4E15A

Crystal structure of kynurenine formamidase conjugated with an inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
301
Chain Sequence
b'AGHMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kynurenine formamidase
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/hydrolase inhibitor
total genus 121
structure length 301
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e15A00
5K3EA 2C7BA 5HQ3A 3VKFA 4K6HA 1THGA 2WQZA 1CUJA 1W6RA 3ZWQA 4GXNA 1MN6A 2DHCA 3IULA 5AKEA 4B9AA 2WUDA 3AILA 5K3FB 3CN9A 1QIGA 3ZV7A 3GFFA 1CUSA 4MWSA 3ICWA 3FBWA 5ALWA 5LZ5A 2QZPA 5HFNA 2OPHA 1CVLA 2C5GA 1KEZA 2WUGA 2JGEA 5AHXA 3PUHA 3WZMA 3I1YA 4KE8A 2LIPA 1M33A 1EK2A 1R9NA 3WK7A 3D2CA 1JJBA 2DHDA 2Y2UA 1C7JA 1GKLA 2XUFA 1QONA 3DYIA 2BUAA 2WG1A 3G0DA 4HXEB 1AURA 2WHQA 3STXA 2Y2VA 5FRDA 4OD0A 1P0QA 2HA5A 2GBFA 4DYHA 1ORVA 4IH1A 2QJRA 3F67A 4QDXA 1UWCA 4PNZA 1BCRA 3EQ8A 4BZZA 2HFJA 3HLKA 5ALPA 5JZBA 1TQHA 3I2FA 2PKYX 4BDTA 5AKKA 3AZPA 1YA8A 3ANTA 4X7BA 2OAGA 4EY7A 4ZRDA 5EHZA 1XLVA 1BE0A 2WHPA 1AGYA 2GYWA 1MAHA 2GBIA 2P8SA 3C8DA 1VA5A 2PSDA 1IMJA 4CCWA 1E8MA 1YB6A 4AX4A 5LZ8A 2VT7A 3IUNA 5JIBA 1GPNA 5AK4A 4Q82A 1F0NA 4BRZA 5AKXA 2AJ8A 1K4YA 4U2CA 1IUNA 4HRYA 4LXGA 3F97A 4DMHA 3D2AA 3A6ZA 3OM8A 3K6KA 2DSNA 2IIVA 1DU4A 2WG2A 5LZ7A 5J3JA 4Y2PA 4Q3LA 4G9EA 4N8SA 1QIIA 2G5PA 1PFQA 2WJ4A 4W63A 1XZMA 5EFZA 2QOEA 3FCYA 3E0XA 3GELA 4I4CA 3AZOA 3WA7A 5A7FA 1MTZA 3H1BA 4F0JA 3R3UA 4GHWA 3BL8A 4PSUA 5HF8A 4C89A 3TJMA 2OCIA 2VEOA 2HA6A 4C88A 5JYCA 1XZDA 1CUEA 4C4YA 2DFPA 3FYUA 4TGLA 1JU3A 1IUOA 4GBGA 2PX6A 1AC5A 3WKCA 2CZQA 3ZPXA 3DKKA 1ETHA 1UK7A 1XRMA 3G02A 1XFDA 2AJCA 4BB0A 3WWCA 4TVKA 3AIOA 4HVTA 3MUOA 4PQEA 1DT5A 1LPPA 5E4YA 4UUQA 4OB8A 1L7AA 3R3ZA 5EIHA 3E3AA 5KBYA 4WCVA 2V97A 3FSGA 5ALQA 2ZVDA 3FAKA 5JAPA 5ALVA 2ZJ7A 1E66A 1ZI8A 3CN7A 5CBKA 1K63A 3FLEA 2D5LA 4J0CA 4EBBA 5JZSA 1XKLA 4UBOA 3T4UA 2V98A 4FLFA 1ZOIA 1R88A 1C7IA 5CXUA 3RLIA 2XDWA 5JARA 4AMYA 4ARBA 5ALLA 5FP0A 4I19A 3VJLA 4GW3A 1EINA 3IDAA 2OG1A 3WWPA 1DQYA 5AM4A 1USWA 2XT0A 3H1AA 2HFKA 3EBLA 5HK9A 1QO7A 5AK3A 2DQYA 3BF8A 3MUNA 3V1LA 3O95A 5AKIA 1CUAA 4UFOA 2GBCA 4DSZA 2ACKA 5LP1A 4OSEA 4FMPA 4AO8A 4U2GA 2BUCA 4J0HA 1JT2A 1YSCA 4J7AA 1F6WA 5ALSA 1AQLA 2Y6UA 3FSGD 1HBJA 5IVKA 3WWOA 4OU4A 4AQDA 1E8NA 1H2XA 3HACA 3D59A 3BDIA 2WKWA 3G9TA 1SFRA 1S8OA 2XUOA 1FSSA 1Y37A 1BROA 1ZI6A 5FLKA 5A62A 2RI6A 1D07A 4PSCA 5AICA 4H7HA 2VAVA 4K2AA 3OG9A 2WG0A 5AM0A 4EUSA 5C8XA 3GZJA 4K6GA 3QMMA 2IITA 1J1IA 3P2MA 1EVEA 4QDTA 3C8HA 5ALEA 3D2BA 5AIAA 1TCBA 5YASA 5E4TA 5ALXA 1EK1A 3G0IA 4B84A 5EHNA 2JEYA 2HRRA 5D6OA 1T2NA 2R11A 4D9JA 2XUGA 2QXTA 3DJYA 5AO9A 5EGNA 5AI9A 5ALGA 3WK9A 2ACEA 2RHWA 4G4GA 3E4DA 2VAXA 1THTA 1AUOA 4ZV7A 4CIAA 1GPKA 4Y2VA 4WFKA 5AM5A 3NUZA 3G9XA 2I78A 1WPRA 2X76A 3VJKA 1PV1A 2WTMA 1QFSA 1ACLA 4UBNA 1WHTA 5T4EA 1VXOA 3YASA 3DEAA 4BE4A 1FFEA 3ESBA 4H7EA 1XQWA 1X70A 5ALHA 1XZAA 1W52X 5JD6A 2OCLA 1VE7A 1QIFA 2WIGA 1RP1A 3KWFA 4W9RA 1Q0RA 4DNOA 1WHSA 2XMBA 5FOQA 2ZSIA 1CIJA 4KEAA 5KWJA 1H2WA 1G66A 3L1JA 3WKAA 4AO6A 2PUHA 1KU0A 3G0GA 4MXDA 3BE8A 4KAJA 1DX4A 3WK5A 3ANSA 3QPAA 1O6GA 1XRQA 3C70A 5AIBA 5IKXA 2VQ6A 1SCIA 5HF5A 2B61A 5ALIA 3IUQA 1JJIA 3V1NA 3DS8A 4WFIA 5CH3A 2ZYSA 4XVCA 3MVEA 1A7UA 2B9VA 1Q0ZA 2HDWA 3DL4A 4LIPD 3H2HA 2CB9A 3PF9A 4UFNA 3O0DA 4IH9A 3G0CA 4X00A 3IURA 1CQWA 4E14A 2JGFA 4UBIA 1XROA 4WY5A 3H19A 2VF2A 4EY5A 5LKAA 1CQZA 1CUBA 3STUA 4W1PA 1LPBB 3PFBA 1CUVA 3BJRA 5CW2A 4B9EA 2W22A 4FFVA 2QVBA 4IH4A 3VXKA 4YX9A 2GYVA 3MGAA 3A2LA 5SYMA 2HU5A 3WJ1A 3WA6A 2G4LA 1H23A 3JYHA 4G4IA 1QGED 2Y6VA 2W6CX 1GQSA 1GPLA 1DWPA 4EZIA 1YB7A 2PU7A 1EDDA 2VJAA 5H3HA 5HF6A 1SOMA 5EI5A 3AJAA 4BBZA 3ZLTA 2X8BA 1LZLA 1J06A 4Y2XA 3WL7A 4AO7A 2BAGA 4CG2A 1RYYA 3QMVA 3K2IA 5AK5A 2Q0XA 4OB6A 2QUBA 1LBSA 1YCDA 4E11A 2C5FA 4BTLA 1GT6A 2WIJA 3FYUC 4QDUA 2QKYA 3HZOA 3AIMA 3CCCA 4H7JA 3E1GA 5AKHA 2HRQA 2WHRA 4B0OA 2WLSA 3A70A 4UPDA 5ALFA 2B4KA 3WIOA 3ESAA 5CH8A 4G9GA 1BU8A 1XZFA 3H17A 1EH5A 5T4HA 4QEKA 1XZBA 4AXBA 2ORYA 1TCAA 1QLWA 2V96A 4BYMA 1QTIA 4Y2JA 1N8SA 3QVMA 4OUKX 3PICA 3NGMA 4H0CA 1Y7IA 2VJCA 1R4ZA 1XZLA 3SWWA 3NOXA 1ZIXA 2WUEA 1B41A 2ZYIA 4U2FA 5K3AA 2FJ0A 5JAUA 1UK9A 4G4JA 3G8YA 1R9MA 2XQJA 3FWHA 3KWJA 5CMLA 7YASA 2Z3WA 2DQZA 5CURA 1LZKA 2O2GA 4X93A 3F98A 5DJ5A 1G42A 3IUMA 3O9MA 4C4XA 3DOIA 3F96A 4J0KA 1JMKC 2NW6A 4PV7A 2RHTA 1P0IA 4LYDA 2BGNA 1H22A 1SCQA 5AK6A 1N5MA 1XZKA 1HPLA 4UBLA 3RKSA 4BCDA 1HKHA 2BFNA 3L1IA 4DMCA 2QR5A 2O7RA 4H18A 3FVTA 3IVMA 3ICVA 5IVDA 1XZGA 2BKLA 2X5XA 1CUWA 4X6UA 1XLUA 1CUXA 3GA7A 2I3ZA 4CG3A 2DHEA 3N2ZB 5E2IA 1WM1A 3B12A 1JKMA 3QITA 1VZ2A 1BS9A 4INZA 1E3QA 5HQ3B 3VVLA 2Y1KA 1Z68A 3G9ZA 5LKRA 1G4HA 4WJLA 3H2GA 1CR6A 2J4FA 2PL5A 4CIBA 4ZXFA 2XUQA 3H2IA 4LXHA 4HS9A 3DDUA 5FPPA 3WJ2A 4KACA 4BAGA 1AMNA 2PVSA 3BDVA 2OCGA 1JMYA 2XUJA 5CXXA 5D3ZA 2EDCA 4HXFB 2HU7A 4JYMA 1TK3A 2WSLA 4G1FA 5AM3A 5CT5A 3PI6A 4KYVA 4BP8A 3H0CA 4RE5A 4P08A 4N8DA 1LPMA 1CPYA 1QIEA 3VVMA 3I2IA 2H7XA 3R3YA 1A8QA 3C5WP 5AKYA 2O2HA 3UUFA 1U4NA 4QE3A 3X3HA 4Y2TA 3R41A 4QA9A 1VE6A 