4E12A

Substrate-directed dual catalysis of dicarbonyl compounds by diketoreductase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
283
structure length
283
Chain Sequence
MTGITNVTVLGTGVLGSQIAFQTAFHGFAVTAYDINTDALDAAKKRFEGLAAVYEKEVAGAADGAAQKALGGIRYSDDLAQAVKDADLVIEAVPESLDLKRDIYTKLGELAPAKTIFATNSSTLLPSDLVGYTGRGDKFLALHFANHVWVNNTAEVMGTTKTDPEVYQQVVEFASAIGMVPIELKKEKAGYVLNSLLVPLLDAAAELLVDGIADPETIDKTWRIGTGAPKGPFEIFDIVGLTTAYNISSVSGPKQREFAAYLKENYIDKGKLGLATGEGFYRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual catalysis mode for the dicarbonyl reduction catalyzed by diketoreductase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Diketoreductase
total genus 109
structure length 283
sequence length 283
ec nomenclature
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 4e12A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e12A01
5IAAA 4D79A 2GSDA 4YWJA 3GPIA 4Z3DA 1DC3A 2CDCA 4JNKA 2EIHA 4PRLA 4W7IA 1I2ZA 1KEWA 3CUKA 2GUGA 2Y1EA 1ZNQO 3GG9A 1AXEA 2RH4A 4RLSA 1I33A 2E6UX 1I3LA 1XCBA 3PQFA 3N7UA 3TF5A 4KWIA 1BXGA 2CVQA 5TT1A 2FN7A 4FW8A 5EQDA 2I3GA 3PJGA 3DBLA 2JAHA 2YQ5A 4BO6A 5B37A 3DFZA 2H63A 5A03A 4R54A 2C07A 1FDSA 2EEZA 3PDUA 4D3SA 3SXPA 2VRCD 1UXIA 4TRRA 2VRBA 2G0TA 5T67A 2DVMA 3EK2A 4MOWA 3W8FA 2FPPA 1JA9A 3DBRB 2E37A 5CG1A 5G0WA 3KYDA 4JROA 4JK3A 4TKLA 4N5MA 5BNFA 3RJ9A 3AUAA 3PHJA 3FN4A 1HE5A 2EW8A 4U7WA 1SBYA 3JCZA 1IE3A 1GCOA 4ALMA 2RAFA 3EVNA 1R12A 2C2YA 4Q3CA 2DT5A 1OAAA 2PA3A 4R41A 4B7UA 4CJXA 4CM8A 1EE2A 3DXFA 4BO9A 3ANLA 4IM7A 4CMIA 2E48A 4PLGA 3NV9A 3P2YA 3TOZA 3EUWA 3IUPA 3FNHA 2G82A 4DA9A 4IUYA 1H2BA 4IIUA 3EZLA 2DC1A 2AE2A 4M87A 2Q1TA 3KLMX 2TMDA 3BMOA 3VDRA 1GUFA 3V5NA 4AJ1A 3JYOA 5L7TA 2X6TA 4H16A 2Y93A 3K6JA 1B8UA 1EFKA 5JCJA 2PGJA 1D1TA 2POQX 3QWAA 4IJUA 3RWBA 1GUZA 4O6VA 3WXBA 1JKIA 5B4TA 4ZRNA 3Q0EA 4WLUA 1F12A 3QVOA 4J7XA 2VWGA 4LVCA 4FDAA 4TRNA 3D3WB 2OHXA 5I7VA 4EBFA 3GVCA 1ZKMA 1OI7A 2HK8A 3OF2A 4I1IA 4RVGA 4E5YA 2NV6A 1GZ4A 4JBIA 4PVCA 5ILGA 1DDOA 4HV4A 2DFVA 3CIFA 4J1NA 3BHMA 1YL5A 1I30A 4CQMB 1WMBA 3Q9UA 2IYOA 1DJNA 1C0KA 1HZZA 3JD4A 3OJFA 3HADA 4JN6B 4JJGA 1IYZA 1KVRA 2Y66A 3U9LA 1KC3A 3M2PA 4AJ2A 3TNLA 2IXAA 3C7AA 4XKJA 2QHXA 3G3EA 5A06A 4JJIA 2YHIA 4RVDA 1NQ5A 1AHHA 1B14A 4O1MA 1WW8A 1KC1A 2DUUA 4PG6A 3V8BA 2QRKA 2P9CA 2PD3A 1P77A 3C1AA 1J0XO 4NFSA 1KERA 3B1KA 4JJFA 4UREA 5DBIA 4YT8A 2LDBA 2QRLA 2VQ3A 3ITDA 4FR5A 4UULA 2OXIA 5CDGA 4YT2A 4ND3A 3VTZA 4A73A 3F1LA 4BNLA 1N7HA 1GY8A 3GR6A 4R3WA 1A5ZA 1E1NA 4J9VA 1ONPA 1FK8A 2O3QA 2NTVA 2WDZA 4NQZA 5THKA 1P45A 3F5QA 1T2AA 3PZBA 2Y1GA 1YVEI 1AXGA 4NH4A 5KKAA 2IEDA 3OMLA 1R4NB 2X5OA 5KNLA 3GRPA 5H81A 1XU7A 4FJ1A 4XQGA 1XELA 5L4NA 1PQUA 3GPDG 2Q1WA 2QG4A 5AQ1A 1A9ZA 1F8GA 3DMTC 3GNTA 4L9RA 2FZWA 3QE3A 3G0OA 3QP9A 2OGUA 1YONA 4IZHA 3GVHA 2DM6A 1IB6A 4M54A 2ZTUA 3RUIA 4D44A 5J23A 1LSJA 2DAPA 3F4LA 4CV3A 2IYPA 3WBFA 4CM6A 4OM8A 1B26A 1Q7CA 3OETA 1GR0A 2B35A 3GOHA 3U4IA 1GYRA 2XXBA 2ZATA 5ILOA 3SC6A 3ZV6A 1MLDA 2YDYA 3JSAA 5A9SA 1LUAA 5G4KA 2H6EA 4E6PA 1V6AA 1SB8A 2ZTVA 3WJAA 2GN8A 1DLIA 5U9CA 2D4AA 3OQ6A 3DAGA 3ZWBA 1G0OA 1JTVA 3B6ZA 4J3FA 4DQVA 4HKTA 4LVUA 5HA5A 4B3IA 1ISFA 2GDZA 4AJEA 2PH5A 4B79A 4FFOA 2BGKA 4OSPA 4BOYA 3GK3A 1JN0A 2VWHA 3ON5A 4QECA 1V3VA 1LRKA 3LYLA 3RQSA 1VM6A 4KP7A 1XG5A 2I65A 3QY9A 3RI3A 5IDWA 2PZLA 3G79A 4XB1A 2VHYA 4DC1A 1Q0LA 4KZPA 4R1NA 3ETEA 1I3KA 3X2EA 3HJAA 3OIDA 3JQFC 4GL4A 3U3XA 3TWOA 5A9RA 2TMGA 4RO0A 4TQGA 3VTFA 1R0LA 3H9EO 4DRYA 3K2EA 1YBAA 5JNLA 1HT0A 3KETA 3KYCA 3PP8A 2AW5A 4J1QA 5IXSA 3RC9A 2CY0A 3HUDA 3PRJA 3PJFA 5C37A 1NR7A 1DEHA 3JQBA 5TJHA 3W4KA 4ESOA 4WPGA 2W2KA 5JSFA 1U3UA 1HYHA 4PFJA 4MVJF 1ORRA 3DQPA 4NG5A 2WD8A 4D43A 2V6BA 3I83A 3EMKA 4MP8A 4S3MA 1IPEA 3INRA 4QXMA 5CDYA 1NQTA 3C3XA 2F00A 4J6FA 3RD5A 1N92A 4II2A 4CODB 2BF7A 4YDRA 4L0QA 4UUNA 1UDBA 3BHJA 4RF3A 3KSUA 3PI7A 1MG5A 3R6DA 4WK6A 5FI3A 4BNZA 3DDNA 3GGGA 1N9GA 1N9GB 3GMSA 4GVXA 3PFFA 1U3VA 5I8WA 5KVSA 2Y99A 2C59A 4KUGA 3Q2KA 3KO8A 1NFQA 2PWZA 5BSEA 4CQMA 5C7LO 2W8ZA 3AM4A 2V6GA 3GGOA 5ER9A 3IP1A 4EJMA 1W0CA 4J49A 4GH5A 4R1TA 4AG3A 1ZMOA 3BYZA 3KSZO 4BV9A 4E2WA 5ICSA 5DOZA 3QSGA 2HRBA 4BNHA 1V9LA 5DF1A 3RU9A 3ST7A 1IHXA 1BVUA 3FTNA 4BMNA 2IZZA 2J3JA 3BTOA 3GY0A 2CSUA 4MP3A 1OBFO 1UZLA 3IAHA 4L8VA 5DZSA 3WGGA 3DZGA 1TB4A 4Z0TA 4J9UE 1ZEMA 2DKNA 3BAZA 4J91A 3ICPA 4CR8A 3ZV3A 5A5FA 4IIVA 3F1KA 3AI3A 5CG2A 3ZWCA 4E21A 4N5LA 1GCUA 5JAIA 4RVUA 2ZTLA 5CEEA 5KJ1A 5T5QA 5EMHA 1HE4A 1LDGA 1VJ1A 3L9XA 3WWZA 3JQCA 4BGEA 1J49A 1PWXA 2FZEA 4XA8A 5MDHA 3VPXA 3HDYA 1KVTA 2WMDA 3WB9A 1GYPA 4E3ZA 3FSRA 4H7PA 4RDIA 1B3RA 1U7HA 3AOEC 2HJSA 1R4NA 4B4UA 1R15A 1BWSA 2NQ8A 1DXYA 2FOIA 5JFOA 2VRCA 1U4OA 3MJ4A 1HZJA 1SOWA 3TZKA 1N2SA 3O4RA 2OBYA 3ZCXA 1HTBA 3N58A 4ZHSA 1YRLA 1KIFA 3DOCA 4RPKA 1Y6JA 2C5EA 2O3JA 3ZWYA 3BA1A 4IINA 2JCVA 1EVYA 1C0IA 1M6WA 1H0KA 5A02A 5DBFA 1E7WA 5A5EA 3ZN2A 1O5IA 5LCXA 7ADHA 1DRUA 3AFNA 3IIEA 4NIMA 4FJ0A 1YWGO 4K26A 1TT5A 4TROA 1WDMA 5KVCA 3QVXA 2A4KA 3BTUA 1XHLA 1E5LA 3HDQA 4L75A 5JDCC 2W2LA 4S1VA 3R3JA 4BB5A 3ZU4A 3RBVA 5A9SB 2VWQA 5G4KB 4CM9D 4OYRA 1NASA 4NI5A 1DFIA 4GSLA 1QR6A 