4E11A

Crystal structure of kynurenine formamidase from drosophila melanogaster
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
300
structure length
300
Chain Sequence
b'HMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHSAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kynurenine formamidase
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 116
structure length 300
sequence length 300
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e11A00
4DLNA 3JWEA 3RKSA 1YB7A 4NVRA 4X95A 2OGTA 4MYSA 3DNMA 3FYTA 3AINA 1DQZA 4B7ZA 3PICA 1QLWA 4MEBA 3R41A 4A23A 1AUOA 5K3EA 4X6UA 4N8EA 1CUGA 1UK8A 4PNZA 4LXGA 4UBIA 2WUEA 1R3DA 4B81A 4WY5A 2ZYHA 3C5WP 1KEZA 5ALJA 2HA7A 1LBTA 1MAHA 2C5GA 1JJBA 1WHSA 2GZRA 5I9IA 3KWFA 3WWOA 5LZ5A 3AZQA 3F8SA 3LIPA 1EH5A 1F0NA 1YR2A 1EDDA 3DEAA 2B20A 3ZI7A 1ODCA 1ZI8A 3O0DA 1RYYA 5EI5A 4UBNA 3ICWA 1CUIA 4W1QA 5BWCA 3M82A 5DYTA 1W75A 2BKLA 2WU4A 1HL7A 5KREA 3JYHA 4Q1VA 2Y2VA 5FKJA 3ESAA 5ALGA 3AIKA 4A16A 5AHXA 1SCIA 2WHQA 2G63A 4Q3LA 1TCBA 3BIWA 1XRQA 2VATA 5ALQA 7YASA 3L1JA 3AILA 3G0GA 3STVA 4X00A 2DSNA 3QH4A 4AX4A 3KSRA 1WPRA 4FTWA 2GYVA 5HKAA 5T4BA 2ZSIA 4KJXA 1NU8A 1O6GA 1CUHA 3AUKA 3RK4A 3S2ZA 4KAFA 4DNPA 2I3DA 4AQDA 4ZV7A 5DYYA 1CPYA 1CIJA 1XZJA 1MX9A 2WG0A 4PSCA 1A7UA 4DMKA 4J0DA 4XX1A 2XQKA 3DQZA 4BTLA 4HAIA 1NU6A 1R9MA 1H2YA 3GROA 3VJLA 5BOVA 1WM1A 3KWJA 1GXSA 4DM7A 1DTEA 2B9VA 4Q3OA 1QFSA 1AX9A 1DT5A 4M0FA 1QIEA 4C87A 2QXUA 2VJBA 3OG9A 5AOCA 4J3JA 1CUXA 3O9VA 4WJLA 1VXOA 2XUQA 1SCKA 4RPCA 4OCZA 2IX9A 5D7BA 2XUKA 5IVIA 3DYVA 4W63A 4QLOA 1UKAA 1VE6A 5JALA 1CUYA 3BIXA 1CUVA 4LXIA 1XZDA 1TK3A 1YS2X 5ESRA 4BCDA 2RHWA 2VA9A 4K6HA 5HF9A 3FYUA 5JAUA 3L1IA 3IVMA 2VT6A 4OPMA 3G0IA 4G8DA 4NS4A 5FXMA 2JGLA 1B41A 3H0CA 1UOPA 1QIDA 1SCQA 2JGJA 4LHEA 2XLBA 2JGEA 4GWLA 4H35A 3H2GA 1LPBB 2PSDA 4XVCA 2YYSA 3WK7A 2X76A 5JAHA 5LKAA 1GT6A 2VEOA 1XRNA 3F67A 2WTMA 1GZ7A 2WFLB 2RHTA 3G02A 2QM0A 4Y2SA 4BB0A 4B84A 2PU5A 1XKLA 4JEIA 5C81A 4AMZA 4I3FA 3ZLTA 2ACEA 1CEXA 3Q0TA 1ZOIA 4EA6A 5I7UA 1N8SA 2XUJA 3H1BA 3WWEA 2BGRA 2PSEA 3R3YA 4EY5A 1QONA 2BUAA 2WIDA 1JFRA 3OPMA 4FKBA 1UT6A 1VZ3A 1J1IA 5E4TA 2WG2A 1YSCA 2XUHA 4G9EA 4BP8A 5JD4A 1MX5A 3WKEA 1K5PA 4K6GA 2QUAA 1E66A 3WIBA 2XUGA 4UHBA 5CH3A 5A7GA 4KE7A 1E8MA 2OCLA 4MWSA 2VAVA 1EDBA 2HU8A 4EY4A 5AI6A 4Y2XA 2QTBA 3VVLA 2GBIA 2R11A 5ALUA 1EVEA 1UKCA 2ES4A 3SC2A 4YPVA 3CN7A 1IVYA 1JMYA 4UBMA 4E46A 4HXGA 4N5HX 5DLPA 5HQ3B 2WIJA 3O4IA 3PUHA 2PUJA 1JU4A 3BJMA 2WUDA 4JH0A 2D0DA 1BCRA 4O08A 4J03A 3YASA 4Y2UA 5SYNA 4C01A 3FYUB 3FNBA 2C58A 4Y7DA 1XZFA 3U0VA 1IUNA 1WOMA 3A2MA 3RM3A 3AZPA 1EB9A 4GW3A 3MVEA 1I6WA 3WWDA 4YX9A 1W76A 4W1PA 1ZI9A 3DDUA 2XE4A 2XQGA 1KU0A 4J0IA 4ZGBA 2I78A 4PF1A 5AJHA 5EHXA 5E4YA 1HKHA 1YAJA 4HRYA 4GEGA 4RE6A 5E4JA 5ALEA 1GQSA 3FYUC 2CBGA 5AKHA 1XZCA 4JUIA 4GXNA 5EGNA 1VA4A 4FBLA 1CUZA 1E5TA 5CXUA 4BAZA 4QWMA 3EIOA 1FFDA 5IKXA 4D9JA 3PFCA 3DS8A 4K2AA 1WB5A 2JGFA 1LGYA 3T4UA 1MO2A 3ANSA 2WKWA 5AI8A 1ZIYA 2XMQA 5AIBA 1XRLA 4LIPD 1EVQA 5KWIA 3IURA 1XZKA 3STXA 5ALIA 4AXBA 4WFJA 3OTQA 3GELA 2XUFA 5AK5A 1GKKA 4AZ0A 4RNCA 3A2NA 2XUPA 4UHCA 2JBWA 4X91A 1QIIA 2PX6A 3GUUA 1GPKA 2QKYA 1PJAA 4FDMA 3I2GA 4AO7A 2DHDA 1X70A 4S0XA 1EI9A 4X93A 4BVLA 1E8NA 2XUAA 4FLEA 2WHPA 1QIKA 1USWA 4WCVA 5FPQA 1P0QA 2PVSA 1AMNA 1BROA 3VDXA 3PUIA 4DNOA 3ZWQA 3BF7A 1AURA 4OYLA 4IO0A 1WB4A 1JJIA 5ALXA 4W9RA 1YA8A 1T4MA 4FLFA 3DD5A 5AKXA 1XQXA 4BP9A 5IVDA 2Y2UA 2OPHA 2DQYA 1A8SA 1C7JA 1UZAA 3AIOA 1K4YA 3ED1A 4W1RA 2H7XA 5KBYA 2CB9A 1WB6A 4BBZA 3D4LA 4Y2VA 4Q82A 5AM2A 3WI7A 1DQYA 4ETWA 5JADA 1ODSA 2VJAA 2QVBA 5AOBA 4CG3A 3B5EA 3WKDA 4IH9A 4X71A 4L3WA 2DFPA 1GKLA 2FUKA 2PKYX 2V9ZA 4HXEB 3I6ZA 5AI4A 4AZ3A 2XLCA 5AKZA 1OXMA 4UBLA 3ESBA 3QM1A 4GDMA 1ZI6A 5DNUA 1CUEA 1H22A 3IIIA 3ZPXA 1W52X 3O9MA 3FWHA 2WTNA 1F0PA 4DNQA 5HF8A 5CMLA 4DNFA 4YK7A 4F60A 3HACA 2ZYSA 4J0JA 1XZEA 5LZ7A 4HTAA 4UHFA 5CT9A 1TRHA 4IHAA 1CV2A 1XRMA 2Z8XA 4ZI5A 4FMPA 3GFFA 1XLVA 1QO9A 1DWPA 1BEZA 3DYIA 4UFPA 3ANTA 4Q3KA 1IUPA 3DKRA 1UWCA 4UUQA 3WK8A 2X5XA 3CXUA 3DL7A 1ZICA 4OSEA 5JAOA 1QIHA 2WHPB 4W1SA 1CUSA 3I6YA 3F97A 1H2WA 4K5QA 5AI5A 2GYUA 2FJPA 1Q0RA 2HA5A 2R8BA 4BRZA 1OILA 5CH5A 2C5FA 5SYMA 1ZIXA 3W05A 2XB6A 1P0IA 3IB3A 2GBFA 2XMDA 1FFBA 2D5LA 5D3ZA 4WDRA 4G4JA 1ACLA 1J07A 1BRTA 1MX1A 2V97A 1W4LA 1QTRA 1IUOA 4UFOA 1VLQA 3C5VA 3E3AA 3TRDA 3K6KA 3VISA 3UMJA 5LZ8A 4QDZA 3GA7A 2GZSA 3FLBA 3O4GA 4LYDA 1P0PA 3EBLA 4MJ3A 3EQ9A 3H1AA 5ALFA 3I2KA 4EZIA 5DWDA 4ITVA 4MQLA 1FFEA 3DKKA 5EHZA 1QIGA 3W9UA 1ZD5A 4F5ZA 1FJ2A 3M81A 4HVTA 5HFAA 1DX6A 4ZXFA 1TKRA 3ICVA 4BC1A 5JZSA 3WYDA 5D3KA 5ISMA 5AP9A 3WKBA 1G66A 2HA4A 1LLFA 1TCCA 2Q0XA 3BL8A 4DIUA 5FRDA 4CG2A 3H2HA 4A5SA 4BRSA 1XQYA 4IH1A 5DNWA 3NWOA 3I2IA 3QYJA 3H2IA 3KD2A 4EY8A 1SOMA 1DU4A 3HJUA 4BCCA 3VJMA 4FOLA 2WIFA 1KU6A 4BDTA 4EB0A 1DWQA 3N0TA 1CUBA 1UXOA 2AJ8A 3WL6A 2QS9A 3QPCA 5ALKA 1N5MA 2QR5A 3G9TA 5A7FA 5K5EA 4KAJA 3I6MA 4F0JA 1XZGA 1BCSA 2CUTA 1XLWA 3TGLA 1F6WA 2RIPA 2JEYA 1E89A 1EXWA 3W04A 3K9BA 2G5TA 2YH2A 5JARA 3FCXA 3M83A 2VT7A 3NUZA 5DYWA 2IITA 