4RE6A 5ALTA 2QS9A 5AP9A 1NU8A 4ZI5A 4YPVA 2RGUA 2XUHA 3LP5A 4FTWA 1ODCA 2HHAA 2JF0A 2G5TA 5JASA 3Q8WA 1XQXA 5LZ9A 4GEGA 2I03A 4K5QA 3Q0TA 5DYYA 1XZIA 1EHYA 1CUHA 4I3FA 5AKZA 4JUIA 5JAOA 3LIIA 4FDMA 2WFZA 3GUUA 2WHPB 3R40A 4EA6A 2J3QA 2HL6A 3QM1A 4S0XA 4J0GA 3ESCA 4DNQA 1TIBA 5ALOA 3C6YA 3V9AA 2YXPX 2XE4A 5CT4A 1E5TA 4X6YA 1MU0A 1VKHA 5A7HA 3IA2A 2HA7A 5JD4A 4WFJA 3FLBA 5CH5A 4BC0A 4BDSA 2XLBA 2WM2A 3HC7A 4X71A 4NMWA 4A5SA 1U8EA 3VISA 5DTJA 3L1HA 5ALKA 1R1DA 1XZCA 1ZGCA 1XKTA 3WYNA 5HCUA 2RONA 5LZ2A 5E4JA 4HXGA 4EB0A 2CKMA 1BN7A 3AINA 3CXUA 1AKNA 4EY6A 5DNUA 3N0TA 4X92A 3DL7A 1ORWA 4ZV9A 2OAEA 4F21A 4YASA 4BCBA 3FYUB 4BVJA 1P0MA 4MQMA 2XUKA 1GQRA 2WFLA 4ZGBA 2ZSHA 2XMGA 5IH7A 1ISPA 5BWBA 4P92A 4UBMA 1CRLA 4FNMA 1DINA 4DGQA 4Q3KA 1SCKA 2GBGA 1XRPA 3DYVA 4Y2QA 5JADA 2CBGA 3WKEA 2C0QA 1A8UA 2PM8A 5EIAA 5T4BA 4BCCA 4E46A 4Y9SA 4B85A 3F8SA 1ZD3A 2E3JA 1ZD5A 4GDMA 4FFWA 3LS2A 3RK4A 4DM7A 2XMDA 4WY8A 4EY4A 2JGLA 1QIDA 2R8BA 3WK6A 1LPSA 1XRNA 4B6GA 4AB1A 2Z8XA 4BATA 4QWMA 5C8ZA 5A7GA 1OILA 4BTVA 5A6VA 4PSDA 4GWLA 4J03A 3ED1A 1N5RA 1XRLA 1JJFA 5C7YA 3GROA 5HZGA 1DWQA 4B80A 2JBWA 1LNSA 3QPCA 1X2BA 3WZLA 1CUGA 3SC2A 5HKAA 4X97A 5EHXA 5D7BA 3OPMA 4M0EA 4FBMA 3H2KA 3C45A 4OYYA 2EDAA 1J07A 3V1KA 4UHCA 1XZEA 3DD5A 4MEAA 3OOSA 1W1IA 2XUPA 2H7YA 2D0DA 5FKJA 4J0DA 3S2ZA 3PUIA 5I8PA 3WKBA 4GLBA 5JATA 3H18A 4XX1A 5ALJA 1HQDA 2PBLA 1BN6A 1E89A 2JGMA 4A16A 5ALYA 1EXWA 4WDRA 1F8UA 2QMQA 2HADA 3WKDA 1WOMA 2JGIA 3FCXA 5AM1A 1H2YA 2PPLA 1LGYA 2WIDA 5AI0A 2UZ0A 1W75A 5K3DA 3ZI7A 3I28A 4FOLA 2ZJFA 1LPOA 3BF7A 3SK0A 2FX5A 1ZD4A 4H7IA 1UZAA 4IQ4A 1MPXA 2Z3ZA 2G63A 3OURA 1LLFA 1F0PA 3WK4A 3FVRA 4Y7DA 1UKCA 5LLSA 1PJAA 4N8EA 4OCZA 4W1RA 2PU5A 1UKAA 2QT9A 3DQZA 4KRXA 5ALMA 1VXRA 2BGRA 3B3QA 4Y2SA 4PW0A 3DOHA 4LKOA 2XMZA 4K6KA 4X90A 5A2GA 3KXPA 1CLEA 5K3FA 2B20A 4L0CA 3ESDA 4ZREA 2HA0A 1FFDA 4FKBA 3W9UA 2ZJ6A 2OGSA 2O2IA 3AZQA 2XLCA 1EVQA 1WB4A 2VTVA 4BAUA 1MJ5A 1BEEA 4L9AA 4GECA 5SYNA 3HXKA 4MEBA 5EIEA 4ARAA 3WL5A 1C4XA 1U2EA 5IVHA 4RGYA 3WL8A 1CUIA 5AOAA 4DMKA 4GI1A 4G8DA 1CUUA 3C6BA 3EF3A 1MO2A 4MQLA 2XMRA 3UMJA 4CCYB 2IX9A 4ROTA 1UK6A 4C4ZA 3I2KA 4IHAA 5DNVA 1DTEA 4BE9A 4U2EA 3G0BA 2H1IA 4L72A 4B81A 1GZ7A 5AI6A 1QZ3A 4UBKA 4PO3X 5AI4A 5KREA 3IB3A 4MYSA 2PUJA 3BXPA 2O7VA 2ROQA 3R3VA 3I2JA 1ODSA 2PSFA 1YR2A 1LPAB 4DNFA 3R0VA 5AKJA 2GYUA 5LYYA 3C6ZA 5DTIA 5K3BA 2Z5GA 4BRSA 2XQGA 5FXMA 4DTCA 5BOVA 3WWEA 2Z8ZA 4DNPA 2GZRA 3SX4A 3O4HA 1UOQA 5EHQA 4DSAA 4B82A 2CUTA 3I6ZA 3OTQA 3V48A 4F60A 1EB9A 1MAAA 1UOOA 4G8CA 3ZLVA 3BIXA 1IZ7A 4HRXA 1EDEA 4HAIA 3HSSA 4IO0A 1CEXA 4M0FA 1Q84A 3IIIA 2AJDA 3TGLA 2ONCA 3C43A 3KDAA 4QWWA 3WQHA 1WCYA 4WDQA 1K6EA 1FJ2A 3LLCA 3AIKA 4JH0A 4OU5A 4UBJA 1I6WA 4UHHA 5DWDA 4AZ3A 5F4ZA 5AH0A 5K3CA 1NU6A 5DLPA 4X85A 4O08A 2HA4A 5FPQA 2YASA 5AOBA 4Q1VA 2HA3A 3IBTA 3PF8A 4M0MA 4UHEA 5CRIA 4CI9A 1WB6A 4H7KA 3I6MA 4JNCA 2V9ZA 4DMFA 3ILSA 1J2EA 3M83A 5JANA 2YH2A 1HL7A 2C58A 1KU6A 4ETWA 2PSHA 1CUCA 4KE9A 3DKRA 1QFMA 1EB8A 1WPXA 1IVYA 4H7FA 5JD5A 1CUFA 5ALNA 4W1SA 2HIHA 1B6GA 2XQKA 4FLEA 5ALUA 1TAHA 4F5ZA 1LPNA 3U0VA 4LYEA 1VLQA 2PSJA 5CTAA 3DNMA 5FV4A 2RAUA 4KE6A 2AJBA 1MX1A 3A2NA 3D7RA 3EQ9A 4LXIA 1Q83A 3EQ7A 2WIKA 3UUEA 1JI3A 2QUAA 2RIPA 2XUIA 3C5VA 4L3WA 2XMSA 1CUYA 4X95A 4ZWNA 3HEAA 2YYSA 1JU4A 1FFCA 1GXSA 4FWBA 2OLEA 1N1MA 2HM7A 3H2JA 4E15A 1VJ5A 4RNCA 2VATA 4JEIA 3QYJA 3KOOA 3VJMA 1H2ZA 3D0KA 2WU3A 4N5IX 3STYA 4BZWA 4KAAA 2XUAA 2WFMA 2VT6A 1XZJA 4BC1A 1EDBA 3DCNA 3WK8A 4CG1A 1UT6A 1A8SA 1UXOA 1VA4A 3C6XA 4UHBA 1K8QA 2XB6A 1ACJA 2VJBA 2CEKA 3W05A 2HA2A 3TRDA 3U1TA 3D5EA 4P9NA 2WU4A 1OCEA 4KE7A 1DWOA 4KJXA 4FBLA 2WJ6A 5ALRA 2K2QB 4BVLA 3AFIA 1MNQA 4RPCA 5AJHA 2XMCA 2PSEA 4FHZA 4QNNA 4W1QA 3ZLUA 2WJ3A 2WTNA 4Y2YA 1XZHA 2XMQA 3FLAA 4J0IA 5BWCA 5C8VA 4QLAA 2WIFA 1BRTA 1MX5A 5JALA 2VSQA 3AUKA 4FNGA 4EHBA 3JWEA 3B5EA 5I7UA 4H35A 4Z49A 2I3DA 1MX9A 1L7QA 2QTBA 5AKGA 1ZJ4A 1VZ3A 3STTA 3O4GA 3I6YA 4MWTA 5ESRA 1AZWA 1G5FA 1YS2X 5HF9A 1P0PA 3HI4A 2ZYRA 1XQYA 4KRYA 1UOPA 3G9UA 4X3CA 1EI9A 3O4IA 1W4LA 4NZZA 5C81A 3T52A 4J0JA 2WUFA 1ZIYA 3TEJA 4A23A 4TPKA 3BIWA 4QLOA 4AMZA 5AKLA 4OPMA 3C87A 3RARA 4B83A 3LCRA 3D4LA 4QDZA 1DQZA 4J3JA 4C87A 1O6FA 4LHEA 1ZICA 3BJMA 4V2IA 1QE3A 4UFPA 5D3KA 5IVIA 3RM3A 4G5XA 3I2GA 1YA4A 4HZGA 1ZJ5A 2AXEA 3BWXA 3FNBA 1E8DA 1FFAA 1EX9A 5CT8A 3WIBA 1TKRA 4G8BA 4ITVA 3WMRA 4EY8A 2OGTA 3QZUA 5CT9A 3WI7A 3JW8A 3IUJA 3H04A 1LBTA 1ODTC 4Q05A 1UFOA 3STWA 1QIKA 5AOCA 5ALDA 5KWIA 4KR0A 2OXEA 4BP9A 3I2HA 3PFCA 3W2TA 3I1IA 2VJDA 1QTRA 4FLMA 4N5HX 3KSRA 2J3DA 1HDEA 3V1MA 3R3WA 4AN0A 1K5PA 1GKKA 1YAHA 2C4HA 3VDXA 2H9YA 4P93A 1EA5A 1TCCA 1X2EA 4H77A 2WILA 1QOZA 2QXUA 1CFJA 2ZYHA 3R3XA 1ZI9A 1GGVA 5A71A 3GBSA 1Y7HA 1YASA 4U2BA 3A2MA 5LZ4A 4OB7A 2CJPA 1T4MA 1MT3A 3PE6A 4YK7A 3KD2A 2XQFA 2OQIA 4HTAA 1R3DA 3QBJA 1NX9A 4C6HA 1WB5A 4JYPA 2VA9A 2WFLB 3NWOA 2BJHA 2ECFA 3O4JA 4Q34A 3D3NA 4X94A 4XJVA 2JEZA 2JGKA 5DYTA 3O9VA 4QDOA 1UKBA 1SC9A 4MJ3A 4QZVA 5ISMA 1XLWA 1QJ4A 1UK8A 1QIHA 4BVKA 2FJPA 3S8YA 2OCKA 5HKBA 2QM0A 4XWGA 5K5EA 3QMWA 5AI5A 