4E11A

Crystal structure of kynurenine formamidase from drosophila melanogaster
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
300
Chain Sequence
HMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHSAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kynurenine formamidase
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 300
sequence length 300
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e11A00
4ROTA 4B9AA 3H04A 1CUJA 1EB9A 4XIIA 3WKBA 4KEAA 2D0DA 2BUBA 4V2IA 1DQYA 3M81A 1O6GA 3L1IA 4OSEA 2V96A 2WTNA 5AHXA 2WHPA 5AK5A 5K5EA 2CJPA 2XMGA 3FCXA 3SC2A 2OAEA 4KE7A 2EEPA 1QOZA 2D5LA 3M82A 4EA6A 5A7GA 4X95A 3WL8A 4O08A 5F4ZA 4JUIA 2WG0A 1XRPA 2BAGA 1GXSA 3QPDA 4BE9A 3PF8A 4S0XA 4H7IA 4WFIA 1XQXA 3HLKA 2DR0A 4JYMA 4MJ3A 2RONA 4FDMA 4H7JA 4RNCA 3H0CA 4W1PA 2WTMA 4FLFA 5C8XA 4B0PA 1Y7HA 3V1KA 3BJRA 3A6ZA 4FTWA 5FPQA 2AJ8A 4J0JA 2XMDA 4P92A 1JJFA 3EF3A 3Q8WA 2PPLA 4LHEA 3M3DA 3FYUB 1MPXA 2XUJA 4Y7DA 5AKEA 2ZYHA 4G8BA 3KXPA 4GI1A 1HLGA 2G5PA 5CH5A 4H77A 4WY5A 1SCKA 3D0KA 3C6YA 5HCUA 5I8PA 3AZOA 2Z8ZA 2OXEA 3O9MA 2OCGA 3IB3A 5LLSA 3AZQA 2WJ3A 1H2XA 1EX9A 4GEGA 5FRDA 5HK9A 1L7AA 5CRIA 5ALHA 1BEZA 3V1MA 1UK9A 4XWGA 1X2EA 3WL5A 3NUZA 3DS8A 1P0QA 1VA5A 5JAPA 2QZPA 3CN9A 3E3AA 1DINA 3NWOA 5A6VA 2OGSA 3STVA 3DOIA 4OU5A 2HM7A 5ALXA 4DTCA 4AO8A 1SFRA 4N8SA 3HSSA 4GW3A 2QXTA 2HDWA 4YK7A 2G4LA 2ZJ6A 3ILSA 3KD2A 2OGTA 4P9NA 5CH3A 5AKHA 1EK1A 4KJXA 3FYUA 3G9XA 4IH1A 1CUWA 3LCRA 2OGZA 2Y6UA 3F97A 5ALOA 3WL6A 3DCNA 4PSDA 4CIBA 4LYDA 1QFSA 4GBGA 1DTEA 1K5PA 2DQYA 2PVSA 5ALWA 2BGNA 1Q0ZA 4DYHA 4BDTA 2XE4A 2C0PA 3B5EA 2QS9A 3OM8A 1ORVA 1QTIA 1O6FA 1QIIA 1UKCA 2FUKA 1AUOA 1K4YA 3GBSA 2AJLI 2HIHA 3G7NA 4BC0A 4QDXA 1QTRA 4Q3OA 4H7FA 4HXFB 2CB9A 2OCKA 1LPNA 4ZXFA 1CUFA 1YB7A 1JFRA 1GKLA 5DNUA 1KU0A 1DT5A 4P08A 4MYDA 1YR2A 4JNCA 5AM4A 4KYVA 2Y1KA 2Y6VA 3GFFA 1H22A 5AKGA 4J0IA 3I2KA 1W52X 5KWJA 3D2AA 3F96A 5JD5A 3OURA 1CUIA 5ALRA 1IMJA 4MEAA 3STUA 1ZD3A 3IUJA 2FJPA 4PO3X 2VJBA 3LIPA 3WWOA 4NVRA 3OG9A 1CUDA 3KDAA 3IA2A 5JASA 4KR0A 2DSNA 4Y2RA 5E2IA 4FLEA 3V1LA 4EHBA 3HJUA 5AI4A 1EK2A 2PSEA 2WJ4A 2BJHA 4BC1A 2BGRA 3GROA 1L7RA 5EIAA 1LPSA 5YASA 1N1MA 4FBLA 2XUDA 3O4JA 4BCDA 3PUIA 3WK6A 4WCVA 2Y2VA 1ODCA 2HFKA 5JZBA 3WK7A 2FX5A 4M0FA 4CIAA 3E4DA 3LP5A 4C4YA 1CUEA 4OB6A 1EXWA 3D4LA 1W1IA 4QWWA 2YH2A 4PSCA 3WYNA 3OOSA 5ALJA 4Z49A 1ODSA 3MVEA 4FLMA 4OCZA 2PX6A 1BCSA 4FHZA 3R40A 4Y2YA 3RLIA 1SCIA 5EI5A 2DHEA 1F8UA 5HF6A 3WA6A 3T4UA 4B7ZA 1XRQA 4FBMA 4C01A 2J4FA 1GQSA 2AJDA 4DIUA 1IUOA 1CUHA 1DT3A 5I7UA 3QITA 3SX4A 5JAHA 2WHRA 4DNQA 4N5IX 2XUIA 4ZRDA 1XQVA 2XQKA 2Z3WA 2CUTA 5T4EA 5LIPA 1T4MA 4G4IA 1CV2A 5HFAA 1FFDA 5SYMA 1WPXA 3B12A 4QDZA 4G5XA 2WUFA 1DWPA 2JGLA 5ALGA 2QJWA 5ALLA 1XFDA 1LZKA 3HI4A 2C0QA 4KAJA 1VOTA 2OPHA 3Q0TA 1WOMA 4FFWA 3STTA 1E8NA 5LZ8A 1JMYA 4HRYA 3QMWA 2X76A 2XMBA 2ECFA 2WFMA 4NS4A 1VE6A 5CMLA 4A16A 2B61A 3TRDA 2H7YA 2ZYRA 4OYYA 1QONA 5J3JA 1CRLA 1Q84A 3N2ZB 4W1RA 1GKKA 3QMVA 3KOOA 4X7BA 3TJMA 2XUHA 1EVQA 4W63A 4BVLA 3E0XA 3QM1A 3K6KA 2O7VA 1ZI9A 1RP1A 1CQWA 1F0NA 5LZ9A 2Z8XA 3GELA 4AZ3A 2DHCA 2WU3A 2DFPA 2WLSA 1XKLA 3G0GA 5T4BA 1ZICA 3W06A 2ACEA 2WFZA 3K9BA 3OTQA 2O7RA 4HXEB 5LP1A 1XZHA 2QR5A 1EI9A 4K5QA 3OPMA 1J06A 5I9IA 4CCWA 3A70A 1XRNA 5JATA 5BOVA 1MNAA 4GLBA 4G9GA 5AKKA 2XI4A 5LKRA 1YASA 5IVIA 1CLEA 3R41A 4LYEA 2HHAA 3DKKA 4QWMA 2XUQA 5FPPA 2VF2A 4XX1A 1F6WA 1H23A 5KREA 2ZVDA 4GDMA 3X3HA 2VAVA 3DD5A 1Y7IA 1E8MA 1LBSA 4X6YA 5AIAA 2ORYA 1XZIA 3JWEA 3FYTA 2HRRA 2ZSHA 4OUKX 1K6EA 4G4GA 1P0MA 3WMRA 5FV4A 2IIVA 3FLBA 3WK5A 2C58A 2H7CA 3ED1A 4U2GA 4IHAA 5CXUA 3S8YA 3HRHA 5AM5A 5CT5A 3C8DA 1XRLA 1ZD2P 4AN1A 3PFCA 4W9RA 3BF8A 2XMCA 4OU4A 4Q05A 5AOBA 3G0DA 5IVKA 3QPCA 1R50A 3C6BA 2WUEA 5EHXA 3WKEA 5AM0A 4AO6A 3MUOA 4C4XA 1A8UA 4K6KA 6YASA 4UHFA 4KE9A 5AKYA 1XQWA 4KE8A 1XZFA 4B82A 1G5FA 2JGEA 4Q34A 4K6GA 3SWWA 3EQ8A 4HVTA 1VXRA 2O2HA 5FDFA 5DLPA 2GBIA 5EIEA 3FBWA 1LGYA 4X97A 4U2EA 4UFPA 3FYUC 2QTBA 1OXMA 1R3DA 1FFAA 5FLKA 1CEXA 1SC9A 3H2IA 1DX6A 5CT8A 2VEOA 1MO2A 3ZPXA 4BE4A 2I3ZA 1L7QA 3VJMA 2DCMA 4BZWA 5IVDA 1YA4A 1AC5A 4IH4A 5E4TA 5JARA 1QIKA 3IUNA 3O95A 2RIPA 5JANA 5AI8A 4UBIA 2ZYSA 4ZI5A 2XQGA 3WWEA 3M83A 4ARAA 3ICWA 2QOEA 3O4GA 3OC0A 2PSDA 2XUFA 2HA2A 3RK4A 4EY6A 4UBMA 1WHSA 2XB6A 4BAGA 3BF7A 3HEAA 3FWHA 3ANTA 3VISA 4YX9A 1W6RA 4GHWA 4BZZA 4UBNA 4W1QA 2XUPA 1Q0RA 1QIEA 4TPKA 1MAHA 2XUGA 3PI6A 1GQRA 1EA5A 2OG1A 4DSZA 3C6ZA 3VDXA 1YA8A 4TGLA 3FVRA 1MAAA 3HXKA 4LXIA 3PUHA 1ZIYA 2ACKA 2BKLA 4X6UA 5AKLA 4ITVA 1XZLA 2PUJA 2Z5GA 1QIHA 4J7AA 4KE6A 1X70A 5K3BA 4KACA 4U2CA 3DKRA 5CTAA 5SYNA 4X85A 4X3CA 1QGED 4UBLA 5EHZA 3IULA 3C5WP 2GYUA 2V97A 3DEAA 1VLQA 2IITA 3H2HA 4K2AA 2CBGA 1EDBA 4AX4A 3U0VA 5CXXA 3UMJA 2VATA 1LLFA 1YCDA 3R3WA 4X90A 2ZYIA 4OPMA 3DYVA 2BCEA 4QLAA 5BWBA 5D3ZA 2VSQA 3WZMA 2C5FA 4JYPA 3CN7A 3STXA 5FUMA 5E4YA 1ZIXA 3JW8A 5AKZA 3EIOA 3DDUA 1CIJA 3C6XA 7YASA 2JGIA 1CUSA 2FJ0A 5AO9A 2PKYX 3I1YA 1JI3A 3O9VA 2V9ZA 1CPYA 2VQ6A 3MGAA 2RI6A 4ZV9A 4INZA 4C87A 3V9AA 4EZIA 1MJ5A 4RE5A 5AIBA 4HAIA 4HXGA 2EDAA 2XLCA 