4KEAA 4EUSA 5K3DA 3STUA 2NW6A 3A70A 3IA2A 2B61A 4CCYA 1EA5A 4E14A 1ZD4A 1U4NA 2Y6VA 2OGSA 1HQDA 5JZBA 2ZYRA 4OB6A 5AK3A 3VKFA 2PSJA 5YASA 1QJ4A 2VSQA 2XMZA 1FFAA 1L7QA 3CN9A 3O4JA 3OC0A 3BE8A 5IVHA 4AN1A 5HK8A 1LPOA 1XRPA 2WJ3A 4B83A 1C4XA 4XWGA 5AM3A 2VAXA 1ZD3A 4U2BA 4X6XA 4OYYA 2ORYA 3WL7A 4DGQA 3I2JA 4M0EA 3C6XA 5CT8A 3MGAA 3M3DA 3AIMA 3WK6A 3DJYA 1AQLA 3G9ZA 1K8QA 1CUUA 2HFJA 3ZV7A 2WIKA 3B12A 1LNSA 5DJ5A 4GHWA 2WHRA 4OU4A 3WK9A 5AKJA 4I4CA 1E8DA 4NMWA 2XMRA 4UHEA 4B0OA 4OB8A 3QITA 5CRIA 2J4FA 3H18A 3E4DA 3V9AA 5AKYA 4INZA 3JW8A 3UUFA 1CUJA 2WSLA 4DSAA 2W6CX 3QVMA 1H2XA 3WMRA 1A8QA 3RLIA 5LZ9A 4QLAA 2Z3ZA 4KR0A 3WZLA 4JNCA 1GPLA 4BE9A 1YB6A 3QMWA 1QO7A 3WK4A 3HSSA 3IUMA 3SK0A 1U65A 1QE3A 1XQWA 5E2IA 1XLUA 2HU7A 2WJ4A 2HADA 4X94A 1A8UA 4FNGA 3D2BA 1LPSA 1G42A 1K63A 4Y2JA 3F98A 5AI0A 4CCYB 4K6KA 2HA0A 4OUKX 5JZ9A 3R3XA 4PW0A 4G8BA 1VOTA 2XUIA 5AK6A 4ZV9A 4Y2QA 1R9NA 2O2GA 2Y1KA 4G8CA 1Z68A 5HF5A 3LLCA 2VJCA 3PE6A 2Z3WA 2WUGA 4Y2RA 4H7HA 4EBBA 5CBKA 3QBJA 2V98A 3GBSA 1XQVA 4DTCA 1UOOA 3EQ7A 3C87A 5AIAA 3I2FA 4P92A 4KYVA 1G4HA 1R1DA 3WZMA 5HZGA 1ORWA 4MYDA 2ZSHA 4L72A 1MNQA 5K3FA 3W2TA 1AZWA 2JGMA 3R3VA 2XQIA 5C8ZA 4QZVA 4NZZA 3V1KA 2H1IA 4DYHA 4QEKA 1CQWA 3HYSA 5LZ4A 3NGMA 1UK9A 3C43A 2XUDA 4J0GA 4ROTA 1QZ3A 4B6GA 3LS2A 2H9YA 4QDTA 3WWPA 1J06A 2P8SA 3STTA 2PL5A 5ALHA 3IBTA 3STWA 2O7VA 1UK6A 2HRRA 1GQRA 4AMYA 1CUDA 4GECA 3LCRA 2DQZA 4B80A 1ACJA 1B6GA 1R88A 1JJFA 4MWTA 1LPNA 3C6BA 1BEEA 2WU3A 2ZJFA 2HU5A 1DX4A 3HEAA 3G8YA 3HXKA 2XMGA 4FHZA 1EB8A 4ARBA 4DSZA 3WWCA 1VA5A 1JT2A 3O95A 1EK2A 1BE0A 5LIPA 4QDXA 2OGZA 1K6EA 1AC5A 4L9AA 2ZYIA 3FLEA 4C88A 2OAEA 2YXPX 1W1IA 3H2KA 4GBGA 4X3CA 2CKMA 1CUCA 4P08A 5CW2A 3AJAA 4H7JA 2IIVA 2K2QB 4CFSA 5FP0A 1NX9A 4JYMA 4P93A 1QIFA 2HL6A 5KWJA 3C45A 3I1IA 4G4IA 2GBGA 3FLAA 4OU5A 2H7YA 3IUJA 5AH0A 4Y2TA 3BXPA 2ZVDA 5A7HA 1T2NA 1GPNA 4F21A 5A2GA 1WHTA 2E3JA 3G9UA 2QOEA 2HRQA 5ALOA 2CMFA 5JD5A 3R3UA 5LKRA 1JU3A 1OCEA 3VJKA 5EIAA 5C7YA 4V2IA 3VVMA 1ZJ4A 4Q34A 4XIIA 2WQZA 2DCMA 4GI1A 1UK7A 3QMMA 2CJPA 5AKIA 3AFIA 1EK1A 1QFMA 1IMJA 5ALNA 4J0CA 4QDOA 1XROA 1THGA 1CUWA 5FPPA 2VQ6A 1EINA 5ALWA 1SC9A 2CZQA 5ALDA 4YASA 4HRXA 3HC7A 4J0HA 4GLBA 2HA3A 3IDAA 5AICA 2OXEA 2ZJ7A 3QPDA 2VTVA 1HDEA 3FBWA 4FWBA 2Y6UA 5JATA 1QTIA 2JGIA 3R3WA 5JYCA 3GZJA 4PQEA 4E15A 3MUNA 3TEJA 1QIMA 3W9BA 4PSUA 4UPDA 3D3NA 2C4HA 2RONA 3R40A 4X7BA 3FVRA 1BN6A 5DTJA 5AM0A 5K3AA 4UFNA 4ZREA 4KE8A 4FFWA 5EFZA 4EY6A 1L7AA 1E3QA 2OCGA 3F96A 2RAUA 3AZOA 1CUFA 2ACKA 4AN0A 3HLKA 1MAAA 2RI6A 3WIOA 2G5PA 3WKCA 2GYWA 1F8UA 5EIHA 3EF3A 4N5IX 2CEKA 4FBMA 1PFQA 3HI4A 4WFKA 3X3HA 4BAUA 2WIGA 4IQ4A 2QJRA 2QJWA 3ZLVA 5HFNA 1P0MA 2C7BA 1XZLA 1TCAA 1EHYA 1WCYA 2BJHA 3BDVA 5EHNA 3SX4A 1JKMA 1R4ZA 2PUHA 3R0VA 1CRLA 3D2CA 3ILSA 4C4XA 5K3BA 2ECFA 3DOIA 3FOBA 5AKLA 4RE5A 4KRXA 2DR0A 1LPMA 1MU0A 3WQHA 1ZGCA 1A88A 1BS9A 5EHQA 4P9NA 2HA2A 5ALRA 4B85A 1TIBA 4L0CA 1MN6A 1VJ5A 1H23A 2PSFA 3ZLUA 2JF0A 1N5RA 5T4HA 2LIPA 2BUCA 2QUBA 4PSDA 4RGYA 1HPLA 3QMVA 2FJ0A 5C8XA 1LZKA 1PV1A 4TGLA 2Z5GA 3D59A 3N2ZB 3TJMA 2G4LA 3C8HA 4ZWNA 5ALYA 3DCNA 3HZOA 2QRUA 5D6OA 3PF8A 2XQFA 5JANA 5AKGA 2I03A 4DMCA 1RP1A 5JD6A 1DWOA 4UHHA 1FSSA 4E11A 4Y9SA 4C6HA 4BYMA 5ALTA 1XZMA 3E1GA 2WFLA 3V48A 1R50A 3PFBA 5CT5A 2WM2A 1LPPA 3HRHA 1ORVA 3MUOA 1BN7A 4WDQA 2AJCA 1N1MA 5A6VA 4DMHA 4ARAA 2PPLA 1LZLA 3KDAA 4G4GA 3D7RA 2OQVA 3D5EA 2OG1A 3CCBA 1JI3A 2HHAA 4KACA 5A71A 4H7KA 5C8VA 5AM5A 3G9XA 1ETHA 2BFNA 1ZJ5A 2B4KA 2J4CA 1IZ7A 4HXFB 4J7AA 3OOSA 2BGNA 4H7IA 5ALZA 5AM4A 1XFDA 2C0PA 6YASA 5HQ3A 4LXHA 2O2HA 1M33A 4AO6A 1X2BA 4DMFA 2XUOA 4H77A 2WUFA 3C70A 2OCKA 1YA4A 1YS1X 3FCYA 3SWWA 5LLSA 2WILA 2EDAA 1AKNA 3WK5A 4IH4A 4AO8A 4X6YA 3V1LA 3P2MA 2HDWA 3I28A 5CTAA 5CURA 4FFVA 1GGVA 1XKTA 4TPKA 1TQHA 2WFZA 2QXTA 2PBLA 4Y2PA 5CT4A 4CI9A 4H7EA 2AJDA 2DHCA 5ALLA 3VXKA 4BVKA 2VJDA 3D2AA 2AJLI 5BV7A 2H7CA 4BAGA 4H18A 1VXRA 2Z8ZA 5DNVA 4U2EA 4G1FA 4LYEA 1YASA 4QA9A 3FVTA 5ALMA 4QNNA 1JMKC 1QIJA 2BAGA 2GBCA 3H19A 5DTIA 2HIHA 3G7NA 3FSGA 3FAKA 1RWQA 2X8BA 5T4EA 5ALPA 2VF2A 3BWXA 2HFKA 2PSHA 1C7IA 5LZ2A 4KE9A 3WA7A 3G0DA 4H0CA 3PDCA 1MT3A 1S8OA 2HA6A 3B3QA 2UZ0A 3WJ1A 5HKBA 3HABA 4BTVA 1CVLA 4G5XA 2HM7A 4WY8A 4J0KA 1MJ5A 1G5FA 4U2FA 3QPAA 4BZZA 2JIDA 2V96A 5CT6A 4U2GA 4BVJA 1SFRA 3BDIA 3FSGD 1BU8A 4EHBA 1QOZA 3QZUA 4PO3X 5JIBA 4AB1A 3D0KA 3EQ8A 1THTA 3WLAA 2ZJ6A 3I2HA 3WL8A 2XDWA 4OB7A 3H17A 4KE6A 4TVKA 3UUEA 3V1NA 2JGKA 1ZGBA 1D07A 2XQJA 5FDFA 1DINA 5H3HA 4CIBA 3C6ZA 1H2ZA 2O2IA 4B82A 3WKAA 4UBKA 1J2EA 1WPXA 5I8PA 5AKKA 1U8EA 3Q8WA 4KRYA 1UOQA 2PM8A 4X85A 4XJVA 4BCBA 1TAHA 4H7FA 1YAHA 1DT3A 3DOHA 4M0MA 2J3DA 4MXDA 4BE4A 2FX5A 3E0XA 5EIEA 1FFCA 1XZAA 3W06A 2JEZA 1HBJA 2ROQA 5AKEA 1AGYA 4H7DA 2QMQA 2EEPA 4FNMA 3KOOA 3WA6A 2OCIA 5BWBA 1CUAA 4Q05A 2XMBA 1MNAA 4B0PA 3IUNA 3T52A 2XI4A 5ALSA 4LKOA 2WLSA 4X90A 4G9GA 3K2IA 2XMSA 4EY7A 5F4ZA 2I3ZA 4UBOA 4CIAA 4I19A 2AXEA 1ODTC 2OQIA 1QGED 1MPXA 5AK4A 5LYYA 4KAAA 4FLMA 2WFMA 4C89A 1VZ2A 5J3JA 1XZHA 4B9EA 1L7RA 4C4ZA 2J3QA 5JASA 2OAGA 1CFJA 1Y37A 3OM8A 2RGUA 4BZWA 1MTZA 