1XQVA 3M3DA 3W06A 2OGZA 1W76A 1ZGBA 4CCYA 3QH4A 3WLAA 3HJUA 1L7RA 1CUZA 4NVRA 5BV7A 4PF1A 4Y2UA 1A88A 6YASA 2JIDA 2XI4A 4B0PA 3LIPA 4DIUA 2XQIA 5T4FA 5JAHA 1RWQA 4AN1A 1AX9A 1XRRA 5DNWA 5HK8A 3STVA 4KAFA 4DLNA 3EIOA 4X6XA 5FDFA 4UHFA 1YS1X 2H7CA 3M81A 4H7DA 2ES4A 2XUDA 2FUKA 4CFSA 2J4CA 4X91A 1QO9A 1VOTA 4XIIA 3F9CA 1CUDA 2GZSA 1TRHA 2EEPA 3FOBA 4C01A 2CMFA 2JGJA 1U65A 3W04A 5LIPA 2DR0A 3WYDA 1DX6A 3WWDA 3QPDA 1BCSA 2HU8A 1MNAA 1IUPA 5JZ9A 1JFRA 1HLGA 4BAZA 5AM2A 3K9BA 2QRUA 2DCMA 4NS4A 2C0PA 1DT3A 5FUMA 3WL6A 5DYWA 4OYLA 3HABA 1OXMA 4AZ0A 3OC0A 3G7NA 3PDCA 2AJLI 3M82A 2QJWA 5AI8A 3DLTA 1R50A 5HFAA 1ZD2P 2OQVA 3HRHA 1FFBA 3HYSA 3W9BA 4B7ZA 1IZ8A 1CV2A 5CT6A 5I9IA 4UHDA 4Y2RA 1QIJA 4U2DA 1BEZA 4Q3OA 1QIMA 3CCBA 2BUBA 5ALZA 4MYDA 3FYTA 2BCEA 1YAJA
chains in the Genus database with same CATH superfamily
1XMJA 4HMOA 4JP3A 4L4XA 3LUHA 1AE1A 5EJ2A 1V3TA 3DAGA 4IEFB 4UM9B 5HQ3A 3LCUA 3D02A 3ZNQA 5E1DA 1EZZA 5EYPA 4JI6B 4IQFA 4K6HA 3WLJA 3PQ4A 5BQFA 4OQXA 4BFLA 5EPOA 5LDGA 4CEHB 1JQ5A 2WQZA 1FTWA 1DTSA 3NTQA 1P18A 1AY0A 4RF5A 4CLHA 1W6RA 3ZWQA 3DM5A 4GXNA 1FP1D 1KMIY 5AWFC 2B4AA 2FRVA 4GQBA 2QG6A 4IFTA 2WUDA 4IXTA 4TTJA 4EX6A 1H66A 1YR9A 1QIGA 3R7WA 3OQ6A 2GD1O 2JFUA 4EUNA 3K70C 3I5UA 1CUSA 2IW3A 5E95A 1RQPA 5IS2A 1UQRA 3SJUA 1Y1TA 1XAGA 3LV8A 1PGQA 2OPHA 2BVNA 3EXIA 1XE3A 4DNXA 1K2VN 5BT8A 4E21A 1I2AA 2YN4A 4LXTA 2X8AA 3THWA 1FNNA 4OYHA 3V8NA 3OF2A 1BDHA 3IUEA 3KETA 2XBMA 2R6DA 3WGGA 1U2RA 3WLPA 5BN4B 3IRUA 5IEBA 1LDBA 5DHRA 5K8LA 1Q95A 4ZI3A 3ZE8A 1FUEA 2L18A 3SCZA 4RJTA 3AVVA 2LIPA 1Q22A 1R9NA 4GF5A 2DHDA 2H31A 4FHGA 3HU5A 3QG1A 1NJSA 1GKLA 1Q12A 1XU4A 1GL3A 4JBHA 4LHZA 3RFVA 1NQWA 1J8QA 1B43A 4CL8A 1BJTA 4F5EA 3EDYA 5KTPA 3TLMA 1UBGA 4AROA 2PYZA 4H6XA 2G07A 1FQWA 2Z98A 4FYJA 2DUJA 5IJ0B 4RSRA 2WHQA 1EQUA 5FTJA 4PC2A 2PRSA 4G5OA 1SWVA 1W19A 3O5AA 2I76A 4GQIA 1C9JA 3CLVA 4P54A 1KERA 1XJQA 3ST7A 3TW6A 1UEIA 2CYBA 2I22A 1NDQA 3IAS1 5E1BA 1P0QA 3ENWA 1U7HA 1E9EA 3DWIA 4A4DA 5U4XA 2BHNA 5HWSA 4TKMA 4YWHA 3C3PA 3ZWCA 121PA 2JIZA 3A4IA 3IIKA 3IMKA 4NQRA 4RADA 4QDXA 5CA0A 2EFGA 4MV0A 3UIEA 3A9UA 3R0JA 3G8CA 4O4IF 4DUGD 1RM3A 1QK5A 2XVXA 5ESDA 1N6NA 2XNJA 3H42B 4PAOA 3K5WA 4YRDA 3U3DA 1OY1A 2H7VA 2YV3A 3BL5A 4BJ5A 5JZBA 1KEPA 5ILQA 4HVAA 5LR6A 3I2FA 1TCUA 3CW2A 4LTNA 4BDTA 1PK8A 4XB6B 4HEHA 3DH0A 3UYLA 5JJIA 4K9RA 3CU5A 2CBXA 5B53A 3ZCPA 2R1TB 3A1DA 2OAGA 4U63A 1Y63A 2V9CA 4XVHA 3U48A 3NDBB 5TMEA 1U1CA 1DCFA 1KYXA 3TMKA 2VUSA 1GR1A 1DHTA 3QHAA 1ICEA 1BE0A 3M4ZA 4UQPA 1T9GS 2ESRA 4XJXA 2GYWA 3OMWA 1OI2A 2GVZC 3LNCA 4W7IA 5L51A 2QYHA 3DTTA 3F78A 3UB4A 5BRJA 2XMPA 5JS6A 5B3LA 2PXCA 4Q3CA 4INOA 3T95A 3L6CA 3DONA 4NCIA 2QL5A 2AZDA 5DOVA 1YB6A 2H16A 4L51A 5HPYB 4DV4B 3EZNA 4XARA 3R5FA 4TSFD 3KKLA 2AMVA 4B3BA 2CW5A 3IUNA 2CMHA 2H5JA 2HSEA 3NBFA 2VP6A 3RRBA 4XR9A 2A1UA 1NYTA 3T7JA 1F0NA 5I8WA 4CKCA 3E27A 3DXZA 4G86A 2OZVA 1K4YA 4OHWA 1ZU4A 4U2CA 3LXRA 1Z5NA 4S1TA 3SIPA 2DTEA 5K45A 1D5WA 1NASA 1P75A 3D2AA 1FXWA 3M1YA 2D2FA 3CVYA 3UW3A 1E0AA 2UZ1B 4HV4A 4NLLA 3IRVA 5CPBA 1AGPA 2IIVA 4YJ2F 1P2UA 2WG2A 5LZ7A 5EVJA 3CGWA 3PC8C 4Y2PA 1KNXA 1L5LA 4BQOA 5ICEA 2NU6B 4PX9A 4Z99A 4QOFA 5EESA 1TAUA 3A05A 1A72A 3U2QA 1A5SB 1DL5A 1SUEA 5DWVA 1D2AA 2JJ2D 3D8TA 3T5BA 1T1SA 1FXUA 3GR6A 2P77A 1NF8A 4G9EA 2HK8A 1PS8A 1IEXA 4URYR 1PFQA 1V37A 4LRQA 4EELA 3ZHRA 3BA1A 5G40A 1Z4NA 1Q7RA 3EZXA 3K9LA 1DJOA 1JSRA 2CVOA 2OA0A 1T5IA 4MV4A 2SKDA 1LW7A 4W5TA 2GXSA 3GELA 1F4VA 1MJGM 2B2CA 4I4CA 3OWHA 1EFRA 4JS0A 2JHPA 2BHTA 3CQ9A 4BB5A 2ZQYA 5A7FA 4PC6A 3WA7A 1YZLA 3ZHXA 3LYLA 2B82A 3AF4A 4OQZA 5HF8A 5DTEA 5D85A 4JMPA 2JFFA 3FMPB 3ZKWA 4AZ3B 4HQOA 4B40A 4DC9A 1GRQA 4MKXA 4TVSA 3D4BA 2QTHA 2HPAA 2Q9UA 3DAHA 3VHQA 1ISHA 3A6LA 5JYCA 2JVKA 3KQPA 3ZEIA 4ITRC 1GWNA 2OB1A 2SKCA 3N8DA 1GPUA 3FYUA 4TGLA 2LRHA 2NSHA 2VUTA 4ZU6X 1YR7A 1G0NA 3EXAA 4MVJI 5E7MA 2B30A 4E0BA 4Z2AA 4HYEA 3U7GA 2VWHA 4J0QA 2WSMA 4PZ9A 4QGAA 1B16A 1I13A 2DWPA 2WAAA 5KYVA 5IBQA 5BV2P 4E09A 5I7VA 1TJ4A 1YULA 4MV6A 4YCSA 2DEUA 4X65B 3GDHA 3U4GA 3HMKA 4CHGA 2QX6A 2F1KA 1FVFA 1NC1A 4Y6PA 3ZWOA 5H1YA 3QHPA 1AQIA 1KFCB 1MAUA 1IZZA 1WX1A 2PZAA 2VF4X 1Y5LA 4L8VA 1W2HA 3QVUA 3OO0A 4QBHA 4Y1EA 3H8JA 4WJZA 5DHQA 4BMVA 4BQPA 4DV0B 5GVRA 2D8MA 3ZPXA 3OJEA 1ST2A 1ETHA 5FI5A 1TXGA 3GVIA 3AEKB 2EX1A 4YQZA 3FVVA 4AJHA 1ZCJA 3DZFA 4ZDIA 4HWSA 2BFFA 1JFFA 2RGAA 3E5RA 4GUDA 1FBNA 1P4AA 1QC5B 1X7GA 2AJCA 4BO1A 3SYNA 4JI0B 3U4AA 2GFHA 1J0XO 2NVUA 1G64A 4TVKA 1UMBB 1T8SA 3MUOA 4HVTA 5B1HA 4Q1BA 3EGDB 3VC2A 1NMYA 5G4LA 4TM7A 2ZRCA 4BLWA 5IABA 1A0OA 1C81A 2ABWA 4IIBA 1Y8RB 2C9YA 2EF0A 4UUQA 1Z25A 5GONA 1NHWA 1VMIA 4JXXA 1L7AA 4UPEA 4L4RA 5REQA 3KWLA 1HNXB 1WTAA 3ZE6A 3LC2O 2B7LA 4LOIA 2PIDA 3R3ZA 3JYNA 2ZTHA 4RPKA 4ZTBA 1JXQA 3A1FA 3I6BA 5EE9A 4WCVA 3KHSA 2B1RA 4L28A 2HQOA 3ER6A 4IVNA 4AF8A 1Z6YA 4FE7A 4LSGA 3G82C 2Y4NA 2VNJA 5ALQA 1B2LA 2C9OA 2XZLA 1OZHA 3ZTTA 2VXBA 1QRTA 3OY2A 3NHRA 3FTEA 3K16A 2FSVA 2QHXA 1TPZA 1LDMA 2PL9A 3HDHA 5E0OA 1ZM3A 2QU7A 4IWYA 2ZJ7A 3C1OA 3GUCA 1SPXA 3L5OA 3TLZA 5ALVA 4BP3A 3GCXA 4O4HF 2YOGA 