1XZJA 2I03A 4Y2UA 4RPCA 1ISPA 2O2GA 3AFIA 4OB8A 3WK4A 4E11A 2WUDA 5CH8A 5KWIA 1GZ7A 4AQDA 4LKOA 4QDOA 5ALEA 4F60A 3P2MA 4H7EA 4Q3LA 3STWA 3WJ2A 2ROQA 3BDIA 1UWCA 3W04A 5K3DA 4DSAA 2WIJA 3FLEA 3FSGA 2XMRA 1EINA 1QIMA 4L3WA 4KAFA 4QA9A 3W2TA 4BVKA 2G5TA 3I2FA 3H2KA 3VVLA 4N8DA 4U2BA 3G02A 1BN7A 3NGMA 5CT4A 1LPBB 1MX9A 2R11A 3WK8A 1CUVA 1JMKC 5AK6A 4EBBA 4DGQA 3HZOA 4FNGA 2QRUA 1C7IA 1K63A 4CG3A 5HQ3B 3GZJA 2HADA 3ESCA 3B3QA 2QXUA 3F9CA 4CFSA 1XRRA 4WDQA 4XJVA 1JJBA 5ESRA 4OYLA 2XQJA 1TKRA 1ZD5A 5KBYA 3FVTA 4L9AA 2JEZA 3UUEA 3W05A 4B9EA 2RHWA 4BDSA 4YASA 4J0CA 1CUGA 5AKJA 2YASA 1IZ7A 2PBLA 4FMPA 4EY8A 2PU7A 5A71A 1FFBA 2WIKA 1VA4A 4MQLA 3UUFA 5D3KA 4Y9SA 2UZ0A 5CT9A 2E3JA 5AM2A 3F8SA 4OD0A 3WJ1A 1LPPA 3STYA 2WG2A 2I78A 2NW6A 1ZGBA 4U2DA 1E3QA 2IX9A 5JD6A 2R8BA 5AI6A 2ONCA 5DNVA 2WHQA 3WI7A 2GBGA 2QMQA 3EQ9A 5A7FA 3RM3A 1ZGCA 1EH5A 3FCYA 3H1BA 4JEIA 5ALIA 4Y2QA 3HABA 3QH4A 5EHNA 1MX5A 2WSLA 4MWTA 5AI9A 4B83A 4BCBA 1ZJ5A 4G1FA 1AGYA 5HQ3A 2AXEA 2XQIA 3H17A 4Y2SA 2GZRA 4BTLA 5JAUA 4WDRA 4UHEA 3WKAA 4UHHA 2QKYA 4CCYA 4X91A 4H18A 5K3EA 4EY4A 1BE0A 3I6MA 1WB4A 1CUYA 1CQZA 1OCEA 1XROA 5K3AA 5AM3A 2CKMA 4TVKA 4UBKA 3I1IA 5HKBA 2VTVA 1CUZA 2WM2A 2OAGA 1QE3A 4G8DA 4I19A 1XZEA 1BN6A 1A7UA 4MWSA 4A23A 2HA3A 2VA9A 3DL4A 1BEEA 1HDEA 2JGJA 4WFKA 5C7YA 1WB6A 3C45A 2Z3ZA 4BATA 4EY7A 5HF8A 4MQMA 4DLNA 4LXGA 3IUQA 4H7DA 2QUAA 5HKAA 5CW2A 1E89A 4C89A 5HF9A 4M0EA 3ZV7A 1CUAA 1WM1A 4FKBA 5DYWA 2XLBA 3V48A 2GZSA 5AK4A 1G42A 3R3VA 3H2JA 4MXDA 3D7RA 4B6GA 2HRQA 2BUAA 5D7BA 5AH0A 4MYSA 2RAUA 4E14A 4BRZA 5AOCA 4J03A 5BWCA 5JYCA 3BE8A 1T2NA 4PQEA 2RGUA 5C8ZA 4IQ4A 5A62A 2EDCA 1THTA 3LLCA 1QJ4A 3QBJA 4F5ZA 4C6HA 4Q1VA 5AJHA 1SCQA 3CCBA 3CXUA 1XQYA 2ZJ7A 4Q82A 4AMZA 2OCLA 1LPOA 2WKWA 3MUNA 1H2YA 4G9EA 5DNWA 5DTJA 1UKBA 4B80A 2QT9A 3QVMA 3RARA 3VJLA 4I4CA 4ZV7A 5CURA 1XZAA 3H19A 3DQZA 1TCCA 1JU3A 5C81A 5ISMA 3S2ZA 3IBTA 4DMHA 1NU6A 1Y37A 3D59A 5DYTA 4Y2VA 1A88A 4GXNA 1UK6A 3BXPA 4D9JA 3AUKA 4BBZA 1EDDA 5EHQA 3WZLA 1NX9A 2XUOA 1QZ3A 3DLTA 5IH7A 3VJKA 2YXPX 3C43A 5D6OA 1XLWA 1UT6A 2HU5A 1B6GA 2AJCA 1U8EA 1KU6A 1MX1A 2B20A 2XUAA 3I2GA 2WIGA 3BL8A 5ALTA 2JF0A 3AJAA 1BROA 4QDTA 4UHDA 1I6WA 1XLVA 3BJMA 3O4IA 4BB0A 1YS1X 4I3FA 1EB8A 1YB6A 2HA6A 4LIPD 3PDCA 1MNQA 3LS2A 4C4ZA 3BWXA 3ZLVA 3F98A 4U2FA 5LZ4A 3I28A 2OQIA 3FOBA 3L1JA 3G0CA 1QFMA 3IVMA 3WK9A 2HL6A 1CVLA 1U65A 3R0VA 2GYVA 2OCIA 3KWJA 3G0IA 4N5HX 5AOAA 1VKHA 4F21A 5E4JA 3U1TA 1EVEA 4H7KA 3A2LA 4PV7A 1HBJA 4EY5A 3PICA 2HA4A 5IKXA 1QIFA 3BDVA 2PU5A 5ALKA 1UOPA 4ZREA 3HYSA 2X5XA 4X93A 1OILA 3WWCA 3G9TA 4BP8A 3ZLUA 4BP9A 5T4FA 3R3YA 1R9NA 5HK8A 1DQZA 5JAOA 4QEKA 3W9BA 1EHYA 1P0PA 1F0PA 4B84A 3DYIA 1E66A 1THGA 1P0IA 1MU0A 1Z68A 2JEYA 4B85A 4B0OA 1AMNA 3H18A 1HL7A 4L0CA 1LPAB 4K6HA 1CUCA 1QIJA 4WY8A 4H0CA 1UFOA 2K2QB 5CT6A 3AIKA 1C4XA 4C88A 2BUCA 3C70A 2HU8A 2WFLA 2JIDA 1XRMA 2PL5A 1GPKA 3WIBA 3R3XA 5JZSA 2HU7A 4ARBA 1J2EA 1IUPA 3ZLTA 4BYMA 1JU4A 5FOQA 3ESDA 5DWDA 1ZI8A 4QE3A 5AP9A 4QNNA 3SK0A 4FNMA 2V98A 4KRYA 3WKCA 2XUKA 4Y2TA 5JIBA 1KEZA 4N8EA 4BVJA 3O4HA 4Y2JA 3D2CA 4UBOA 1H2WA 3DL7A 3PFBA 1FFEA 1AZWA 5FXMA 5AKIA 1JJIA 3QPAA 1X2BA 2ZJFA 3H1AA 3WWPA 1B41A 1BS9A 2LIPA 3I6ZA 1JKMA 2VT7A 2GYWA 4FWBA 1VE7A 4Y2PA 5LKAA 4H7HA 4QLOA 5AICA 4W1SA 5K3CA 2WIFA 2VT6A 1DWOA 2XT0A 5HF5A 4GECA 3ANSA 2AJBA 2B4KA 1MT3A 1ZOIA 4QZVA 1U2EA 2QUBA 3H2GA 2XDWA 3PF9A 4Y2XA 4X92A 5H3HA 2VJAA 2GBFA 3G9ZA 5AK3A 3I2IA 2HFJA 5HFNA 4DMCA 1TIBA 4BTVA 2J4CA 1RYYA 1PJAA 4YPVA 3A2NA 1WB5A 4Q3KA 2ES4A 4WFJA 1M33A 4ETWA 1QO9A 4UFNA 4BAUA 3IDAA 3IUMA 5JD4A 2H1IA 3D3NA 1C7JA 4PNZA 1RWQA 4AMYA 2G63A 2H7XA 3BIWA 5DTIA 1XZKA 4MEBA 5FP0A 2JGKA 3EQ7A 1UZAA 2VJCA 5ALVA 2WIDA 1YAJA 1NU8A 1UK7A 2ZSIA 4CI9A 3CCCA 4AN0A 1UOQA 4UUQA 4AXBA 4KAAA 1R4ZA 5AI0A 4AZ0A 1BRTA 5ALFA 1E8DA 4DM7A 1WCYA 2HA7A 1A8SA 4E46A 1YAHA 4DNPA 1XZMA 4UBJA 1QIGA 1FJ2A 4X71A 1QLWA 2C4HA 2QM0A 1FFCA 3TEJA 2RHTA 3I2JA 3T52A 4G8CA 3R3ZA 3JYHA 4X6XA 3WYDA 1E5TA 3ZI7A 3EBLA 1GPNA 3AIOA 4J0DA 3VKFA 4NMWA 4CCYB 1SOMA 2I3DA 5CBKA 5IVHA 2J3QA 1W4LA 1CUUA 4ZWNA 1R88A 1IVYA 4PSUA 1G4HA 2WQZA 1YS2X 3ICVA 1LBTA 5AKXA 1AURA 5HZGA 1WHTA 4DNFA 1QO7A 2W6CX 3C8HA 1XZDA 3PE6A 4EUSA 3HACA 3YASA 5AI5A 1PFQA 3I2HA 4ZGBA 4HZGA 1VJ5A 1TK3A 5ALPA 3WKDA 3LIIA 4A5SA 5LZ7A 2C5GA 3WL7A 1UK8A 4RE6A 1VXOA 2XMQA 1R1DA 2WG1A 1UKAA 4HS9A 1XZGA 2JBWA 4AO7A 4JH0A 4IH9A 2H9YA 3WLAA 4QDUA 3WQHA 4H35A 3GA7A 1DX4A 5K3FB 5ALUA 2WJ6A 3N0TA 1N5RA 4M0MA 1JT2A 4EB0A 2BFNA 3QZUA 4E15A 4UHCA 1HPLA 5EFZA 3AIMA 4XVCA 1UXOA 2YYSA 2VAXA 5FKJA 1TQHA 3C5VA 2B9VA 1XZBA 4BRSA 5ALQA 1H2ZA 1VZ2A 3DOHA 1GPLA 1D07A 4J3JA 3HC7A 1ZD4A 3AILA 4CG1A 1FSSA 1LPMA 1XKTA 5JZ9A 3F67A 1GGVA 5A2GA 2DQZA 3A2MA 3VXKA 1S8OA 3BIXA 3ESAA 1J07A 1TCAA 1R9MA 1BU8A 1ACJA 2XQFA 3E1GA 4PF1A 3FAKA 3ZWQA 1CUBA 3IIIA 1UOOA 2HA5A 4FOLA 5LZ2A 2PSHA 1VZ3A 5ALDA 4J0HA 4F0JA 1J1IA 4HTAA 1W75A 2P8SA 1U4NA 5EGNA 5T4HA 3TGLA 5AM1A 1IZ8A 3NOXA 1TAHA 3WA7A 1G66A 3ESBA 1N8SA 2GBCA 1USWA 1MTZA 1EDEA 3DJYA 2PSJA 3KWFA 5K3FA 2QVBA 2CZQA 5BV7A 2PSFA 1AX9A 1IUNA 4RGYA 