4B9AA 1O6FA 2DHEA 2XT0A 4X92A 5FLKA 1X2EA 3WYNA 4HZGA 1CLEA 1XZBA 3LP5A 4BC0A 2QT9A 5K3CA 3H2JA 4QE3A 3L1HA 2W22A 2AJBA 5HK9A 3R3ZA 3F9CA 3C6YA 3G0CA 3G0BA 1Q0ZA 2OLEA 3PI6A 5AOAA 5FV4A 5CH8A 5HCUA 5FUMA 3PF9A 3DLTA 2EDCA 1EX9A 4N8DA 1VE7A 5CXXA 2WG1A 1Y7HA 2O7RA 3WJ2A 1EDEA 1ISPA 4C4YA 2ONCA 2QZPA 4BDSA 5K3FB 1U2EA 4BATA 3LIIA 3STYA 5LP1A 4UBJA 1CQZA 4Z49A 3ESCA 1IZ8A 2C0QA 4U2CA 2BUBA 5A62A 5JAPA 4Y2YA 2PU7A 3H04A 4U2DA 1XRRA 4X97A 1UKBA 5HF6A 3NOXA 3IULA 4MQMA 2YASA 3BF8A 1UFOA 5AO9A 5ALVA 3KXPA 5IVKA 1Y7IA 5T4FA 4MEAA 3I1YA 1LPAB 1YCDA 4ZRDA 3RARA 2WJ6A 5IH7A 4CCWA 3ESDA 4N8SA 4JYPA 5FOQA 5AI9A 4CG1A 1VKHA 4PV7A 1Q84A 3C8DA 3S8YA 5AM1A 3CCCA 3V1MA 1LBSA 3O4HA 2XMCA 1CR6A 3DL4A 3IUQA 3A2LA 1ZD2P 3A6ZA 4OD0A 4UHDA 3WL5A 3U1TA 4WFIA 1W6RA 1Q83A 1XZIA 3BJRA 4QDUA 1HLGA 4HS9A 2BCEA 3OURA 4QWWA
chains in the Genus database with same CATH superfamily
1KO7A 2D4HA 4KNVA 2YXEA 4NVRA 1PJ3A 2GPBA 4X95A 2QTWB 1RLIA 2QRLA 2XNDA 4MYSA 5EE5B 1OBVA 4JOQA 4IFTA 3FYTA 3AINA 2C20A 3X1MA 1ZHHA 1DTWA 3ZCUA 4B7ZA 4ZIRB 3LUPA 4IYRA 1Z45A 5JXJA 1M2VA 2MINB 4MEBA 4RXUA 2QAGA 1UDAA 1TQDA 1PQ4A 3B48A 1V96A 4EENA 1Z83A 3K5IA 2WWGA 4WLVA 5F2KA 5K3EA 3ISJA 3UGKA 3LUGA 1P9RA 4PNZA 2O3UA 3AOEA 1R6AA 2IUFA 3W7BA 2D1QA 1P4AA 3ZE6A 2FMTA 1QBKC 1TE2A 4L7VA 2FP4B 1KRWA 1X0VA 1R3DA 1O3YA 1GNTA 4YPOA 3M1YA 1UBUS 1E7RA 1E3SA 1B15A 2NT4A 1QG4A 5DSZA 3ZXXA 5JSKA 5ALJA 3T35A 4E5DA 2GVDC 2HA7A 3T7KA 2C5GA 5DNYB 4RA6A 1LX6A 1T26A 1HUQA 2ZR9A 3R4VA 4CM4A 4B5KA 2DFDA 2GZRA 4J16C 1OA1A 4WL0A 3UCEA 2FB9A 2RSLA 2WDPA 3IR5A 3SZ3A 1K4MA 4UEWA 1XN1A 6ABPA 1S3IA 3K1TA 4NZPA 2WJPA 4DZRA 4ETMA 3GLIB 4PC1A 3I9KA 4AJNA 5HIMA 1YBAA 3OIVA 1JAHA 4C5CA 4CKCB 1Q7GA 3ORSA 3LLVA 4FONA 5TVKA 1K3FA 5F2NA 3C0KA 3PQ8A 3ENWA 2H1WA 3JAMA 5B1SA 4G41A 1U28C 2NO7A 2ZETA 1T43A 4C0SA 2B20A 4Q3NA 1RRCA 1E9SA 1ZI8A 1NLUA 4HH0A 1RYYA 3LCCA 4I1IA 4FQ8A 3ZXYA 3D1VA 1ESDA 2ZSJA 1E9FA 1ENZA 3FGZA 3DBRA 3X0DA 5BYBA 4GPZA 4LJRA 2A1UB 4NMMA 3GRCA 4PLPA 4ZU3A 4DA0A 1GTVA 4E33A 3T99A 3PQ3A 1ONOA 3C7KA 1NVTA 2QUKA 4PY2A 1Y5RA 3ZZMA 2BKLA 2WU4A 5G0WA 3RVPA 4QM7A 2XWJI 3PKZA 4NYMQ 1Q92A 4POAA 1WVGA 4DADA 2OILA 2Q49A 1SRQA 3INGA 3MMPA 4GOMD 2YHUA 4HQRA 3JQAA 4LYFA 2CDNA 4OO3A 3Q2OA 2B1QA 1V9CA 1GL9B 1K7XB 5LYJF 3FTFA 4QRDA 1JKFA 4CM8B 1EVJA 1SXJA 3RIMA 1N32B 4RK5A 2PH7A 2H65A 4TS9A 4NPAA 4DW8A 1T5DX 3MCTA 5FHQA 4PLZA 4H17A 4AYWA 5JMTA 3QVLA 3BFJA 4A16A 4LOKA 4ZMBA 2OUKA 4LNAA 1T3ZA 2HO5A 2WHQA 3WJ7A 5AJYA 4OHFA 4YRZA 4QU0A 4C0HA 4Q3LA 4CU2A 4Q7QA 3ELWA 4YT4A 1T1IA 3MEQA 5IT5A 1L4LA 1WU8A 3SS8A 2IYUA 4XQ9A 3IKMB 1VYHA 3OJEA 1ICEA 4ZT6A 1WPQA 1E77A 4ES6A 4O4JA 2EZ4A 1ZUWA 2P9ZA 2QA5A 1G9TA 3AM5A 1B76A 2FHPA 4LY9A 4XVRA 4YCJA 4EEZA 4AZWA 1IZ9A 4KB5A 2IGBA 4O02B 4PM4A 4OQ4A 5A9TA 2RHBA 1WX1A 2C7PA 2GFQA 1DV2A 2AOXA 5LDGA 1WPRA 1HQYE 2O2ZA 4FTWA 4G65A 4OI2A 4KR9A 1XWIA 2LCQA 4DCCA 1H4SA 1G19A 1RXIA 1QH8A 2YYAA 3ZVNA 4WCDA 2FP3A 2FRVA 4HL6A 3RS4A 2ZR0A 3PXDA 4QODA 1C0IA 5T4BA 2A0XA 4V24A 3CRMA 4ZT4A 3URMA 3AUFA 4QXMA 2ZSIA 1KMHA 1LQUA 3ZHCA 3UBTA 3ZJVA 4JUCA 5K4HA 1T35A 2G1PA 1O6GA 4EA7A 3PJRA 4KR7A 3S2ZA 3UC9A 2EBUA 5DGCA 1RLTA 2I3DA 4K9KA 1JEYB 3BAZA 4BMXA 2AMFA 4C2TA 4XIYA 4ZOEA 1N0VC 2ZRFA 3R8XA 4CLRB 3MYRA 4EPXA 1CPYA 3QNMA 4LJ9A 3AFGA 5IFLA 2CXNA 4NS1A 3CISA 1XZJA 4IUCS 4ZYLA 5M34A 1MX9A 4PSCA 3JSAA 3EW7A 3HV2A 3A6PC 2YFQA 3AR4A 5KOJB 4XTCS 3FX2A 2BMVA 3BWCA 3DQZA 1P5RA 2KLHA 1RADA 2G08A 4M6WA 3ZE1B 2GNAA 2A1TR 4HAIA 1XEWX 1MXFA 3PQ7A 3TL2A 5JROA 4N1AA 1H2YA 1EXNA 1N7JA 3CINA 1HO3A 3GROA 2WYVA 3VJLA 1R6TA 3CT6A 3GN2A 3OZTA 4JJ6A 4REQA 1KHHA 3BICA 4ZVPA 1U5AA 5BOVA 1VHJA 4PXSA 5KDLA 1YVDA 2BR4A 3PC8C 4E4TA 4KITB 1NN1A 2ATVA 3QG1A 1UBSB 4M7WA 4PZYA 3CLHA 4I2VA 2V8BA 4LCEA 2VHYA 2B9VA 3OQMA 4Q3OA 4Z1OA 1B6RA 3MXOA 3QMPA 5FTMA 1AOXA 1OYWA 1TZKA 2HIAA 2QBYB 3AL0C 4RTJA 2NUPB 1QP0A 4DQUA 4KI0A 3K0KA 4V02A 4GE0A 4AS1A 1YR6A 3KE8A 1OFUX 2FEAA 2KLBA 4J3JA 1GPWB 1Z37A 5LMCA 2W8ZA 5HW0A 1QE5A 3SYNA 1V9LA 2ZYVX 2CUZA 3BXOA 3ECSA 3KUKA 4G84A 3TM4A 4DPMA 3QA3E 3QFHA 1BIFA 3R0JA 1FP2A 1YV9A 1NR1A 1R0BA 4PPQA 4HDSB 4GIBA 4FYHA 3OAAD 1TU3A 3K9CA 4HEHA 1GN9A 2IX9A 3TLGB 1KL7A 1FY2A 2LTAA 1CF2O 2H5JA 1ABBA 1VCOA 4ASUD 3JQFA 3KJFA 2IEAA 3NHSA 4HG2A 1JHVA 3WMXA 4D8XA 2E4WA 5L4NA 3D2LA 3E03A 4UM9B 5JALA 3GLIE 1P2SA 3ULKA 1JL3A 1CUYA 3BIXA 1Z4IA 5H7XA 2GBPA 5FNZA 2UVPA 1PJ4A 2ZTSA 5BQOA 3LO8A 3ROMA 2IYZA 3SIXA 4BKQA 2MCFA 5TPZA 1FDWA 5KC8A 4PG5A 4LXUA 5ERGB 3VC3A 3RCBA 3MWEB 1QYXA 1EFAA 2Z2ZA 5DN6A 3T6KA 3V34A 1C30A 3PUXA 3HZHA 3HDYA 3ORHA 1HR0B 4BCDA 3KEFA 3FOZA 1PEKE 2G70A 5D01A 1CY2A 1OI7A 3BMQB 1G8YA 1YIDA 2C82A 1EJ6A 3HDHA 4V03A 2ISSD 2HCBA 1CBUA 2LNDA 4K6HA 4MB0A 3ZGYA 1MFZA 1P17A 2DGDA 1B3BA 3WBFA 3BIOA 2PGAA 2D06A 2GD1O 4C3VA 1UUFA 3ORYA 2Q2OA 4AKEA 5I4KA 4DV1B 1WXIA 4PTYA 1YKGA 5EP2A 3FA2A 4NTZA 3OIDA 1FX0B 4JNKA 2J7PD 2XGGA 1VMIA 1R27A 1A72A 4AJPA 3DEZA 2UYGA 5G4KB 3ZQ6A 3BZWA 1O5IA 4AG3A 2QNBA 3VFDA 1RBMA 2BFDB 4DA9A 2UVDA 1NV8A 2JFGA 3OEEA 2WAAA 3WGLA 1KVUA 2WNSA 4JJ4A 1UOPA 3TINA 4DLVA 4EI7A 2IZ7A 2IKQA 2W2KA 1SCQA 