E3JA 1K68A 1ZZGA 3SICE 1Q57A 5ALMA 3I8XA 4MWSA 1DKNA 1NVTA 2IOYA 1NBIA 4M1QA 4LN1A 3GV0A 1ZD1A 2FW0A 1ISJA 4PNHA 4QGBA 4OHOA 3GLGA 1TMGE 3TCXB 3W8RA 2XR1A 3EB9A 1XMJA 2FPWA 3KYCA 2HSJA 2K87A 1AMUA 4JXXA 3D59A 2IYWA 1OYVA 2O2HA 3ECAA 3BREA 5AI4A 5B58T 4F1KA 3UJ9A 1OXMA 1YR9A 4PO9A 4ZAGA 1DQYA 1BWRA 2I5PO 2Z4TA 3A1FA 1K6IA 1C9NA 1WXIA 2IPNA 2J0QA 4JU8A 4MYTA 1I4DD 3AHEA 3W3AH 4UPEA 1JVBA 1QPGA 2WZBA 1AURA 1XAHA 3JQEA 3PYLA 1ZSYA 4IIUA 3VKVA 1A8PA 4FE3A 1AZWA 3K2EA 3J81k 2J07A 1V8FA 1H2XA 3NBZC 1R5NA 2EDCA 1W7AA 1NNEA 3RS0A 3ONVA 2GEBA 2QUHA 1AUVA 2CGEA 1R4MB 3UTDA 3DMHA 1T2CA 4AK9A 1SVIA 2C5GA 1GUAA 2M6SA 3TDNA 2GPJA 1UBLS 3ESYA 4KXXA 4YRIA 1XVLA 3MTGA 1FVXA 3GJ7A 1XJ5A 1M5TA 2OVBA 2ZBUA 1F2TA 3L49A 1O3YA 4Q4HA 5LLSA 3R7SA 4ARVA 4EB3A 3PQ5A 2CNNA 2NM0A 2GCOB 3NR2A 4RZSA 3N5CA 1ODKA 3T3GA 1A4IA 1LPAB 3CN7A 5CVDA 1OI4A 2GCGA 2IUSA 2JF0A 2XE4A 1DO0A 2GD1O 4G0UA 2QTCA 3D2CA 1B42A 4HAWA 4BV8A 4BX9A 3ZCVA 2OGZA 4HXFB 1C9DB 1M83A 2K6GA 2DSTA 1Z29A 2WZCA 3GL9A 3ZYZA 3BFJA 1Z88A 2A0FA 2JASA 1KR2A 4OKIA 3E27A 5ER9A 2WDZA 3FFTA 4U5XA 3SJ7A 5I4BA 4W5QA 5JDCA 2J3HA 4Q15A 3OKAA 4XGRA 4EA9A 1RI5A 5M34A 1HNWB 4PXSA 3KC2A 4L4YA 2CL0X 3CVYA 5FQNA 3ZV7A 4R83A 1RYFA 3SQMA 1I3MA 4DT1B 1IVYA 4RKQA 4KVFA 2BI4A 4B7CA 1B2LA 4TTAA 4OA8A 4WESB 5FA6A 3RRNA 3ELWA 2CLHB 1WSDA 2WYOA 1A1VA 5DWDA 5LOVF 4Q1BA 4EMTA 4DE5A 3JWPA 1FXSA 3F7OA 4MZDA 1RABA 2ZYUX 1BVHA 4DJJA 1RXUA 1T5SA