3DNMA 2OQVA 3W9UA 3G9UA 4P93A 1PV1A 4J0KA 1TRHA 3AINA 4BCCA 1LZLA 1N5MA 2WU4A 4GWLA 5DYYA 1AKNA 2Q0XA 2JGMA 5JADA 3WIOA 3K2IA 2CEKA 3IURA 4HRXA 3G0BA 3L1HA 2WILA 4UHBA 4PW0A 5ALYA 4WJLA 2C7BA 3G8YA 5ALMA 5LZ5A 4CG2A 3VVMA 2O2IA 1XLUA 3QMMA 4DNOA 5EIHA 2WHPB 4L72A 4IO0A 5DJ5A 2PM8A 4FFVA 1CUXA 4OB7A 4BAZA 3D5EA 4NZZA 2XMSA 3C87A 1ACLA 4KRXA 4B81A 3D2BA 5ALNA 3AZPA 4G4JA 3RKSA 4X94A 5JALA 1Q83A 4DMFA 3FLAA 4UFOA 5C8VA 1MN6A 3O0DA 1A8QA 3GUUA 1ZJ4A 1HQDA 2W22A 2XMZA 2VJDA 1AQLA 4J0GA 1BCRA 4DMKA 3WWDA 1LNSA 5ALSA 1HKHA 2HA0A 2QJRA 4UPDA 1K8QA 1ODTC 2Y2UA 3FSGD 4AB1A 3V1NA 2WFLB 2PUHA 2JGFA 2DHDA 4LXHA 3KSRA 1QIDA 2CMFA 1YSCA 3I6YA 2J3DA 5LYYA 2OLEA 1CR6A 3FNBA 1ORWA 5A7HA 1WPRA 1DU4A 1ZI6A 1TCBA 1DWQA 2WUGA 1ETHA 2X8BA 3R3UA 1CFJA 1GT6A 1W76A 4X00A 3QYJA 1XZCA 5ALZA
chains in the Genus database with same CATH superfamily
4ROTA 3EVTA 5L53A 3H04A 4HMOA 1CUJA 2QTAA 3ZWBA 3M4YA 5CA1B 1DBVO 1T9GS 4I3HA 3CUTA 5K1ZA 3TUZC 1A9QA 4ETMA 3OJCA 4Q93A 1T5TA 4A91A 1MC8A 1OGYA 5J2TB 1PYDA 1UJ6A 1DKMA 4F3KA 3QWIA 1AGNA 1K8XB 3EIHA 2QL5A 2WTNA 3GUCA 4QHSA 5LQDA 3TH5A 4BNUA 1P5JA 2JLVA 1EUCA 5GJVC 4N12A 5CIWA 1V4NA 1JQLB 5IUKC 1MXFA 3DZKA 5KTSA 4OX9Y 3PE3A 2ERXA 2KQUA 5DSZA 4KOAA 1XA4A 2IE0A 4A1OA 1Q0PA 4U4AA 2WF7A 2Z6VA 3NHBA 4AMBA 3UXMA 3AF2A 3RNLA 3QOWA 4KE7A 1R74A 2SHKA 3PDJA 2D5LA 5EZYA 3M82A 3T7IA 3TIVA 1COZA 1U7TA 1F12A 3KOXA 5H3LA 2FU5C 3O84A 4ZAXA 1P2TA 4RHTA 4UNIA 2HXYA 2WQ6A 1BFKA 1YMVA 4TVBA 2JFUA 3PRHA 5JQGF 2YINC 1HT0A 3UB2A 1LUAA 2VUTA 1Y4UA 2Q1TA 3SQDA 4JUBA 3CVUA 1XRPA 3AUXA 5FTKA 3QPDA 1TL7C 4A6DA 1DAPA 3UT0A 5C53B 4JJ8A 4XD7D 3PF8A 3QOFA 1WMFA 5B7QA 4S0XA 1UP4A 1XX6A 1JQ3A 1J0XO 2PT7A 4Q3BA 1XQXA 3UEOA 4MJ3A 2RONA 3WXBA 5KJ1A 3FCUB 1BDHA 2VRBA 1RLUA 4WACA 4BTEA 4R71A 4LDRA 5FPSA 4RK1A 1WQ3A 3O31A 4LJ8A 1TFUA 2WAAA 1G8AA 5B64A 5EINA 2OOKA 2WOOA 4RMIA 3S44A 3G9QA 1ZNXA 2QGFA 4DXHA 1V4VA 1VIYA 1R8SA 1Q7BA 3MLEA 4GVPA 4R16A 4ZC8A 4FLFA 4JI6B 3ZQKA 3QYAA 3N7TA 4QXQA 3I64A 4LOJA 2X40A 4DMUB 2YXBA 4B0PA 3NDJA 4LX8A 5SYAA 3ZR4B 3ZX4A 5EEHA 2EZ9A 3KEOA 2PBFA 2KYRA 2AYXA 4QO8A 2BMFA 3R7WB 4BJ3A 3FPAA 2VPPA 1DRKA 3RS7A 3UMRA 3V1KA 3UMCA 3WQBA 4BB6A 5JPCA 4MLZA 4YYEA 5KX5A 1IN5A 4G97A 1QHHB 2GSDA 3INRA 5CM2Z 3REOA 2PL9A 1LSJA 4ARVA 2A9PA 4RJIA 3TKAA 4IJQA 2ILVA 1ZM9A 4HX9A 4B87A 2BFFA 4GICA 1O94C 2X42A 2I76A 2ZTSA 1FDVA 1NN1A 1SU6A 4DIBA 4FCVA 3M3DA 3RBZA 1MPXA 2OORA 2RCNA 4EFLA 2IQIA 5CIQA 2GLXA 4KXNA 4R8KA 4Y7DA 1EMDA 1FMTA 1SVIA 3L0DA 3JQ8A 3NNSA 4E22A 3VZRA 4EJSC 2XYRA 4ZCSA 16PKA 5JNVA 2HI0A 1SH7A 2RG1A 4RFSA 2BWJA 5IF9A 1OFHA 1IPHA 3ZJUA 4F3CA 1WCWA 1QRTA 3BULA 4RU1A 3WJAA 1IBKB 4OHWA 4WKPA 2ATEA 5HA5A 4Y6LA 1MFZA 1XE3A 1XN1A 5F12A 3CKKA 4WY5A 1O77A 1SCKA 3TQOA 2ZAIA 3GJZA 3W79A 4FCCA 1AO0A 2BZ0A 4CTKA 1XNJA 4OMCA 5B4VA 1CT9A 1HE5A 3K5HA 3QOYA 3O9MA 5BPFA 3EUEA 3P9KA 3AZQA 3W5AA 2L18A 4EKGA 1E5QA 1NLFA 4UASA 2IZ1A 3MXTA 5CA0F 4ZJUA 4RVFA 4G56A 4R5HA 2ZRJA 2DE0X 2QAGA 3CF6R 2C5SA 4D8TA 5FRDA 5FO1A 2YOGA 3U40A 1L7AA 4IGEA 4XLTA 5ALHA 4WD3A 1RDFA 4WKNA 3C1TA 4F4UA 4IGIA 1UK9A 3GJ8A 5EKDA 3MJ4A 2AK3A 3S5JA 4B40A 3OCCA 2BE9A 3WL5A 4DYVA 3ZXXA 4OIFA 1W2GA 3S40A 2XODA 3NASA 4TTVA 4G09A 4ZQEA 4L9SA 1TF2A 1S8FA 2AXNA 1VA5A 3E82A 4P35A 4J1QA 2YS6A 5SY6A 3ZZNA 5JAPA 3UCEA 4E21A 3RHFA 3E5NA 3KQUA 1GQYA 1KMQA 1SZDA 1PLJA 3FWNA 3NWOA 4TKVB 3V5NA 1M8GA 1XMVA 2VSXA 3WLIA 5AVOA 1K4MA 1NGSA 2WTEA 4EEXA 5HQJA 3ZDEA 3AHJA 4Y6PA 1WAMA 5I7VA 1Q12A 3D3EA 1VMIA 1KFKB 1PHRA 2P4SA 3NM4A 1M2WA 4JAVC 5FBHA 3V34A 4PLWA 3UHAA 4I1OA 1T5DX 1RQXA 4YI5A 1PEDA 3PQCA 3S2EA 3FPHA 4N8SA 3HSSA 2ZROA 3N28A 4GW3A 2GXQA 2O2YA 2OHOA 1FQKA 3CQ9A 5IKPA 5K20A 1JQBA 5TPWA 5BRAA 5JZOA 3ER9A 3TFWA 2FGKA 4D4KA 4D98A 3G68A 3OMLA 1M7GA 5AQ1A 3G89A 3PFIA 3FNQA 2L0XA 4JJIA 3SMQA 2PNJA 3P9NA 1E2NA 1Z4NA 1JPUA 1QHEA 5EJ9A 3UK7A 4OLHA 1HMYA 4PX3A 3OZWA 3BMQA 2HIGA 4RY8A 2XYHA 4TLAA 3DBHB 4LOHA 1V37A 5HMMA 1QQBA 1YBVA 3A27A 1HX7A 1TTTA 3RRJA 2MYUA 1DCFA 1JTEA 3U6BA 2ERYA 1EK1A 3FYUA 1GQQA 1DKLA 4BMYA 4EHAA 3AM5A 3KT6A 1OB2A 3AVXA 2O8BA 1O5IA 4PBSA 3KKZA 1HY3A 1G8HA 1RLJA 4LXYA 2GZ3A 4MWEA 5AXDA 3ABOB 2OGZA 5ECGC 3SC4A 3EFOA 3KV3O 3LX4A 1Z3IX 2W4QA 4PCAA 3GT0A 3CG0A 3IELA 5A3VA 4CKEA 3IBYA 4RIFA 4Z1OA 2NQ2C 2R2GA 3RS0A 5BT8A 3B85A 5AW5A 1ZHOA 4IYJA 2PKCA 3PNQA 3JS5A 1ZGAA 3TTTA 1QG6A 1VCIA 1ZIPA 4P84A 1MXHA 4RHEA 4NPCA 3QEAZ 3MD9A 1NUSA 5K6TA 3VOBA 1NLMA 2ZB3A 1ZUD1 5ESWA 3U49A 1DBWA 3D6VA 1DKQA 1T0HB 4S1WA 5IAKA 3MTDA 2ZRFA 3OZAA 4KGXA 4ZC1A 5HFJA 3T94A 1N1DA 4FP9A 1LVGA 4RDCA 1DJPA 2AH5A 2WWXA 3B5EA 4PE5B 5K3SA 3WDKA 4IUYA 4E1BA 1VTKA 3C8ZA 1SJ9A 3LBNA 3CR3C 3NDRA 4JBHA 4IIGA 4LVOA 5LA6B 1S4QA 3W9SA 4XR4A 3K9NA 1GQFA 3PNKA 4LQDA 1FNNA 3W1WA 3B20A 5KTTA 2VWPA 1ZCFA 3Q5DA 4O4IF 4PHCA 2C8KA 3AU9A 3NOVA 4DBZA 5CDSA 3PD0A 1GZUA 3IEXA 2QNRA 3PJDA 4A1FA 1TAUA 4M76B 5DM60 3FPCA 1TU4A 2C97A 4Q3OA 5DE3A 4KFSA 1VDZA 4BQIA 1KI1A 1X3SA 4NMXB 1LX6A 3UMBA 1TVEA 2CB9A 1Q1EA 4YUXA 1KK1A 1LPNA 2VP9A 1CUFA 4ZXFA 3RUIA 4Q3EA 2HCFA 4RSGA 3S8MA 5FFNA 5E0OA 4PPGA 1ODJA 4DREA 3LT4A 4L5AA 1ZEJA 4FYYA 3ST7A 