2GPWA 5JDCC 5IU6A 3C74A 3CN7A 1RKXA 2G9RA 4PANA 4X1IA 3TMAA 1K63A 1MAWA 1XP8A 3DZ8A 4J4HA 1ZJWA 4LNHA 2NM0A 3B38A 2ZJ8A 2D5LA 4J0CA 5AK0A 3GVPA 3LDUA 4AI6A 4RVDA 4F71A 1ORDA 1KE1A 1OLUB 4EQZA 3C3DA 5B12A 1AS3A 1FLVA 3RUAA 3WTBA 4LSWA 1D9XA 5FTLA 3N58A 3T4UA 1U7TA 4Q93A 1Q0QA 3TSZA 1S02A 2FFRA 2V98A 2HYDA 1SKYE 1DOAA 2VEDA 4FLFA 1YZFA 4X84A 3ILYA 1M1NA 2YJ6A 4RK0A 2V6FA 2AWNA 2CLSA 2NUPA 4IUYA 2IV7A 1EUZA 5B1IA 3WHPA 1N7GA 3PEFA 3K96A 3E7FA 4BEBA 1K7SN 3RYFB 3S2IA 5CFQA 1NQUA 5AJUA 1W36B 3B52X 3N0WA 4RLHA 4YUAA 4B5LA 3SXUB 1ZS9A 3DO5A 3NPAA 1N5DA 3IDAA 1BVHA 4QXMA 1YBHA 4ZO6A 4RTMA 3EVDA 3QKIA 5FEMA 4JX9A 1PR9A 1HRKA 5ERYA 1XTJA 3CJQA 1F0YA 4PRKA 2EZ4A 4K86A 3ZY6A 2O8EA 4QBIA 3RRZA 4HTFB 1YE3A 2HF8A 2RJNA 1PSWA 1SXJD 4MUIA 1WA5A 3EBLA 4ME6A 4ALIA 1J22A 1IQUA 1YRBA 2VDVE 4LGMA 4DEYA 2CK3A 4HGQA 4NECA 1EP9A 3ACBA 1EK0A 2AYZA 1M2JA 2ZTVA 1AF4A 3FPHA 3M3PA 3O95A 2HU2A 3AIIA 2QQ0A 1TF5A 4NFSA 3L1UA 4OI0A 3IEUA 3AERB 4LJ8A 5FPYA 4A26A 4D0GA 1JSLA 3C1TA 3LXUX 1U8FO 3DE6X 4U2GA 4Q02A 3DDZX 2BUCA 2Q2NA 4TQ9A 4WZ6A 1JT2A 1YSCA 4MV3A 1F6WA 4OUDB 4BMYA 3OMXA 1PJQA 1HETA 2YHBA 2YWJA 2FOXA 4D0SA 1YV9A 2XCRB 2TSYB 3C4JA 3SHOA 1JIKA 3HBLA 2I7VA 3KE8A 1X6VA 2YHIB 2PMKA 1NRWA 2X8JA 2Z4SA 3G68A 3OZBA 4JGIA 2HJGA 4BV3A 2NIPA 1TJYA 1QUFA 4B4VA 1LVGA 3NFYA 4I1IA 5DHUA 2Y68A 3GXOA 3KCNA 3G9TA 1C0IA 1GG2A 2YVKA 2HAEA 3FFWA 3Q5GA 5A02A 5KNBD 3II6X 2AG1A 5HS4A 1H0RA 3CLUD 3QWFA 5K0BA 5DT2A 2Z5VA 4EB8A 2RG7A 3I61A 1L5FA 4URFA 2VDWB 1U1EA 1NUQA 2Y0CA 1H42A 1VCOA 5TE9A 2O5EA 4IZOA 2RI6A 4G56A 4LNUA 4P5EA 4E12A 3DMDA 3HFJA 4A82A 3KZKA 5I3CA 2XD9A 4K88A 4CEJA 3ABSB 1VJDA 1RMYA 1XVUA 4V0NA 4H7HA 2CDAA 2PGIA 4KLZA 1JTEA 2J6IA 4EUSA 4ALNA 1E99A 3NT5A 1T9KA 3FUUA 2RBKA 3G8AA 1QHFA 1Q3HA 3FR8A 4RHYA 2BFEB 2IITA 3NHPA 3R5JA 1Y5IA 4P4SB 2Y1LA 3THXB 2BFWA 3A14A 3U4HA 4RH1A 4F2PA 3KAQA 3KR9A 3P2MA 1NXSA 3DKIA 4QOIA 3TQOA 5C4MA 1D0SA 5FPTA 3C8HA 5ALEA 1YTLA 4TKVB 4PHHA 5YASA 1NBOA 3UV7A 5I4KA 2IXFA 3NTVA 4WZAB 1IPHA 4BO4A 2Q0QA 1CQIA 1ZJZA 5ALXA 1J9GA 1V25A 5BMVF 1MDFA 4B8ZA 3IEKA 1VJTA 3BRWA 3G0IA 1V35A 2WPDA 3BD9A 4Z7QB 1XPOA 4HC4A 1L5RA 4CTJA 3T61A 2JEYA 3Q3EA 3W5VA 3IP6A 1T2NA 1M0TA 1V5EA 4CW7A 4LJ5A 1TF7A 2WJJA 3F8WA 3JQ6A 3C2QA 4QU0A 3KKZA 4OLFA 3L4EA 1IQRA 3UMYA 4IUCS 5F73A 5AI9A 4D6PA 5ALGA 2BYTA 1KNQA 2ODEA 3BQMB 4MS4B 4ZO8A 1N1EA 2RHWA 1XO1A 1GQQA 4YRJA 4I50F 4ZCIA 2X19A 4CKZA 3ORQA 3E4DA 1DIBA 2VAXA 3OLWA 4MQEA 3ROEA 1ML4A 4GOJA 2PFGA 3GWZA 1Z7EA 4EGFA 3U7FB 1W30A 3HXQA 1DE0A 1Z8DA 4TUYB 1M1ZA 2IPLA 3R0XA 1N0HA 3RRMA 5F77A 3TQRA 4NFHA 4CIAA 5BOSB 2DQKA 5JY6A 2FF5A 2C9CA 4Y2VA 4DV3B 1N92A 1BYUA 3N7UA 2JKYA 1KFJB 3NUZA 2GEJA 5TIIA 2Q9CA 4I4TA 4I08A 1ULZA 1HUQA 1VYVA 1Z0KA 5FULA 3P9YA 2WTMA 2AUTA 4P98A 3MB8A 5KYYA 4LWQA 1CCWA 2ZBFA 1IHUA 1G8HA 2G80A 4HPJB 1F6BA 1RE1A 1UJ6A 2EFCB 1L2TA 3BS4A 3DEAA 3M6XA 3N59A 4IRUB 4KPUA 4Q4AA 4BE4A 2H5IA 3IQWA 3AF6A 1B76A 2BCJQ 1V5WA 1GITA 4H7EA 1PG0A 1WABA 4GT1A 2IVZA 2ON6A 1XZAA 4MV9A 2AEJA 1VCMA 2OZLB 4PZAA 5SY4A 1FS4A 1OLOA 1PK9A 1XEFA 3G1TA 4MPTA 3A3KA 1G1AA 4OBBA 5AJYA 3RBXA 4AJKA 5CCXA 1U1DA 1SJ9A 3KWFA 1W2GA 4F56A 4C0HA 1HYHA 3CM0A 4F97A 3PE4A 4FX5A 3EZLA 1KH1A 2BMDA 4Y2GA 3F71A 1BVRA 2ZSIA 1YZNA 1UP7A 4Y0NA 1CNMA 1GCIA 1VSUA 2O05A 4BWYA 5JSKA 3ONWA 1E6UA 3GXBA 5KWJA 1H2WA 4UU1A 1BD4A 1O95A 4YJ3F 1VKRA 2IELA 3VH1A 4DV7B 1SY7A 1Z2CA 3OT4A 3AU9A 2I71A 4TV8F 3BE8A 4G3XA 4YUVA 3RHTA 4ARZB 2ZJYA 4KAJA 5ITVA 3MT0A 2X9NA 3U62A 3HP1A 5DBIA 3DCYA 4ICIA 4R6XA 4IG4A 2B8NA 3C70A 3SBOA 1V45E 1F2TB 1NX6A 4UM5A 4ZQHA 3S7TA 5IKXA 3OCCA 4I1VA 1EFDN 1GZ4A 1SCIA 3GBPA 1VJ0A 3OIGA 4KN8A 4LY0A 5HF5A 3K5PA 4D4MA 2D3WA 3RIHA 3SQNA 1B4DA 3BJIC 3IUQA 2FG5A 4UUBA 1FJXA 1H3NA 1KY3A 3GN1A 2XXAB 2J67A 1EAYA 4B31A 1EVIA 1JDUA 1HX7A 5CB4B 3KJQA 2GM5A 5LYJA 4KPYA 2L0XA 3PUXA 2LV8A 3RUFA 1A7UA 2VJMA 4LIPD 1KHHA 1ZMXA 2CB9A 2IC5A 2P6NA 2WF8A 4IH9A 2AZ4A 2OKGA 4F04A 1CQWA 1I01A 3EDRA 4Z4IA 4LBVA 5LOVB 4I8DA 4G63A 3T9DA 3GVHA 4XIFA 4XLTA 1Z6GA 2JGFA 2YQ5A 3V7FA 3ZXSA 5I5EA 3KQNA 3ER9A 1JAZA 3A3PA 3TLGB 4BFCA 2VF2A 4DMLA 1O6CA 1YA6A 1OQAA 1RQXA 3ECSA 3R75A 4Q7QA 1CQZA 3SFZA 1HDRA 2D7JA 2YRWA 3G3EA 3O94A 5FOWA 1C14A 1T43A 1CUBA 3IV9A 5AW8A 2PE5A 3O1IC 3SHTA 5AW4A 3TLYA 3ETGA 2RKWA 1M6HA 1VL1A 4ZGWA 1DG3A 3BJRA 5CW2A 1KEUA 5JCXA 3CH7A 4Z86A 4B9EA 1C0KA 3RHZA 4ZMBA 1Z4LA 4FFVA 1JEYA 2PGXA 4IDOA 4JJIA 1IK4A 3GJSA 3V6MA 4E5YA 2AW3A 1RD4A 2FVYA 3OE1A 2JL1A 4INJA 3ROXA 1MC5A 1JB1A 1MW8X 1HO3A 2E1PA 4CLEA 1RYFA 4LE0A 4WACA 1VE3A 1OSNA 4WLFA 1DB3A 1MUUA 2AGVA 3GEIA 2Y1DA 3OZRA 4EYQA 3OQNA 4OHRA 1W44A 3PHCA 3QGMA 1QNLA 2HBRA 3HNPA 3KOZA 5ECYA 2VK1A 3I8SA 1T2DA 3CEPB 4MQFB 5JO0A 4YJHA 4C43A 1R8XA 3W1VA 4NX2A 3N87A 1QANA 3H8WA 1Z4OA 3CF2A 4R84A 4X8LA 2VCYA 1U28C 1DWPA 2ZI7A 4J0EA 1YVUA 1RKVA 2R65A 1ZNXA 2ZSDA 3C6MA 3P32A 4EI8A 1KYTA 2WP0A 3TIFA 2J32A 1SZCA 2JAOA 1EDDA 1XTTA 2OV4A 2VHUA 1ENOA 1XZ8A 3KT8A 4HL6A 4ZEWA 4ACAA 3Q72A 4DCNA 1QDLB 1RWBA 5CVTA 2QDKA 3LHSA 5GPBA 2OXIA 3V46A 4BBZA 2OSVA 4D9IA 3L4JA 3HJAA 4LHVA 4YV2A 3CX6A 4IILA 3U80A 1MXFA 1RS0A 