3I76A 1V3TA 4RKQA 8ATCA 4TWBA 3N76A 1GVHA 1RIIA 3WGOA 1W36D 1N6IA 5BPHA 2UZ4A 4W6ZA 3LAWA 3CUTA 4MA4A 4GWLA 2HWYA 4WN3A 4UU8A 3R3HA 1BE8A 4EKYA 3HBJA 4O4LB 1A8IA 2PSDA 5KDOA 4BZPA 3ZJUA 5A0TA 5IHXA 5IJ0A 2YY6A 2RHDA 2E5LB 4TTQA 4EVQA 1RQ7A 4TX1A 4RVOA 5BSTA 3RQIA 3VI4B 1PUIA 1Z39A 3ILHA 4E3WA 2IH2A 3EZLA 4RPIA 3GD5A 1N2CA 2WUWE 1EX6A 4NNPA 4EHNA 4KFUA 3ZGXA 4BFXA 4JZKA 2DQ4A 2WFLB 1BDMA 4TRNA 4ESHA 1U5CA 2O0MA 4HLUA 3EZ9A 3TL3A 1K92A 4N76A 2QSUA 1RM3A 4UAUA 1BWPA 3FWZA 5IWCA 3UOAB 2FLKA 2FEOA 1XALA 2Y1CA 4JEIA 4NV3A 4JI6B 1I80A 2O3SA 1E1RA 2GFIA 4H6XA 3ZLTA 4A92A 2ASVA 3JARA 2DLCX 2PXCA 1YGPA 5C9ZA 5BSVA 3H1BA 4QOEA 2X5KO 3IDSA 3Q7PA 3WWEA 2PTHA 1V8FA 4EOGA 2HF7A 3DMRA 1VL8A 3QLEA 4HLNA 1O4WA 3RYFB 3OE4A 3OPMA 1EJ0A 1Z0IA 1C1DB 2HZBA 4FKBA 1RYZA 2C7OA 5CFQA 5HKOA 3V80A 1J1IA 1WABA 3O8QA 5IJWA 4S12A 1YSCA 4G9EA 2R4TA 4OJNA 5D1NA 3TQOA 1IHDA 3TLMA 4AJ9A 2SKCA 1GGHA 4MLCA 1IY9A 1K5PA 5LBUA 5FPYA 4ZDKA 4OXNA 2X2OA 3L9XA 2Y1DA 1PJ8A 4GBED 5ERXA 1X94A 1TD9A 5M5BA 1A50B 2MSLA 3LDUA 4JT2A 4WCFC 1J42A 3LWBA 4B3FX 1I36A 1E66A 1DC5A 1F0KA 1S6YA 2OWEA 2FE1A 4R2HA 1VLZA 1APBA 3USCS 2JFFA 3RH0A 5A4DA 4Z53A 4M1KA 5A7GA 1K7CA 1X7YB 3GJYA 4FR2A 2OCLA 4KR2A 3AC0A 1EDBA 4EY4A 4QBHA 2H0QA 4QC2A 4ZYTA 1MHTA 1FZTA 3PWZA 4UEKA 4BZQA 2B0CA 3VZSA 4WD3A 3VYTB 5ALUA 5BY2A 1EVEA 1MRZA 2Y0CA 2JHFA 1TAQA 4RULA 4RACA 4DJAA 3MLBA 4KAXA 5HEKA 3INNA 1TQ8A 3CN7A 3W9SA 4M1WA 3M9LA 2O3JA 1RHMA 4E46A 1ZC3A 4D81A 5EIFA 4K9DA 3SQWA 4V1CI 2F3TA 4ZQEA 3I1FA 3OD5A 1G8PA 1X13A 1X7XB 4Q3EA 5ECWA 2C61A 1MA0A 2V7XA 2WF5A 4NABA 4QPZA 5BRNA 1SCAA 3G82C 2QW0X 2VNAA 4M0DA 1CJTC 5TC4A 4M1QA 4TXLA 4ACBA 2QRMA 4AMVA 1QVRA 2X8LA 2PUJA 3ZCXA 2NZVG 2CVHA 4K46A 3O1LA 5G0SA 1YVRA 4MPPA 3UPDA 3HB5X 3V7YA 1JQ3A 1QQAA 2HQSA 2D0DA 1V48A 3PV0A 3WSVA 3ZZNA 4UVGA 2RGNC 1NF3A 4YUZA 2ID8A 4MW5A 1SHUX 4RESA 1JPJA 3YASA 3LRTA 3A9WA 5JECA 1JLRA 2HTFA 4OHZA 3E22A 4B4KA 4C01A 2IBSA 3FYUB 1NP3A 4OHPA 2CNBA 1ZYUA 4Y7DA 3U0VA 1TMKA 1XCGB 2RFLA 1IUNA 1WOMA 2VDMB 2PQ6A 1CJUC 3A2MA 3L7DA 1AY0A 4R9SA 4DUZB 1OH6A 2OXFA 1W581 3PDIB 4FIZA 1QTNA 3I01M 4LNUB 4II7A 1N9GA 4NU6A 5IRCD 1DJQA 3QTTA 1HTWA 4F8EA 4GW3A 3MVEA 3F4BA 3ZCRA 4EK9A 3GJ3A 4QVGA 2C1ZA 1BGXT 4YCMA 3DE1X 5D00A 1ZD9A 5E0OA 1CNEA 4KVGA 5BR7A 1W36C 3KYBA 1P9NA 3HWRA 1TQ4A 1FRQA 3LD9A 3ZD8A 5G0UA 3BE4A 3PXGA 1Z6ZA 3PXCX 5CEEA 1ZOSA 5GJCA 2JZCA 3N7TA 4M87A 3OOJA 3N39C 3KQKA 2CLMB 4DV4B 4IJKA 4JP5A 5AJHA 4UPEA 5L4LA 3E61A 4GLOA 2QTNA 4BS9A 4KNWA 4Y7CA 3SKYA 3NB0A 3S68A 4IV8A 2XPCA 3OT4A 3KE9A 1SRRA 4MW1A 4HRYA 4PZDA 1INLA 1E0JA 4NBNA 5E4JA 1BHJA 4TN1A 1ZWLA 3IRUA 4D8TA 2ISQA 5FTWA 4LS3A 4K1LA 3WB9A 2PGXA 3FYUC 3IC5A 2JJMA 4Z0PA 5LNK1 4WZBA 4JB3A 1A98A 2CLIB 5F5XA 2X0EA 4BNUA 4ITUA 4G5FA 2NN3C 3SSAA 1U7ZA 2PCJA 1BXGA 2BFEB 4J9VA 2IDJA 4FBLA 3A6GA 4IKEA 4JIGA 1TZ2A 4IJWA 3VHXB 1D0SA 1X92A 2ZWAA 2QMHA 4UEJA 5CXUA 2PIAA 3LQ2A 3RAEC 5K0LA 4CWAA 3RIEA 2B8NA 2VK8A 1MO5A 3TFWA 5EOVA 1FFDA 4R2IA 3WS7A 4RC9A 3UW1A 2ZRKA 3D64A 1YZFA 3CRRA 1BW9A 4XGKA 5GV8A 3VOAA 4BIIA 4EQ6B 1CETA 3DR5A 4P3XA 2NUBA 1PR9A 2ZT6A 3C14C 1U1DA 4TN5A 5AI8A 5EG5A 5AIBA 5HUJA 5FA5A 1XRLA 3N74A 4LIPD 2AC7A 2IP2A 5BNWA 2ZATA 3HK2A 5FLEX 2FSGA 5BOSB 3GDFA 2FY8A 3SHTA 1DKOA 1Q0HA 2QM8A 2HIGA 1W0JD 4J8PA 3LA6A 2Y1WA 1PDOA 3LC0A 4LGCA 4DLSA 1J1UA 4C5AA 3KEOA 4M21A 3W78A 2I91A 1J5XA 3NS7A 1YDFA 5JQGB 1GKKA 2XTNA 3MT7A 4OP2A 2OZKA 1J90A 4RZHA 5JR3A 2R97A 1ZNQO 1DFHA 1RRKA 1S2NA 3PNSA 3EXHA 3OE5A 4FMBB 2BY4A 1U0EA 1U7DA 2XUPA 2A92A 4UHCA 5AVQA 4CM9A 2IDKA 1GG2A 1P2UA 2Q07A 4X91A 1XVTA 3U9SA 1YF3A 4MRPA 1Q3HA 1CZHA 1VP3A 4R7GA 5E1DA 1ZN9A 2R7LA 3OICA 4W5OA 4R2XA 1GPKA 2Z5FA 3SC2B 2P6OA 4RGBA 3ZGOA 5HZHA 5LU9A 5E7IA 4BNWA 2WJZB 3E5HA 2W9XA 2Q45A 3I2GA 1FLVA 3QHQA 1M34E 2XVMA 3GXBA 4L8FA 3T3MB 2H0AA 1X70A 4BJ3A 2UXCB 4G89A 3GGSA 3UEOA 2C1EA 4LYHA 4AUMA 4DDVA 3Q87B 3IQXA 4YN3A 2VTEA 4DRYA 5KOHB 2COUA 4ZI7B 4KDEA 1U0HC 1E8NA 3UAXA 2XUAA 1N2OA 5E0KB 2WHPA 3OC6A 3KKOA 1USWA 2XCQA 3IP5A 3MNFA 5B30A 1PZGA 4ILEA 2C7RA 3OEWA 4F3KA 3IH5A 1B4DA 3D5TA 4IHQA 1V7QA 1AMNA 1U2GA 1L4FA 3A6KA 2W70A 4NRDA 1SZPA 2L42A 4LY0A 1QFXA 3SDSA 1NVWQ 5B1DA 1LSUA 3THYA 3AEQB 2VP3A 1GUZA 1JN0A 4B33A 1XXHB 5DEIA 2NUAB 3IE2A 1F8YA 4KBYA 4AAYA 2O6LA 3KVVA 4P22A 2C9OA 2OXTA 1G5RA 1CD5A 3DZIA 3N0VA 2V3WA 3ZWBA 4Q1AA 3G79A 2QK4A 4DJDC 2IHBA 3QVUA 2YCLA 3ZE0B 1O03A 2XWQA 4WH0A 4BNDA 5ALXA 3HCEA 4K9OA 2BE7A 4MWCA 4F4JA 4O0MA 5IVKA 2PZEA 4JJFA 2FQXA 4CMAA 4F96A 4BP9A 1ML3A 5HFJA 1I4WA 4US2R 1AKRA 5C53B 3OIGA 5FCDA 1MLDA 3HVUA 1RRPA 3BIJA 1I4OA 4MX8A 3EHDA 3L8ZA 4BLRA 4V0NA 2Q1SA 4QGAA 5CUQA 4DA7A 4ZOLB 4LF7B 4E07A 1UPUA 2CXSA 1ZRHA 1OR8A 3SMVA 4KSCA 3LXXA 5CBPB 1WB6A 1Z0DA 2JB9A 1Z6QA 5E2BA 4D6XA 2R6JA 3FCCA 2VYFA 3R3JA 4Y2VA 4YCAA 4Z86A 2G72A 4PSKA 1LJLA 5DM0A 4ZYWA 2XVXA 1I2ZA 5C37A 1ODSA 2W8BA 2VJAA 4Y2HA 2C0CA 1EE9A 3BTUA 3QVXA 1P1HA 2W4MA 2CYCA 1RLMA 4F5YA 4X71A 1C7EA 4YVFA 2JANA 2EWWA 3E3NA 4A6PA 5E6SB 4YALA 2DFPA 3A14A 3GJTA 3W8EA 4HFNA 4NR0A 1XTTA 1ZM7A 4TWRA 2WE7A 2AG8A 3I6ZA 4L5YA 4JLPA 4RIHA 5CLIA 3QPBA 1Z8NA 1CCWA 