4BKPA 2NU6A 1HDZA 2YDXA 3CMCO 1NM5A 3GEMA 4XR4A 5BT9A 3D4OA 3LSYA 1WMAA 5EN4A 4ZQEA 4K28A 1X7HA 2VUTA 2PD4A 2C5AA 3NEPX 2LDXA 5AVOA 1OOEA 3COSA 3DMYA 4UVDA 5BQFA 3QV1A 2EXXA 2B4RO 1TVEA 4CM4B 1HDRA 2P4HX 1JKJA 3UXYA 2UUOA 5TC4A 4YAKA 2D3TA 4FCCA 3AI1A 1LA2A 3PXXA 2ZKLA 4EEZA 5G0VA 5DT9A 1A27A 3I9NA 4J4BA 4NMHA 3S2GA 4JBHA 2FSSA 3GGPA 1PU2A 4AVYA 3D3EA 5HM8A 1ZBQA 2DU8A 2VNAA 2BGMA 5TQVA 2AEFA 3TPCA 3WYEA 5KWEA 3DC2A 2X4GA 1P1RA 2HU2A 4YJDA 1PZHA 3ROKA 3ETDA 1JLLA 5JYEA 3QW2A 1LX6A 3A9WA 4BNYA 4CR7A 2PGLA 1HDOA 4G2NA 5C7OO 3K8ZA 4ND1A 2NWQA 1EBUA 1NVMB 1YL6A 3DBHB 3JQFA 1QXSA 2CVOA 2HMTA 4TWRA 4MVJG 3DBVO 1GZ6A 2H9IA 2NLOA 2P2SA 4GSKA 4CQLB 5KOIA 3EGOA 2I66A 3DBLB 4YJGA 2EKLA 4OQZA 1JW9B 3U4DA 1KYQA 3B1FA 2VUUA 1D4FA 1WLYA 5JS6A 5MGBA 4ID9A 1EUCA 3RBXA 4UUPA 1I2CA 2JHGA 1SEVA 2ZQZA 4WNCA 1HSOA 2ZB4A 3VC7A 2GCGA 3ZNPA 1VC2A 3FR8A 1ZFNA 3JQ7B 2Q45A 3ROPA 3A14A 1MC4A 4XX0A 4DPMA 1BRMA 3TL3A 2JCYA 3MJSA 3V1TC 1Y8QA 3V1YA 4PLCA 2W2LD 2JCXA 4L4RA 5G2OA 4TVOA 1WDLA 2NU9A 1YBMA 4XIJA 4RVFA 3S2EA 1X0VA 4B3JA 4DREA 4FPXA 2EKQA 2BELA 4MO2A 1S7CA 2Y0EA 3W8DA 2DTEA 1GPDG 4XDZA 3HWRA 5L7YA 2PV7A 1NFRA 3OQ1A 4OJNA 3GH3A 4R01A 3DMTA 4YT5A 5CDUA 1T26A 1MUUA 2PZKA 3GVPA 2OP0A 1ZSNA 3AFMA 1QYWA 2Q50A 4RPGA 4FB5A 3DB2A 3GFGA 2I9PA 4CM4A 2DLDA 1MA0A 2J8ZA 3FPCA 1H94A 3RC7A 1E77A 3OEYA 1J5PA 4GKVA 4LCEA 1UUFA 4ZRMA 4J1SA 1Y81A 3AOEA 4J43A 1F06A 4RZIA 3RJ5A 4U0JA 1RYEA 1ENPA 2ZB3A 1C14A 3EVTA 3M2TA 2QYTA 4K9DA 2VYVD 1ZSYA 1Z82A 3JQ8B 2AHRA 3VDQA 1UP4A 1X1TA 3AUSA 5AXCA 3NTQA 3ULKA 1HKUA 1Z73A 3OP4A 5ITWA 1P1HA 2Y1FA 1LJ8A 5IZCC 3DTTA 4BQPA 2PY6A 1M66A 1WWKA 3PIIA 3KXDA 3PWSA 2GRAA 3UH1A 2X23A 2Q4EA 5THQA 2B5WA 4NJMA 2AE1A 1DHRA 3GZNA 4CLRB 1YDEA 4KUEA 1T1SA 3E8XA 1YQXA 1UXGA 4WLOA 1VI2A 1H2HA 2P9EA 3IDSA 2ZK7A 3UVEA 4YCAA 1B15A 2G5CA 3FNEA 4A26A 3DAFA 2DQ4A 2VUSA 2BLLA 1EK6A 1ZZEA 4RPLA 3IKTA 4YJFA 2O7QA 3KB6A 4RPHA 2GR9A 4IS3A 5DOVA 4JP3A 2O3RA 3A28A 4XD2A 2YFHA 1IL0A 1KETA 1FJHA 3AM5A 3EC7A 3JQBC 1E3WA 3L9WA 2GNAA 2BGLA 4PRKA 4RF4A 3RVDA 4BO4A 4QT0A 3K5PA 1DRVA 1UP7A 3Q11A 5JC8A 3MWDB 3NGXA 2VHVA 4AJ4A 2HRZA 2Z5LA 2X58A 2NUAA 1DLJA 1P0CA 1E7SA 3BMNA 3GF4A 5TRTA 3I4CA 4IJKA 5F3RA 5I7FA 3IQDB 1YQGA 3ZV4A 3H3JA 1LRJA 3B70A 7MDHA 5JDIA 4XYEA 3RROA 3GAZA 3MJEA 4Q3NA 3HZZA 5AXAA 1UZMA 1EVZA 3GHHA 4BV8A 5A4DA 3I9MA 3CH6A 4YTEA 3W6UA 1K89A 4W82A 4FFPA 2Y0CA 2DBQA 2GZ3A 1KBZA 1MC5A 1NQAO 1F8FA 3PHHA 2VTDA 3NDRA 4I8XA 4YJHA 2HLPA 4IMRA 5EIOA 3GN2A 1MFPA 4ALNA 3H2ZA 4ZICA 3OA2A 1FDUA 1VJTA 2GZ2A 3JYQA 4E5PA 2YJZA 4PLWA 3AY7A 3ASVA 4GMFA 2WEKA 2EJVA 3B1JA 2OFPA 4UVEA 1Z74A 2X0RA 1IY8A 2CDAA 1LLDA 3TN7A 3VZQA 3IS3A 3P7MA 4BNUA 1P0FA 2Z95A 2DPGA 2R6JA 5T64A 2ZCUA 4D7AA 1BXGB 4OQYA 3WTBA 4R5HA 4RZHA 3ZWOA 3IJRA 1L1FA 4RVSA 1Q2XA 1PJ4A 2EJWA 5BSGA 5L40A 1BHSA 2D2IA 4A27A 1HDCA 4IDGA 4BGVA 4C7JA 4L4XA 2GPTA 3LZ6A 3FTPA 1SZJG 2OBNA 4O5OA 2CD9A 1EBFA 2IZ1A 4URFA 5G0TA 2J3HA 4BNJA 2JHFA 3I9KA 5IG2A 4D0RA 1FDVA 5A3JA 5JAQA 4Z9FA 3INTA 2EKPA 3RC1A 1U2DA 4Y6RA 5TSDA 3OIGA 1SMKA 3HHPA 3O26A 1MGOA 3QLJA 1GQQA 4RJTA 3ENKA 1I10A 4G65A 4E5KA 2FHSA 4PZCA 4NHEA 2FY8A 2SCUA 2GGSA 3VAZA 5H82A 3C7CB 4BUCA 1LEHA 4CR6A 3WJ7A 1XQ1A 4IY1A 1FDWA 1YBVA 1UH5A 1UJMA 4XQEA 1KEPA 1L7DA 1UAGA 5CDTA 2X9VA 3UUWA 4PLYA 3RKRA 1QYVA 4XYMA 3TFQA 3WNVA 2EGHA 3L77A 8ADHA 3NX4A 2PTGA 4U6QA 4HNHA 1ZJYA 3S1LA 5BNTA 3JQAA 2PFGA 4PLVA 4AJPA 3OJLA 2WE8A 3HB5X 1EQ2A 1DC6A 2NNLD 2O3SA 1E7MA 4E2XA 4GGOA 3WBBA 3ZNQA 1LI4A 3DO5A 2Y1CA 2PLAA 1D3AA 2DTDA 3D4NA 3SX2A 1ZH8A 5K6AA 1TLTA 1PQWA 2JL1A 1F17A 1IOLA 4FFNA 3U09A 4FN4A 4J2OA 2WD7A 1PJCA 2XXJA 2FP4A 2AQHA 2HO5A 2P68A 2CVZA 4EZBA 1GV0A 3IP3A 3WG9A 4OHUA 2Q2WA 2HMWA 4U0KA 5F21A 1XWFA 4E5NA 8LDHA 3VH3A 1ISMA 3MEQA 3GDGA 1A7AA 5KIAA 1Z75A 4FGWA 2UAGA 4GLOA 1O8CA 2VZ0A 1NHWA 4IDCA 1D7OA 2W98A 3S55A 4KUHA 1ZK1A 3NYWA 4XDYA 2EG9A 2OP1A 3F47A 4INAA 1T2FA 4IQ0A 4PCVA 4J0FA 4L73A 1CQIA 2BFAA 5CHEA 4GGPA 4BMVA 1AUPA 4YYZA 2VOJA 5F5NA 3R0IA 4R9RA 3DZHA 2OO5A 3PYXA 1PX0A 4W6ZA 4XRRA 1X7DA 3RIHA 1LRLA 5KJCA 1NVGA 5ICMA 2CZCA 3MJTA 4QO8A 1QRRA 3CZMA 1B2LA 2X0IA 4GX5A 4PLFA 3WQRA 4F6LA 2AG8A 1CF2O 3PLNA 1ENOA 2EV9A 3DOJA 1GV1A 1NX6A 2FSVA 3MZ0A 4I5GA 3E18A 5HRUA 3IC5A 4ROSA 1EVJA 3V2GA 1Y5RA 1E7YA 4CUJA 3DZFA 4K6FA 4Z0HO 3U0BA 2DTXA 2RIRA 5TGDA 2AMFA 3JQGB 3AU9A 1K2WA 4E0BA 1E7QA 3DTYA 3JQGA 3PGXA 2NQTA 5GY7A 3VKVA 1M2WA 5ES3A 1BTOA 2C20A 3CMMA 3FR7A 3D4PA 1LSSA 2I99A 3ZU3A 4F6CA 4LRTB 1UZNA 2HCTA 1CRWG 5DCYA 4BO3A 2J3KA 2X0NA 4EUFA 4LGVA 5B12A 3WGIA 4KTTE 4QUKA 4F46A 4WLNA 2C29D 1UXJA 4CMKA 1LTHR 4DQUA 5CFZA 1PJSA 2E4AA 4NFYA 3I6IA 5A04A 3GFBA 5U1PA 3ZW9A 2OUIA 4J1TA 3UAGA 4A10A 1H9BA 2QQ5A 1SCUA 2X7HA 4FJ2A 4NNJA 5C5IA 2EHDA 4J90A 2YHIB 3QWFA 1VRWA 2IDZA 1YDWA 1C1DA 2AXQA 4BNMA 1F14A 2PH3A 5C3MA 1XU9A 3JQEA 3LT1A 1HF3A 5IXYA 2X5KO 4NU5A 4JLWA 3NUGA 1PTJA 3IOYA 3ZHYA 4WCFC 4BQRA 1A71A 1N8KA 1NTOA 1ZK4A 3WSWA 4NJMB 3LK7A 3PDJA 1R0KA 1I3MA 2C54A 3QWHA 2VT3A 4GPD1 1N5DA 1DAPA 1CQJA 1ONNA 3ZWAA 1N7GA 3PVZA 1O95A 1NPTO 3F46A 5JCXA 3S8MA 2E82A 4QEDA 3PHLA 5L51A 2XAAA 2BKAA 5IDYA 2ZYDA 3ABIA 5JXWA 3GEGA 1U4SA 3M6IA 