3EQ6A 1KKUA 4LX8A 3WL7A 2R7AA 1G7RA 1SOWA 3DZGA 5LMCA 4A10A 1WRBA 1S2NA 4M55A 2LBPA 4LCJA 3PNMA 5A03A 4Y6LA 1M5UA 2FPPB 2RMKA 3QMVA 4DBLC 3SIWA 5A4KA 1N7JA 4PRLA 1NRJB 2Q0XA 2VQ3A 1L5MA 3EUAA 3AEUA 3GFSA 3GF4A 3MRXA 1V1RB 4MYUA 4AY5A 2C4UA 3GP5A 1JH8A 2C5FA 3EZ2A 4JC8A 3THYB 4GNKA 3RAEC 2RH5A 3R6GA 3EASA 1FSZA 1DNPA 1NYRA 4O2AA 3VGJA 4HNAB 1YFJA 2QDXA 1PL8A 2ZR7A 4MR7A 2BM1A 2YR0A 3HZOA 3V3TA 2ID4A 3LD9A 1UDRA 2WTEA 4V1CI 4B4UA 5AVSA 4M8SA 3IODA 2Y1XA 3AW8A 1SIWA 5TQ2B 3ZXXA 1E2NA 4R1TA 3ZS8A 5AKHA 2KPOA 2C98A 3DEKA 2P90A 1T26A 2MIIA 2J1LA 4IWNA 5K8TA 2Z83A 3JQ7B 4KOAA 4TWBA 1LQUA 1D8AA 5AVJA 1E6EA 1IZ9A 4Z1OA 1XAHA 2H5LA 1EGHA 2E5WA 2EJUA 2CCGA 3BBLA 4FU0A 1GKUB 5EXPA 2O6HA 5HE9A 3JAWB 3OTIA 4ER5A 3L6DA 3DE0X 3PC7A 4M22A 3AL0C 4RVFA 4CIVA 3DLHA 5CH8A 1Y3AA 3JZIA 3SOZA 1EP1B 1HT0A 2WPNA 3GGOA 3NT4A 4G9GA 2P6OA 3OCXA 3ZCSA 2ODTX 2HYIC 1KYVA 2OFOA 3NOOA 4NBTA 3RIGA 1LXCA 4KGDA 3VZSA 5FO1A 3OUTA 1CY1A 3OP4A 1PRYA 4G1UC 1WW8A 4KWIA 4QEKA 1SEPA 2HPZA 3P52A 4FFMA 1DEKA 4EPTA 1TA0A 1LSSA 2UAGA 4X24A 1S8NA 2PQ0A 3EZGA 5KTRA 3KX2A 1DBIA 3K30A 1JWAB 4IUDS 3N0XA 3R7FA 4R8RA 5DDIP 5BRAA 2LCQA 1QTIA 4QYMA 1U7ZA 3QVMA 4WKCA 4DDMA 1OKKA 1JR6A 3K9CA 5IN4A 3GYBA 4M37A 2CCJA 4R2JA 1A7JA 1Y7IA 3A26A 2PFKA 1K3FA 2VJCA 3K9WA 2I67A 1XZLA 1V7PC 3SWWA 4G5FA 4XDYA 4EKDA 1CZRA 4MQ4A 1IK6A 3AXSA 4DLBA 1KMHB 4KQEA 3ZJ5A 1HT1E 2FJ0A 2JCGA 4RVSA 3VQTA 2XPCA 2QB5A 4CT0A 2O19A 5JJLA 3FFTA 2RHLA 3DOOA 4G4JA 2WM8A 2CHVA 3G8YA 4XRRA 4JVOA 1Z0FA 4P34A 3TRIA 3FWHA 2A5LA 3KWJA 4JELA 2H17A 4NHEA 4S35A 3CKLA 3G8DA 4S04A 4JKYA 4V0ME 3H9UA 2JAQA 2AOTA 2YQZA 4LMAA 3PQCA 3T5DA 2FXVA 1C0LA 4X93A 2PTHA 5DJ5A 3PIDA 1FMFA 3LU1A 4L5YA 3EA4A 4DB2A 3DNPA 3LBHA 4UM8B 4HQNA 3AHCA 3QF4A 1AJEA 1SUCA 2QGFA 4XQCA 1PSDA 4JODA 3KZ1E 1Q2XA 1R10A 2IKQA 2IUYA 2OV8A 3MNFA 3G2OA 1P31A 3N3AC 5T6MA 4BVBA 3F96A 3RYHA 4YAWA 1W0JA 2OUIA 2XGOA 4PYJA 2OGUA 4IOKA 1DFIA 2RFLA 3V3KA 5IW8A 1GPJA 1RYDA 3I3OA 4LQDA 4GMKA 2J09A 3F47A 4I1PA 4CNBA 3E3LA 1NN5A 3AUXA 4LYDA 1Z35A 3DMTA 1N5MA 5KDLA 2WMOB 3GN2A 1HPLA 3GARA 3JQ8A 1WXFA 2ISSD 1NTRA 3KKPA 3V4SA 3AVQA 3TKAA 3VOSA 3SN6A 4XWKA 4U9HS 2GTPA 2IH2A 4PGGA 3HWWA 3W4JA 1GFSA 5K2MA 1T3TA 5JVDF 1WKBA 2V7WA 4CKYA 2I4TA 3EXEA 4DZTA 2H18A 3B1XA 2HW8A 3ICVA 4REQA 1XZGA 2BKLA 5IVDA 2FN3A 5TNXA 1O08A 3T3MB 3A28A 3T1HB 1YBFA 2JIQA 1GCGA 1TIKA 3KRTA 1K1EA 3DVSX 1KO1A 1TU3A 2R1UA 2R8YA 3H1GA 1BXRA 3RQSA 1SOVA 3WV5A 4BZXA 4CG3A 5IUNC 1Q0SA 3IDFA 5BMOA 3OETA 3DVAB 4IIUA 4QGHA 2V9PA 2EV9A 2D0IA 3M6IA 2O3QA 1WM1A 3AR3A 3DOUA 4IZIA 3C98A 4II7A 2B4YA 3VC7A 1KF0A 1X42A 1VZ2A 3EXHA 3R77A 1VIMA 3TXAA 4G2TA 4DDKA 3IUYA 4JVNA 3MWYW 1P6UA 1XEXA 1DC5A 1O94C 3NM5A 3ZQ6A 2Q3BA 2J4FA 4MZDA 2PL5A 1RZUA 4Y1RA 1NIPA 1ULHA 2BDTA 1ISSA 1XTKA 2CV0A 4ASUA 4ZXFA 2FEKA 1OC2A 2GPYA 2L2QA 3H2IA 4K05A 1SKMA 2X0RA 1THMA 1GVHA 3FNFA 2ZSAA 3MJTA 2DXIA 2JVJA 4KACA 3SBXA 1MFZA 2O0KA 1TT5B 4FPXA 2GD6A 4LJLA 1AMNA 3FOZA 1P61B 5LQMA 3U16A 5EQTA 2XUJA 5CXXA 3LTNC 1UXJA 3PJDA 4EHNA 1B26A 5CA1A 1KVQA 3HTXA 1DXYA 4QECA 4Z0PA 1DMSA 1TK3A 2JIZD 1NXOA 1U7OA 4BIIA 5AM3A 4PS1A 3OOYA 1C2TA 3DV0B 3E03A 3K20A 4MP3A 4RMGA 3PI6A 2AQ8A 4NZMA 5B7NA 4Q0MA 5KWSA 5H8WA 3FZEA 3VR4H 4O1IA 2IEZA 4B4OA 4RE5A 4D8UA 4TLBA 2BW0A 2O7QA 4LSMA 4QM6A 2EG9A 2C3MA 1N6OA 4MB2A 4TZ0A 2AI2A 4Y2HA 3VVMA 3VZQA 2GSWA 3C7AA 1JSCA 2IXTA 1HRDA 3KSUA 5A5EA 2H7XA 4CR7A 1QTQA 4HEJA 3U3OA 2RH4A 3R3YA 3VR2A 1A8QA 2O06A 4RJJA 1G5IA 4BNYA 3KSAC 1A5TA 4I4NA 1DDGA 4LF8B 5EE0A 4R8LA 1JBEA 3IS3A 2V7TA 13PKA 3OQBA 2UUAB 1NLYA 3UUFA 4CM7A 4DQVA 1XMSA 3QJ5A 2YWEA 3OZIA 4D6XA 2I6UA 4QYIB 3VOTA 3M9LA 3ONDA 3AP2A 4EMSA 4G0YA 4CMCA 4QA9A 3NNNA 4RCZA 3K15A 2GDZA 4RE6A 1A8PA 5BQ5A 1P5ZB 5ADWA 4RW0A 4C6SA 1C3JA 3UAWA 3RNOA 1Q7EA 4RWEA 3PQFA 2SCUB 5DKFA 4YPVA 5J23A 1KRXA 3GJYA 3I62A 2ZUBA 4FTWA 1QH1B 4C4AA 1T36B 2QW0X 4F84A 2JF0A 4FONA 2G4CA 3WQQA 1BCRB 4QFCA 4Q3NA 1OIWA 1ZRHA 1YO6A 3ID6C 2WD7A 3IE0A 4YRRA 1NJ1A 4H1HA 4Q6WA 3SJZA 4I55A 2QM8A 5BSMA 4RKQA 1ZNQO 3TD9A 5ULLA 1SVLA 4V0LA 1I51A 1V95A 4CM8B 4K5QA 1EFKA 2YMQA 3VUEA 1XWIA 5G02A 4E7PA 4ZZ3A 1YRQA 4IDQA 3AKDA 5EIOA 3GLGB 2IZ7A 1CUHA 3DZBA 1L4MA 1XJ0A 4H16A 3UK6A 5JAOA 5JJ5A 4HDKA 2YXLA 3LIIA 4IFIA 1QORA 4RLFA 4KVGA 1EESA 2WFZA 5BWOA 5B64A 5JRJA 1HTTA 1I2DA 5DBEX 4A0GA 2ZUVA 4MPJA 3NGXA 4AD8A 4PZLA 4YQEA 3WLMA 4QODA 3EVAA 3RBAA 4EW2A 3EIEA 2REOA 4QT4A 1NC3A 1J9EA 1L4EA 1OWOA 1FUKA 1U3DA 2J3QA 2PRZA 3BGIA 3BXEA 3CE9A 3CVJA 4S0XA 3WHIA 4E30A 1M75A 5KYXB 1CF4A 3L8HA 5LB2A 3N7AA 3NEYA 3C6QA 2G82A 3K4PA 2G1JA 1TIBA 2I2CA 4L6IA 1SD2A 5ALOA 4MKGA 4Z3KA 2GEFA 1J7JA 1JR3A 2EOAA 3HBJA 4YCMA 5B6IA 1UKZA 3SI7A 3H4IA 3OTWA 1DG9A 2YXPX 3U9LA 1ZGZA 2BP7B 1E5TA 1NVBA 1EFRD 1U9JA 1XD2A 2BL4A 2VF8A 3OEYA 4LBZA 3NBZC 1MU0A 4QKQA 2SICE 1GAXA 3TS1A 3M8KA 4R2WA 4IQ0A 1Q74A 4ZIRA 4QXPA 2CL0X 3IP1A 1RAEA 2VP2A 1GSAA 3EGOA 5B4TA 4WFJA 3A9VA 4BDSA 4H3HB 4IDBA 1U8XX 2CNBA 2XKAA 1NMZA 2Q6KA 2XLBA 5C8YB 2AXQA 2V8BA 3K8YA 4ND7A 4C07A 2ZRJA 2WM2A 1QQ5A 4OK5A 1NGSA 1BZYA 5ES3A 3GMDA 5HZMA 1QB8A 4XWOA 4CF6A 3O2NA 5D7NA 