4MJXA 1C1XB 2AX3A 1VJ1A 4UQOA 1PTJC 1KNXA 4UBLA 3O91A 4V38A 2NXJA 5ADHA 4BU0A 1C2YA 1FUEA 4AUKA 4RTPA 1XAJA 3NOVA 4GWKA 2OY0A 1AXGA 1ZD1A 2WIBA 2NZWA 3B3JA 5F7OA 1YI1A 5HMMA 2A7XA 2WF6A 5LM3A 4YR9A 1P60A 2FA9A 1YRAA 3PDHA 1KS2A 3O9MA 3TG8A 2YWDA 2XA2A 3BUSA 4HMQA 4D8VA 1W49A 3CBGA 1W2HA 5B3AA 4DNFA 1S8AA 2YXLA 4YK7A 5EQTA 4F60A 4BN5A 4IQGA 3N87A 1OXVA 2X1MA 1XZEA 4DXAA 4F92B 1TYZA 2BC9A 2DFTA 1M74A 2P3SA 4R9RA 1A5BB 5I45A 5KTNA 3TDKA 3GMSA 1NPDA 3MK31 4IHAA 4Q16A 2PMBA 1ONBA 2NYRA 3UFXA 4FMPA 2W2QA 2I7XA 1OZHA 3FNEA 3N70A 4K03A 1SURA 4MZDA 3W3AD 4QAJA 4JS0A 1WF6A 4M8IA 3JZMA 5E9QA 4HDQB 2PANA 3K3PA 3ANTA 3Q9UA 3TM5A 1EK5A 3CSUA 1E4EA 2IL1A 1UL1X 5GIOE 1XTQA 3R7FA 3U44B 3EOZA 1DJOA 2FNAA 1Y8QB 1AB6A 2ZQYA 4X20A 4DY4A 1LK5A 1TECE 3HFRA 4EI9A 3ZYCA 2PUDA 3DC7A 3ADBA 1S9DA 2VP9A 2ODPA 3CEPB 3CRW1 1WVIA 3DMPA 3WK8A 2H3EA 4I6JA 2CFIA 2X5XA 4QU8A 3CXUA 3EC7A 4LJYA 1P6UA 3AWIA 4MI9A 3A25A 1NF2A 3H5NA 4B6SA 2Y66A 3HB4X 5GGYA 4K9LA 1S3FA 3FWPA 3VKWA 1TT5A 4DIOA 5JAOA 4DABA 1IVNA 1KORA 1L8XA 1CUSA 3S1AB 1GGFA 1KF0A 4RD1A 4TZKA 1R8XA 4LVCA 5JZMA 1COWA 2XRFA 5AI5A 3H5AA 4QG7A 5FR2A 1XMOB 1VSUA 1U9IC 2GYUA 3ST7A 5KSYA 3G85A 4DE5A 4P2GA 1SOVA 2CK3D 1Q0RA 3UAYA 1BKDR 2O7NA 2HA5A 2P91A 4L57A 2C5FA 4ZQHA 1O6CA 3S99A 3KOXA 4G01B 1OZFA 2PMDA 2XB6A 4Q93A 3VHQA 2VNKA 5E1MA 3I04M 3UUGA 4EO7A 1B3RA 1NAIA 3MSXA 4D96A 2ZBEA 1KVSA 4QBGB 2WSMA 2XMDA 2DBZA 1X8XA 5FIUA 5BWOA 3NTVA 4IG4A 2G7ZA 4RKFA 1V47A 2PKRA 3IBSA 2PGJA 5ER6A 3U3OA 4BUZA 5F52A 3NATA 2X4DA 1QRTA 4NPCA 2RHOA 3CJQA 5ITVA 1JDSA 1LI5A 1R4MB 5CLJA 1G5PA 4E32A 1G7RA 3NXSA 4RPJA 1ZXBA 5I4CA 2FW6A 4NC9A 4P3NA 3RRJA 3F7TA 1YR9A 3F6PA 1XXHE 4LJ4A 2ALJA 9LDTA 2UZ1A 1GZUA 1QP8A 3PHCA 4JP1A 3BWBA 5KMGA 2IS1A 1BRTA 4GR4A 4HDKB 2XY4A 2V97A 4QUEA 4MVCA 4LX0A 4EUKA 5DNAA 2UXBB 4P4UA 1W4LA 5JCXA 2P9EA 2ZVJA 1JQKA 5IJZA 1IDOA 1NSYA 1PJZA 1U8AA 4YTEA 4EBFA 5BN5A 2JHAA 3AW8A 3MJHA 4JHLA 5K0GA 4NNJA 3FOCA 2O1SA 3PWKA 2QLLA 2VYNA 1W87A 1U2DA 3OQBA 4QECA 4GYKA 1TVKA 4JDUA 5CX4A 5ENVA 5TPWB 1ABEA 4FB4A 4Z2AA 3PX7A 4M7RA 4R51A 3QWHA 1LD3A 1VL1A 3MD9A 1Y3FE 1Z0FA 4N0EA 3A3KA 4MW0A 3ZVMA 1LA2A 3PQFA 3EQ9A 1DAGA 1DTSA 3I2KA 3KELA 4TRMA 4EVRA 4EZIA 2RGRA 2XZLA 5EHZA 4MQLA 2QP3A 2JATA 1QIGA 2BCGY 2J4DA 4C78A 2HU2A 5TIIA 1Q3KA 3M81A 2J6CA 1UJ5A 3RUPA 4A03A 4F5ZA 1E6EA 4FFDA 1DX6A 1II8B 2GO7A 1QHEA 2D74A 3IQIX 2VOEA 1TCVA 2P1RA 2VHJA 3H65A 5DBOA 1TKRA 2Z5VA 1TLTA 2NTEA 5JZSA 4CN9A 4JLOA 1D5CA 3H42B 4MVJM 5AP9A 1G66A 3IKLA 1G7CA 4MHTA 6ADHA 3UO8B 3BL8A 1WZNA 1QOQB 4ILKA 3VM6A 2WWIA 5AW5A 2XADA 4ARVA 1NNI1 3H2HA 1X80B 5JC8A 4A5SA 4OP1A 4DCPA 1XQYA 4IH1A 5HCIA 4DQXA 2IEBA 4K9SA 1UAGA 1VPDA 1NE7A 3AFMA 3FPBA 3I2IA 1ZFNA 4C4PA 4E5KA 1IPFA 1F17A 3QYJA 4L8VA 3T5AA 2ZSDA 1D2NA 3KD2A 3W5HA 3U4QB 3PVZA 3E9DA 4BQFA 2X5OA 1EX7A 1IEWA 1OYYA 2JFQA 5EN4A 1XIVA 2GM5A 2EEZA 3EH1A 1K27A 3WDLA 4C4TA 1XL0A 1DU4A 3T61A 2YC4C 1V8PA 3QVSA 4BLSA 4EEKA 3HG7A 4BCCA 3Q7SA 2P1ZA 3OPQA 4IZHA 5TQ2A 1F8XA 1GL7A 1NVKA 1DAHA 2WV7A 3ND5A 1KDRA 1OWPA 2ZTVA 4LV6A 3DEYX 2WIFA 3LKZA 1KU6A 2RGBA 3UZUA 4BDTA 4H4DA 2CUKA 4E0BA 1ZGZA 1UXOA 1QR2A 3QPCA 4RETA 5ALKA 1N5MA 1TCUA 1FW8A 4BKUA 4KKVA 5JFTA 2JFUA 2H4XA 3H3JA 1C7QA 2IYWA 3G9TA 4LOIA 4F91B 2C2KA 3EDCA 4KAJA 1RRFA 3C98A 2ZBQA 3ON5A 3Q3JB 2AMYA 2GA9A 3I6MA 3SF8A 4B6RA 4L5BA 1VTKA 1G20A 1P7ZA 3WXBA 4EFKA 4F0JA 3WV5A 4U8HA 1E6CA 5BPFA 4LZZA 4XZ3A 4RTNA 1SCUB 2GLTA 2XF2A 1SJ9A 2NACA 2Q50A 3HEBA 1GRRA 4ND4A 4P5EA 4PO1A 3VSEA 2IYRA 4DC0A 3MGGA 4MV9A 1PP4A 3R5FA 2HQRA 4MQFA 3SHQA 1F6WA 2IUEA 1EMDA 1H2RS 3P9QA 3CSDA 5E6RB 5I48A 1P4SA 1TYBE 3WQRA 1E89A 2DCUA 2WD7A 2EX4A 1HETA 2V7VA 4CTKA 3ETCA 1D2RA 1NZDA 1GYPA 1XEXB 2HSDA 3K9BA 4MW9A 1SBNE 1ODIA 1IY0A 2EGHA 3URKA 4M9ZA 1U0SY 2H1HA 4BZXA 2VTBA 1CFZA 4EL0A 5CVDA 4MS4A 3UV3A 2ZKIA 4PO9A 4QIHA 4GSYA 3DVQX 3T3DA 1NFFA 3T8YA 4DLAA 2EFEB 1OPRA 4BNKA 2TECE 4Z54A 5K3DA 2VP4A 4UREA 3PEYA 1E59A 2NW6A 4W99A 1NX6A 2ZIXA 3GDHA 4W5WA 4E14A 4BNNA 1ZD4A 1RAFA 1T8UA 4IXNA 3RSFA 5JY1A 1YS4A 2OGSA 1HQDA 1IBSA 4EI8A 1IXYA 1NFQA 2ZYRA 2QMUA 3GY0A 2XNCA 3K1YA 3KSBC 3DO8A 3AVUA 1A9RA 1Z3IX 4PCAA 5KTSA 2WD8A 5B55A 4MICA 4PYJA 4UEQA 2QIPA 2VHZA 5C1IA 1JFLA 3VTKA 1I6KA 4CKEB 2XMZA 4TT3A 3CW8X 3CN9A 3L7MA 1DRUA 3IMGA 4TTAA 1KPIA 5IVHA 4R83A 1MQSA 1CF9A 1EESA 1SA0A 3LWZA 4FCVA 1FNSA 3SR0A 4AN1A 3D6FA 3HUTA 2C31A 1XNJA 1TUEA 2PUVA 3ZXIA 5GVSA 5FO0A 2F4VB 3DAGA 1HE2A 1K7SN 3GFQA 2PRKA 1QH0A 1XRPA 2YWFA 2WJ3A 4HPWA 3I83A 1D9ZA 1NONA 4B83A 1C4XA 2OCAA 4DC1A 5K05A 4OXXA 3ZBQA 4BXOB 2Z0MA 2AD1A 2J3KA 1CT9A 2OZLB 4IJ6A 5DHQA 3GQBA 5FH9A 1SM4A 5I7HA 1SHTX 2ORYA 2F43B 5JWHA 4WEQA 3K70D 4J91A 4LZPA 4JR2A 2VDLB 1F8GA 4KVFA 4QXAA 4D26A 2V3VA 1VGVA 2Z2KA 3BH7A 1M83A 2C4UA 3WYFA 1UH5A 1A3CA 3TQQA 5HRCA 1PNTA 1XZ8A 4IGFA 1EFDN 1OA0A 4R3UC 4GMKA 3EAGA 3MWJA 3FTEA 2W90A 5K8JB 2OXCA 1B8NA 2QPAA 3GNQA 3GRPA 2ECPA 2BEKA 4CBVA 5AVSA 1KTIA 3M3DA 3AIMA 1RQGA 2ZVPX 1RYNA 4YGYA 1QLJA 2XECA 3MJSA 2GI4A 3KYIB 3WWZA 3G9ZA 1K8QA 4BX3A 1CUUA 3EGOA 2O8EA 4FI3F 2IYLD 1M2OB 4PHGA 2HSJA 5KJ6A 2DX7A 4JI0B 3SVZA 1DAKA 3LU1A 