4YA6A 1ZMTA 1FDTA 5TX7A 3PHGA 2XPCA 3T7EA 4P8RA 1ZO8A 1NAHA 4LN1A 3EY4A 4XB2A 4MJLA 4GVLA 4ALKA 2CDBA 2A35A 2X9NA 5T57A 4LSMA 3RBZA 5L53A 3K96A 4DYDA 3NT2A 3D7LA 1CERA 3N74A 1WZIA 3TOXA 4BO7A 4TMFA 4R9SA 4DPKA 1HSZA 4CLHA 1I32A 4LCJA 3WNQA 1GEGA 1TEHA 4YAEA 2I3AA 4ZQGA 4OO3A 3UW3A 1EVIA 3GZ4A 3K92A 3DZJA 3TSCA 5AXBA 3UKOA 1ENYA 4ZQFA 4DWVA 2YZ7A 4Q3BA 1A4UA 5T8KC 4MIOA 4DXHA 1LSOA 4LW8A 1ISGA 3Q1LA 3SEFA 4DQXA 1SB9A 3SJ7A 1HDYA 5F1OA 3NT4A 5I7SA 1IUKA 3C1OA 3ZNOA 3UHAA 5G0UA 1DJQA 1GYQA 4ZD6A 1ARZA 3WS7A 3JD3A 4GQAA 2JKVA 1YGYA 2FWMX 4HFRA 1H5QA 2Q1SA 1BSVA 1HXHA 1GUYA 4WOJA 3WIDA 4RLHA 1Z45A 3UCXA 3NJ4A 5CEFA 3LDHA 2XOXA 3KYCB 1DIBA 3DEYX 3F4BA 1XEAA 3T4XA 2D8AA 4YJFB 1DC5A 4KTVE 5ADHA 4ALJA 4JQCA 4B4OA 4BS9A 3IUSA 5ER6A 3SBOA 1R16A 4ZQBA 4WASA 5KVQA 3FF4A 4WCFA 5AXDA 4Z3KA 1K0UA 2VZ8A 2B36A 1G6KA 1NQOA 3FWZA 3T4EA 3OFSA 5JE8A 5L3ZA 4ZGWA 5LDGA 4NFHA 4KDFA 1VKOA 1ISIA 1ZCJA 2Q2QA 5JC1A 3HFSA 5EESA 3OBBA 3HDHA 4Y6PA 1R6DA 5IN5A 1NPDA 4Q3EA 4CM9A 1EEHA 2IE0A 5JO9A 1PL7A 3AUTA 3C7DB 1PJBA 1W6UA 3ONFA 4I5EA 1BW9B 1I36A 1H93A 2D1YA 2V6MA 4CM8B 5TLSA 1I3NA 2VOEA 2B0JA 3H4VA 3JQDA 2R00A 3QQPA 4OKNA 1PGJA 1QLHA 3DAPA 4GX2A 2HDHA 1X1EA 3G17A 3WGYA 4BB6A 2HMVA 1E3SA 3CSDA 1IPFA 1YB5A 2AA3A 4KDEA 5K6AC 3LC1O 4IDAA 1K5HA 3GA0A 3LU1A 3WYBA 5L95A 9LDBA 1L7EA 1T25A 1CYDA 5JYDA 1NR1A 4MPDA 4NBWA 1GD1O 3AJRA 1LLUA 1RKXA 1M67A 3LLVA 1U5CA 4PG8A 2G1UA 4HFNA 4GBJA 4RORA 3NJ8A 3LF2A 2HK7A 2B69A 3I9JA 3TQHA 4CMJA 1OC2A 4BNFA 2QW8A 4Y6SA 3RC2A 4WNIA 4HWKA 4GWGA 4WLFA 1JWAB 4YB8A 3OJ0A 1BXKA 4HXYA 1PSDA 1VLLA 4XQ9A 1J6UA 3TRIA 3MJCA 1C1DB 4A2CA 1U7TA 1WZEA 2GN6A 3DHEA 1BMDA 2EWMA 3H3FA 3ZI0A 5L7WA 2G76A 3RU7A 4NBRA 1B8VA 1XR3A 4FOOA 1VSUA 2NM0A 3CTMA 4XZ3A 1PL6A 4CLRA 2ZB8A 3ZHZA 2G17A 1ZXLA 4MP6A 5LC1A 1KEVA 1P1IA 2A94A 1SEPA 4WECA 5A3VA 4BNXA 1RYDA 4XYLA 4AJHA 5KCZA 1BG6A 1I01A 5TT0A 4EI2A 3O8QA 3ZWMA 1PGQA 3MOIA 3FCOA 1HL3A 4ALLA 1HYEA 4CMGA 3V1UA 4DLAA 4B8ZA 1E0DA 1KY4A 2YQ4A 4MINA 1CIVA 1GEEA 4DBVO 1VSVA 2QRJA 4IJVA 5DULA 3NTOA 1AN9A 4ALIA 4D46A 3VOSA 3KSDO 4EGFA 3ZWVA 2C7GA 3FI9A 3VVBA 2B4QA 1T2CA 2O2SA 1EUZA 1NAIA 3L07A 4OH1A 2OOSA 5DCUA 2VHXA 1YS4A 3AU8A 3RASA 1H6CA 1PZFA 3DZKA 3PTZA 3BXXA 4Q9NA 3NKLA 2Q99A 3NDIA 1YO6A 1MX3A 3IKVA 4JCOA 4A5OA 1NP3A 4G5HA 4YPOA 5L4LA 1PIWA 1O9BA 1VKNA 4GI2A 3QWBA 4QX6A 1QG6A 1GTMA 2O3UA 4YBZA 5HS6A 5JY6A 1EE9A 3PWZA 3Q3CA 2J5KA 3H6KA 2GF2A 1Q0QA 2F1KA 4A7PA 3EDMA 3L4SO 3BTVA 1KS9A 1TT7A 2OMEA 1QSGA 3OICA 1YOVA 3Q2IA 5JAZA 5GZ6A 3ZZNA 2EF1A 5CPFA 1Y8RB 3BMOB 4BO2A 4J16A 6ADHA 1HEUA 1RWBA 1GAEO 3FD8A 5KJ6A 1RJWA 1JAYA 3C1TA 2X0JA 4GMGA 3STHA 1I2BA 5JPIA 2C0CA 4BNIA 4DMLA 1PZGA 3E9MA 1QYCA 2DBVO 3VH4A 4EJ6A 3VPHA 2HJRA 4M1QA 4RQUA 3GEDA 3ROQA 2NTNA 1JVSA 2CF6A 4M89A 2RCYA 4XQCA 2UUPA 3WIEA 3JQ8A 3M1LA 4HNGA 4YVFA 4R1UA 3ZU2A 3JQAD 3PIDA 3KM0A 2B37A 4I9UA 5AYVA 3ZH2A 3UFXA 1E3LA 1YOVB 1DFHA 2I6TA 5IF3A 1NPYA 3E9QA 4XCVA 1DB3A 4BO0A 1ZJZA 1PJLA 4KMSA 1PEDA 3CPSA 2QZ9A 1UXHA 3NDJA 3GNQA 3I3OA 2D59A 2YFQA 1UDCA 3I4FA 3P2OA 5JCJD 1X13A 1PQPA 2O23A 4OL9A 3LLSA 4KQXA 5FWNA 1DIHA 4Z0PA 3OIFA 4MVJE 2NTJA 3R1IA 3E1KA 4WKGA 4XYGA 5IZ4A 3RAJA 4PZDA 1ENZA 1XKQA 4ZU3A 4JBGA 3GAFA 4RQTA 4CLXA 2P91A 4BO8A 4MKRA 3PEFA 2FPGA 3R3SA 4J4TA 2JFGA 1FF9A 2J6IA 2VHWA 1B8PA 1BGVA 3E03A 1HRDA 4CMEC 3VKUA 4CL8A 2Y67A 5L4SA 1UXKA 4UEOA 4IJWA 2BMAA 1P1JA 3H5RA 1ISJA 4M49A 3FNGA 3PJDA 2Y1DA 3HE3A 3U4HA 4DUPA 1IULA 3SLGA 1E92A 3JQ9C 3DBRA 1H6AA 4FD3A 5BR7A 5I8ZA 1E6UA 3WQSB 1DFGA 4QSMA 1P1FA 1D8AA 4E5MA 2IXBA 2X8LA 1X15A 6LDHA 5HWSA 4RVHA 1QMGA 2YUTA 3GVIA 3HNPA 3U49A 4KQWA 1A72A 3TZ6A 4FFRA 1DBVO 4AJKA 1SNYA 1SOVA 5L45A 4OSOA 3I9LA 1JQBA 3DR3A 1Y9AA 1MB4A 1SO8A 4UEKA 5JO0A 2BHLA 4E30A 3WFJA 1LNQA 4DMMA 2HSDA 4B7XA 3OA0A 2NVBA 3EHEA 1P33A 1RM4A 1PJ3A 3PYMA 3ZWXA 2O7SA 4PN3A 3DBHA 3HB4X 4OGWA 4OOEA 1Y8QB 4AJIA 4BNKA 3BHIA 2PR2A 2J5QA 1B7GO 5CAEA 1SC6A 5IFLA 3CEAA 4H15A 4ZQHA 3UCFA 4XJTA 5FEUA 2X9GA 2Q1UA 3E5RA 2VN8A 5CPBA 2JD2A 3PLRA 2HAEA 3GVXA 4W7HA 3RUHA 3UGKA 1T2EA 4EJ0A 1EFLA 4ONEA 2O4UX 3IL2A 5JDCA 3HQ4O 1NBOA 2OZPA 4CMAA 1UAYA 3JTMA 3WQQA 4L74A 3E6AA 5KJFA 2CMDA 3VHRA 2BI7A 4FQ8A 2ZYAA 3U5TA 3ANNA 1W8DA 1AE1A 3BMCA 2PGDA 1DIGA 5EINA 4BKUA 2X1HA 5I9LA 4WJZA 1TI7A 1V0JA 1K3TA 1Q7BA 2O50A 3G1TA 4B8WA 4E33A 5L9AA 4I5DA 2HKIA 1ZIDA 4TRMA 3L6OO 3V2UA 3JD2A 3H9GA 4YRAA 1YJ8A 3GZNB 1I0ZA 1MFZA 4WCDA 4XGKA 4E32A 1JKFA 3MWEB 3ENNA 3TL2A 3ITKA 4AL4A 1XYGA 2Y1OA 4HBGA 2CUKA 4YQZA 3ROMA 3SC4A 3ANMA 1P3DA 3VPGA 4OMUA 5CDSA 2JFHA 1XIVA 5HBRA 5A1TA 1Z6ZA 4DVJA 5T8KA 4UEJA 4BNNA 4X54A 4BIIA 1JAXA 3CXRA 3UN1A 1Q0HA 2HUNA 4E31A 3PFWO 4FBGA 5JDIC 1O6ZA 3EZYA 3KYDB 5JW6A 2E49A 5B4VA 4BNWA 1PZEA 5JLAA 3RUAA 2ET6A 3PQDA 1YQDA 4MVJD 1QP8A 2C82A 4ILKA 3ICCA 3GLQA 5ITVA 3BMNB 2RH8A 3PJEA 4WGGA 3W1VA 4NBUA 2D5AA 2I67A 3A06A 4I5FA 4H3VA 4C4OA 1A4IA 1WNTA 4TZTA 3FHLA 4BKQA 3DWFA 4NR0A 5EERA 3NTRA 3GDOA 3KTDA 3ZHBA 5TF4A 1E3WB 4D0SA 2WYWA 2GN4A 1VL6A 3DZIA 1OZAA 4XEHA 1DO8A 3NT5A 1RM3A 3SJUA 4QFDA 5BSFA 3RKUA 3DL2A 3S2FA 2VYND 3UOGA 3JQAB 5IJZA 2IRWA 3F9IA 3WGQA 2VT2A 3RUEA 3D5TA 4EUHA 1IZ9A 3KVOA 1Z7EA 