1JDSA 1T34A 3AEXA 4S2UA 3AMVA 1BS1A 1DC3A 1OXKB 1MGOA 2NU9B 2HEIA 1REQB 1YVEI 3B2QA 3KIPA 1NJ5A 3L0IB 1VDZA 2WYUA 1T5HX 3EYAA 5JBNA 1BFUA 1IN4A 1Q3TA 3QLEA 4PLTA 3B36A 5A9SA 2PD6A 2OBXA 1EM8B 1UXIA 5TS3A 2RONA 5LZ2A 1I0IA 1COZA 1L5ZA 2DKFA 2FZ5A 3QOWA 1S1MA 4HXGA 4QPCA 4EL0A 3VFDA 4URHA 2B8WA 2O0JA 2EJBA 1WZUA 4MZXA 3AINA 3IEPA 1JDPA 3N53A 3VKVA 4ZJZA 3NYRA 4YJKA 4EY6A 4GICA 1QYRA 3N0TA 4QTYA 3CF4G 4JLOA 4R9SA 3S99A 5C51B 3MTBA 3DL7A 3ZQUA 1GL9B 4ZV9A 3GX1A 1WXEA 1FNSA 2GASA 3BSWA 1CZUA 4TLDA 3VV3A 5E9AA 1LJLA 1TGYA 1GGHA 4RIHA 1UEJA 2FWIA 3SDZA 5KU1A 1IOVA 2JA1A 3WLLA 4IXNA 1TEZA 4BCBA 3GMIA 3HVHA 3I0NA 1XD9A 1SQFA 2OE2A 2XDAA 1P0MA 1SBZA 1PHPA 3AWDA 1H1DA 1AK1A 5CEEA 2G04A 1FZTA 4PFJA 5MN5A 4RS3A 3LXMA 1SKUA 1KOGA 3N74A 4RZSA 5G3ZA 3GNTA 3ABOB 3GGCA 4ZGBA 2DBQA 2YV4A 3PR1A 1ONSA 4I6JA 3VX4A 1RQRA 4L57A 2G71A 2MYTA 3H2BA 4FYVA 5IH7A 1I24A 2IY8A 3RT9A 4WZBA 3EA0A 1DO8A 2O8NA 2IX3A 3F5MA 3K09A 4H9GA 5BWBA 4OMCA 1CRLA 2RKBA 3OIFA 4U6QA 5B7PA 4GAEA 1ZVJA 4FNMA 1DINA 1GZDA 5DXFA 5DB4A 3A7EA 3DMHA 2QF7A 1WWKA 1G4UR 2F9MA 3V4RA 3SZRA 1ENPA 1SCKA 3M6VA 2QNIA 3TQQA 3HP7A 4JVSB 3OP1A 1XRPA 3RPEA 3QFRA 1F48A 4FMDF 4FW8A 2JIOA 3MGKA 4JC4A 2C0QA 2PMCA 4O63O 5EIAA 1P8JA 5I9SA 3ZHSA 1L7BA 1GCUA 3KQOA 1NUUA 1ATZA 2OHVA 3F8SA 3LPLA 1SXHA 1X13A 2O2CA 1N9GB 3C7TA 4FFWA 3OX1A 5KAMA 2DP4E 2PNFA 3G1UA 4F8YA 5IMBA 3FHTA 4ESVA 4HDRA 2VUUA 2E85A 5BNZA 3IKLA 1A95A 2Q2OA 4ILKA 1RYZA 3LGSA 5I5GA 3VU9A 2IGBA 3V00A 5JAQA 1X7XA 1JE1A 1X7YA 1QIDA 5BYBA 1I3CA 1EGVB 2R8BA 3C3YA 2BRUA 3HO8A 1G5HA 4ZEVA 1XCGB 4AB1A 5M34A 2A84A 1MORA 1R4NA 2NT4A 1U1IA 4NJMA 1XLTC 4O5OA 5DHTA 3DUFB 5FLEX 3UFXB 5JWOA 1CWUA 4QWMA 2XECA 2IHKA 5KJCA 4QG3A 5KSOA 1KH2A 2EYQA 3TPFA 3AFMA 2JJ8A 3KKMA 4UMVA 1UDWA 5A7GA 1L1QA 5C32A 2CK3D 4BTVA 5A3RA 4RA6A 1GQOA 4PSDA 2HZBA 2B78A 4FT2A 3MN1A 4TLMB 2WSIA 4PPYA 3LQ2A 4E5PA 4N9QA 1SZDA 3QXCA 3ZOKA 3PUKA 5E6SB 3Q8LA 4RTRA 4QJ5A 1NAHA 4ON9A 1E94E 1GFWA 1N6LA 3K8QA 3LT2A 1L4KA 1FYEA 2A9RA 2BD0A 3JD2A 4X0EA 2PBFA 5C53B 3NONA 1LNSA 5I48A 4POAA 1NVKA 2PWZA 3CJRA 4BNVA 1E9RA 4AUEA 3QPCA 2GM3A 4JCCA 5L8VA 4RBNA 1X2BA 3PTZA 3THOA 1Y6JA 1JEOA 1F3OA 3SC2A 5HKAA 1X86B 4URWR 1K3TA 5A1JA 2FEXA 1Y7PA 1SUSA 3SZGA 5F3WB 3KG2A 3M1LA 1RMTA 3EIHA 1A9TA 3CX8A 3D8UA 3BD6A 1NDHA 1V47A 1NV8A 2H11A 3AKCA 1J33A 1R0XA 2XCOA 4M0EA 5IM4F 1U8YA 1I32A 5KHLB 4MMYB 5B6JA 1C3LA 1X74A 2ZI6A 4S1PA 4B3IA 3KQHA 2JLYA 3DJFA 5DULA 4JI4B 4ZO4A 1DOZA 3C3BA 5H5JA 4DARA 3H84A 2R0QC 3N2KA 2BONA 2EDAA 2E4XA 2IL1A 2VHYA 4EG5A 1DARA 3P0FA 2J6BA 1CVIA 3CH4B 4B1FA 2BMVA 2ATXA 2IEDA 1QH9A 1IWBB 1XZEA 2Q5QA 1V48A 3CEJA 3DD5A 3FCSB 4MEAA 3S70A 3VHXB 4J0FA 1YZHA 2NYAA 3HDTA 4PYKA 1J5EB 3C48A 1R0BA 2EVWX 2R6HA 3FTPA 1Y4AE 2D0DA 1P1KA 2NO7A 4EFLA 2O8FA 1NBME 3X1ZA 5CIQA 4F3CA 1G60A 4Z0HO 4BQRA 1VIAA 1VB5A 4IDPA 2Z6AA 1XK6A 1VECA 1ZCBA 3DMRA 3PUIA 4OA5A 3ICPA 2IPXA 4LRTB 3I5AA 4FHEA 5CDFA 4C14A 4U7DA 3ZW9A 4QU5A 1Q1AA 4NYMQ 5BW4A 2HLDD 3DSRA 1APBA 2ISCA 3WFIA 1I2CA 5KMGB 5A5VA 1NVVR 5F7OA 4CCSA 1IOWA 1ZW6A 1YZVA 4P5PA 2J9XB 2NX2A 2NWQA 2VZ9A 4HH3C 4G5QA 3SQWA 5JAMA 4AT1A 4QU9A 5LXTF 2AXNA 4M8KA 1Z82A 4EW1A 5GJWC 2OYSA 1Q1EA 2DMRA 5BW8A 1QH8B 2GESA 1KJIA 1UFQA 2QMQA 1U9ZA 4C5AA 1RI1A 3BRWD 2WPDD 1WOMA 2VWPA 5FNVB 2JGIA 3FCXA 3VYUB 5IYZB 5KJ1A 4NDAA 1RLOA 2H52A 4O4LF 4PC3A 2IXAA 4OOFA 4D5GA 1Q16A 1WTCA 3P2KA 2UZ0A 4ZVNA 2HEGA 5ELLA 1KEEA 1KJYA 1Z29A 2ZPUA 3E6AA 3K0EA 4UMDA 1JTVA 2OXFA 3SK0A 3C4VA 1L5SA 3JZDA 4BNZA 4YMLA 1JX6A 1N8TA 1HQKA 1LA2A 5K0CA 1TIPA 5IC5A 3T5MA 4FXPA 1DKLA 4HUJA 2PK3A 3FN4A 3VBEA 3SHQA 1XL1A 4AZVA 3Q6MA 3IOMA 1E5DA 2VQSA 3WGZA 4FM9A 4JBIA 5AJTA 3SS7X 3KSZO 2Z3ZA 1VYTA 2JJ1A 4A3SA 3H9CA 3O84A 1S9DA 3HZHA 3PUVA 5ENZA 2G63A 4PR0A 3GPCA 4AP6A 3OURA 5ED0A 4UCXA 2C8VA 3AT1A 3NM6B 1UDBA 3FVRA 3WK4A 2R6ZA 3FETA 5IT4A 3TRKA 4IMJB 1T10A 3MTQA 2VJOA 2J9FB 2O7NA 3DDHA 3TTWA 1DBSA 1TM4E 2OCBA 4RUKA 4N8EA 1VP3A 1NP3A 4OCZA 3UTDA 2PU5A 3NC1C 1U8UA 4U9UA 5A0VA 4P84A 1FJGB 4PSKA 1E5LA 1QK3A 2J41A 2O07A 3REQB 5AW2A 3EPKA 4JK3A 3PHJA 1RHJA 2B94A 1VXRA 2PLNA 3EEIA 4KNYA 4OF4A 1TQ6A 1MABB 2C20A 1UKYA 2ZCVA 2QWXA 3CLTD 5L7WA 3TG2A 3VR6H 4LKOA 4AURA 2QAGB 5LWQA 1N3IA 1ZEMA 2B5OA 1EXNA 2HB6A 2J6HA 1QHGA 3U7RA 4AUKA 1DLJA 4TS1A 3RDPA 4IMIB 1ZBQA 2W70A 3LRTA 4WKBA 4XGQA 4CLDA 3H87A 2R4QA 2VT2A 3G6WA 1ZAYA 1Z9BA 3PDIB 3F73A 1X3SA 3LP6A 3P94A 1YJBA 3C4QA 4BMZA 5DTQA 2Q3MA 2JLVA 3EQ2A 1SQSA 3NQ41 4ONEA 5CM2Z 2YINC 1D03A 3MCTA 4B47A 1JR2A 5K0EA 3UJ7A 2XB2A 2XKKA 2PT7A 4J4BA 1P17A 4FKBA 3OA0A 2XEDA 2BC9A 1ISMA 2QL6A 4YAEA 2PR7A 4DXHA 1KP9A 4BWFB 4DN6A 2O2IA 1SCUB 1U9IC 1VRCA 2JLXA 1U11A 2XLCA 2RCYA 2I2XB 1WHTB 1JJVA 5JMTA 1GSOA 2IYFA 2YZMA 1MJ5A 1ONNA 4HGPA 1SUBA 3COWA 3K0BA 1BEEA 4RZ2A 1IM8A 1YOVA 1KQNA 1JLRA 2FZLA 3PRYA 3QWBA 1NQAO 5EN4A 2ZKIA 3WQSB 4CF5A 2Q6IA 2XVMA 3D6UA 4U3JA 5SYNA 1P0CA 1LV7A 2OO5A 3K4QA 3KKEA 4MGHA 3ZU5A 4BKUA 5EIEA 3WL5A 4HWOA 1OT3A 3KBOA 3EVZA 1S01A 1DHRA 1KVTA 4EHIA 5CYOA 2AJTA 1QR2A 1CUIA 5AOAA 2AX3A 4IFEA 2KW5A 5LDDC 2QXYA 1XMVA 1MB0A 3CMMA 4PGHA 4F2WA 3OT1A 1CUUA 