2FEMA 2HBYA 3F3KA 4IWXA 4YCNA 4IAOA 1FVFA 3N1UA 4BGUA 3GAFA 3J81k 1XVAA 2WIKA 5ED4A 3V3KA 5FV7A 3NHJA 1CXZA 1LNSA 4QUHA 3ZCVA 1H5QA 2WJJA 2PMKA 2YZNA 2BISA 3GH1A 1DDIA 2GPNA 2VK4A 3WK9A 2FOIA 4I4CA 1LSJA 4PRYA 2TS1A 1X39A 4KXFB 3SNKA 5AJVB 5T6MA 3NM4A 4GPTA 1SKBA 1GCOA 4GQIA 3I8XA 4JVNA 3VC1A 1G6HA 1E63A 1Z5WA 1J97A 1MB9A 2GDJA 4I50A 4ZYVA 5K0EA 1UDCA 1A5ZA 2GWRA 2M6LA 2DPHA 3NP9A 4OB8A 4Z8XA 2XXJA 4BV8A 3I09A 4AURA 2ZI6A 2RHJA 2GR9A 1KVRA 1XMJA 3M49A 2JAOA 2J4FA 1JXAA 4HFMA 5AHOA 1JR3A 3C3EA 5FD8A 3V9AA 5L7WA 1RU3A 1IBCA 3NHUA 4CLOA 2ZAGA 4CMIB 4XUGB 2G77B 3D4NA 1VYUA 1GPUA 1REQA 4QUDA 4XSGA 3IEVA 4FHEA 3TO5A 4AZTA 1UC8A 1BMFA 4DGSA 2QLFA 3VR2D 4EG8A 4MQ5A 1YNOA 3WMRA 2ZZKA 1A8QA 1RKQA 2RHLA 4B3CA 1VC2A 5IF9A 5JYDA 1J1ZA 1EQUA 1T6ZA 2UDPA 3DV0B 2Z3ZA 4QLAA 4CTMA 3FH0A 2XZTA 3B20A 2O20A 1Y98A 1Z5UA 2VJNA 3BTOA 3LF1A 4ZOLF 1BVRA 4L4UA 4BE9A 4KHPB 5CTJA 1FEZA 1CG6A 3HSSA 1GSHA 3IUMA 3SK0A 2H54A 4OAOA 4X60A 1D2CA 3K6RA 3QK7A 1UM9A 2Y1EA 1BQ4A 2JVKA 4BVBA 1QE3A 4GD3Q 2JFXA 3ZV6A 5E2IA 5JMPA 2HU7A 3I04A 4M53A 5JBNA 3GPLA 4KV7A 4PC7A 3WR5A 3W5DA 1VKNA 1X19A 3EDOA 2Y1OA 4FNGA 4JI8B 2H48A 4WLUA 1EP3B 4Y6GB 1PX2A 1UKYA 1GSOA 1ZOLA 3KVRA 4N7RA 5DHRA 5TEVA 3IKTA 4K6FA 1PDVA 4Y2JA 3Q8LA 1DC4A 4ND8A 1YE3A 2VDJA 2VZ9A 1DG9A 4OHVA 3SZLA 3UW3A 4BB6A 5F5LA 1SHZA 1O94A 1ZU4A 1JLLB 2HHLA 3E7FA 2GTHA 1JR6A 5F3DA 5J47A 1XDBA 3L93A 4QYIB 4TVBA 5HNKA 4GKKB 2ETXA 1D2EA 4CR6A 1X1SA 3C48A 4IJ5A 2H29A 4KMRA 2NSDA 4EITA 1H8HA 4GXRA 3Q7QA 5IF3A 2ZZNA 3OFNA 3B6EA 2O2GA 3AK4A 3ZY4A 2GUGA 4YRMA 4IKPA 1PD0A 4G8CA 4F1WA 2CLLB 2YUTA 2QTVA 4GX5A 4OHKA 3KPVA 5E8JA 3UAGA 5KS2A 2E1RA 4QXPA 3RTGA 4FYIA 1K4KA 3RTAA 3IAFA 1PGOA 2VZEA 4V0SA 3VH2A 2G82A 4BJ6A 2OFWA 1AV6A 4NLLA 3OPYA 1KMMA 2OL4A 4TM7A 1O08A 4L16A 3GARA 3ZN2A 1DKUA 2V98A 3N28A 3G6KA 4MV1A 3UATA 5C2JB 2QXYA 4KU4A 3K70C 4MDYA 4MS1B 2WSIA 2Y9PB 4I9GA 3LI2A 2PRIA 4D92A 3JPWA 4ZVSA 3MIIA 3F9IA 1QB8A 2GARA 1Y34E 4RA9B 3SXPA 1NY6A 4P92A 4ECEA 2Q6IA 4KYVA 2IS4A 1Z06A 2CXPA 2OK8A 3MCUA 4JVSB 1BH2A 2FQYA 3RC3A 2CKDA 3DHEA 4B32A 4IIXA 2DR2A 3RT7A 1KJJA 3L4JA 1NM5A 1UPXA 3N3BC 1YZUA 1ZK2A 3LKDA 1KGDA 3HDQA 5HZGA 4B8ZA 4V1CB 2YOHA 3I58A 3PQ4A 1ORWA 1SO8A 1UEJA 3L5KA 3X1YA 2HDHA 2R1VA 1T36B 3OZRA 4PRLA 1L5HA 5I4IA 1VECA 4QOJA 3K9FC 3N3AC 4L72A 1RJFA 4P32A 3ZE2B 1IK6A 1XAGA 4MMXB 1G4UR 3EARA 1LW6E 2O05A 4LHSA 3W2TA 4Q4CA 3DP7A 1CRZA 3PA8A 4MWZA 2JGMA 4UATA 1VSVA 3DBOB 4QX6A 5C8ZA 5L51A 5K0TA 3VUFA 3O1HB 4XDHA 5CX1A 1X1EA 5KCMA 3TX6A 1P19A 3V1KA 5B2FA 5CB8A 4DYHA 1HQKA 1J4AA 1UWKA 3AETA 5H81A 2BI7A 3HYSA 3MTGA 2JFWA 4A0FA 3C43A 3BE5A 2XUDA 2R68A 3CEJA 5KNDD 5LC1A 1GDDA 3GNSA 3UV7A 1QZ3A 4RVCA 5D5QA 3LS2A 4B6GA 4O29A 4I46A 4DXDA 2HHHB 3CZPA 4BUCA 1N6KA 1NKVA 3FOEC 4FJ1A 3T06B 1GTRA 1J06A 2OE2A 3DHWC 3HVKA 3F5DA 3P0IA 4FMDF 3HXQA 2X5NA 1N6OA 1LJUA 4DHEA 1H0SA 4PIPA 2CF5A 1GNLA 2O7VA 1UK6A 2OORA 2RAPA 2WMDA 3F49S 4UMEA 2ZTHA 5M3BA 1GQRA 1TJYA 1TX4B 1UR5A 2M9MA 4MVYA 3WFZA 1GU0A 4LMAA 5LP6F 4DLTA 2ZU0C 3N8DA 4FFNA 2D6FA 1KJYA 1MVNA 1CE8A 1M67A 2BWJA 2DQZA 3UWOA 4B80A 2PYIA 3FTQA 1NXSA 4MRMA 4OLAA 4UMDA 4MUYA 3HUUA 5B7PA 3C6BA 1SCNE 3AR8A 1IN4A 3B6ZA 1EHIA 1IB0A 1PLJA 2Z1MA 3A27A 3P52A 4WESB 5NULA 3U61B 2HU5A 2LBPA 3N7UA 3QXXA 4IGAA 2ZP1A 3OX1A 4ANFA 3I9V1 1RXCA 3QU2A 5FBZA 3HXKA 2CF6A 2OENG 2PV0A 2RG1A 1R0WA 2O59A 1QP7A 3P2JA 2FG7C 4LHWA 3KSMA 4KYTA 4ARBA 4ER6A 3VDQA 1J21A 2ZB7A 3WWCA 2FTKE 4TLAA 3MWDA 3UB3A 2BVNA 1U3TA 5EJ2A 3ZHYA 1K06A 4E7OA 4YMGA 1RHQA 2HBQA 1VSTA 3O95A 4XVHA 3K6SB 4DM4A 3LHFA 1P1FA 1BE0A 1MBZA 1YC5A 2JS7A 3CX8A 4QDXA 4J3FA 2Q0HA 2EFDB 2ZPUA 3DMTA 1WPGA 4JC8A 2P35A 1CY1A 2ZYIA 3RWBA 1FS4A 1NFRA 2YXPX 3K4HA 3AG5A 3LYHA 1W1IA 3KZOA 3E23A 2HMSA 1U2PA 2KI5A 2JKVA 4QHSA 2CKMA 3PEUA 1BQ3A 3K0SA 4PX2A 2QRHA 4JL6A 1EWYA 4G23A 4P08A 4WJKB 2OBMA 1KAQA 3WSTA 3ET5A 4A0GA 2J3MA 3AJAA 3NIBA 4RKRA 4H4EA 3SQLA 4ZIRA 5JJCA 4ZJZA 3JQBA 5FLYA 4CFSA 4HJRA 3F6EX 1NX9A 4S1PA 3V8PA 4YP6A 1Q1EA 1QIFA 2JFPA 3ZWWA 3C5CA 3BSFA 4EFMA 1I3OA 5K2MA 2LKCA 4MNTA 1Y9ZA 4P4SB 3W5CA 1USGA 3ASZA 2GBGA 5HKLA 4JR0A 3QQ5A 1GM5A 3Q5EA 5TV2A 3U60B 4OU5A 3O6VA 1TOAA 1JJAA 1H05A 4GR5A 2FP4A 4MGKR 4MUHA 3ZD6A 2D2EA 3NHKA 3T1HB 4WSOA 4OVKA 1DOZA 3BXPA 3LC7O 1E1DA 3ADPA 1AQIA 1FTYA 1KY4A 3GJSA 3MRSA 4MOWA 1T2NA 3PVSA 4OA5A 4URHA 4EECA 1GPNA 2LDXA 3AVQA 1PFKA 4D4MA 4XYBA 2C9YA 2WF7A 3PD0A 4G5HA 2J9GA 3G9UA 5JD5A 4TRJA 3T7RA 1MO6A 2FEWB 3H3XA 1JU3A 4NOKA 1NJ2A 4KJZA 3GLIA 4Y98A 5E1BA 3K32A 4M9CA 3D4BA 1NI5A 4LC1A 5HTKA 4KOEC 3AHIA 3B1ZA 3M2TA 1VG8A 1C2TA 3DC2A 4IBOA 4TLCA 1W5FA 2C3PA 1NNEA 2CV2A 1Z8FA 4BFVA 5CVCA 4RU1A 1E0DA 3WAKA 1RSZA 5KX5F 5B58T 4PGFA 1RTTA 2DMRA 1OLUB 1W44A 2AYZA 1G8KA 2YHSA 4N7BA 4ZHQB 3HM2A 4MDFA 3NFYA 3PP8A 2DCMA 3K94A 1K86A 3O26A 4QDKA 4R2LA 2PKEA 4HYTA 2O4UX 1GKIA 4RXMA 4RCVA 3STHA 1Z74A 4POOA 1O8BA 2K2WA 3QMMA 3ZWMA 5H68A 5DM1A 1GNQA 5FPHA 2P2YA 1ZVJA 3AFIA 4EB6B 1NQXA 1HOXA 5AVJA 5HTOA 2QN9A 2XJ4A 1QFMA 4U9IS 2A86A 4YRDA 4CR7A 3JD0A 5ALNA 5HYVA 3VI3B 4B44A 4XDZA 5FBWB 3KB2A 3QBDA 1E60A 3H9JA 4E4YA 4LZOA 4PN7A 5LDDC 