4GX0A 4NK4A 5F1KA 3RCBA 3OJOA 5LDHA 1A7KA 4CPDA 1H6DA 1ADBA 3UF0A 4F45A 3PYLA 2W2KB 4PG7A 4DIBA 3LF1A 4CMBA 3WX0A 3GT0A 4DGSA 5JAMA 3ZV5A 3UCEA 1EQUA 4CMEA 1MP0A 5EJ2A 4CM1A 4DYVA 4PVDA 2Q3EA 5EQFA 4ZA2A 1CDOA 4BNTA 1B3BA 3QVSA 2EGGA 4GWKA 1X14A 3FBGA 5I9MA 1GPJA 1K6IA 3OM9A 4RL6A 3H9JA 4CQLA 4YR9A 3DOOA 3ZWPA 3AM3A 3RUCA 3INGA 2P9GA 1PJQA 4NPCA 1LU9A 1SAYA 4YRDA 2EERA 3W6ZA 4YT4A 1T24A 4W9NC 1J4AA 1E3IA 3H5AA 3M1AA 3O03A 4WEOA 4CM3A 3ZGYA 1VJ0A 3VH1A 4E2YA 4YXFA 1NNUA 1JVBA 3CE6A 3ORFA 1ZUD1 4P22A 3GN1A 2JFFA 3BTSA 3OEWA 2ZB7A 1GL3A 2H1SA 4HUJA 1DOHA 1MV8A 4KOAA 2YYYA 1KOLA 1NWCA 1LDNA 2A92A 1XDWA 1WXDA 1S6YA 3TJRA 1VL8A 3MOGA 1MG0A 3JYPA 3EAGA 1U1IA 4R3NA 3K31A 2BI8A 2YW9A 5HS4A 2J5RA 2V7PA 1YKFA 3FNFA 1DPGA 4D41A 2BRUA 5GMOA 3B20A 1DC4A 3H9UA 4D42A 3P19A 5GZ1A 1E1KA 2QZZA 2QX7A 2AG5A 3SLKA 3KV3O 3ASUA 1HLPA 3QJ5A 4MIYA 1C3VA 3DONA 4OOFA 3W4IA 4IDEA 4QO7A 3WMXA 5K0ZA 4NJOA 4MVJI 1GFSA 2AQIA 1YE3A 3ADOA 1C0PA 5FI5A 3UICA 1E3JA 1PR3A 5DDIP 4EITA 4OXNA 4QQRA 1EMDA 2HMUA 1YB1A 4J2HA 4CQMD 4TSKA 1WDKA 2RHCA 3JQ9A 1M76A 3PQEA 4UVIA 4XR9A 4RCVA 2HK9A 4Y9DA 2O4CA 1PGPA 1E6EA 2P5UA 3AW9A 3JQ6A 1CWUA 3FWNA 3D5QA 4HADA 3ZWNA 4CMCA 1ZXBA 3GG2A 4LMPA 4FGSA 1V3TA 4IBOA 1CETA 5FYDA 2GO1A 5ENVA 4D45A 2AEJA 4TRJA 4YJHB 4PLPA 3F6YA 4LRSB 4O63O 3L0DA 4GX1A 4IXWA 4HP8A 2YY7A 4E13A 3E48A 2JJYA 1VL0A 3GUCA 4XRGA 5JMWA 4BMSA 2QIOA 1PS0A 4LMRA 4ZJUA 3PGJA 3BMQA 1IZ0A 3VPSA 4R16A 3ZNNA 4N54A 3OHSX 4YAGA 4Y67A 4PGFA 3KUXA 2GYYA 1ID1A 4W9NA 1AGNA 2VYNA 3GDFA 3RFVA 3EYWA 4NU6A 3I6QA 2Q4BA 1WP4A 3AK4A 1ZSVA 2C7VA 3JYLA 3LVFO 4CLEA 4N7RA 2Q46A 1ZEJA 4FS3A 4MVJP 3ADPA 3ZHXA 4G81A 4Z6KA 4CLDA 1TXGA 3JV7A 4I9NA 4W4TA 1PGOA 1HETA 1U8FO 2P5YA 1E1LA 3MTJA 1ADCA 4WCFB 4YQYA 3Q9NA 1UDAA 1ZVMA 4TVBA 2FMUA 1PS9A 3GNSA 1YB4A 4MVJM 3WSVA 2Y68A 4EW6A 3W8EA 3G1UA 2BH9A 2PKRA 4IGFA 1NVTA 1GQYA 4CUKA 1QLJA 5COQA 2NADA 1PL8A 1BVRA 3VVCA 1ZK3A 2JD0A 2ZIZA 1E3EA 3HFGA 4CM7A 1U5AA 2UDPA 4HY3A 3QVTA 3P5SA 5HTOA 1DAOA 3KBOA 4A03A 2BFMA 3RUFA 4OIMA 1LDBA 2V65A 4B7CA 3CZRA 3C8MA 3JQ7A 1PJTA 3QVWA 4IZIA 3KEQA 1QV7A 4R51A 2ILTA 2X5JO 1N1GA 5IN4A 1YL7A 4Q3AA 1BDBA 3BMCB 5K9ZA 4FC6A 4UVHA 1LQUA 4DBZA 1XQ6A 4KWHA 3DZBA 2ZCVA 2HQ1A 3JYNA 1O0SA 1BXZA 3ZU5A 3EW7A 4AJOA 1LLQA 1LC3A 1PGNA 2FR8A 5ENDA 4IQ8A 2DBRA 3H8VA 3RFXA 1UP6A 2GZ1A 4XGNA 4CMHA 4ITUA 2O3TA 3WICA 4HFMA 1ML3A 2DPHA 3K30A 4NK5A 4PLTA 5TJ9A 2YHUA 1QYDA 1RPNA 3Q6IA 3WTCA 3QA9A 4IPTA 4L76A 3WLEA 3OQBA 4B4WA 2ZJ0A 2NVUB 1LDYA 2Z1NA 3AUUA 3PPIA 4ND5A 5CEJA 1PS8A 2D0IA 2ZTMA 4D3FA 4E12A 4PZEA 3F5SA 3AY6A 1LXCA 3OSUA 5JMPA 4A0SA 3I52A 5EL0A 2JAPA 1K6XA 3T7CA 4ND2A 4BHTA 3LT2A 4YAIA 4RDHA 5AOVA 5A05A 3TDKA 4BNVA 2XF8A 1R66A 5COAA 4AJJA 3ZW8A 1GQ2A 2VWPA 2B5VA 4ZN6A 3GRKA 3RFTA 1C1XB 4AJLA 4FC7A 2Q49A 4PIVA 1JWBB 1T1RA 2Q2VA 1H9AA 4JP2A 5DN9A 3QRWA 4U8GA 4WEQA 1OC4A 2AQ8A 4II3A 2WWRA 3WDSA 4FFLA 2W4QA 3CKYA 4Q3DA 5H83A 4K6CA 1XA0A 4OKIA 1P74A 1SPXA 3KLPX 4AJNA 2WE7A 3RSHA 1Z7BA 1KEUA 3KYBA 2PNFA 1EK5A 2ZJ1A 3A1NA 4J4HA 4B3HA 1ISHA 2PD6A 4AFNA 4C7KA 3WR5A 3H5NA 3E82A 2VNSA 3TZCA 1PJ2A 5COBA 3OECA 3NGLA 1Q1NA 1OMOA 3VZSA 4IQGA 4UUMA 2B4TO 1E6WA 3WYCA 2NU8A 3LC7O 1R4MA 2R00C 3K9QO 3S2IA 1U3WA 3JD1A 5F5LA 4P38A 1ADGA 3CTVA 3GHYA 1PR9A 3HN2A 1ZK2A 3PK0A 4HX5A 5A9TA 4CV2A 5BSHA 4P4NA 1U9JA 4XIYA 4O0LA 3GQVA 4QTZA 2ZYGA 1O94A 1KVSA 3PHIA 5I9NA 3KEOA 5G4LA 2Y0DA 2YV3A 1ONOA 4CLOA 4IXTA 3MJVA 3I9OA 4LISA 4BGUA 4EEXA 5KTKA 2GN9A 4M55A 4M8SA 2A9FA 1V3UA 4R68A 3WWYA 2QYSA 3RUDA 4WUVA 2AQKA 4WE3A 3NRCA 4B4VA 2Y05A 4O59O 4TZKA 4RF5A 4UVGA 4JX8A 1XLTA 1XSEA 1EDZA 4IDBA 1T2DA 3LC2O 4BKOA 3I5MA 1W73A 1Y9EA 1T4DA 1Y5MA 1VPDA 1P31A 4PG5A 1Y8RA 1E7RA 1ULUA 2NVUA 3AI2A 2EP7A 2FPIA 2WSBA 1N1EA 1A9YA 3K2BA 3KOUA 3U4CA 5I7EA 2EP5A 1WAMA 4YACA 3IJPA 1TA4A 1TT5B 4R69A 1E1MA 5TNXA 1VE9A 2X86A 4FFMA 4N18A 3HG7A 4R5MA 1Q7GA 1QYXA 5CP8A 4GKBA 5JY1A 3GUYA 2V6FA 4I9HA 1K6JA 2WM3A 2I76A 1EDOA 1YJQA 1OFGA 2ZQYA 3WFIA 1U8XX 1YXMA 4U5QA 4R1SA 3ZDFA 4RV9A 3JD0A 1R37A 2UV8A 4OXKA 4BO1A 1P9LA 5T6BA 2NSDA 3BZUA 1I5RA 2YV1A 2WYVA 3FRJA 4FOSA 3WOHA 3A4VA 5FF9A 5TIIA 1U3TA 1EUDA 1NWHA 2FR1A 2GLXA 1NHGA 3D1LA 3DHNA 4PG4A 9LDTA 3G49A 4QFCA 2IZ0A 3MTGA 5DCWA 4LSWA 4BNGA 3E5MA 2DFDA 3O8QB 3WLFA 4Q39A 2CFCA 2JD1A 3I1JA 1QV6A 2O2YA 3GC6A 3PWKA 1C1XA 1T4BA 1GZ3A 5DNAA 4W99A 4CMIB 4XJSA 1Y1PA 2RHRA 3D64A 1FMCA 4JXKA 3AOGA 4UUOA 4PLZA 3TZHA 1YH3A 2PZJA 4EDFA 1PWZA 1LSUA 4GAEA 1FXSA 1X7GA 1HYGA 1HDGO 1P44A 2J3IA 3WGTA 2AEMA 1U2GA 4OAQA 1W4ZA 2VCYA 3HSKA 3O38A 4F3YA 3SVTA 4E2ZA 1ULSA 2VHZA 4DLLA 2YV2A 1CEQA 1NXQA 4MDHA 4CM5A 4LK3A 1WPQA 5B1YA 4U6SA 4FSHA 5FFFA 4P4LA 1DIRA 2GASA 3KHUA 4NBVA 4NZ9A 5JBIA 1QORA 2O48X 1D1SA 4L4SA 4CV1A 1G1AA 3KRTA 4IGEA 4CL3A 2PKQO 1LDMA 2VYVA 4WOKA 2PZMA 3GMDA 3F3SA 3AY3A 3ONEA 2WJPA 2OORA 5G0SA 5IZCA 3C24A 4Z9XA 2WD7B 1LLCA 2D5CA 3VZRA 2BFPA 1KY5A 2FR0A 4BO5A 2WTBA 4XGIA 2VTEA 2DUWA 2PKQP 4YAJA 4BL5A 1HLDA 4E4YA 2GD1O 4XYBA 5KKCA 3DHYA 1CJCA 4FIZA 5DP2A 4DL9A 4DPLA 3H9QA 1JU9A 5KVVA 2EW2A 1AHIA 1DSSG 1H6BA 1R0SA 1GDHA 3L4BA 4IDDA 4DIFA 1BW9A 2UYYA 5GZ3A 3KZVA 3WMWA 5B4UA 1KVUA 1ZK0A 5BNIA 