1M5UA 3VKWA 2FZGA 4LTDA 3K0CA 2QTFA 4IUBS 1LRLA 1M2HA 5IXSA 3IIEA 4PAGA 1Z83A 3SVTA 1LSSA 3ZW8A 1YVRA 2IYEA 3CMCO 2JCSA 2A5DA 1HZJA 2JFXA 1ZUHA 1NSYA 2PBRA 1YR2A 1ULBA 3DOJA 3FI0A 2FSUA 2V0CA 1VLZA 4MYDA 2X0FA 4F2PA 2QE6A 4ARCA 2FDRA 1HTBA 2Y1KA 2VIIA 3K09A 1H22A 1MO6A 1WXWA 1N36B 3I5XA 3IOYA 3GN1A 1GSOA 1Z2NX 4YIHA 1GG9A 1WDKA 3LLSA 1HDIA 1ZMTA 5E4FA 5EWMA 1XCOA 1WXFA 2ECKA 3NZEA 4QIHA 5CK4A 4NOKA 2DR3A 1RSZA 1DLJA 1GGKA 2LGJA 4MEAA 3STUA 2GHTA 2QT1A 4U2KA 4ACAA 5GJBA 2ON6A 1ZD3A 3L18A 3DULA 2FJPA 3GGDA 3SIXA 4PO3X 3LIPA 1L5HB 5J2UB 3UZUA 1PJTA 3FSRA 3JYNA 3KVYA 1T25A 5ETJA 4RM3A 4KUEA 4TMXA 4OKSA 3TTYA 1T29A 2I6TA 5A4AA 5ED4A 4P81A 2BFEB 4RXMA 4CFYA 1BX0A 2C59A 1E2MA 1JSXA 1Q14A 3G6KA 3KDAA 3OUZA 4KR0A 4QDKA 4RK4A 1ZSNA 5J23A 1Z0KA 3M6IA 2AYZA 5G4KB 3V1LA 4DA9A 3AB7A 3HJUA 3NHKA 4FHGA 2RK6A 5AI4A 2YQ5A 1UBFA 3A4IA 3EXEA 3O3OB 3R6DA 3T5DA 5BORA 4ABYA 5T8KC 2WSMA 2BGRA 3WGQA 1SCUB 3GROA 2HJRA 3I32A 4QFMA 5KINB 3MOSA 3ZBQA 3KOYA 1XTJA 4BRWA 3FWKA 1KNQA 1ATIA 3OT1A 3UPUA 5CHEA 3TMKA 2EF0A 4GPTA 4OQDA 2XB2A 1CNMA 2ZT7A 3NEPX 1UJBA 2ZE7A 4P4UA 3HZZA 1EPUA 4YQYA 5C0OE 1E94E 4FYXA 4C4YA 4KITB 5A4KA 1Q21A 3GFPA 3K70C 1PZNA 3I8SA 4DMGA 2L2QA 3QJGA 3ASZA 4OMDA 4K1LA 4PCLA 4WLEA 4CWAA 4YCNA 2I5PO 2FN3A 3OCJA 2BGTA 1G0OA 1FDUA 1HEUA 1KSFX 2EIXA 4R69A 3D4LA 4OHVA 4A27A 3NT4A 1ZBQA 4H9GA 1FX1A 1KZYC 1RM3A 2W58A 2WTAA 3JU3A 1W1IA 3LQ4A 3SEZA 4TQAA 3VM6A 5JQGA 2QYSA 3OAAA 2IHZA 1X3LA 3JD3A 3PX2A 4NAHA 1JB1A 4NZOA 3LHSA 1TJNA 2YH2A 3IE2A 3L7AA 4G63A 5JVDA 2OL4A 4EVRA 2HUPA 2FPIB 1T8UA 5DEIA 1T6NA 1NZDA 1VECA 2QG6A 5B7NA 5ES4B 1COWA 3THYA 4LF5B 3GDHA 4N76A 5FA6A 2X8JB 5F77A 4F3NA 1JVNA 4KCGA 2AOUB 1U8FO 1RKQA 1F4VA 4YP9A 1BMDA 4FLMA 1KPGA 3DR3A 1BCSA 4G5SA 4O4JF 4FHZA 1KOLA 3ZGLA 3AI2A 2IC5A 3H4IA 1SCIA 3FTQA 1SEVA 4G5GA 4PAWA 1A9YA 1F38A 5HJ2A 3QTLA 3DE0X 4F46A 3LBAA 2ZAOA 2C2KA 2ZK7A 5IKMA 5A5VA 4AMUA 1JIKA 3U4QA 3OHPA 2C4VA 3G17A 5FT9A 4QBFA 4QYIA 2NLOA 3G5TA 4G1UC 3DVAB 4UMEA 1W88B 1WXQA 3DV2A 1R0YA 4CYMA 4FBMA 4D3FA 3NHFA 1GQSA 2OBLA 3PD1A 4I7EA 2FX2A 2JDID 3VGJA 3TOCA 2NXNA 1FXWA 3QITA 4GG1A 4RXTA 4CBVA 4HVCA 4D0SA 5KYXB 4X1IA 1U3DA 3FKSD 1TT5B 4IDGA 4MVYA 1G6KA 1RT9A 4RTOA 1XMJA 4I5GA 1J99A 2RHGB 3NGLA 2C1XA 2O23A 4FD3A 5TGDA 3EF0A 3QI2A 4HFJA 3K4QA 2D7DA 2QBYB 2C03A 4I14A 4CV2A 2QY9A 4OX9B 2XUIA 1V71A 4CTNA 2NSJA 2QRGA 5AQEA 1R4NB 3JASB 2XQKA 3F49S 2QL6A 1JB9A 5DLQC 3GRYA 2Z3WA 4CMBA 1FTNA 2RH4A 3RUCA 2YMLA 3X1KA 3VR1A 1KEEB 5DXFA 3OHMA 1C8LA 4AZVA 2ORED 2ENWA 4JEUA 4ZJZA 1V1RB 4DIFA 5J5CA 3KVVA 4RTMA 3KV1A 3TRJA 1WPXA 3GFOA 2DWUA 3KJHA 1P7VA 1U6IA 1XMOB 1XAIA 2WUFA 2GYYA 3R0JA 1U0BB 3QUCA 2P3SA 2IYVA 2JBAA 2JGLA 2VUIB 4KDRA 2C9ZA 3GVHA 1B42A 2CD9A 2RJOA 3EZGA 4JMPA 4QOGA 1M1XB 1MJGA 2L69A 5BWOA 4Q6BA 5JCOC 1E2BA 4PBTA 4UNRA 5KPJA 2C0QA 4O8CA 3AP1A 1F51E 1VOTA 4KAJA 2BFPA 4US1R 2OPHA 2G8LA 3UXEA 3B13B 4ZAZA 3W7BA 5HOQA 4RIEA 5B4UA 4HNQA 4OK6A 4RJ2A 4DUGA 3OJWA 2AC4A 2JFGA 2JLUA 3JQAB 3MWDA 4H27A 1PZXA 4XRGA 2GEJA 2H63A 5A6SB 5C46F 4LBZA 2C5LA 4G0MA 3STTA 1E8NA 1W4ZA 2C42A 2XSZD 4NR0A 5FIUA 3REFA 4KB5A 4BO4A 4EARA 4FM9A 4B45A 2WJWA 4P3YA 3WGTA 5SZJA 1O5OA 2X0IA 3PIRA 4KDCA 1CF4A 5DGIA 1KO7A 5I9SA 1WCXA 3QMWA 2X76A 1NLYA 3BSWA 4KK3A 2XMBA 3IA7A 1GTG1 2XA2A 2Q3JA 3KFXA 3R3SA 3TB6A 1CQXA 2NIPA 2W7TA 3OF2A 4V02A 2GD1O 4QT4A 2FPGB 4INPA 4IZIA 4OL9A 3QEOA 5TVKA 4QXPA 2M6LA 3RH0A 1X38A 4YRGA 2HMSA 3T99A 1KK2A 2IYWA 3TRDA 4R6WA 1L1QA 2ZYRA 1QONA 4OYYA 1SKYE 2Q4TA 4H08A 4TTRA 2CXUA 1PR4A 3GOQA 1GCAA 3HDVA 1V11A 1XTIA 2A3RA 2DSTA 2R6GA 2QG4A 3K32A 4LJYA 3CW2A 3SYKA 1U28A 4PHFA 2SCUA 1KERA 2HJWA 1CR4A 1Z16A 2Q99A 4N3BA 4PYRA 3C98A 2XUHA 2PEZA 3TJMA 4G25A 2J0EA 3QX7A 5BW6B 4KWIA 3GU3A 1F2TB 1ZGZA 4BVLA 4EUFA 3AR9A 3E0XA 1A7AA 1K1EA 2ZBFA 5BQXA 1EAMA 9GPBA 1NJ2A 5EUMA 2V59A 2LP4Y 1GLVA 3P9ZA 2ZJ8A 4OKIA 4R84A 4AZ3A 4FDUA 2VSNA 4N01A 3RI3A 2DHCA 4UREA 5BQ5A 4PQGA 2D7CA 1JQKA 3H6HA 4COKA 3FFBA 4X8LA 1XKLA 1P73A 3G0GA 1SMKA 3FNHA 3CURA 4CNQA 2WFZA 5AK0A 4CKZA 4JENA 4DLBA 4C7OB 5I3CA 3MJHA 4EG8A 2J31A 1QZTA 4TQUS 4C6TA 2B8WA 2R60A 2UUOA 4FGSA 3I58A 2ACWA 3AR7A 2ZU0C 1AKUA 1E2EA 3EG5A 3EODA 4YJFA 1QH8A 3G6WA 1U2DC 5I7HA 3JQ9C 2ZFUA 3IPYA 1PZGA 5TARA 1VIVA 5IH3A 5LFAA 4HVLA 2PXCA 3WP0A 3K9GA 1BQ4A 1MNAA 3DE2X 4M9SA 3NCTA 2BYTA 2I2XB 1E0AA 4JLUA 4UNQA 4PLGA 2Y77A 4JN6B 4CXMA 1HYHA 1NV8A 2IUTA 1BVYF 1SR8A 2HO5A 1TZJA 5CUQA 4G86A 4DVJA 4W5HA 8OHMA 3O3NB 3R0XA 2XVMA 1WVMA 2RGCA 3H7AA 4FYKA 5K0BA 1YGPA 1Q16A 3I6IA 2X9QA 3K31A 2N1MA 3OPYA 3ZUGA 4MTCA 1JZTA 4QWMA 2XUQA 5TPZD 1GZDA 3HEBA 5F51A 5K09A 2JJMA 3C3KA 1WUKS 2CVZA 2VNKA 2PUCA 3HJFA 2PY6A 4IQ8A 3F6RA 2ZVDA 4ZVMA 1JBKA 3W6OA 2ZUBA 3SC2B 1XNGA 3CX4A 4N3AA 3VX4A 1IY0A 4HDRB 4HFNA 1NF2A 2NU6A 1Y7IA 2PQ0A 5IT9A 4ZOQI 4EGSA 4M4SA 1DC8A 4QGBA 1L2TA 4F4FA 1O1YA 4JVOA 2WMYA 3JWEA 4JBIA 5KSYA 2CV2A 1P2DA 1QP8A 2B9EA 4PZCA 2ZSHA 4UM8B 2DUNA 2JD1A 3G8BA 3QUQA 2Y1LA 5HKLA 2HMAA 1M5TA 1PS8A 1U1IA 4OUKX 1EFHA 1MENA 1P0MA 4P58A 1J1UA 3BAFA 3QWFA 2ST1A 2ZSFA 2ZUDA 3GLQA 1KAEA 5THQA 2F8SA 4E07A 4H1VA 2C58A 