1TEXA 4J0CA 2P2CA 2IYVA 3TCKA 3U81A 2AHRA 1SQSA 2PBFA 3AXTA 2AOUB 1HXHA 2ESRA 3LY5A 4RH0A 4YLEA 4FR5A 3MQ4A 1K75A 3IO5A 3AR3A 4EVIA 1KYQA 2VI5A 2UZAA 1EINA 1Y3IA 2UYHA 1DCTA 3OFKA 2C29D 5ALWA 2ZXEA 4N7MA 4B75A 4BMVA 1Z7WA 3D9QX 4L0MA 4PHTA 1QV9A 5EY5B 4HRXA 1Z7BA 3PWTA 5GQSA 3BJIC 4ZZ2A 2B2CA 2CNOA 4MAAA 3W5JA 3LW8A 3PCRB 4FINA 1JZTA 3DAFA 5U1PA 5COBA 3S1LA 1FQKA 4AZ0B 5CA1F 2HA3A 2EKPA 3B9BA 1BA2A 3ISVA 4IM7A 3QEBZ 2Q2QA 2YJTD 4MQBA 1CIPA 1Q16A 3EEFA 2OXEA 1VBFA 1XVIA 5EWLB 4PLFA 2ZIEA 3MILA 1HDEA 3V6MA 1FP4B 1T9AA 3BKWA 3NPMA 5KNBD 4O25A 2VPPA 4FWBA 1GPMA 2NVBA 3R6WA 4DB4A 1ZR4A 3CEHA 4JA2A 4ZEWA 2RHRA 1LBIA 2PNFA 4GSKA 3RC1A 4E08A 3NDJA 2YY7A 1QTIA 5JYCA 2NVWA 1SXGA 4MMYB 3W4IA 3M1AA 4DBLC 1RXUA 2APJA 4EJSC 5AXAA 3L41A 4Q4LA 4EIWA 3USZA 3LKBA 3OPVA 3TGWA 4F4UA 1VBNA 1UC5B 2Z56A 4KLNA 3U4AA 4FM9A 4NYIQ 3P9XA 1IY1A 5K8IA 1JEYA 3D3EA 5DI3A 1DZIA 4I4TB 2CFOA 5DBGA 4RK0A 1T15A 3RU2A 1NA5A 1NT2A 2CNWD 2SCUA 5EZSA 2I4LA 4UTRA 4RLFA 1TD1A 4CLRA 4C4SA 3TW0A 3GAZA 4MCJA 3V2IA 2FSUA 1HYBA 3AM3A 5CIQA 3HXPA 2F3RA 4JITA 2ZT7A 4YJ3B 2W0MA 4RWZA 4Y6OA 3AHJA 3OJFA 3V8RA 3VU3A 3ECCA 1E3QA 3F96A 2IELA 1E9DA 2RAUA 4HDNB 4XDGA 5C5EA 5HVNA 3I5XA 5L6MB 1ULZA 2AKYA 4TVSA 3H2YA 3PGXA 4RPKA 2Z2JA 3EZGA 3TMKA 4X5OA 2R6AA 1C9NA 2H08A 1DIAA 4DQKA 3NAZA 3C3MA 3S7TA 3B51X 5AW3A 5FQOA 2QQEA 2VCEA 1V39A 3F5FA 3JYOA 4HWSA 5HM8A 2BYTA 2GYWA 4G67A 5JE8A 3VR3D 2H4ZA 4JSTA 5EIHA 1U8CB 3M4NA 1EJBA 4KL8S 1UQTA 3EF3A 1KXZA 1MPTA 5CHYA 3C1UA 4K88A 2QN6A 4BOYA 1TTQB 1WMEA 3IJRA 5T8KC 2I2DA 4PS0A 1XDZA 2VF5X 3PBKA 4UE6A 4BVEA 5AUNB 4TYWA 4Z9AA 2EFCB 2QJWA 4RO0A 1OZ0A 1XU9A 5HFNA 5HQTA 2QBYA 4QL3A 1X74A 3P0RA 1O5OA 1XZLA 4AKSA 1LB1B 2NUPA 4J90A 4CTOA 1PAUA 1UPAA 4M54A 2V7QD 3GPCA 5EHNA 1JKMA 4XQCA 1SKAA 4C5BA 3AOGA 2E4XA 2NM0A 3RFTA 5GP1A 1SKMA 4WNAA 1YVUA 2HMTA 4C3UA 1EBFA 4MIYA 3B6JA 4K7JA 3DLBA 3CF4A 5BMVF 3F5SA 3OCXA 5I3ZA 1NW4A 2GPWA 3FFAA 1QO0D 5IYZF 4KUEA 2PZAA 4QPCA 4F4DA 1XK7A 1SH7A 3A4YA 4HDSA 1GCAA 3D2CA 3ILSA 1AGPA 1LVGA 1YA6A 2XYHA 5EE3A 2BL4A 3AL2A 2NZUG 5K3BA 3SGLA 4CEIB 2RB4A 2ZLBA 4M55A 2OCBA 3TLGA 4AROA 5HIKA 2GHIA 1FQJA 1NQ5A 4PCLA 2PD6A 4EB8A 1WXWA 3UPUA 2O50A 4KPFC 4DSUA 1NIJA 1MOQA 4Z1MD 1FU7A 1NQUA 3ZDDA 3K4PA 4M1MA 5BSKA 3VV2A 2YMPA 1U0GA 3FXAA 1SR8A 4OV6B 3UT6A 3ZVLA 1Q2UA 2COKA 1YZQA 1BVHA 3JZAA 1ZGCA 3CX7A 4C7XA 2QZSA 1EP1B 4CU5A 2UUCB 2QYHA 2HA2A 3OLYA 4OYHA 4KO8A 5BT8A 3IOMA 4EHHA 2YXDA 1ZVVA 2A1TS 4C22A 3D6AA 3K0BA 4I5IA 3K4QA 4CKZA 1M2GA 3GFSA 1O95A 3N5KA 1SVMA 3PDWA 4Z2YA 3WQQA 2V45A 4HBZA 2B7BA 2M6KA 1U7TA 4EATA 2FFHA 5L45A 2FV8A 2PSFA 1L7DA 2AZMA 1H69A 1N5RA 3BMQA 4BBPA 2ZJYA 3DEIA 4W7SA 2Y1LA 4ZGGA 4CPDA 1ADGA 3KAKA 2B8JA 2BUCA 2QUBA 4JI3B 3E18A 1HPLA 4GPBA 3S8MA 2FJ0A 2ODTX 1A9SA 4KO1S 2VZ0A 3ICCA 1RWWA 3OWXA 3VMFA 2WU1A 2WA1A 3NUGA 1FX0A 2Q46A 1E3WB 2JJ1D 4GI7A 5G4KA 2Z5GA 3ONFA 1M1NB 3L7AA 4WY2A 4RCZA 5D1HA 4LOHA 4CIYA 2BFDA 3GJ6A 3Q10A 3H75A 4CDMA 3KQVA 3IEXA 4OTZA 1NLYA 5A4FS 5AVUA 3OETA 4IF6A 3ZK8A 1E61A 3U37A 2B6HA 5T6BA 3QE4A 4PVDA 3O31A 2R00A 2QN3A 3RC7A 2QAIA 1Q6YA 1T10A 4FGLA 1Q1GA 3MG9A 4KQMA 4KPGA 4I5EA 4PZPA 5GY7A 2AQIA 1SXPA 1Q5PA 3VZBA 5D3QA 4F71A 1V8DA 2J07A 4A6XA 1E1KA 1Z5NA 2IEYA 2VPIA 3UXEA 3UA3A 16PKA 3WHPA 1MDFA 1X1QA 4Z0NA 1XYVA 3OE7D 1E1QD 5HSGA 1K97A 4ENTA 4RF5A 1TAUA 3FGNA 1YMUA 4TV8B 4Y9SA 3CFYA 1WW3A 1J0DA 6GPBA 3QE9Y 1M3SA 1XYYA 3KKKA 3SICE 4BYMA 4OQMA 2YMQA 3GPIA 1XNHA 2O2DA 1DC8A 2WFLA 2B8EA 5HG0A 2QRKA 2M2IA 2M1XA 5TX7A 5LNK6 1SXQA 3INYA 1AUPA 3GP8A 2ZS9A 4TLEA 2PLRA 4FBGA 1O5TA 3LRXA 3L7NA 1NUPA 4X45A 5IDVA 4ADSG 2IOFK 5SYAA 3UOGA 2M6RA 2H7VA 2OK7A 4CEHB 4DUYB 1FE8A 4WDQA 1IY2A 3WRYA 3I9JA 3ZD7A 1YQEA 4DMUB 2PBZA 4LHZA 3RVMA 1N8NA 3NWEA 4KO3S 4BEBA 5FO1A 2IOQA 1FA9A 3FFBA 4DMHA 4DLPA 4PAOA 2FF5A 1LZLA 3M89A 3RYFA 4R1OA 3D8BA 1C1DA 3QOYA 4G4GA 4Q7JB 5AVKA 1TFRA 3T4PA 3MTEA 1H3NA 3FHJA 5CA0B 3QPVA 1K7YA 2OQVA 2WM9B 4NYMR 3NEJA 1G41A 3UYLA 5CM2Z 1DS6A 1R8JA 1JI3A 1TZCA 1XMPA 2P69A 1M34A 4LDQA 1EVLA 5D5HA 1UAAA 3ROZA 2AFHB 5C8VA 1V11B 4FXPA 5JAQA 3V6LA 2R7NA 1KK1A 2G4CA 2QSZA 2YBEA 1ETHA 4O4HB 2C7VA 2C99A 1ZJ5A 3PXAA 3SHOA 4A8PA 1KI2A 1KE2A 1KYXA 1X7YA 3ZQ4A 3AVPA 4LCBA 4OREX 5E2AA 3THRA 3UV6A 1Z7EA 4XIFA 4YDRA 4EYSA 1EXDA 4AF6A 3IUPA 1M1XB 3ZC3A 3PGLA 4IXWA 1R10A 4R8MA 1WW8A 2EKLA 1W59A 2IYTA 2NO4A 4NKRA 3VR5H 1ULHA 2R6R1 4J7AA 2YWRA 4G5YA 2XCSB 4HQ0A 2RHCA 3NTOA 1QG0A 3BD8A 4GE3A 5JCOC 1M5UA 2YMMA 4S1WA 5CDSA 4JJAA 1V4VA 2DY0A 1ZWKA 1EG7A 4H7IA 1C1YA 3AVWA 4JP2A 1NBAA 1XFDA 2G4VA 1ATIA 2ACVA 1RHKA 3ZKWA 1F5SA 6YASA 2JLSA 1FXWF 3ZEAA 1VPVA 1X7XA 1Z6AA 4GKVA 3DBLB 1FFSA 3QSGA 4F2DA 4BE7B 1SQGA 2I2CA 4RV5A 5CCXA 2VDVE 1M2KA 1J5EB 3W2EA 3QWFA 2FDCA 1DBWA 4NAUA 4AO6A 1KEWA 3KR1A 3OZBA 3ER8A 1DQRA 2C2MA 2QE6A 4RDCA 1JSRA 2CYBA 2W00A 4Q1CA 3SFZA 1H2BA 4IIEA 3WICA 1M0EA 1S2MA 5BRAA 4DR6B 3T5DA 3WBBA 1A77A 5DTEA 1PK7A 1JH9A 4L3VA 4LTDA 1VJGA 4X44A 4EGAA 5H8WA 4BVGA 4JSYA 2EDAA 2R6HA 2X9NA 3UUWA 7REQB 2AV6A 1T1JA 3GJ4A 4IH4A 2R87A 2BFCA 4W9NA 3U9TA 3UTCA 3P2MA 2HH9A 2HDWA 3I28A 1ESCA 1WJGA 3WFIA 3ADDA 