4MW4A 3C6BA 4YAFA 1MO2A 3F4LA 3B3JA 2P69A 2VLBA 3FLMA 4U5XA 3UMJA 3EA5A 3NM4A 2PUAA 3QXGA 3TLCA 3PEYA 1EJBA 1U0BB 3AYZB 1KYWA 2I6FA 2AQHA 3OAAA 5HIIA 3V2IA 2GTIA 4GVXA 3TBHA 4PCAA 1Y48E 1TRKA 1IN5A 1VIDA 2H2FA 4P22A 3KD3A 4O4IB 1HDOA 1N1GA 1O87A 2YHUA 3FD8A 1T4CA 3IIJA 4Q9HA 3ETEA 3EBOA 1RWOA 1YXMA 4MUXA 4EJSB 3L01A 1F8FA 1YJQA 2IPMA 3W8RA 3FAZA 1KSFX 2CXUA 3LRPA 1J8DA 3TNFA 4UOQA 3LY5A 5DM2A 4RJLA 3UGJA 4WESB 5CFNA 1FX1A 2J30A 2V6IA 4UBKA 4WERA 5CVJA 4UTVA 1W5BA 3W1EA 1VMKA 3LWZA 2BEWB 4ETMA 2QE7A 2PZJA 4GP7A 4HLUA 1PLKA 3IB3A 2QVLA 1N25A 5DHAA 4KWHA 3WVNA 1Z36A 1EHCA 1JPVA 2FP3A 1KETA 3HYLA 2V74B 3PT5A 3Q1LA 1T9CA 4HDOB 2O7VA 2ROQA 2GQ0A 2WYOA 3HP4A 2IHNA 3I2JA 3CV3A 3TDKA 4GVLA 4YCNA 1RQLA 3GJQA 3D31A 1JR4A 1AU9A 3CRW1 1O0CA 4CL2A 1RNLA 3LUGA 3BK1A 5AKJA 3BQNB 5LYYA 1VFNA 3A4MA 2YMLA 5NULA 2V54A 3ND8A 1PNRA 1FRNA 1PT8A 2CGEA 1GNVA 2W0SA 5KYNA 2EL7A 3AR7A 1EXVA 2FN4A 4A73A 4R0VA 3GJ6A 4LFAB 2DX7A 3EOBI 4XYMA 2FK7A 2G1KA 3FDFA 5IAGA 1SRQA 1PD1A 1J09A 1N2CB 2HJSA 4P4TA 5BRNA 2W4MA 4R4JA 2EXXA 2NPOA 1R6TA 1PN3A 1M2OA 3O47A 4FSDA 1R6XA 3F0TA 2FJUA 4X1YA 1A9XB 4Y67A 2GXUA 3ZU3A 5KQRA 4DSAA 1ZYUA 1F5SA 3KXIA 1EG7A 3L05A 4G0NA 3O92A 1PS9A 4PG8A 1QNFA 4FEGA 4YJ2B 1XCMA 4FX2A 4M89A 1G21B 3A37A 4PXYA 3SYTA 4HRXA 4JGGA 3HKBA 3HSSA 4GX1A 3S40A 3RH0A 1DKMA 1Z33A 2FPWA 2H0RA 1QAOA 3FPAA 3HS3A 5T8KA 5C7LO 3T06B 1JIQA 1Y1PA 1E7WA 4HLCA 3IIIA 1FFHA 1U3CA 1VPEA 3UBMA 4MDYA 4C4RA 4CDGA 1M0EA 5L4LA 221PA 2EP7A 5KJFA 4E32A 1ZUNA 3LC7O 1M2WA 2A58A 4MVJM 2ONJA 3T7KA 4NULA 2GEDA 3KDAA 4QM7A 5CTJA 4QPJC 2ODBA 3H83A 1HLPA 3LKBA 1NKVA 1V8BA 5TRTA 4C05A 2ZM6B 3LLCA 4UHKA 2OBFA 3HB5X 1YR3A 2X5KO 5L3SA 1HLFA 4J16C 1N36B 1FFXB 3SF8B 5DTRA 1G5PA 4JH0A 1I6WA 1FVXA 2FFQA 4TV9F 1JEAA 2GN6A 4NOLA 3AETA 4R7GA 3B53X 4JLBA 3I8OA 3K6JA 4JXKA 1VSVA 3QEMA 4RWZA 2PRJA 3JD3A 4FCTA 1YCFA 4JEHA 5AUPB 1IQ0A 4CDNA 4HY3A 1J9ZA 2ENWA 2R6GA 1SVIA 2RGNA 4BV9A 5DTMA 1NONA 2WKRA 4WV3A 5JZVA 3F1KA 1HA3A 4D4JA 4TMYA 2QEQA 1BE1A 2QLNA 3KEOA 2HA4A 1DEOA 2A14A 2FCRA 3SSOA 3SZMA 4W5NA 1UFRA 3E48A 3LCJA 1GPAA 5FPQA 3RU3A 4ER0A 1BX0A 1C41A 4KO8A 1U63A 1QGAA 3IBTA 3K4HA 1ZHFA 3G1WA 1M73E 5IFLA 2ZT7A 4RMNA 4M6WB 4M0MA 3WLEA 5T57A 4HNTA 1SBCA 4RCYA 5KC9A 2HDNB 1DRKA 4UNRA 4IJWA 1JQEA 3I6MA 4P81A 5AW7A 1RPTA 1IN8A 3ILSA 1OKKD 3M83A 3OU7A 4XJSA 3UF0A 1Y9ZA 3REFA 3IHTA 2YH2A 1HL7A 3OBBA 3R9KA 3GEBA 1BYIA 2PSHA 4OQ4A 3QUAA 5KKCA 3ZVKA 1L4GA 4EFNA 1JEQA 4PR3A 3H7AA 1R00A 4OQFA 4LYYA 1OFHA 1TMOA 3LX8A 3G85A 1U3WA 4HGOA 1EB8A 1QBKC 1KPHA 2IYLD 3VPAA 3U19A 1INLA 3SMVA 4NQZA 4OL9A 2PMWB 2Q45A 1VPLA 2CMGA 1HDIA 2PVPA 2G4VA 3UWSA 3ONNA 4GPAA 3HBAA 1M54A 5EYPB 4LFBB 1B6GA 2XQKA 3F6YA 3I0ZA 1GZ5A 3ETCA 5ALUA 4WOBA 1BHSA 4ZAXA 3OCYA 4GG1A 2GN1A 1R0ZA 3IJEB 3VNRA 3AVXA 4F5ZA 4K6FA 4G4SO 1PYGA 2I29A 4D8VA 3HQ4O 4GEKA 4G5GA 3NBKA 4MRVA 1GYQA 3QVXA 1I4EB 1RC0A 2JHAA 3HVJA 3OIUA 3R7WB 3KZCA 4C4TA 2B8JA 4PLFA 3VPSA 4O4JB 4O4HB 3VR0A 4KE6A 3HCBA 3AKYA 3WTCA 1MX1A 5JLAA 1W0JD 2OL4A 1V7ZA 1JKJB 1VBNA 1JA9A 1TJNA 1ULTA 2R48A 3D7RA 3EXIB 1Q83A 3EQ7A 2PD3A 3GMSA 3IXLA 5L3RA 1V41E 2PNJA 2IIPA 3OQIA 4A2PA 2G88A 2PX8A 4FCCA 3B5IA 3F6RA 1KBZA 2ID9A 2PMBA 2QRLA 2XMSA 1FZQA 3KT6A 3A6HA 1CUYA 1G9TA 1XF1A 4Z9BA 4JDPA 1X9HA 1YUNA 5IAOA 4LRWA 1JU4A 5CNIA 1T5DX 2CLEB 1P9OA 1TO1E 1D6NA 2OLEA 1J99A 1N1MA 2V4MA 4A2WA 2JLUA 2IDZA 4IJUA 3H2JA 4N49A 2JIPA 2PANA 3OFNA 4JP1A 4IXDA 4WZZA 5AVQA 4E15A 3RIEA 1IBCA 2R47A 4WKPA 3UJ6A 4DGSA 3UAOA 1VJ5A 1G38A 1PZFA 4NCBA 3HA7A 1JQJC 1BS2A 1P45A 3FXAA 2WHXA 2ZULA 4L85A 2CYAA 3BGWA 3HCPA 4JCOA 5EKDA 1LJUA 1UR5A 5CA0B 4DRXA 4A7PA 2X7XA 3O21A 4JB3A 4DTIA 3RBZA 4H1VA 5CHYA 4OSPA 3DP9A 3VYWA 3D0KA 2E6UX 4N5IX 4PRZA 5B2ZA 3STYA 3WIVA 1IM2A 1GV1A 1UJMA 2SNIE 2FEOA 5SICE 5KYUB 1JLLA 3EEYA 2F43B 2XRZA 4UAJA 4FR2A 1FDTA 3G7SA 3PHLA 2FPIA 4NZYA 3QENA 4QAQA 1K3UB 1P72A 1QWOA 2QN7A 5G0UA 1Q44A 1H6AA 3DCNA 3SJBA 1EXMA 3WK8A 4NCAA 1YRHA 4G5SA 3ZHCA 1LRLA 1VA4A 2J5XA 4BVFA 2EFDB 2D4HA 3D1LA 4ASUD 3ZGLA 5BQXA 1NAIA 3WBJA 1OH8A 3DB1A 1OH6A 5C9ZA 5BNTA 1K0UA 1UJCA 2FMUA 2X42A 4FFPA 2Y0PA 4KIGA 4F1JA 2JAPA 1SU8A 3MRTA 3WGOA 4N0PA 4LXQA 3KFLA 1MFPA 5JDIC 5F51A 1EGMB 3E3OA 5FEUA 1OTHA 4RHXA 2XY4A 1ZHOA 4YDQA 4ARIA 4O2BA 5GV7A 4DL9A 1W4CA 3TQHA 5A6SA 2VFAA 4XR4A 2ATCA 1FRZA 4V0SA 3U31A 2C7GA 4ZAZA 4D6YA 3IP7A 5U1PA 2OWDA 5AXCA 4MINA 3NDRA 5DX8A 3RK1A 3UT5A 1CBUA 3QVGA 1JEEA 1OPXA 3IO5A 3URKA 1KK3A 4KUGA 2A1UB 2QPAA 4TXNA 4B79A 2LR0A 1L3BA 5C8DA 4BEJA 5F23A 4IDEA 3CH6A 5FV7A 4BVLA 4ZICA 3C5EA 4LI3X 4NL4H 3O0TA 5AJWA 1N7HA 1JPJA 4I0WB 4TTVA 1PQ4A 4FR0A 2PH3A 3BB4A 2RCNA 3JZAA 4FHZA 3UEOA 3L7BA 2Y0DA 4AECA 1K8YB 4CKBA 2PZFA 1ZR2A 4QNNA 1Z6XA 4W1QA 3LBIA 2WJYA 4W7HA 1Y8CA 2ONYA 4ZQEA 1XZHA 3FWPA 2G7MC 5H02A 3VPXA 3NH6A 5BWCA 4Q4JA 2D62A 1I80A 2I6TA 5JNTA 3D3QA 2A0XA 4QLAA 2UU9B 1S5PA 3V9PA 1D2GA 2ANBA 2RGYA 1UM9B 4YV0A 1PX2A 2VPWA 1GSIA 1W4RA 4DA9A 4EG8A 3V8QA 1IY9A 1BRTA 2XNDA 1MX5A 2I4RA 3RF7A 5JALA 1MRSA 3TOSA 3H75A 3UUGA 4IIYA 2X9QA 1NQOA 4D41A 1QQAA 4E5DA 3ZY2A 4M9RA 4R3WA 5F9HA 4EABA 1YR8A 