3L2OB 1QP7A 2POCA 3OPQA 3PXDA 2QLLA 3A26A 1TMOA 3V1YA 4XVUA 2H7CA 3D3WB 5ENDA 5EYPB 1PCXA 1XRLA 1ZD2P 1QNLA 4HLNA 1JGTA 4LYYA 4W9RA 5INTA 5F76A 2V6IA 5EQFA 3P0FA 5AUQA 2BCGY 4W7HA 3T9AA 3COYA 1RYNA 4XJTA 2R8PA 5GQSA 3MIIA 2XXBA 5IVKA 5ADWA 1R50A 3RLFA 1L7EA 3H0KA 5LJIA 1IXSB 1YR1A 3Q7QA 2D13A 1WHSB 5JSFA 1JKIA 1QO0D 3KL2A 3NPMA 5DW0A 3UC9A 4CKWB 1RI3A 2AN1A 2Q9BA 2WHYA 2OXIA 4U5QA 3OSUA 4IXWA 4PLHA 1A8UA 1LDNA 3LT2A 1C81A 3AF5A 3HSKA 2P0AA 1BJKA 3BWMA 4K6KA 3PZBA 4KW7A 4JLPA 3U5ZB 3G2LA 3ZCSA 3D6UA 3TLXA 2CNDA 3W8RA 4JJZA 1UPCA 4UCWA 1TADA 1P45A 2HZBA 5H4HA 3S2GA 5CIYA 1S1MA 4B82A 3HNRA 1TLTA 1VKRA 1JKJB 3DWFA 5EE0A 5FUBA 4BEBA 2HCTA 4YJGA 3RANA 4Z8XA 1GQ2A 4GUDA 1EVYA 3TAHA 3JQDA 3LV8A 3UWDA 4Q34A 2HJSA 3VUFA 5B58T 4EW3A 1DS6A 1X0VA 4XASA 5HOEA 2K6GA 2CBZA 2QA5A 3NP7A 1JDSA 5K0SA 3G82C 1P75A 3RBVA 4E2WA 4EHKA 1BNCA 2Z2ZA 5JBNA 5KWSA 1VXRA 2XF2A 3EJ6A 3WQSB 2C7VA 5LQMA 2A0XA 5DLPA 1SEPA 2GBIA 4TL7A 3SMVA 5H70A 5EIEA 1PV4A 4XWOA 3QEJA 1J97A 2LVBA 1GZ6A 5BN5B 4XCVA 4OGKA 3ZU6A 1USUA 5EUCA 4TUYF 4HDNB 3PSHA 3OCYA 4RTKA 4F56A 1XKXA 1OXMA 2G67A 2I6SA 3TMYA 3N7UA 3UW3A 4K88A 3K9HA 5B1IA 3EXFB 1Y6ZA 1UKEA 4YMSA 2HJGA 3AI1A 5ESXA 5K0EA 4E1AA 3WYAA 4L15A 4EO4A 1DZ3A 1RHMA 4B6QA 2PKRA 4KNWA 1N6IA 3LL7A 4ENTA 1F7UA 1OXTA 1Q0LA 3A1EA 5KNBD 2I87A 4JJKA 2ZW9A 2VJOA 2W8ZA 2X4LA 4L85A 2CHGA 3QHPA 1W44A 3L8YA 4WKBA 4CW7A 1A71A 2VEOA 3LA8A 3LVFO 3HDHA 5JBQA 3CO5A 4TT3A 1SUDA 3DE4X 4QYWA 1UBHS 2B0JA 3TE6A 1L7QA 2XGGA 3HGTA 2BM0A 3EXHA 1DQPA 5DT9A 5BT9A 2C1EA 1E79D 3KR0A 1XTVA 4BV9A 4DG5A 4RL6A 1G6HA 2MT9A 1DAHA 1DUIA 2FMKA 4L2IA 2NPFA 4CUKA 4CQMB 1CRWG 1A4UA 1XWWA 4GGMX 1OTYA 2NQTA 3PGKA 3DXZA 4IDBA 3S55A 5BR8B 3F7MA 2IXFA 2PUFA 5IBCA 1QIKA 2J9FA 2BTOA 3IUNA 3O95A 3PBKA 4Q7LA 4IMPA 1JH8A 2BV3A 1NUUA 3KRTA 3VQTA 5IM4A 1IXYA 4UBIA 2FWRA 1FTWA 4DV4B 5IAGA 5EHGA 3RBAA 2ZYSA 4R01A 2ATVA 1T15A 1JQEA 4M7RA 3LP6A 4I0WB 4YRAA 4ARAA 4BFTA 4F9TA 1HL3A 3ICWA 5EMNA 3CXRA 2DFTA 1N2HA 2A1UB 2JS7A 2UZ1A 1RYBA 3ZLJA 3SICE 3CSSA 2LBPA 5JS7A 3N8KA 3JAKA 2I91A 5EVCA 1U0JA 4WXMA 1E4EA 3HWSA 3I9OA 3OE1A 4XB2A 3HV2A 1CVRA 1EK6A 1WCIA 3FMFA 4UBMA 4EAQA 3IJ5A 3UENA 1PQUA 1XD8A 3MGGA 4J4TA 4UPVA 4COOA 3RYCB 1TQ6A 1R4MB 1ZYUA 2B0CA 2ZRAA 3BE5A 3BM5A 3NANA 5EY5B 5A1TA 3QE4A 3VISA 4NFYA 3U80A 3ZE9A 5IWAB 5A4MS 2NUAB 2ZREA 1XVAA 1QKJA 2OC4A 3I0ZA 2HCBA 2PLWA 2QN3A 2E89A 4GPAA 2X9LA 3L6UA 1T8SA 3HQ4O 3QQPA 4RA9A 4WL0A 3MWLA 2CLLB 3W4KA 4DV5B 3KKOA 3OLVA 4UDYX 3MFQA 3SBEA 2XUPA 4ZALA 3QIAA 3PA8A 1EKXA 1PG0A 3NIFB 2BFBA 3H9BA 4O2AB 4TPKA 2J9XB 1HC7A 1ZK3A 2QGNA 2WOJA 2CXTA 5BXQC 3T5AA 4B2PA 3EEOA 5JNLA 2P4HX 1KNXA 1YJBA 3PI6A 3KUCA 2EXXA 2IZZA 3OU2A 5JDIA 4YP5A 1K2VN 3MAJA 4DSZA 3I0MA 1W5TA 3AGQA 2J67A 2P11A 1HURA 5DV9A 1PVOA 1HFJA 3AF6A 2OLJA 2F4VB 1ISFA 2R5NA 3VDXA 4CL8A 4GIBA 1QR2A 4MKHA 3VU9A 1BA2A 3CLUC 4DV3B 5DXJA 3OOYA 1IM5A 5EP1A 2Q7XA 5IPFA 1ZL0A 3GFGA 1E9RA 1SQ5A 1H42A 3LVQE 4G67A 4Z3DA 5AVQA 2LCFA 4BMDA 1GAEO 2O59A 3SOZA 1U02A 4RVCA 5IULC 4FIDA 5AKLA 3DE3X 3E18A 5GIOE 1MHTA 4BPBA 1XTRA 4L3VA 3Q3EA 1PW7A 2GZAA 3QE0A 1KFBB 3KZNA 3H5RA 3CR8A 1GIAA 6ABPA 1A04A 1W5BA 4V0RA 2C99A 2F1OA 3O75A 5AJUA 3IX7A 1FFWA 2RBEA 2VK8A 3VKUA 1YJAA 2OXTA 4IFTA 3R9KA 1XVLA 2DY0A 4IJ6A 2GXUA 2AUTA 4LY9A 4MUGA 2QXYA 3BIOA 4QYMA 4O8ZA 4AUEA 1JHAA 1MA3A 5LC1A 3UOWA 1GJRA 3MWYW 5H9WA 3JRNA 5G0WA 3L79A 4DPMA 1TMKA 3M7IA 3ELYA 5BSGA 3KHTA 2QW0X 1P3DA 4XGIA 3I04A 3IULA 1Z5OA 1B0AA 3ETNA 4NOLA 2EF1A 2ZR7A 1QVZA 2F48A 3GMTA 4RK7A 2ZTHA 5E2BA 4E5VA 2OZKA 2FPLA 3ZH9B 1TEHA 3SJZA 2VS1A 4YQEA 2EWVA 3NORA 3QU9A 2P40A 4HQFA 2CXOA 3JQGA 3JYPA 4UU1A 2I2WA 1MOPA 2H9AA 5EPUA 2F9LA 4QPJC 1NBAA 3TUIC 2CZCA 2JJQA 2JRLA 3CZ4A 4I8XA 4Y1GA 3U0VA 2FZ4A 3RIGA 4CM9A 2FZKA 1PK7A 5CXXA 3UMJA 4Z4EA 5HKKD 1LLFA 1YCDA 4EPYA 5IC5A 5BNIA 1N77A 1Y3BE 3IDQA 1YTUA 1QLJA 1Y1RA 3TCKA 1UMDB 4X90A 4GKBA 1XPRA 3M4XA 4LECA 4MROA 2OSBA 1U90A 4ZJYA 2BCEA 5A02A 3IV7A 4B4OA 4CN8A 4DARA 5B1EA 5BWBA 5D3ZA 5BMOA 2HRBA 1JHVA 5NLLA 1IZ9A 2VQDA 9LDTA 4ZZ1A 1OJ7A 1RWKA 1S89A 3T9CA 4BLPA 3CN7A 1I4TD 1Q0UA 3UQYS 3EULA 4UU0A 3I76A 4TMTA 3SFVA 3QVWA 2I2CA 4GR5A 4ZDWA 3JW8A 5KYKA 3EIOA 3C7CB 1FU4A 3AO0B 2IP4A 3KVRA 1GU1A 1NVAA 3JPYA 5IKOA 2V8BA 2ZJ2A 4TYNA 1ESEA 4A73A 3VPAA 4Y1FA 3TDKA 2WJAA 3MQFA 3QPUA 4JJEA 1VHWA 4ND2A 2RHLA 4FZVA 4LHSA 5AO9A 2R5WA 4F91B 4RDHA 4DHEA 1V39A 2J3MA 1RPNA 1XQ6A 1RCFA 1JI3A 3ZWMA 2GF2A 5BW5A 3OZGA 3K70D 3VPBA 1XYVA 3BXXA 2VXCA 1HO3A 2IBTA 3ONNA 3R0QA 1CPYA 1QHGA 4V03A 4YJ2B 5AWFC 1L4EA 3DHNA 3V8MA 2E6KA 4NENA 2HEIA 1CY8A 1N2BA 4ZV9A 1Y8ZA 2ARKA 4XPIB 1KO8A 1L9KA 1Y1PA 5D3MB 3V9AA 1C14A 1FTSA 1KHTA 5JO0A 2B4TO 5D51S 3COPA 4ZOLF 2Y9PB 4JEHA 2BSQA 4JI7B 2NZUG 4NKRA 4HAIA 4ZVKA 3BWVA 3LBFA 3FE2A 4R1LA 1QQTA 3OIYA 4UAVA 4L6IA 2R8YA 1KR2A 5LXTA 2JI8A 2WVGA 3BK2A 1SC3A 1C3VA 1VBFA 2O2GA 2F3RA 2QMZA 1JT9A 2CLKB 3BJEA 4GSLA 5FWXA 1UFVA 2CNBA 3RRNA 4BFLA 2WUDA 4Z0TA 1F1JA 3A6JA 3LBIA 3I01M 3EPHA 4R6XA 4L78A 1ABEA 1HDXA 3L82B 5JCXA 5ALEA 4JMLA 2FI1A 5BOSB 2FOXA 2TMYA 3FVWA 3KAPA 4OK3A 3P2MA 2FG7C 2MMGA 2C2HA 1M2GA 1RAHA 