4PLHA 4Y8VA 2DBZA 3I23A 3NAQA 1GADO 4TKMA 4NDNE 4IDFA 1E5QA 2NACA 3LT4A 4J7UA 3OH8A 2UVDA 4D3DA 1LDEA 1IHYA 2CF5A 4CLOB 2BD0A 2I5PO 3H2SA 1DHTA 3DFUA 5F1PA 4ND4A 4CV0A 3O9ZA 4BGIA 1EZ4A 1ADFA 1MXHA 3W4JA 1HE2A 3L6EA 4EUEA 4AICA 2B83A 4BVAA 3TFOA 3VZPA 4M86A 3QHAA 4K1LA 4I08A 1I24A 1QKIA 4JGBA 4MKXA 3VH2A 1O89A 3ETGA 4MKZA 1LQTA 1LBEA 2OL4A 2VZ9A 4DTIA 3K73O 4RF2A 3D3WA 1JDJA 1X0XA 1V8BA 3LQFA 4DIOA 1HDXA 2Z1MA 3E9NA 2H5LA 4UAGA 4EYEA 3PZRA 1P1KA 4NBTA 5C7IO 4R4JA 5DP1A 4P4GA 4JIGA 4XWYA 1BDMA 1M6HA 3LT0A 1GU7A 1LC0A 2FRDA 1V35A 4DC0A 4MVJA 5U4QA 2R2GA 1KVQA 3OJEA 4YJGB 1B16A 4WLEA 2WYUA 3FBTA 3L4BC 3WGOA 3WGHA 2NVWA 3X2FA 1R4MB 3U62A 3HN7A 1DIAA 1U28A 3AWDA 1I8TA 2P4QA 4BKRA 3VPFA 3ZWWA 3H7AA 1G0NA 5KJEA 3ONDA 3CINA 4ZVVA 1HWYA 3MCVA 4IS2A 1ZW1A 2IODA 1HE3A 3BIOA 4DLBA 4WLVA 3TZQA 3C85A 2GERA 2HMSA 4J0EA 4CUZA 4Z9YA 2BFOA 4YRBA 5IDXA 3BMQB 1NYTA 1DRWA 3WGZA 4OXYA 2IEBA 5IDQA 1XGKA 5EPOA 3D0OA 2PK3A 1C0LA 4MIEA 2C2XA 3HDJA 4Y98A 2CNBA 1RM5A 3V2HA 4GLLA 4J7CA 5DBGA 1UR5A 1WVGA 4RGBA 4MVJH 1RM0A 2X22A 4IMPA 4N5NA 4RPJA 1B0AA 3H65A 1NFFA 3IMFA 1F0YA 2RBEA 4YEDA 4HFJA 1Y7TA 1MXFA 3L6DA 2NU7A 3FPLA 5TS3A 3QIVA 2W90A 3QWIA 1M75A
chains in the Genus database with same CATH superfamily
5IAAA 4LBVA 2GSDA 3WDKA 1HQKA 1GN9A 4LXTA 3S1SA 1YU9A 3JVVA 1D0VA 2MT9A 3DW1X 1FVXA 5IX8A 3X44A 3E3OA 4IQ4A 5CT9A 2COKA 4GHWA 3VR0A 3W1WA 4W7IA 1OXVA 3SSAA 1KEWA 1YMVA 3ACDA 2Y1EA 3Q10A 5ALQA 1BMTA 5PNTA 4AK9A 2RH4A 4RLSA 1NBHA 4NICA 3R7BA 1I3LA 1W87A 1A9QA 3N7UA 3TF5A 1MAWA 4NCAA 1RPZA 2WV7A 1EFRA 4FSXA 2FN7A 4URZR 4QUBA 1MENA 1X86B 3PJGA 1U28C 2HPVA 3BZBA 3DBLA 4MGHA 1UPXA 4ZYYA 3I3SR 1O77A 4C6TA 1EXDA 2YQ5A 3LX4A 3HCPA 4D9IA 4XD7A 3MWLA 5KYVA 4O4LF 2C07A 621PA 3I0ZA 1JJBA 4D3SA 3SGLA 1I4EB 2VRCD 1QDLB 3IEPA 1MV5A 2NU7B 4MLZA 2XGOA 1HC7A 4EHFA 1NZDA 1U1DA 1L4LA 4MV9A 5T67A 3EK2A 1EFHA 4PBSA 4X9XA 3HMKA 1PQ4A 4H35A 5GM2A 5JNWA 1VMIA 2DR2A 1WNFA 5AW5A 4RD0A 1AKRA 3FNRA 3RYCB 3AUAA 4X92A 1O6BA 2A58A 2WRZA 1V11B 4UD6A 5AUQA 1Y3IA 4CHTA 3PV0A 4OHPA 4AO7A 5B3JA 4GM0A 2JGDB 1T9HA 2J85A 2VXYA 2BGJA 3I5AA 4I50F 4CKEB 1JAIA 4ALMA 3BXGA 2RAFA 3RU2A 2IZ7A 3DB1A 4F3KA 2V97A 3Q40A 2HWXA 5CX1B 4OA5A 1R12A 1WCXA 2DT5A 3PGA1 5HUJA 2G04A 5LZ2A 2X1MA 5I6DA 5KVAA 2E0IA 2PZAA 3ANLA 4C87A 1QUFA 3NV9A 3SF8A 4MWOA 4HPXB 3W1EA 2IYFA 4AWXA 3IUPA 4OBBA 2EG5A 4DA9A 4IUYA 4WTOA 4PHFA 1P9RA 4MCJA 4BRWA 4UTNA 1UQTA 3WRYA 2Q1TA 2ECKA 4MDFA 1DV2A 2TMDA 2AL7A 4PPFA 4DYHA 4K5QA 1F6BA 3VDRA 4HXEB 2X2PA 2WP8J 5H3HA 1H2FA 1XHFA 4CIWA 1VMEA 4AYXA 3KCNA 3K6JA 3I9FA 4HPJB 1Z0AA 1BA3A 4BWFB 1CT9A 2BKVA 3CR7A 3KOWA 1X8JA 3DDSA 4RTOA 1MIHA 1V2HE 1GUZA 2DFNA 2FW1A 3AF1A 1DZ3A 1JKIA 4O6VA 4Q24A 4RMHA 3WXBA 2XUHA 4OB7A 3RODA 4AZ0A 5B4TA 5J3JA 5KOHA 2A0FA 3FGZA 4XPIB 1JZSA 1R0YA 2VWGA 4LVCA 4OHRA 2OHXA 1UBLS 3QFTA 3GLKA 5BUQA 2C7PA 4X3CA 2Z57A 1YZQA 1RXSA 3WGKA 3OF2A 4I1IA 4E5YA 4EO7A 2IHUA 3PGVA 5JXGA 1DDOA 1E5DA 4HV4A 4A1OA 1P2FA 1YL5A 2H4YA 4RHUA 1I30A 1MJFA 3EQ8A 1WMBA 3LVRE 2IYOA 1XXLA 1C0KA 3GRAA 4IIJB 2IFTA 3NALA 3PNKA 4GOLD 2G5TA 2D1QA 4JN6B 4DLRA 1DRKA 1IYZA 1KVRA 3U9LA 4ME6A 1IPHA 3WV5A 4LJYA 2I62A 2IXAA 3C7AA 4FINA 5T7BA 2QHXA 4KSBA 4YCBA 3RAPR 4YRTA 4ETNA 1XKXA 5TY0A 4JJIA 5CVVA 5HJ7A 4GKJB 1XD9A 4RVDA 3HLTA 4O3FA 1B14A 1ACMA 2EX1A 1MQAA 4I9FA 2PD3A 2BIFA 1X1SA 3IUNA 2CXQA 3MAAC 2QVYX 1B93A 3OUUA 3B1KA 1DEXA 2NW6A 3A3YA 4EF5A 2P27A 3IQIX 2QTNA 4UULA 4DBLC 5JZVA 3MTAA 4IR7A 1KSGA 1UBUS 2AMYA 2CNKA 1UJNA 1HQCA 2PGOA 2PRJA 2QLMA 3FETA 3Q7TA 2HRQA 1N7HA 4GXTA 5SZJA 3IBCA 1C4WA 3NCTA 1AF7A 4TLMB 4X95A 1LB1B 3DYVA 2HW8A 4HZIA 1E1NA 1ONPA 5IW8A 3CR8A 1WO8A 1GJRA 4DSAA 1KJJA 1PD0A 3HKDB 4LX0A 1Q22A 1TQ4A 2EP8A 2WU4A 4KHZA 1T2AA 3E9ZA 1TEZA 4LHZA 5LMNB 4UTOA 2Y1GA 3VX4A 1QWOA 4JY7A 4WNYA 1GPLA 3PD0A 4UDOA 4TQUS 3MYRA 2X5OA 2AKEA 3G5TA 3LIPA 1QRTA 1KZHA 2C57A 3EGVA 4IO0A 5L4NA 2ZS7A 3B82A 3EAFA 1A9ZA 3D0KA 5DEOA 5KYWB 3NBXX 2CLOB 1NN0A 3DMTC 4L9RA 4MGEA 4ETIA 3CU5A 3O3MB 3G0OA 1UJ5A 1Z4NA 3M33A 1OA1A 3OG9A 1JDTA 3QP9A 4HNAA 5K7SA 3TXAA 2ZR0A 1DL5A 1Y3AA 1YONA 2FI1A 1MF7A 2HA2A 3GVHA 1ZN7A 3PI6A 4TL6A 1IB6A 1ZAKA 4AECA 2BKEA 2QL6A 5F51A 2DOKA 1E0AA 2HQSA 2OKCA 1H05A 3KDPA 1VTKA 3WLTA 1KRWA 3FW1A 4ND8B 1JQLB 4YUAA 1TCAA 4A8JA 1DE0A 1J09A 1IAQA 2IYPA 1PZMA 4UTXA 1P7ZA 5ALYA 4CM6A 1AGXA 3ILXA 3HRHA 1FFXA 1GR0A 2B35A 2OC4A 2NYUA 2ZATA 1IY9A 1MKYA 3U4IA 3EXHC 3KT0A 4OPMA 5CVEA 1GL7A 3SC6A 2GEKA 3DUFB 1KO1A 1R5OA 5JNVA 3GBSA 2ZAYA 1LUAA 3BGSA 2H6EA 2HJVA 4GC5A 1KSJA 3QPAA 4WVLA 2D0OB 1XNQB 3MSXA 3MXOA 2JIQA 3D8NA 1G60A 2XUAA 3M6VA 3OQ6A 1JTVA 1F3OA 1Y1SA 3B13B 4X84A 2ACVA 3D31A 5TVGA 2KSQA 2PH5A 2R8YA 4FFOA 2F55A 2Q5LA 1KO4A 4QECA 2CXRA 4LSZA 4Y6GB 5DASA 2QVZX 5LQRA 1WBBA 3CZPA 4BFCA 4O4JB 1XG5A 2PX3A 2I65A 2VF7A 5JATA 4LXQA 4F1JA 1TZJA 1IWOA 2VJYA 4YROA 1OI2A 3ZGVA 5EOVA 4KZPA 3ETEA 2O1SA 5FUWA 2B7BA 3G9ZA 4ZAFA 5F64A 4ZT4A 1RPAA 3TW6A 1FNCA 1RD4A 3A10A 3D81A 1L7NA 1A3CA 2BGTA 2G3YA 2GAFA 2TMGA 4RO0A 4TQGA 1JFLA 8ABPA 3DEZA 1TU4A 1XRRA 1MJGM 3Q85A 3K2EA 1I1HA 4RJJA 3R44A 1ADYA 5B2EA 3OX1A 4QM7A 3DVRX 4B2YA 1HT0A 2IC5A 2SKEA 3KYCA 2YWXA 1Q19A 