4TZTA 3M1AA 2I3DA 4Z7NB 5J2UA 4Z9XA 3PZBA 3BH7A 5FQOA 3ITNA 1ZJ4A 3H3JA 1XTUA 5DP1A 3OLYA 5EJIA 4LOHA 5KS2A 2CUZA 3O4GA 1NMSA 2ZB2A 4ENQA 5L3VA 4J6FA 1A9RA 1I4DD 2WUWE 4QTUB 5EZYA 4DSOA 3ETLA 4M9QA 3ND7A 3CC8A 1B3BA 1JNYA 3IOBA 1ARZA 3W1WA 5JSHA 2ZYRA 5KJEA 1G6KA 4XFDA 1VL8A 4ZN6A 1UBHS 3VU1A 4KRYA 4ZQFA 4YRZA 4L27A 3G9UA 2ODWA 4X3CA 3RJ9A 2B98A 3MJCA 2OXRA 1XGKA 3O4IA 3NTRA 5C81A 2P5SA 4LA4A 4U4AA 1Z38A 4DADA 2ZIXA 1ZN9A 3BTVA 3FTCA 4XW2A 1ZO8A 1ZC4A 1FS6A 2NAFA 2HRZA 1PD0A 2AZTA 1V8PA 4JL6A 3R9XB 1Y81A 3OSUA 2O2ZA 3OPVA 1QGUA 4KYTA 1LQTA 2H06A 2B1IA 3BK7A 1OW3B 2O3JA 3SBDA 1NURA 3LYHA 4IY1A 3N1UA 5JMWA 4ZTZB 3AHHA 1M83A 3DXYA 1CDZA 5C18A 1RXYA 3R5HA 4JJ8A 1WSBA 2XGJA 3CVOA 2FP4B 4HPXB 1T2FA 3N8KA 3PEEA 4WOKA 1H4QA 3MOSA 1KP3A 4PS0A 2JGAA 4J3JA 4D9EA 3UYKA 2ZZMA 4KDRA 4PG7A 1ZICA 4W5OA 4FINA 2V7BA 3GFBA 1XG5A 5HM8A 1S2GA 4Z3OA 2ZBGA 3ZH9B 2G1UA 1SHZA 2AOUB 2RHRA 1NE2A 4N01A 3V7YA 3OD5A 3RM3A 4ZKDA 2A94A 3I2GA 4JENA 4HZGA 3AW9A 3E8XA 3N2GA 4P4NA 3I53A 3NP7A 2AXEA 1RXEA 5FUXA 1EEHA 1I6MA 4RU1A 5I9LA 1YZQA 1NULA 3L4BC 2BV3A 4LXXA 4QRDA 3FNBA 3I3SR 3NWBA 2B3TA 4MARA 3RC8A 4MLPA 4C3VA 3HYTA 3GRUA 2ZW9A 3CR8A 3PPYA 2NZXA 2DR3A 4YJ3B 2RHCA 4PSAA 4PAMA 4TTPA 1U4OA 5K1ZA 2IY7A 1TE2A 3FFXA 5ESXA 4MV7A 4US0R 1TKRA 2PGAA 4GFDA 4G24A 4GO1A 3U44A 5L53A 2YWHA 5FOSA 2CXQA 3EUEA 4UE3S 3C7DB 4DKJA 3PC8A 5EMHA 3T8YA 3GLGE 4LY3A 4TYWA 2P9TA 1U2SA 5HGJA 3GZNA 5CT9A 3WLIA 2DPGA 3JW8A 3FBTA 1A97A 1ODTC 2PKRA 2PKWA 2JFZA 3RU9A 1F14A 3TH5A 4YT2A 2WOOA 3TL6A 1ISJA 4ZI7A 1WDKA 2I1VB 2BJWA 2VYNA 2G70A 4MWZA 2H0QA 5GGYA 1OX4B 1GNPA 1KI7A 2P5YA 2YJTD 3E2MA 3F5FA 3I1IA 1UIRA 3PFCA 5AVVA 4N5DA 2I55A 3QLUC 4BU0A 2G6TA 1M1NB 1UMCB 1TTQB 1ZN7A 2OHOA 4LECA 4LZWA 2HCTA 4ALLA 2O54A 2NUPB 4XQGA 2EQBA 1T35A 3NRBA 4NENA 1MIOA 5EKSA 5KQLA 5FYDA 3VZRA 2R1VA 1X1EA 1JHZA 3PIIA 1K5PA 1LU9A 1NUTA 1GKKA 2PUCA 2O8DB 3EXG2 1E3MA 4K1XA 4PIVA 1BGVA 5KEIA 1QQ7A 2HXYA 4P93A 1FE8A 4KREA 2JDIA 1Q0HA 2OV6A 3KUUA 4MUFA 2G06A 3I9JA 2ZU6A 5TQVA 5K20A 3B20A 2IYUA 5DSXA 5EZ6B 5EWMA 5TGDA 2O8BB 2ZYHA 1QRRA 1CFJA 2QXUA 2XRFA 1HEIA 5HE8A 4BQQA 3G6KA 3CX3A 4ZEXA 3CT6A 3AOEC 1A04A 1X1CA 3O4FA 4KFTA 1Y7HA 4M98A 3ZCQA 3QVWA 3DEJA 5K8VA 3MSCA 4U2BA 3A2MA 2QVXX 3Q0IA 4HK4A 3L6OO 4WXYB 2CJPA 5EMKA 2O8EB 1HSOA 4LI0A 4IX9A 3O1HB 1E2GA 1MT3A 1GG9A 1DSSG 1R5NA 2C5HA 2IEBA 2XB4A 3PQ5A 4YK7A 1MW9X 4FDLA 3TUJC 4DJDC 1GDTA 5JPCA 4JROA 3MT7A 5TF4A 1JLHA 2ZYVX 1QOQB 2I2DA 1KDVA 2WAMA 4LYFA 1CZHA 3G59A 4G36A 2JATA 3MELA 2Q5LA 4FC6A 2Y9MB 5J5AA 4ENSA 3G5TA 4TWJA 4EK9A 3CISA 4EYEA 1WB5A 5BV1A 3WFZA 1IHOA 4EF5A 2XR1A 3NEJA 3HL4A 2BJHA 2L69A 2ECFA 4Q34A 3H9EO 1E9SA 3WLTA 2WUVA 3M89A 3NC0C 3K3PA 1LX7A 4L4SA 1P7PA 5DLEA 4RTPA 2XNKA 4QDOA 3SZUA 2X8JB 1IHPA 1FLNA 1NRIA 1RACA 1J5PA 2GRUA 4MJ3A 3WQRA 4XUCA 3PNYA 5IM5A 4MJ7A 1QJ4A 3L92A 1OH5A 1QIHA 1CHDA 1YVPA 3NOVA 2ASEA 2KB0A 4BVKA 1GFZA 3NVAA 2DHQA 1H3FA 4WTOA 1DKRA 1O9GA 3WRYC 4LOJA 1Q50A 4TMTA 1LC3A 3A6PC 3QKSB 5EZQA 3HEBA 4A36A 5J4HA 1YK1A 5KWVA 1RYNA 1X87A 1Y6QA 1HQCA 1X8LA 3F46A 4LNUB 1UXGA 4LDZA 1R5JA 3QMWA 3RW9A 1L5GB 3COVA 4CEJB 3KR0A 1L1EA 1PQWA 4OHVA 4UVIA 4E70A 2LTAA 3B48A 5TPZA 2CHQA 1OREA 1WQ4A 2V7QA 4R1MA 4YJGA 4E2FA 5JDCA 3P97A 3QXJA 3OJOA 3Q7QA 1JBQA 1JP7A 2GAOA 2ONKA 3H9GA 3Q1KA 4CCYA 3ELYA 2I4MA 2WZQA 4RZ3A 5SYAA 2D1RA 3LLVA 4ZAGA 3M5DA 2OXTA 4GLJA 5HXAA 1YDMA 3ZD7A 4DQKA 3MFYA 3UJDA 2DQ4A 4H27A 4JKOA 4B35A 1K8ZB 4YRBA 1I36A 1YMUA 1Z0SA 3QU7A 1BGWA 4MR9A 1V71A 1DS6A 3ZE9A 3LIPA 4WFQA 4B6SA 3O7WA 1Y3HA 4ESHA 1K4MA 3NJ8A 1VHLA 1UBCA 1ZXXA 1STOA 1AK9A 4TMVA 2XCSB 1CQIB 1IJFA 2C2YA 3EMDA 3SD7A 3CEAA 5FUVA 4PYRA 1RYHA 4TWAA 4BHTA 2D7DA 3EIOA 4GOXA 4X6XA 2O8CA 4YRMA 2FMHA 2JLQA 1KP2A 2XE6A 4CM5A 4NWIA 3CX7A 1NF2A 3WGTA 2RHBA 3ORSA 1D7OA 1UM8A 3LLMA 3L7DA 4F92B 3N8IA 3TI7A 5BQ3A 2RI1A 1QE5A 2GO1A 2Q4RA 5BORA 2AQIA 3UK7A 5E3IA 3R7LA 2ODPA 3M81A 5FAKA 3R7NA 4TXMA 3DHWC 5EJ6A 4LJ4A 1XRSB 2HPVA 2ZS7A 3CLSD 1YS6A 3LBAA 5CVUA 3WMXA 4B6EA 1PFKA 4MULA 4BLVA 2DB3A 1USVA 3LVRE 1E63A 3N2YA 1HGXA 4MQEB 1QKJA 4W8GA 1K5HA 2FLKA 1ZQ1A 3UMBA 4ATNA 3Q8MA 2WTXA 1QFJA 2A88A 3ZBUA 1VOTA 3IV7A 3JQPA 1C7FA 1VYUA 1USUA 3T94A 3A6JA 1Z4MA 3UWMA 4ZHQA 3BL6A 3FDZA 3WFJA 5D5PA 3ASYA 3HJBA 2IH5A 2CUNA 1BH6A 1JPUA 2JCYA 4JI2B 4C01A 3S8MA 1AD2A 2B7BA 1RSZA 1ZR4A 2FPGA 4I4TB 4MKHA 4RQBA 5K3SA 1IU9A 3GFRA 1U90A 2QUIA 1X3LA 5FI1B 1WDMA 3LKZA 3R5SA 4TRRA 2PH1A 4RA9B 5EKUA 3GNSA 5KYYB 1WAMA 1WV0A 5DO9A 1EBBA 1XUOA 2Q3HA 4JJKA 3TXYA 3E9CA 3OBIA 3CW8X 4PVDA 3GQBA 1RLMA 2RGEA 1H2EA 2IKSA 3QKTA 1P3JA 1YHYA 4IF4A 1JYEA 2W6NA 3A1VA 1I3LA 1M2HA 5KHAA 3QPDA 1BCSA 4PTLA 4YMTA 3QOXA 2OOKA 1MNAA 1VB3A 3I9LA 3PQEA 4L8WB 1QAQA 4KXWA 1E1LA 3SC6A 1CZNA 1BX3A 1TDJA 1JFRA 1S4MA 2WWIA 2F3TA 3QX9A 4V39A 3RVKA 4MRMA 6REQB 4XPIB 3K9BA 4ZVOA 4ANFA 2DCMA 3LLSA 3NIDB 4NS4A 8AT1A 3OOJA 3O38A 2LE0A 4BJ3A 2MHCA 4BNJA 4BVGA 5FUMA 2JJ1D 2FOLA 4OVKA 2GOYA 4WXPA 5G1NA 3BM5A 1C1XB 3RQIA 1KK1A 1TUGA 2VH5R 2CHFA 2J3EA 3K92A 3Q9UA 4OYLA 1PGJA 1IAQA 4MWDA 1R0RE 2J0QA 2FETA 3KQWA 1ZCZA 1OXMA 4XWTA 5DBGA 3TPZA