2ZBVA 5FPTA 2KPOA 4TM8A 2GA8A 3G2JA 2NZ2A 4HDSA 2R6DA 4IAOA 4NCXA 4U0KA 3S3TA 2QROA 3BDIA 3BMNA 8ABPA 5F64A 2O3UA 2DP4E 4B44A 5A3JA 1QBGA 4MIEA 1UWCA 2JFZA 1PGQA 5KTYA 2CXSA 2PAAA 2CGEA 4B5KA 2WIJA 5HHTA 2ODNA 1YUMA 1XA3A 2I6XA 4XARA 3QW4B 3T9DA 5LLTA 4DB2A 1T4CB 4MRPA 1EINA 1PL6A 3LLMA 5SV2A 2O0KA 2LW7A 1PUXA 2RC5A 4IJVA 5A9SB 3B1ZA 5I9LA 3QTTA 2BEJA 4DCPA 3L7LA 1L5RA 3SM9A 3W2TA 4HMPA 4OREX 4BVKA 2Q3EA 4LSGA 1SKAA 3C8MA 3OM1A 4LZNA 5KYUA 3F2VA 3TS1A 1O89A 1ZH8A 3EUAA 2I7XA 1T9DA 2AS0A 4LV8B 1PR9A 5G4LA 2Q6VA 1Y89A 1QNFA 3FXAA 5JO9A 4BNIA 1A72A 4ITRC 5IRCD 4EX7A 2OV1A 2FWPA 3IS3A 2XBLA 1KH1A 3SDZA 4ZEXA 5JSZB 3GLGE 5LL6P 2MYTA 5EJEA 3HO8A 3R7LA 3FETA 4DGQA 4X65B 1I94B 2V6GA 5C1OA 2VDQB 2H5JA 4JKIA 3PYMA 1TA0A 4NG5A 3K6JA 4QUEA 2JFPA 1EG2A 1KP2A 5KYVA 4WZAB 4PZZA 3ESCA 1UMBB 3CWZA 3DE5X 3F9CA 1Q2UA 2QMOA 2AK2A 4CFSA 4H17A 4FD2A 2CHQA 1QH9A 1BXKA 2PL1A 3DE6X 3HO6A 1TKRA 1ZD5A 3KVOA 4WXEA 2DTEA 1QP4A 2XQVA 2B7LA 2W48A 3HBMA 1UPFA 4ND6A 1OVGA 1F2UA 2QTMA 3HY3A 3NTOA 4LC9A 1MD9A 2ZJZA 2GAIA 2I80A 5F3DA 4Z1MD 1BKSB 4JWTA 1P18A 3UUEA 1E1QA 3TM4A 4WEQA 1RYZA 5K0CA 1YL7A 1H69A 1GTL1 3DLCA 4KNVA 3W5DA 4X60A 1C1YA 2RHWA 1KYYA 1SNYA 2ZB4A 2C92A 5ULLA 3RAJA 1PJBA 4J0CA 4HF7A 5F1PA 4EBFA 2BGJA 2Y1DA 3K6SA 2WD7A 4NU8X 3TVYA 2FN8A 4HWGA 1IZ7A 1SVWA 5DK6A 2C29D 5AESA 4F3RA 3EGIA 1YZYA 4HLDA 3ZD8A 2G9UA 2NSHA 2NYVA 3DTVB 1MDFA 1XEAA 2I71A 3H05A 3LP8A 2FSGA 1I5EA 5COQA 3RIXA 1WS6A 2X1VA 5K4AA 2IXDA 3G2KA 3LCUA 2ZPUA 2WIKA 1VA4A 4MKFA 4U7GA 4OGWA 1EFAA 1LS6A 2ZBRA 3T7TA 2UZ0A 5CT9A 1RFGE 2J45A 1L4LA 3P71T 4QYTA 3R6GA 4EKYA 3QHAA 2GTHA 3S29A 2I4MA 2R97A 3PRJA 9LDBA 2XWBF 3H1GA 3K3PA 5KKAA 3FG9A 4H2DA 4B4VA 3WL4A 4D97A 3F8SA 4WNAA 2VRCD 1LPPA 2Y1XA 3STYA 1K7SN 1V1MB 1NBMD 3FFAA 4KRFA 3Q9UA 2GPNA 3MRTA 1MZVA 3GGJA 2UYGA 3T1HB 4KQEA 2I78A 1R0XA 3AH8A 4HH3C 4KR7A 1I2AA 1O96A 1H1LB 2FK8A 3LOUA 5K2OA 4GLFA 4AKTA 2VNAA 5EZSA 2I55A 4KVFA 2BF7A 2BFDA 1ITZA 1C29B 2LUOA 1JAXA 2DBYA 2P1DA 2Z8YA 3G2PA 3OIVA 4JDUA 3TD2A 2FR8A 5AXAA 3UMSA 2QP3A 2OKCA 3VUEA 3VU1A 4YRBA 3NATA 5E3IA 5LQNA 5A7FA 1OIXA 3KHUA 3DOFA 1SWVA 1Q1AA 4RKFA 4W8GA 3II6X 1JTFA 2G6TA 4DA0A 3ZKAA 4UQLA 5DIZA 4I4NA 3BZWA 1M2FA 1D2NA 4IIUA 3WV4A 4A2PA 1MVOA 1RM5A 3HUEA 5CYFA 4YT2A 4EJ2A 1BSVA 2W11A 2C4WA 3WNCA 2CLOB 5I47A 4F3TA 1T36A 2B37A 4AICA 1KYXA 3EVBA 1JNYA 3A6GA 4IL5A 3C24A 3L0OA 4F3YA 5AI9A 3FTPA 4BCBA 3BGWA 1JG7A 4CEJB 1MABB 1AGYA 3OLWA 4OSPA 5LP6C 2DPXA 2XDQA 2XOXA 4EZEA 3H5NA 2GZRA 4UXHA 3TG8A 4GYJA 2HQRA 4W8OA 3WKAA 1JEOA 2NX2A 4NONA 2TECE 1WBBA 4ARUA 3EXIB 4IILA 4UHHA 2QKYA 4YFYA 3TGWA 3N0XA 4Z4QA 3KX2A 4GFDA 4X91A 1X7XB 1ZZGA 4H18A 3PRKE 3H8SA 3QTBA 5CX1A 4Q7QA 5K3EA 2J5BA 4MUKA 1SKMA 4I4TB 3FWZA 1Y7TA 2AJTA 2OXRA 2JKVA 4L7VA 4S2UA 4XDZA 5MHTA 4UTVA 1BC5A 1FLVA 1CUYA 1CQZA 5JJIA 1OCEA 1TEXA 2PJZA 5IW8A 3ZH2A 2FRDC 4DCVA 1YF3A 3ZE1B 1TX4B 1T2AA 2NP7A 1E6WA 3UAZA 3CSDA 4E6EA 4CFZA 3SZ3A 4ZT3A 4RTQA 3RRYA 2YW2A 4E08A 1E2KA 4UBKA 4B73A 3GO4A 2OAGA 1QE3A 4NCIA 2DFKB 2HU2A 3GLRA 4LVNA 5AD1A 2OZVA 3IODA 5D5PA 3C7TA 4ARZB 3DL4A 2EQ5A 3PNVA 1R6TA 1Q6ZA 1I14A 1E5DA 1D2AA 1I51A 4LRUA 3GLUA 3BBPA 2GI4A 2X7JA 3HS3A 4GL4A 4UVIA 4BMVA 3RG2A 4YUYA 4TLCA 1NIJA 4HEQA 5I5GA 4RMJA 4ZAWA 3VVCA 3OQOA 1Q95A 3GLFB 4DSUA 3FMGA 4M36A 2QL9A 1SG6A 4PYJA 1Y48E 1ZWLA 4KLZA 2AFHE 2XVZA 3IT1A 2Z2XA 4WZ6A 4R9VA 2NUTB 2EKBA 4WBNB 2ZUVA 2GDJA 2WV9A 1N2XA 1RPJA 3N3AC 5FADA 1ABFA 4KFUA 1V41E 3GP3A 1L8XA 5TE9A 5B1YA 3EDYA 5B55A 1JG4A 3SQLA 5FOUA 3DBIA 3QV1A 4PC2A 4DLNA 4PWYA 3CZRA 3LBYA 2WMNB 2O8CA 4M8IA 2C3PA 1CJSA 1VGVA 2XE6A 1OLXB 2AFVA 2Z3VA 3DB2A 3K2EA 2GEVA 4ZHQB 2O8FA 1W2HA 4Y1EA 2YMQA 5CW2A 3J81A 2VSYA 1ADGA 3I5YA 4D0NA 1ZX1A 1G1AA 4REQA 1YQXA 1E0JA 2O1WA 5L4NA 4GOLD 4JC8A 1ULZA 1OD6A 2VZ0A 1LA2A 2Z2IA 1IMOA 5IAJA 4B3DA 3QX9A 4LRQA 1WKCA 3AHDA 4DT1A 4UJ5A 1XDGA 3Q9NA 3WBKA 2CVFA 3HM9A 1GVNB 1T2VA 1AF7A 5FTWA 3GNSA 3R3VA 5TMEA 4GC9A 1UT8A 3VPDA 3CVXA 3FR8A 3DKPA 1F3LA 4B6GA 3I5UA 1KYZA 1H93A 3MFYA 4MAAA 4QASA 4REOA 3U3JA 2D0IA 4E14A 3JRXA 4LGCA 4O63O 4BRZA 2H4ZA 4G0YA 1KSJA 2IZOA 1AVTA 3LX8A 5ITWA 2X1HA 3DLHA 3TLCA 5BWMA 1YDMA 2RGUA 4KH1A 4MP8A 1P77A 2WIAA 1WY7A 3L7CA 4LMRA 4UTOA 2VTKA 4XX0B 5CFRA 2JIPA 4RTLA 5A62A 1D7OA 3JYOA 3SYTA 2G5CA 4UVGA 3UT6A 3GZNA 5FEUA 1SXGA 1RHUA 2J08A 1Z38A 3E23A 2XCSB 5T41A 3G2NA 3HSYA 4YJ3A 3GIDA 1QX4A 1CJBA 4ZP1A 2OCXA 5JDCA 3DLPX 2V65A 3Q7IA 3U0BA 5KDDA 1EZ1A 3FYDA 4EW6A 2QQ0A 3PXUA 4EHHA 1T2CA 4L4SA 4RHYA 1Y34E 4Q1VA 5AJHA 3W6NA 1FK8A 3D7MA 1FP2A 3K0AB 2OCAA 4U7WA 4JIGA 3VU8A 1QRSA 2EBWA 2QD5A 5EMKA 5CBPA 3H87A 3COWA 2ZSDA 4JS0A 3RK1A 4P0PB 4Q82A 4AMZA 3DLIA 2FP3A 2HLHA 1EBFA 4PX5A 3T1QA 2ZVJA 5LWQA 2WKWA 1NN5A 4MUBA 4DKXA 1OWOA 4S0ZA 4AXXA 3E2PA 3NJRA 3BFKA 3QVMA 3TG2A 1R7RA 2R9VA 3DDOA 3ETJA 3NVMB 3P7MA 3QVJA 3VJLA 4X64B 3AU8A 3K9LA 3PDWA 5CURA 3EY4A 5HJEA 3OX1A 3H19A 3ML1A 4C5CA 1C5KA 2F00A 5KYNA 3S2ZA 1S01A 1AS3A 2IFTA 4U9UA 5IJWA 4U7DA 2ZQ5A 1ODLA 3DZFA 1Y37A 3OC6A 3PITA 5ES3A 1PUIA 4TRRA 3K73O 5MN5A 5JH7F 1HSOA 1TVKA 3OBIA 4LYFA 4NL4H 4JJ4A 2VOJA 4FILA 3TNFA 