2AW5A 3PP8A 4IGAA 1KEEA 3O4JA 4AY4A 5IXSA 1X7XB 3IPAA 3PJFA 3O2NA 4OA8A 2BAGA 2HWUA 4RK1A 1CUXA 3W4KA 4PAMA 4WPGA 1YCHA 1C8KA 4HT3B 1Y33E 5JSFA 3F6BX 3DOUA 1NF3A 2ICAA 1ZGJA 2BFEB 3NWEA 3U7RA 1QRUA 2YOGA 4NG5A 3ONNA 3B8HA 4FOLA 1YHNA 2CLHB 5UKDA 1H5UA 1KS2A 2H11A 3CEHA 3MW8A 4MP8A 4QXMA 3NP7A 5HQJA 2C3OA 4S0XA 3A1TA 4OQFA 2XUFA 4J6FA 3P5BA 3ZXXA 4F8EA 1KARA 3G68A 3I1FA 3OFND 4ILEA 5A4MS 4II2A 4ZI7F 1GXSA 2BFNA 3IDAA 3KJEA 3KT6A 1ZLYA 4WXHA 4RF3A 2XSZA 1YS2X 4H3KB 4WAUA 4Y1FA 3LOUA 2IW1A 1SPBS 4QWMA 4HQ0A 3JWIA 2KX7A 4KXMA 2HA4A 3K0EA 4CE6A 5ED4A 3T06B 1OFCX 3GMSA 4QODA 3PFFA 4DG8A 1AMOA 3Q8MA 2R66A 2ZT7A 5DI3A 1U3VA 3HM2A 4LJ4A 3CVWA 1X7ZB 3EWSA 4WRRA 2C4KA 3CNLA 2WKQA 3UMSA 3U26A 4KUGA 2HSEA 2UYCA 1NFQA 4ASUD 3PG5A 1TM4E 4CBVA 4RWEA 2W8ZA 3H1BA 3UAVA 3VNRA 5ARBA 3ZEIA 1W0CA 5KNBH 4AG3A 1G4UR 3A8TA 1UDRA 3DF7A 3FB4A 3ROTA 4F2PA 4ER7A 4BV9A 4ZJPA 3IIJA 1UQRA 2IPNA 1N3YA 3W3ZB 4YDHB 5EGSA 3ST7A 1AJEA 1VXRA 4PGAA 3FTNA 3D02A 1GTG1 1H2AS 4P3OA 4BMNA 1DU4A 2IZZA 3GY0A 1KOGA 3AR5A 4MP3A 1OBFO 5DZSA 2PGXA 1E1YA 4CYMA 3O82A 1TB4A 4IP0A 1YFKA 1XA3A 5FP0A 1VE6A 5EFZA 3I6YA 5EI5A 4CR8A 1ZEMA 3RRJA 3VA7A 5BV7A 4PINA 5CA1A 1QE5A 5E2IA 1GPYA 3CRVA 3ZV3A 1OT5A 2ZCJA 1QJ4A 1QIDA 1PE0A 2ODAA 3UANA 1K92A 2AXNA 2D1TA 2PVCA 3AI3A 2CE7A 2LIVA 2QXYA 3TLGA 3NH6A 2WAAA 2EBUA 1A2OA 3AHJA 1WOMA 3EDRA 1JIQA 1GCUA 3N6RA 5JLJA 3L84A 2VLBA 3HXTA 3Q87B 5FNVA 1O97D 2ZTLA 3RQIA 2FPPB 2CHEA 4F04A 3U0VA 5CEEA 5T5QA 7REQB 5LMUB 4QGAA 2PT6A 3DE1X 2HF8A 3LUPA 4H2DA 2GM3A 3OCJA 4N3AA 4V2UA 1VL2A 3VZCA 1F0NA 1WG8A 4UBIA 1QTNA 1J49A 3LOQA 3M5WA 4LI0A 3BCSA 2ZRBA 3L0ZA 4ZKDA 5LZ9A 1ZBDA 2NO0A 3WGVA 4E5VA 2F3TA 5MDHA 4ZVMA 2B6NA 4HXFB 1DEOA 3FSRA 4E3ZA 3PHBE 5KOJA 1OPRA 3NTLA 3BWMA 1NW4A 1F5NA 1QFXA 3OU6A 1BWSA 1VMDA 1Y9JA 4YALA 2FQQA 4EI7A 3QFCA 4US2R 2VRCA 3OJWA 1I51A 1JEYA 3TZKA 3O4RA 4H7KA 4QQFA 1YR2A 2W8BA 3O47A 5DK6A 3CF4G 4ZHSA 2WFLB 3Q15C 2COEA 2WWHA 3CIOA 2Y6VA 4MSUA 4EYQA 1M2NA 1G66A 4MICA 3ZXSA 4D81A 1T8RA 3LRTA 1C0IA 4XX0B 5DTRA 3NWBA 4RD6A 1RRFA 3HN6A 3ZN2A 3IUYA 3PQ8A 2B2CA 3L2OB 2OD2A 2WM8A 2WAOA 3Q3VA 3WO0A 4BLSA 1TT5A 4ZP1A 5DNDA 2GETA 3TAUA 3CF2A 5ICEA 1CNEA 1G21A 3GT7A 3ZIAD 3ET4A 3HCFA 2W2LA 3R3JA 1W5SA 1AB6A 3RBVA 1K8YB 2P7HA 2VWQA 2XDYA 3VV3A 4BC1A 4CM9D 2OGTA 5ADUS 3DL0A 3ZH9B 1DFIA 1RP1A 1QR2A 1XALA 1SWWA 4XR4A 3QVGB 3NBYC 4NJEA 3LDFA 2BBSA 4QULA 5BR8B 3G7NA 4RPCA 2V58A 1M2OB 3V80A 3EHDA 2A9KA 4OGGA 2CSXA 2VJPA 3NS7A 4PZ9A 4JI3B 2XYGA 3C3BA 5DO9A 3LWBA 3J7AC 2AZ4A 2WM2A 3COSA 4MCIA 4YJ3A 1JFSA 4UXIA 1CY0A 1DT3A 2WMNB 3OT4A 5BQFA 4RIIA 2QE6A 5BRJA 1HDRA 4YMVA 2AMLA 2BR3A 2D3TA 2NPOA 2WQZA 3WGUA 4ZYTA 3AI1A 5B36A 5JXIA 4E70A 3PXXA 4NNPA 2ZKLA 2NZ8A 2QLFA 5LLSA 2LV8A 4U9IS 1DKQA 1G8KA 4HAYA 5CNJA 3OHPA 1BROA 1PG2A 4C0QC 2P0AA 3AVVA 4C06A 2Q5CA 3VTKA 4YP1A 3M6AA 4AVYA 1PU2A 3QY0A 4XFKA 2IWRA 3TAXA 5HM8A 2GJ8A 4S1TA 2YZGA 2BGMA 2GA8A 1N2CB 3QI2A 1E5TA 4LI3X 5AOCA 2TRSB 3G9UA 2ZI9A 5KWEA 1HL7A 4KN6A 1LNZA 1J2UA 1P4GA 2R1ZA 3N2LA 2ZUVA 3ETDA 3O21A 4QXQA 2QU7A 1ZNWA 3F6PA 3QW2A 1Z6TA 3CPEA 1OPXA 1Z5WA 4TT3A 1UMDB 1VYTA 2NSYA 2PGLA 5GVRA 5JD3A 1HDOA 4LF9B 3PFHA 4G0UA 4B4KA 2KLHA 3D3JA 3F3KA 5CIQA 1SOUA 2HWKA 3M9LA 4GZ5A 3DBHB 2YCBA 2J1LA 3CT6A 2FSGA 1IJBA 1FS6A 2HMTA 5DISB 1NF8A 3V8QA 3C7TA 3UYLA 4L0CA 1RCTE 1GZ6A 1T29A 1VI6A 2WUEA 5C31A 2PRKA 2BBOA 3VU8A 1SHJA 4JEIA 1USGA 2EKLA 4I4LA 5K99A 4OAPA 3U4DA 5HFJA 1KYQA 2QMQA 3GMIA 1JG1A 3RS2A 5JS6A 1TF2A 4FOPA 4QOJA 2Z4RA 1ZN2A 4MJ7A 2H92A 3DEHA 4OU5A 5LIPA 1COWD 3CF0A 2VJMB 1YZNA 4ZDJA 3OQPA 3O1LA 1SEVA 4L3OA 5EKSA 2PFKA 2GCGA 1NG9A 1EDBA 1N7JA 3FR8A 1ZFNA 5J2TF 4KR7A 1T35A 3JQ7B 1KEZA 3Q5GA 2VSQA 1YRAA 4PNZA 3OQNA 3L06A 4FYPA 1DWOA 1Z12A 2REBA 1PV4A 3R74A 2OQ2A 1RHQA 2J6HA 3A14A 4M7WA 3CRNA 5ILOA 1E1RA 4DUGA 5FEMA 3TL3A 2O9JA 2E5WA 5DEIA 1IVYA 2BR5A 1Y8QA 2NTYC 1JHUA 3V1YA 3AJ8A 3IP5A 3PR3A 4KMRA 3MUOA 2H2GA 3O8DA 4PLCA 3RSOA 4L4RA 3ANYB 5G2OA 4F21A 2NU9A 4DREA 4RVFA 1L5OA 1X0VA 4B3JA 5IDVA 4K9OA 3H17A 4EA9A 2A2ZA 4FPXA 5CDHA 1JDVA 2RG1A 4P1ZA 4Q82A 1R6AA 2Y0EA 1EA5A 1ZHOA 3RVLA 4XDZA 4CDGA 1JLRA 2BHTA 4PYMA 3GEPA 5HQ3B 4HNSA 1XZKA 2WU8A 1YJXA 4HPWA 1CHDA 1UJBA 3SBXA 4OYLA 1MUUA 1BD3A 2PZKA 4MKGA 4O4LA 3WRYC 1YIAA 2OP0A 3NPAA 4UQPA 1J0EA 2Q50A 4RPGA 1MABB 3GFGA 1GZHB 1B8OA 1Y7HA 3MB5A 4K03A 3OPMA 1ZINA 4WESA 1UOPA 3U3KA 5AW4A 1P1BA 3O75A 4YASA 4LJKA 2YJGA 2R6R1 2V3VA 3RC7A 1BD4A 3KKLA 4EOGA 2X19A 2IHJA 1S1MA 3PX2A 1ZONA 2O5RA 4B76A 3GLIB 3DMPA 5LQJA 3OI7A 3SYMA 4DC9A 5EIWA 2Z8ZA 5EIFA 2DUMA 3SZLA 3VR5D 4DLPA 1F06A 4PW0A 1II0A 1RYEA 1TF7A 3UB2A 4HRXA 3URKA 5C2JB 1E79D 2J9XB 4YQEA 1KZGB 2WG0A 3A4YA 1XJ5A 4INPA 1E4OA 4P4UA 3VDQA 1F2DA 5AXCA 1E9AA 1HKUA 1W88B 3FG9A 3F5MA 3OP4A 2RH9B 2V59A 2C61A 4ZPJA 4F06A 3ZGXA 4QVGA 1LJ8A 2J0QA 1THGA 3WZMA 1P75A 1VA4A 4BQPA 4I4IA 2J3EA 2GM5A 1E89A 3T5BA 4C7BA 3KXDA 4BNDB 2GRAA 3UH1A 2Q4EA 4HTFA 5ALTA 2UVPB 1USWA 4G0QA 5DNVA 3RTGA 1YDEA 1ZUNA 3SPXA 4CLRB 1PR0A 1T1SA 3EXAA 1FMFA 2JARA 4FYJA 4K2AA 1YZUA 1YQXA 5CNKA 1VLVA 4WLOA 4DDWA 3MQ4A 1H2HA 2P9EA 4LV8B 2ABWA 2ZK7A 3MGKA 4YCAA 3EQZA 2P2YA 1WR8A 3EH2A 3UVEA 5CA0F 