3NH9A 1VHLA 5JNUA 2BGWA 4U63A 2D1RA 1XD8A 3PDIA 4XWYA 4ZAFA 2W6ID 5KPDA 2PKQP 4NXMB 3OMXA 3WMWA 2BN4A 4TPKA 3JTEA 2RE8A 1JVSA 1XTUA 1EVYA 4C0BA 5CFNA 1ZX1A 2X86A 3W9YA 3JQRA 1K8RA 2Q4OA 5CT4A 1U7UA 3L79A 1GCUA 2GD2A 4OK6A 5ANRB 4CI9A 3P9IA 1FDUA 5ALLA 5K99A 3MTJA 3FUVA 3VXKA 2HF9A 3BQNB 3ETNA 4WLNA 2VJDA 1UBEA 1XCBA 2AJLI 2C9BA 2IIBA 2IP1A 3AM4A 3QUTA 4NMLA 5JZOA 5JTUA 3QIAA 2G17A 2OP0A 4UC0A 2Z8ZA 3OJWA 4OKIA 3WNZA 2Y93A 2YV2A 5IZCA 3G68A 4E70A 1BCSB 4LYEA 4JK3A 1YASA 2J31A 4MKFA 4C6RA 2MIIA 3OQJA 2R65A 3S2IA 1KO5A 2CL6X 2F6RA 1UADA 4DKXA 5JFGA 3GEHA 1SCDA 3OQIB 2YR0A 4BFWA 2N3ZA 3AEZA 4EGSA 3E9CA 4N0PA 2CZGA 4D5EA 3QGMA 3NYRA 4QOFA 5J9FA 5I47A 1I6MA 2Y71A 1QLHA 4TL6A 5E1OA 1N8KA 2JI4A 2QWXA 4CMEC 2BFEA 3C24A 2X8BA 1JIIA 2FN8A 4Z99A 5ALPA 2PN1A 2VF2A 3LDFA 4EYQA 4O2RA 4MP3A 3DTVD 2DWPA 3EFBA 3W6NA 2WF9A 3BWXA 2KX7A 3IDZA 3WLPA 5FFNA 5SZJA 2FMIA 3ZWNA 4AJOA 4BVAA 3ZWXA 1IWBB 1S9HA 2GZMA 2HFKA 1G5IA 4WBNB 1MRNA 3KXKA 1XOIA 3UGJA 5LZ2A 1L5QA 3WA7A 2GJ9A 2PUCA 4CTNA 2HSWA 4XJSA 4EQ6A 3PDCA 3HJFA 4ZHQF 1PJQA 3CX3A 5EGSA 2GPYA 2NSHA 3RV3A 3C8MA 1ST2A 3WJ1A 1C9EA 1KI8A 3L04A 4IV5A 4MV4A 1X7WB 3EIEA 3M4ZA 1RAEA 4MCAA 2GEKA 5AXBA 1X15A 2ZITA 1XD2B 3C3YA 3O75A 4AS3A 1E6KA 1WDWB 3GCDA 4YC7A 4ZYYA 5BOSA 3TXXA 4OHWA 5ABPA 4RYLA 1AO3A 1N57A 3H8WA 2YIJA 3QPAA 3LBAA 3EVGA 4UTVA 4KXWA 1G17A 1Y7TA 5K51A 1J20A 1M8JA 3GRUA 5JQGA 4HRVA 4TL8A 4N5MA 2BF4A 4ECAA 1FRZA 1KH2A 5IP5A 3FCUB 3GLTA 4G0UA 3MQFA 4CG0A 4DAEA 4X66B 2AEJA 1SD1A 2FFBA 3AF5A 4B6JA 4EG7A 5MFZA 5FJJA 2NAPA 4EHBA 1DHTA 3QZUA 2WJIA 3K0AB 1WUIS 1NHWA 5DYIA 1ZUHA 1PT7A 2XBLA 4N5LA 4ZCIA 3WIVA 2VTKA 2AYYA 4B3HA 1KPGA 3E0QA 3WLAA 3E9EA 4LJKA 1LS1A 1LXCA 2GCIA 3V2UA 1YQQA 1V43A 5WRFA 3QUSA 3ROTA 5TT0A 5EVJA 3MJDA 2UV8A 5KOHA 2B69A 2BI4A 4OB7A 4QARA 3H17A 4KE6A 1QAQA 3ZIUA 2A57A 4KPEC 1M8FA 1W0KD 4TVKA 3W8FA 2FGKA 3UUEA 1YHNA 1Z0KA 4WASA 1TZBA 1W9HA 5THQA 1D07A 2XQJA 4OMCA 2GJAA 5FDFA 3L7BA 4DVGA 2CBZA 3ZWOA 2IX3A 1O0CA 3QBEA 1NJ5A 3ML1A 3O83A 4X7RA 1UP7A 2DKFA 4M1SA 3NIWA 4NY1A 3ABRB 1YB4A 4YUAA 3CYFA 4ERNA 1TK2A 1XPJA 5HRUA 2IZ6A 1DXQA 1FUYB 3TAUA 4B3BA 4ARSA 1H2ZA 2O2IA 1ZEJA 1XXHA 2NUAA 3D6MA 3OO1A 4MYTA 4BP1A 2ZJ1A 5K0CA 1J2EA 4EHDA 2R4QA 5J2UF 1NUQA 1FNMA 1QH1B 2WJYA 3MQ2A 3U39A 1U8EA 2P0EA 4P36A 3OHPA 4PICA 4XDYA 2WYUA 3M7IA 4Z5XA 1LY1A 1UOQA 4I4TF 4X85A 5ES3A 3D7LA 3SY8A 3GMIA 2A33A 4H60A 1YAHA 2O0HA 3H9BA 5IUJC 1A9PA 4M0LA 1KIAA 4TMKA 3ZJYA 2B0JA 3DOHA 4P7KA 5IDXA 2HMYB 4XGNA 3SVTA 4MP6A 3BERA 1ULTA 3BAFA 4TMVA 1R0YA 4YJ3F 3ZDQA 2B5WA 4A1OA 4AFNA 4ZVUA 1A2QA 3VOBA 1CR4A 5EIEA 2H17A 2EJUA 3D4OA 5C1OA 2X3YA 5B58C 3NRBA 4ZOLA 5EJ7A 5G40A 3DWEX 3CONA 3WE7A 1PX0A 1WG8A 1F5NA 2ROQA 5CBPA 4UASA 1JEJA 2K7FA 3BEOA 5AKEA 3QJYA 4G25A 1LNQA 1CERA 1MV5A 3WTBA 4N3CA 1U63A 4GQBA 1UBJS 1W2WB 1IHYA 2KW5A 3KOOA 5KVSA 3JQPA 4NH4A 4O2AF 4DLWA 1XNRB 1W4ZA 3ANXA 2I9PA 3NTQA 3PSAA 2OOKA 4LOJA 3VZPA 1F4VA 2JASA 4LGYA 1TQ2A 3IUNA 3T52A 4LKOA 4I5GA 5E6SA 4J49A 4RWEA 3KZXA 4MPTA 3UQZA 3WMEA 1EBUA 1Z38A 2ECOA 2GM3A 2XMSA 4TL7A 5A0FA 4EY7A 3AP1A 2JFYA 4GICA 4LBVA 4X8OA 5K01A 2XNSA 3DZDA 3LG2A 4CM6A 4CIAA 2PJRA 4UTOA 3X1JA 1ODTC 4MA0A 1C1XA 3UYKA 4CHTA 4UTZA 1SU7A 1C81A 3Q3GE 1JWBB 4YT8A 3B7WA 5IDWA 4NMHA 4FLMA 2G1AA 1KZHA 3CKYA 3AX6A 1XZHA 4HJXA 4IIVA 2O3RA 4B4OA 4IEFB 2JLBA 4CT5A 5FTLA 4ESVA 3M6XA 4IYJA 5L53A 2D7CA 3EGCA 2OV2A 1M7HA 5JASA 2HSGA 2JLZA 3PD7A 3AB7A 1TW3A 3OM8A 4GEKA 1I3MA 1DUVG 3HVJA 1GGJA 1MTZA 4GKJB 1N4AA 3Q3VA 5G0TA 2ANBA 1VDZA 2W6JA 2DHEA 2OHVA 4JLUA 4QGFA 4XWKA 4EPYA 4X92A 1DO8A 3DA8A 1BZYA 1NKTA 5ARCA 3ILVA 4KXUA 3OEHA 1CLEA 3NHMA 4HZGA 3ABZA 4J1NA 4BC0A 4BO9A 2BHTA 2QVCA 1FPQA 5FAXA 4BUJA 3AR9A 3COPA 1SIUA 2V7WA 1FMTA 4IIYA 4PQYA 2RBEA 1PNRA 1T2UA 2MTBA 1SMKA 3H2JA 4V0KA 4WN9B 1N34B 3L0SA 1HLFA 2AR9A 4KGZA 4FUQA 5C31A 4YI5A 3DGFC 4BNIA 3DXZA 1VCMA 3KEQA 4OQXA 4XLLA 2P5TB 3F9CA 1VMDA 3U44A 3K16A 1KQGA 3AM1A 1NXVA 3KKLA 3TRJA 4BWYA 1YIAA 1F0YA 2E18A 3RTEA 1XA4A 2PZJA 4WAUA 3PI6A 3GYBA 1SBZA 3FE2A 2CC2A 1B8UA 2O0LA 2IKSA 4NL4H 5CH8A 1ZEMA 1M2WA 1VRCA 1YBHA 3CPJB 1KRXA 2P67A 1X77A 3E3OA 3LM8A 1ZZGA 4MV6A 5K6TA 2CE2X 2XUZA 3DLTA 5HGJA 2WRZA 4Q4AB 3RAJA 3LQRA 4FYVA 3GT3A 3HSKA 3S1AA 1EX9A 4OI0A 3ZZ0A 1SB9A 4JJIA 5CDYA 2PAFA 2CE7A 4W6QA 4S1VA 1JEAA 4TXNA 4EYEA 1GAQA 5CXXA 3E2IA 4F3YA 1HFWA 1WZUA 2XTJA 2VPXA 3B5IA 3GEDA 2IYOA 1R5OA 5LMNB 4NCHA 2PHZA 2W93A 1MD9A 4XLZA 2NVUB 3GRVA 3BDAA 1KWKA 1FUKA 1A5TA 4BDSA 1TGYA 4A15A 4ND5A 4LYYA 4QYSA 3LLSA 2AF3C 5LP1A 3OOYA 1OAOC 5KYKA 4II2A 2B1JA 1KJ8A 2CMGA 2NV6A 4IRUB 3UA4A 4DQLA 3AHFA 3B1JA 1IZ8A 2C0QA 4U2CA 3THOA 4AWAA 5KYGA 1JHRA 1NMEA 1SAYA 2FKNA 3PKIA 1R4MA 3X2FA 3H8VA 3QY0A 4TYPA 4NEQA 4P84A 4YUVA 2Q5CA 3AF6A 3BMOB 1SUEA 5F76A 1DELA 1V3VA 4RX1A 4IJUA 1NI4B 1B42A 2C3MA 4H3SA 3WYBA 1UKBA 2WBLC 4ZXPA 2XYPA 4HDKA 5LXTB 2PBRA 2YFHA 4Z8YA 4JL8A 3IQEA 5CNJA 3OZAA 5IJAA 4L6CA 5LP6A 1PF7E 3IV6A 2VDWB 1BQEA 1T6YA 3EPRA 3MS2A 3R0QA 1GIAA 4Z7OB 1KO1A 3FTNA 1M10A 3IXLA 3VOTA 3K0HA 2YXBA 1Z2NX 1G3UA 3I1YA 1WMDA 2D3TA 2JLAA 4HO1X 1WUYA 2FSVC 1X3SA 4GLJA 4IR7A