1ONNA 4DCTA 1MAWA 2HBYA 4JQOA 4U1RA 1NAHA 4GLOA 3VZQA 4HNVA 3D4BA 2I9PA 3LRXA 3AUKA 4FFBB 2P9ZA 2WRZA 2VTEA 3UJNA 1NR1A 3KS9A 2GHRA 3A1TA 1EDDA 4TTAA 5EHQA 1NX9A 5CLIA 1QZ3A 2GO7A 4EJMA 4B8YA 5IH7A 4XCXA 2BBWA 2X9GA 4I1PA 3OU6A 5COBA 4D80A 1UT6A 5B4TA 2A1TS 4MUNA 5D84A 1YO6A 2DY1A 4DV7B 1N1EA 3BXOA 2FCRA 1MX1A 2BEKA 1HFKA 3ZG6A 2B20A 4D57A 1E3EA 3DB1A 2Z6AA 4O4LF 1P33A 2YMMA 3LUDA 3LYAA 4KVZA 5EQJB 1JEQA 2GGSA 2XECA 5ALTA 3SAJA 4MWGA 3IEUA 5IAEA 2CE2X 2G04A 1TEZA 1OX4A 3F2IA 1PQWA 3B53X 1F1BA 2UDPA 3RYHB 1YBAA 4MI6A 4IIDA 2YBDA 4OTZA 1ZU4A 2HA6A 3QXSA 1G8SA 4F6RB 3CT4A 3BMXA 4FR2A 4OQ4A 4ETIA 2VJPA 3H83A 3HDGA 3PDCA 1O3YA 1VHQA 4NNPA 4GI5A 3DZIA 3V8PA 4DV2B 3LS2A 3UWOA 1NBHA 4R1MA 1T0JB 4L5IA 1C9EA 4F38A 2ZKLA 2NTYC 4OHKA 3EWIA 1Q7EA 5FJIA 2OGUA 3CLKA 1I5RA 4IIJB 3VR6D 3DV0B 3CGGA 1EP9A 3C39A 3CLUD 3L1JA 4HH0A 5EXDA 5AUPB 1J24A 1FUIA 3C3JA 3R75A 2BP7B 3TPFA 2EG9A 5ILGA 2AR9A 3QVUA 3I9V6 3TW6A 3DE7X 4OLJA 3R0VA 4MQEB 2GYVA 4BV3A 1OB5A 2IH5A 4CLEA 4Z3OA 5IDXA 4B76A 4MR9A 4DQXA 2W6ZA 3H5IA 4X41A 2R0QC 1R18A 1Z82A 5TB5A 8ADHA 5E7QA 2HCJB 3AUFA 4WN9B 1HBJA 3BD6A 4DHWA 3D5TA 4EY5A 3MILA 4A0HA 4OM8A 1QIFA 4K9SA 1H0RA 3TBKA 4LDJA 1WUYA 3CZPA 4PWZA 1SZJG 4J2TA 2Z1MA 2W0MA 3VU0A 2NWQA 4ND1A 2FK7A 4YJHA 4PLFA 4M2LA 4X93A 1R37A 4GYKA 1JF8A 1U9CA 1M1UA 2B1IA 2ZRIA 4WOCA 5LXTF 5C4MA 3M6UA 3WWCA 4YAGA 3RWOA 4URYR 4AQ7A 2R1TA 4FNAA 3G9TA 4RVDA 3KU1A 1G2QA 13PKA 5IZCA 1M9NA 1CRQA 2PXAA 3MWEB 1NBME 3NYIA 4BNLA 4EA7A 3H2ZA 1DQZA 1N4AA 2CNLA 3GBPA 4N0EA 1FP7A 4QEKA 4PHTA 3MCZA 3HCFA 1P0PA 2H5LA 1QC5A 2HNBA 2JDIA 3BEDA 1M6VB 3QKIA 1D2RA 4ME6A 4B84A 5CDYA 1X1SA 1TJ5A 3AKCA 4YO7A 2FSVA 1FFSA 2BEUB 2JG3A 1N8TA 1PWZA 2YWBA 1OWMA 4EB3A 2R85A 4GWGA 4V0LA 1ENYA 2OZLA 3IVXA 4OQXA 1P0IA 3KR2A 1QQ6A 4L51A 1NVEA 2Q46A 2G09A 3RIEA 2JEYA 3TL3A 2NO0A 2WTBA 1G1MA 2FP4A 1AMNA 3EEFA 1N6KA 4YASA 4YV7A 3B1JA 4RETA 4U6SA 2RHDA 3V4SA 4TWIA 1FUYB 1I2MA 3ZZTA 2RFLA 4LBYA 2MSDB 2PT5A 1PR5A 4QRIA 3HCDA 1CNFA 1Q74A 2B8NA 1FP1D 3ZHVA 4DLSA 2QSJA 1II8A 4CNBA 3CT6A 1A69A 2ZT8A 1BOFA 3TBHA 2DPMA 1IWOA 1P1JA 2EZ4A 4RADA 4Q1EA 1QH0A 2YIDA 2G88A 3DZJA 3U3OA 4RL4A 3WIBA 4ERXA 4K9OA 3C1UA 2AZTA 2C5HA 2HU7A 2V3CC 2QN1A 2NO9A 4ARBA 4WH0A 1DG1G 2MJLA 3I73A 2FZWA 3BCUA 3DL0A 1QQAA 3H5WA 3LJKA 4GR9A 4BFUA 2OC9A 3X1JA 1V7QA 4DRYA 3K0BA 3WYBA 1FC0A 2L19A 3DM5A 3LF2A 5D5HA 4MQ5A 1NVDA 1ADBA 4XZ3A 3GP5A 5DWVA 4AY6A 3ESDA 3O90A 5H9VA 3T1OA 4XQCA 3OTWA 4EYOA 1REQB 3E3NA 3OTHA 3JQCA 3RFFA 2V7GA 1USGA 2Q3HA 2XSZA 3K5IA 3WGLA 2BN4A 1V5IA 4EUNA 3PC7A 4NV3A 3B2EA 4DWVA 3GUZA 1YU9A 2F1JA 2YUTA 4QUKA 4TSKA 2ZIXA 3DZDA 1U2GA 3SK0A 2V98A 4HYQA 1LV7A 3M6WA 4KHZA 3WP1B 3NOQA 4BVFA 3UWPA 1Y3FE 2VJMA 3E84A 5KQLA 1ZKMA 7ABPA 1Y1LA 4ZMRA 3HCEA 1BAPA 2AXQA 2A9OA 4PBRA 4Y2TA 1U3GA 1EUDB 3ZU4A 2YVLA 2C31A 2C4UA 3RSHA 3E81A 5AJTA 2PDAA 4ZT2A 3A6HA 3HA5A 1VFPA 4BGVA 3QBTA 1MVNA 4N41A 4UBOA 1KYQA 1KO1A 1LXCA 3GRUA 5FXMA 3BICA 3MBIA 1TECE 4R7GA 1KI6A 2ZQYA 4IXDA 1GV1A 4DVGA 2PRSA 1OZGA 3UOGA 4BMPB 2G0AA 3R7NA 3B6KA 1CWUA 1OROA 1QM5A 1H6DA 1KSHA 2A86A 2D06A 1SHKA 5E1DA 4RKEA 1OAKA 3WWPA 2R4UA 3GRVA 4EFKA 5HS6A 3NC1C 3CEPB 3UK1A 3I6ZA 5KQRA 5IJ9A 2JJ1D 3BA6A 2KBFA 3PGXA 4L8YA 3SC3A 2JGAA 4Y2PA 4PN7A 4NJEA 1XKQA 2VFAA 4H7HA 4QLOA 4GWKA 4FJ1A 5LKAA 1GDTA 3NBFA 2Y1FA 4QULA 2I34A 5DP2A 3U7QB 4RTRA 3UK0A 4A8HA 2CNWD 1EFPB 2NPIA 3HKCA 4Z7JA 3FDXA 5TQVA 2PYIA 3WLOA 1EQ2A 3PQ3A 3CO0S 3PEVA 3ANSA 3LKZA 4E5PA 3QEBZ 1M67A 2E4WA 5E3HA 3ND6A 1UKZA 2YVQA 3LRPA 4G84A 4US0R 2R79A 3H3JA 4L07A 2Q2NA 2I0FA 4J6EA 1H9BA 1M2OA 4P3XA 2X23A 4GR4A 1U2EA 2G6BA 3MGKA 3R0IA 1N6RA 1GPUA 2PWZA 2XCOA 3KFLA 4NFLA 2OECA 3AR5A 1R6XA 1Z26A 2EYUA 5DMHA 2B2CA 5ABPA 1YVPA 2XDWA 1A9OA 2Q5CA 1N2CB 3VNQA 4S05A 5L3RA 5JNTA 2Q6IA 4BB9A 2AD1A 4UTRA 1SIOA 3EXG2 3IAS6 1C9DB 1SD1A 4NP6A 1JALA 4BO5A 2BGKA 1PGNA 1BXGA 1ZC3A 4I9HA 4OFWA 4I6GA 5F5NA 1HWYA 3GUYA 2XTAA 1ZQ1A 3PQ5A 1QJCA 3QWAA 4TSFD 4F1KA 1NNEA 4G0PA 5BO5A 1TU3A 1RJFA 3Q2KA 4CEIA 1E1KA 1R66A 4RPHA 5SZIA 2J87A 4ZANA 4A2QA 1X1RA 5DM70 1SUCA 2EFHB 4IVQA 5FTNA 4B3RB 1KAQA 3K0FB 4FFLA 5TPZA 5HGXA 5ICCA 1F4LA 2FN7A 4P7KA 4YMUA 1T8WA 4GQAA 2Q6KA 3V8BA 4RY0A 2O9JA 4EG0A 1V8OA 3VBEA 2D7JA 2H1IA 2H2WA 2X2EA 4MVJH 3SM3A 3U37A 3VVBA 5JD4A 1UEXC 3VNVA 4NE7A 5IT5A 1L1FA 2JVIA 2FCAA 3AWIA 1RJWA 2HH9A 3Q11A 4PNZA 5B5SA 1RWQA 1QSGA 1XWFA 2W9XA 4AMYA 5EIFA 2HPVA 2HSEA 2PGIA 1ZH2A 4RZQA 1JPJA 5JH7A 3JQAD 2WMDA 4MEBA 2XB8A 1N7JA 1C2YA 1YL5A 2VJCA 4I81A 2WIDA 3AGPA 3QKRA 1ZNZA 2PCLA 1NU8A 1TTPB 2B83A 3ZQ6A 1DCTA 4B2YA 2B69A 1ZHFA 4BNMA 1UOQA 3VKVA 4AXBA 1EEXB 1DRWA 2AN9A 3EZ7A 4UOZA 2F1HA 1XU4A 5AI0A 2AC7A 3GC6A 1BRTA 3GVXA 2G36A 4FS3A 4HWOA 5KTKA 4CL3A 2HC9A 1F0KA 4RVSA 1DJOA 1ADYA 2VK4A 5F52A 5J1SB 1E8DA 2VK2A 2VPQA 4LDPA 5IHXA 1BVUA 3ROMA 3WGIA 2OB1A 1X1BA 4DBLC 1U0LA 1PQYA 2I4TA 3T7KA 5BVHA 1BE1A 1X7GA 1Z4QA 3NBUA 4OXKA 5A5EA 2I7VA 4PR3A 4MR8A 4HH1A 1ZW1A 2MSKA 3FFXA 3WIVA 6LDHA 3ZW9A 5K0FA 3HKBB 1CRZA 4WW0A 2P6UA 1Z4OA 2PSSA 3DBRB 4UBJA 5HIAA 4AQYB 4V3BA 4G0VA 3NKVA 1QLWA 4X71A 1NFQA 4ZIRA 4JNKA 3VPHA 2GN2A 