2X4LA 5C80A 3F2VA 3DAFA 3HU2A 1R5NA 4YRRA 3KQSA 1EK6A 1T8WA 1TM1E 3WHKA 4LBZA 3MAGA 4W5WA 3KB6A 1H23A 2R60A 2DH5A 5BW5A 5HVNA 3HVIA 2YFHA 4Q4DA 1GZVA 1WXFA 4JQSA 4UM5A 4W1QA 4J8PA 5E2AA 1MO6A 1SQSA 3LUFA 3UWOA 1C3OB 2GNAA 3FLAA 1J21A 3OZUA 1PUJA 2RGNA 4PRKA 4BO4A 3K5PA 4LE1A 3NWPA 5D5QA 4Q16A 3D43A 1SCAA 1XBTA 1ETUA 1DTEA 2PN1A 4HN9A 2VHVA 1W29A 4AY2A 1UXOA 1Q74A 1U0EA 2Z5LA 3AEUB 2D62A 1H4VB 3KBBA 4IIEA 2V5VA 2IXTA 3F3YA 2PU5A 4KQ6A 4WKOA 1CEXA 3VC1A 1VG0B 2KJQA 1H42A 5I7FA 3IQDB 2IT1A 1BS2A 2NIPA 5A4FS 4XYEA 3DFMA 3RROA 4Q3NA 4TUYF 4RGQA 2HMYB 4JYBA 4ISCA 3K71B 1K98A 3M81A 2YIDA 1ZCAA 2CXPA 1Q20A 2O20A 1NVWQ 2FU5C 3C3EA 4YTEA 4XJXA 4AYWA 3A11A 4W82A 3SZGA 4NY1A 1QVWA 2P90A 3H6GA 2DBQA 2JASA 4WZ6A 4MUKA 3D8HA 3T8YA 5EIOA 4B2LA 1XMPA 4LF6B 1JXMA 1LW7A 2CWDA 1NSFA 2Z58A 4NVRA 5CB0A 1N2XA 5BMOA 1UK9A 4IRMA 1I4WA 3CGWA 3FWHA 4XCQA 2DYKA 5D6OA 1FDUA 1L4GA 5IAKA 5K0EA 5C53B 2J3DA 4F84A 1YTUA 4O2LA 3DMDA 4PRYA 4B6FA 4Z2AA 3AY7A 1GNVA 2ZFUA 1U5BA 4I7EA 3CN7A 4EVRA 1A95A 2BV3A 2WEKA 4UVEA 2X0RA 5EJFA 3QYFA 3VZQA 4UHEA 1EWTA 1V5IA 5AI4A 1P0FA 4QHSA 2NZYA 3OWHA 3LQ2A 4IFBA 2ALJA 2G40A 2XD9A 4I4TF 4IHQA 5C4GB 5T64A 1EX9A 1BXGB 1KK1A 1VSQA 2VJMA 2NU6B 3LG2A 4OQYA 3L01A 4GOMD 4KAXA 4L28A 1ECGA 2AFVA 2QRGA 4RZHA 1NRJB 1WB4A 3IJRA 1X3LA 2GLUA 2H65A 4RVSA 3B89A 2R5NA 4LJLA 1GSAA 2QD3A 4A27A 2WVAA 5F7OA 1YRWA 3H5IA 3WMGA 2NNWB 4C7JA 5LWQA 2GPTA 4TMWA 4JC4A 5ECDA 1RLMA 3RYHA 3AV0B 2J33A 3ADBA 3ZX5A 1IHDA 3LPDA 4O5OA 4TUYB 3CO5A 5JAPA 1QGOA 1TCBA 5BUZA 4KI7A 2J3HA 4NZMA 1OZFA 2JHFA 3DTNA 5IG2A 3HCWA 1TKAA 2IXGA 4D0RA 4D74A 3TR6A 5A3JA 1JIKA 1HGXA 3P2IA 2QT1A 1EX1A 1U63A 2EKPA 1U2DA 2Z98A 5LUBA 1SG0A 3K1AA 1RBYA 3OIGA 4H31A 4PNHA 3HHPA 3O26A 5TSDA 1ZD5A 3U3RA 1MGOA 2UZ4A 5T4EA 3ZE2B 1KMQA 3EVZA 5AI5A 3L0BA 2R68A 3BB3A 1IK6A 1XZMA 2C9MA 2MR5A 5ALMA 3ENKA 1BXRA 4MQLA 4YI3A 4Y18A 1ABEA 1NUPA 1IUPA 1Y1QA 221PA 1GQRA 1T9AA 2HL6A 3ABQB 3SC2B 3UKDA 3VNSA 1XU4A 3A6FA 1DCFA 1MC8A 3AB7A 3D1JA 2GGSA 1OXTA 3C7CB 1JT9A 2OZLB 1NJSA 1LEHA 1IB0A 1L3CA 1VG1A 3M8KA 3S0JA 4C3VA 5CB6A 5A6SA 4ZVTA 3WJ7A 1CEYA 1CIPA 2I2DA 1DMSA 4IY1A 5CA0B 2L69A 1FDWA 1YBVA 1UJMA 3I8XA 1KEPA 1L7DA 4RGVA 5FD8A 4E3WA 1AHPA 3AM1A 3NETA 2I4NA 2YTZA 3RKRA 1QYVA 1D1PA 1IN4A 4KGZA 3TS1A 3U13A 3E22B 4XYMA 4EABA 4MI6A 4P3XA 2PDAA 3T1VA 2R1TA 3L77A 3OCWA 8ADHA 3K9HA 3V4ZA 1C4OA 2YMLA 1NJ8A 3WA7A 3W5IA 1CZRA 1RHRA 1FDOA 5SZHB 2XZTA 3UWKA 3JQAA 3UT0A 1FEZA 3LP5A 4W9MC 2K2WA 4X93A 2NNLD 2G6TA 2JLBA 3GB9A 3FNIA 1G3IA 4RSGA 3WBBA 3TX6A 5KO2A 2AG1A 4C29A 1MHPA 1V71A 4HH4A 1ZH8A 3M6WA 1CRQA 3IBGA 1QMPA 4FFNA 1NBWB 2ZBQA 1REQA 2B94A 1GLGA 4MQUA 3U09A 4FM9A 4QBGB 5LYJB 5I9IA 3N2IA 4KQ9A 2VXOA 2QRQA 1OFIA 4HRAA 1Z6PA 5JSZA 5LQDA 2FJ0A 5J5CA 1E58A 4C3UA 1QIEA 1F2VA 2SNIE 2DQSA 1GV0A 3DCNA 1Z83A 3FJ1A 3QJYA 3TUIC 3WG9A 1E20A 3CWQA 5FA5A 3V2IA 1ULZA 3R40A 1MVOA 4UEWA 3TVYA 1A7AA 2XMGA 3DPIA 1RJ9A 2ZVDA 2CL5A 4HQFA 4CF4A 1I5OA 3T6KA 2W98A 2VCEA 4HS4A 4ZOQI 4I1YA 2AVDA 4INAA 3IP7A 4L4YA 2E4WA 3T3PB 4U4AA 2ISSD 2IHNA 4GGPA 4BMVA 1DCMA 2CB0A 1AUPA 3CBQA 4Y6OA 4DEVA 1AMNA 3W79A 1JH9A 2JBAA 1V7ZA 1AGYA 1Z33A 3S1AB 3QKIA 3PYXA 4QPPA 1W4BA 1L4FA 1EEXB 2QRPA 1GTVA 1LRLA 3HVHA 4E1VA 4URVR 3BBPA 1NX9A 2CZCA 3AIMA 4HAZA 1HKHA 1KO8A 1QRRA 4KCGA 5CFNA 1IMOA 2QSZA 4I1RA 5GQSA 3RVJA 4B71A 1PWEA 2AG8A 3EEFA 4PQRA 5ALGA 4B6JA 4EBBA 5KSZA 1EWQA 4KRGA 1YUNA 6CHYA 3IB3A 1WV1A 4UPDA 5D6NA 2GT1A 3AF3A 3DHWC 1BIFA 4FLMA 4M36A 2CCGA 1I9GA 3SYKA 5I45A 1LVHA 3KK0A 1GUBA 3D2CA 4OLHA 4HVTA 1WULS 4KO3S 4CUJA 2RHGB 4H4DA 5BPHA 5KOHB 3DZFA 3FZNA 4QRIA 2JCGA 4Q9HA 3LQYA 1GGEA 1O87A 4ZAZA 3JQGB 1YS1X 3AU9A 2AI2A 4P86A 3JW8A 4WY2A 2FMIA 2IYSA 1JR4A 2WJ6A 3HZOA 2FFHA 4EG1A 1ND6A 2FX2A 1RC0A 3BN3A 3E1SA 2C20A 1W46A 1O1YA 4EENA 1VLJA 4KFTA 1QDEA 1Y4ZA 2JANA 3K9BA 3OT1B 4N0PA 4UBJA 3QPVA 2I99A 4DJFC 5BN3B 10MHA 2QN1A 3WJ1A 4F6CA 4LRTB 4AMUA 5KYTA 3KJHA 3EOBI 3G0IA 3JWJA 3LXUX 3B5IA 3EGEA 3D7MA 2AYZA 4QUKA 5AW2A 2AZMA 4GQIA 3ADDA 3U48A 4CMKA 2AJ8A 1Q6ZA 4QPNA 4J1TC 4F5DA 3BF7A 1U7DA 1EIZA 2E4VA 2X4IA 3AFIA 3GFBA 4Z99A 3EZ7A 3DFIA 4BVEA 1K6MA 1MX5A 2A14A 4FMCF 1E3QA 1NVFA 2IEZA 2EHDA 4V1CA 5KQRA 2RGAA 3QWFA 3QG5A 4DV7B 2ONYA 4MV0A 3IXLA 5C3MA 4X00A 3C5EA 2J4CA 3E7DA 5IKMA 1D2EA 1QIHA 3LT1A 3OCYA 1ABBA 3NHWA 4UAVA 5E3JA 1K5GA 3GLIE 2X5KO 4BQNA 4JZKA 1YDGA 1QF6A 2QMZA 4NMLA 1Z4MA 2JI6A 2MYNA 2QTLA 1OAOC 3G8CA 4WN9B 4I3HA 1SVIA 4FUQA 4BDSA 4XD7D 4M0MA 2HA0A 4WCFC 4YO7A 1N8KA 1JEYB 2IEGA 1NTOA 2ZRQA 3OD1A 3WSWA 2O2JA 3VYTB 4R2MA 4NJMB 4RELA 2HLHA 4UEQA 2IQ5A 1NYRA 4IRXA 1M8GA 4NYMQ 1MORA 2C54A 2JLCA 4GPD1 4Y30A 1JQJC 4BBJA 1N5DA 1KTIA 5E6UB 5F2EA 1CQJA 4OLBA 2ZSDA 4Q1EA 5HZMA 1N7GA 3PVZA 4ZO6A 2RBGA 4MRAA 3FOZA 3KSBC 4JLMA 3QOXA 5LOVB 2E82A 1H69A 4AKIA 2SECE 4F93B 2HXSA 3ZKAA 2XAAA 3NM5A 2ZEJA 4UW9A 4TMKA 1HT1E 3SN6A 2B7CA 2A9JA 3GJ4A 3HPQA 4BLOA 4CRWB 4INZA 4YA6A 1ZMTA 4ZHQA 1FDTA 5IAGA 1ULBA 4EUSA 4V1CI 3PHGA 1OLUA 2B8EA 1D6JA 2XPCA 4JT9A 3T7EA 1ZO8A 4LN1A 3EY4A 2ODPA 3NIBA 4G1UC 4GVLA 3L5KA 2WJIA 3N2NA 2RKOA 1TECE 3KQOA 4MS3B 5T57A 3USCS 1R8XA 2XCUA 4QYMA 3KT8A 3RBZA 3K70D 5DBHX 5E1OA 2XB8A 