2YYAA 1PKEA 4DY6A 2QM0A 1NVBA 3GJ0A 3KLMX 3SQWA 1FFCA 1FXSA 5BNZA 1RADA 4HWSA 1E63A 1KH2A 2HLPA 3D4IA 1AQ6A 4KOEC 2RHTA 3A31A 4A8PA 3AVYA 4MGZR 3VPFA 4I46A 1SQ6A 1O94A 4G89A 1ECLA 4AG6A 4CIYA 1J22A 2RC6A 1U3UA 3T5TA 4D0GA 3IMFA 2NO7A 4X6XA 2VK1A 1UJ5A 1T8PA 1E5TA 3IQEA 4U02A 4B6OA 3O73A 3L4KA 1M34B 4GMFA 3AVWA 2O2SA 3I6BA 4EJSA 3V4LA 4DCNA 4Y2GA 4OF4A 2WNHA 3IESA 1Z6XA 3BVPA 3HADA 3KLNA 2ECQA 2LZ0A 4CCYB 2DKOA 2OV8A 1TCUA 1XQ1A 5FO0A 1SOMA 1UMCA 1T9AA 3AESB 3B7WA 5AW9A 2WNIA 4IV5A 5FI5A 4N0MA 5L7TA 2M6RA 1W4LA 4IM7A 3ZOZA 5EIBC 2CL5A 5B6JA 3ZWKA 4YCJA 5KJCA 2RK4A 2QQEA 2ZAMA 1IVYA 1G4HA 2P4UA 2QV7A 4GUAA 2XGOA 4LK2A 4YRKA 3VHLB 4E0BA 1JHZA 1GNRA 1YQ9A 2MOKA 1GTVA 3OFVA 3ECAA 1A98A 3OOHA 5KNBA 2GPSA 4IX1A 3Q8MA 1H9AA 3G0OA 1T0BA 1OI7A 1MGOA 2D74A 1UT5A 3OESA 1ICEA 4DNFA 2J6IA 1PNOA 1Z0DA 3AFOA 1Z08A 2D2FA 2QD4A 3GA0A 3C8HA 3DAFA 2AXPA 1HOXA 3YASA 1BDIA 1RXIA 3MNFA 2P8JA 2XTZA 1YR8A 3LW8A 3RDPA 5FQNA 2VHXA 1J49A 4FJ0A 3AFMA 2WJJA 2GEDA 1T2UA 4KGZA 4Q01A 2YW9A 2RH8A 3HCRA 1K2WA 2OCBA 2F90A 2H4YA 1AY0A 1XB2A 2NUPA 3D81A 2P77A 1LI7A 1XP8A 4QYXA 1U8TA 3DONA 5M34A 1N0IA 1FMFA 1HQYE 2J3KA 2H4JA 4FT4A 5K01A 3L7OA 1SBZA 1VSQA 2HK7A 3K1TA 4NCHA 4L6AA 5K2MA 5KHLB 1UZLA 1SCDA 4M0PA 5IJZA 4IEFB 5SZKB 1TZKA 1X1AA 1GN8A 3P2YA 4RE6A 3NTLA 2MR5A 2KX7A 3AG5A 3LHKA 5EWLA 4DSNA 3SHTA 1EUZA 2F8MA 2OXCA 4AMGA 3EA4A 3D0RA 1O6ZA 4HS9A 4L75A 5IC4A 4JLNA 3LMKA 1XCJA 3NXKA 5LDGA 1N34B 4C0LA 1XZGA 3ID6C 3L6EA 1AS2A 2PT9A 1UM9A 4C03A 2UYHA 3SJAA 1SB9A 3W5UA 4FJ2A 3BWEA 4QOIA 3RYIA 5AJYA 2B2NA 5B6IA 5CJJA 2C7OA 3PXGA 1JIQA 1ZFNA 3OKCA 4NBNA 1UBEA 3BWYA 3C5HA 3EC1A 2OV6A 1ZINA 4ZQFA 3U16A 4ANFA 2VTDA 1MG5A 3ETDA 5FPYA 1YB4A 1H9CA 3JQPA 4TV8B 1OLUA 2W00A 4K81B 3ZYZA 3HPQA 2EYQA 1GNVA 1PFKA 4M0MA 4C0AC 2UKDA 1CXZA 4CT0A 1IM8A 4WLOA 4EKIA 4E15A 5KVVA 2V5VA 3EY9A 4UHCA 1HPLA 1K66A 1NW8A 1RC0A 2FW6A 4GBJA 4W8HA 5EFZA 1UXOA 2GEKA 5HE9A 1XMXA 5C1IA 5LU9A 1Q3KA 2PH7A 1KPHA 5KNDH 3DJFA 1RWNA 4PFSA 4BNDA 1Y8RB 4AJJA 1P80A 4MI1A 4BFZA 2VP6A 5DGDA 2Y8EA 3DOHA 4GZMA 3TD6A 2B99A 3IAHA 1GPLA 4YCSA 3HC7A 1U8XX 1ZD4A 3GEEA 2QI9C 3UAXA 4C4RA 3FGZA 3GFSA 2YHIB 4G5YA 5DEOA 3PRYA 4XSVA 3WGMA 4H1HA 4B31A 1XL1A 4LDAA 4BHTA 1SUSA 3FFWA 5JZ9A 5KJEA 2OAQ1 3IE1A 3WB0A 4A92A 5A2GA 1NJSA 1Z3CA 4ZI3A 4FW8A 2DQZA 3F1KA 5GJWC 4BQRA 3GMSA 3GZ4A 2OCPA 2QL7A 1S8OA 2VHCA 3PYLA 3E9QA 1ZRHA 4B33A 1YE3A 1AA9A 1RCTE 1SXJC 2W6NA 3AKDA 2OBMA 3IHWA 1TCAA 1IVNA 1O95C 4IQGA 4KWTA 4DF3A 5ADVA 4KXQA 3P0HA 2OP0A 3U56A 3FAKA 4OHZA 1D0VA 1DKPA 3O8OB 4ASUA 3D7KA 2YQZA 4O2LA 3TTXA 4DDHA 4TS4A 2ZCJA 3V8VA 2AFHA 3EZFA 1IN4A 1B26A 1R12A 1UBLS 3L6OO 2UYOA 2Z9BA 4FOLA 1VZ3A 5LZ2A 2EJWA 3DNPA 1D2EA 3ZNQA 2HJHA 4J0HA 5H7XA 4F0JA 1JEEA 4HX2A 1D4ZA 4U3JA 1IAVA 2AWOA 1VG8A 4LX0A 1FRVA 2P8SA 2RHHA 4Q00A 4DW8A 1JEYB 4M38A 3GLIB 4Z7NB 4OBEA 4HGYA 3LHFA 2Q3FA 3WNDA 2XVXA 4A82A 1CE8A 3LDFA 5TF0A 3M6FA 2M1XA 3A4YA 3G1UA 3KT8A 1KDYA 1EFCA 3H5TA 3S5UA 3O4RA 4EYKA 4AJKA 3DXXA 3HCNA 1JR3D 1RM0A 4KN5A 1EA7A 1G9TA 3NOXA 4U7HA 2V6JA 1H3EA 1WSWA 2M98A 2DPLA 2GCIA 3FM9A 3PHCA 4LN1A 4N47A 5HKKA 1MAVA 2WBLC 4UE2A 2EJCA 1BCRB 4UATA 4GYYA 4EHDA 4LGVA 4CMIA 2JARA 2VZ8A 3V4FA 4JBNA 3EF1A 4KQKA 5BR7A 1Z2CA 3M6AA 4IX9A 1V7PC 3OMXA 1E61A 1RWWA 3O03A 4D8WA 1EDEA 4FGUA 1E3SA 1RS0A 1FMJA 4BO3A 1Z5ZA 4R81A 4JP3A 1E3JA 3BMCB 2IEYA 2X5NA 2YXEA 3KWFA 5K3FA 3I30X 4D3SA 2CZQA 5BV7A 2JANA 4Q5IA 2HHJA 3IQGX 2XIJA 1RAIA 2VZEA 1SIWA 2ZBGA 5LJLA 5EJAA 1NQVA 4UUBA 4RGYA 4ARIA 2IEZA 1QK5A 4BO8A 4KQ9A 5T8KA 4Z2YA 4UAJA 1ZM3A 2WWYA 2C7RA 3ADBA 3T0GA 1WVGA 1V96A 2JFNA 4R3NA 3UT5A 3HI6A 5DMXA 3G9UA 3W9UA 2PQ6A 3IPXA 2HWXA 3UMVA 4J0KA 1UJ4A 2HDHA 1JLSA 4BCCA 4KR9A 2AX4A 3VTZA 1LZLA 1HNNA 2ZEJA 3ENVA 2QJTA 2WU4A 1MEOA 5JAIA 3RREA 1XNRB 3TFOA 2Q0XA 1U2QA 2JGMA 4L5JA 1VPLA 3AT1A 3WIOA 4Q1DA 3C3BA 2I2BA 5TDHA 5LMCA 2ZWOA 2NZYA 2BFWA 1L7PA 3L1HA 1B2LA 1YVEI 4URHA 1U0NA 1T24A 2FB9A 4HAZA 2DOKA 3SJ7A 1N0UA 4PW0A 2XOKD 4HQRA 4WJLA 2IYAA 2BKAA 2WF9A 2JW5A 4RF4A 1JXAA 1IBRA 2OORC 1XMSA 2RH9B 1JFSA 1FZQA 1WUTA 1BJRE 3HU5A 2YRXA 2RHCA 4QTTB 4W7SA 1POWA 1ILWA 2B8TA 3CZQA 2P6NA 4N03A 3IAM6 4KWEA 4R1TA 1EDOA 2GJSA 4IOKA 3FTNA 4PY2A 4C0WA 3CRZA 4Q4AB 4HYYA 5DJ5A 1IK4A 4QQ8A 1TM7E 4GDFA 3OE5A 3FPFA 4CN9A 3MJFA 5JSKA 3CZCA 1AKVA 4BBAA 2R6ZA 4C4SA 4J9UE 1L7OA 4LY6A 5B3LA 4G36A 2W2XA 3BD8A 1PRYA 1DAKA 1QB8A 3U26A 4CDNA 4JY7A 4KRXA 1IEVA 3LXRA 1RI5A 4B81A 2JIBA 3F3KA 3MCAA 4H6VA 4QHTA 5ALNA 1KK0A 4G4JA 3C4QA 3LWBA 4P82A 1LNQA 4X94A 3EVZA 3TXYA 4LF6B 1J20A 3R5TA 2AW5A 4PEVA 1KY5A 5AOVA 1NF3A 5JI3E 1H6BA 3F8TA 2A0KA 4NLLA 1EFVA 1EM8B 3O0DA 2Z2JA 1A9PA 1PGJA 1Y8AA 1HT3A 1II0A 3GUUA 4JOSA 1OSNA 3NDBB 1XF9A 2IUEA 2ETXA 3KB8A 1A95A 2A9FA 2H85A 3EK2A 4MYTA 3B9QA 1WZEA 4IF6A 2G4CA 4PM4A 5F33A 1KL7A 2W2MA 2Y4OA 3N9IA 1NR7A 4IFEA 3N2KA 2QZSA 3MZ0A 3SQMA 1HQDA 1HRDA 1H3FA 4HWTA 3P9RA 4X1YB 1M83A 2PR7A 3TECE 4BGIA 2GM3A 4B1FA 2VJDA 4EOGA 2X0JA 5M2QA 1AQLA 3EG9B 5SY4A 4JROA 2REQB 3S1SA 2BVNA 1DMRA 3F7OA 2Q1WA 2Q9CA 3U7EB 1E7MA 2FZCA 2QJRA 2VZ9A 1K8QA 1ODTC 2EL7A 3S2UA 2IUYA 4ALJA </