4MDEA 3NT2A 1NULA 4BFVA 1XMOB 1GLVA 2WMYA 1N6RA 4LWOA 4JEUA 3QFHA 1OXXK 3ZZ0A 5CJ2A 2GCEA 1P7YA 1RBZA 4YECA 4TMFA 4EM6A 3AF0A 1RTTA 4V39A 4TLCA 5JZBA 4ER6A 2EKZA 4LCJA 4PAGA 3C45A 1UCFA 3VDMA 1GEGA 4PX5A 5CGQB 1I7QB 4KV7A 4O2AB 4QT4A 5LA6B 1LK0A 1IXKA 1ZRMA 5KU1A 4TV9F 3A4NA 4ERNA 3K92A 4JQYA 3W5HA 1ESCA 3TSCA 1J06A 2FP3A 2LKDA 3A4MA 1ENYA 1Q16A 2RI0A 5D86A 2FWRA 4OHWA 4DWVA 1RRCA 3RIEA 1T2UA 3LY8A 4LW8A 4PZZA 4UE6A 1ISGA 2F4NA 1RRKA 3E15A 3TW8A 1SB9A 4YV1A 4TT3D 4K0RA 1HDYA 4QYIB 4ZO8A 1GNLA 1OBVA 2ZU0C 3B2EA 5I7SA 2NO6A 1N0UA 3KFXA 1IUKA 3C1OA 3QYPA 4M7OA 5H7XA 3O1IC 3ZNOA 1M34B 3IPXA 3EIWA 2HLNA 4D82A 2R7AA 4LG1A 3LCUA 2ZXUA 5G0UA 5IJZA 1GYQA 1VMAA 1XEWX 1EP1B 3KKKA 2RHTA 4Z3OA 4H7HA 1TQ8A 3B5EA 3KJIA 3CNBA 2RI6A 1T4MA 1XQYA 4JLAA 5HIMA 1ZL0A 3LV8A 3UHPA 4PR3A 4AMBA 5FV4A 2I7DA 2IXEA 1IQUA 1G7RA 4TYPA 1RWNA 3O92A 5CGZA 4FDVA 4CQJA 1G6Q1 3QFFA 4G9EA 4L8LA 2WW8A 2BH2A 4IW3B 2VIIA 1LY1A 2OLEA 1VPTA 3KR0A 3F4BA 1XEAA 2I2FA 2QRHA 3N07A 4IVQA 4LGCA 4ZHQB 1DC5A 2UZ3A 2GOYA 2CFTA 2PANA 2YR0A 5IP5A 2FYTA 2XNCA 4BS9A 1OX4A 2R8BA 4ZQBA 2ZXFA 3JASB 3I9V1 4WASA 4WCFA 4BMOB 2WVJA 4V02A 1Y4SA 3AR3A 2B36A 1G6KA 1E1QD 1NQOA 3DW3X 4ZT3A 4UPVA 3W5SA 1IM2A 2VHUA 4JUCA 5LLDA 2HJHA 2PUTA 4FX2A 4G1MB 4NFHA 4KDFA 5JC1A 1ISIA 1U8TA 2VSFA 4ZCQA 1IBKB 4BEVA 1FJGB 4PZPA 1MA3A 2EKDA 2FZ5A 1IY2A 4Q3EA 4CG2A 3D7KA 2G5PA 3BT7A 1PJBA 5IM5A 1ML4A 3OLQA 4LDQA 1I36A 5DI3B 5REQB 2PUGA 4U6NA 3D9QX 3JQDA 1TADA 1Q1AA 3QVGA 2HDHA 4NJEB 3G17A 1XC7A 1KDVA 2R6ZA 1E3SA 3D6VA 4TPKA 2R8EA 3ZS9A 1YB5A 1YU6A 3AEKB 3ZLUA 3QGMA 1JEQA 1MBZA 4IDAA 1QOZA 2OCKA 5CDFA 5AVVA 2N47A 5L95A 2ZUFA 2MSNA 5GV8A 5HPYB 4P53A 1O94C 5BN1A 4ICIA 1L6IA 4IV0A 1TAUA 3VU1A 1CD5A 1GD1O 1LLUA 1U5CA 2JI4A 3UAWA 4GBJA 4RORA 3E0QA 4UU8A 3L3BA 2APJA 2HK7A 2GK4A 4FE7A 5JXJA 1ZVKA 1LFDB 3I9JA 3IBFA 1U2ZA 5JG7A 5E1DA 1M1XB 3CO0S 4M9ZA 3LVBA 1RCFA 1C4XA 1E2BA 5HK8A 2VP9A 3IERA 4AW9A 2LBPA 4DAOA 1ID8A 2C97A 1Z29A 4GWGA 2WU3A 3BL5A 2BT4A 3KIPA 3N53A 4HATA 4HWKA 3SOPA 3ZHTA 1G9XA 1OBOA 5E7JA 4UFOA 1ZJWA 3KQHA 3I45A 3IT3A 1CYEA 1S02A 1J24A 4KNWA 3HK2A 4K7JA 4TXHA 2JJ2D 4HDSB 4IVPA 2DE0X 3HYSA 1J33A 2V7UA 1JXQA 3A7EA 1RMYA 2F9FA 3QU9A 4JXJA 1OZGA 2YXEA 3ESCA 1C1DB 2Z3VA 5AK6A 3FHOA 4J7AA 1QFZA 1QPBA 2GN6A 4A2CA 3WBJA 4JI7B 2QJOA 1OHHD 2EWMA 3FTEA 5TMDA 1VA5A 5DM70 3H3FA 2VJKA 2OV1A 3RU7A 5FPKA 4EYSA 4NBRA 4Q18A 1BEEA 1SIOA 4BX9A 1FA9A 3NM4A 2DPXA 4FMDB 3W5CA 1NMZA 3MUNA 1ECPA 1U3DA 2ZB8A 3BDIA 3HYNA 2JATA 4OK5A 1CQJB 2HFJA 4DT1B 5BUCA 3AEUA 5LC1A 4BNXA 1SEPA 4LY6A 3BF8A 2ECOA 4AJHA 2CJFA 5KCZA 4LOJA 3KJQA 4GYJA 3W5VA 1I01A 3VSCA 4EI2A 1OREA 3ILSA 3A1EA 5HF9A 1I4LD 2EFEB 2FWNA 2WBLC 5AW7A 3ICQB 4HEA6 3ZCSA 4F3CA 1MDBA 1UKVY 1XAJA 5AM4A 1A1VA 2BOVA 3J81k 5K2MA 1FSPA 2QR5A 1JDBB 2WVHA 4MINA 1TYDE 2E18A 1VCIA 1GEEA 4B32A 2QRJA 5DULA 2IS2A 3NTOA 1JKMA 3KB2A 3VOSA 3KSDO 4Q47A 3EULA 5JBNA 4ENTA 4PANA 4RHYA 1T9CA 2EDCA 3KVYA 1TTHA 1MPTA 2O2SA 1EUZA 1VGQA 3MMPA 3G2LA 2OOSA 1G5IA 1MU0A 1FDIA 1XMSA 4RTMA 1MO4A 4X3OA 1G55A 5LN1A 2YJNA 1ZIPA 3RASA 2Z4SA 7MHTA 5GM1A 1NJ2A 2HC9A 3DZKA 3PTZA 1K8XB 1U94A 3MTIA 2QP9X 3IKVA 3OCUA 2PX6A 4JCOA 3BJZA 4PWZA 1KMIY 2Y76A 2VP0A 3K6RA 4A5OA 1O9GA 4Q4CA 1VKNA 2JC3A 2OCPA 3PNVA 3DVSX 4AP9A 1Z4LA 2QNRA 3T7RA 4D4LA 3SR3A 2WTEA 2GPNA 3OOJA 2E6KA 4EUKA 1KKUA 3Q3CA 2UYGA 4CDMA 4MIKA 3Q98A 1NY5A 4A7PA 4IKEA 3IVCA 3DYIA 3L4SO 2MHCA 1KS9A 3BTVA 3P9CA 3Q2IA 1QSGA 4JOSA 4MGYR 4UU0A 2A67A 1XLWA 1ZOIA 1JBQA 3HA7A 4KRYA 2VJAA 2XYRA 3U7IA 1XZFA 2WZQA 4H3SA 3BMOB 4KMOA 3OM8A 2YXDA 4BO2A 3LFHA 2V55B 1UK7A 3HEMA 1HEUA 1RWBA 1JX6A 2ZBFA 3FLEA 3IDZA 4D5GA 1EJBA 1JPNA 2VPWA 5BN4B 3RUPA 5E0OA 3U1TA 5JPIA 2R4TA 1QLWA 5F76A 4DMLA 3ZDAA 3E9MA 3HXPA 1KDOA 5E38A 3P20A 3VPHA 4EJ6A 4DY6A 1HRKA 2R97A 3PITA 3OZVA 2GEJA 2QV7A 3ZDXB 1G98A 5IT5A 2VAMA 1Z5UA 1P5RA 2MSCB 2RCYA 5EXTA 4Z5XA 2YRFA 3NBUA 3M1LA 4DY4A 4YVFA 2HSWA 1RLIA 2Q6KA 3BDVA 2JJ8A 4UUAA 3ZU2A 4BCBA 5JT1A 3PIDA 2JBWA 3BWBA 1N75A 1L0BA 5AYVA 2JJ1A 2O7VA 3ZH2A 4K86A 1XTJA 3K9LA 4Q9AA 2HIMA 3OZXA 1L8XA 4LAFA 1PJLA 4YRQA 4ZT5A 5LZ8A 4BVHA 1XOIA 3TZLA 1AN0A 3I2JA 3GNQA 3I3OA 1P2GA 2D59A 3KLOA 1UDCA 2PLFA 3WWEA 5JCJD 1FS5A 1X13A 4UU1A 3ZJ4A 2F8SA 3DEFA 2PUAA 4LRWA 2ZRDA 3OU2A 4HL6A 4JUDX 1DIHA 4HNVA 3T5DA 4Z0PA 4MVJE 2C4HA 5DTMA 4F85A 3EVFA 1VHLA 2NTJA 3TSZA 1EINA 3RAJA 3RK0A 2IUYA 3TLCA 3N2KA 3BD9A 4CKZA 2NAPA 4JBGA 5F12A 3GRVA 3UNXA 4ZDWA 4N6OA 4BO8A 4YCMA 4HDCA 1OCEA 2WWYA 4Q3OA 3O9MA 5A5VA 3NOOA 6GPBA 2F8MA 1G7CA 2GEVA 2JFGA 3D6MA 3U7EB 1U0BB 1SRRA 1N2BA 2GJ4A 2VHWA 2Q6VA 3Q7SA 5EXXA 4G5FA 5FR1A 4DLXA 3WL8A 1INLA 5DYGA 2O7NA 4CL8A 2Y67A 4AXBA 1BJRE 3CSSA 5IAJA 3H5RA 3K16A 4LBYA 3U4HA 2B34A 3C6KA 1NW7A 1IULA 3ND9A 4IICA 3SLGA 1GAQA 3KTAA 3DM9B 4DN6A 1OHHA 4W1SA 5I8ZA 1E6UA 5FYQA 2OORC 2YH2A 3DO6A 4CETA 1QIMA 1G8MA 4G0NA 5C8YF 4LE2A 1O96B 3AIIA 4URHA 5EHQA 2CFIA 1XVVA 2X8LA 1QKJA 4KV9A 1NKVA 1QMGA 4HEHA 4MYRA 5DHPA 3U49A 3T5AA 3NQ41 2LNDA 3TZ6A 4AJKA 1CF4A 3AETB 4N0DA 1U9CA 1N2GA 3EG5A 2XKKA 5JTTA 4H4CA 1X77A 2AH5A 5A2QA 5K0NA 4PYJA 1Y9AA 1MB4A 1WS6A 1R8JA 4NE2A 1Q6YA 3THSA 5ALVA 4EY7A 2B8NA 1QGAA