4E15A

Crystal structure of kynurenine formamidase conjugated with an inhibitor
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
302
structure length
301
Chain Sequence
AGHMYNPRCKDLDRDYFPSYHTTRFQDQPEPNLAVLEHFVRVTKQHGRELTEKQGITVDHLRYGEGRQLVDVFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMDYNLCPQVTLEQLMTQFTHFLNWIFDYTEMTKVSSLTFAGHAGAHLLAQILMRPNVITAQRSKMVWALIFLCGVYDLRELSNLESVNPKNILGLNERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSTTFIEQSRHYADVLRKKGYKASFTLFKGYDHFDIIEETAIDDSDVSRFLRNIEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords kynurenine formamidase
publication title Biochemical identification and crystal structure of kynurenine formamidase from Drosophila melanogaster.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase/hydrolase inhibitor
total genus 121
structure length 301
sequence length 302
chains with identical sequence B
ec nomenclature ec 3.5.1.9: Arylformamidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e15A00
3W05A 2VJBA 5IVIA 2D5LA 4BAUA 3M82A 1QO9A 3NOXA 2BGRA 3M81A 4J03A 1E8MA 2R11A 4TPKA 2QXTA 4C89A 4Y2PA 5CT5A 4QDTA 2BFNA 3H2KA 3FVTA 4IH4A 5CH8A 5A71A 2C58A 4J0GA 2ONCA 3L1HA 3C87A 5I9IA 1BN6A 5ALUA 1QZ3A 2NW6A 5AIAA 1LBTA 4CFSA 1WM1A 1QGED 2Y2UA 1CUCA 5JD4A 4AZ0A 2O2IA 1CUHA 3GFFA 1GQRA 3HC7A 4H7IA 3WA7A 3ILSA 1F8UA 2B4KA 4HRXA 2EDAA 4OUKX 1JI3A 1IZ8A 3I2FA 1SC9A 2OG1A 4IH9A 2J4CA 2ZVDA 3PF8A 1YAJA 5HK8A 4JUIA 1QFMA 2CBGA 4L3WA 2O7RA 3IUQA 1LPPA 2BAGA 2X76A 2WUDA 3A6ZA 1NU6A 4LXHA 3IUNA 3VJKA 2Y6UA 5FKJA 2HFJA 2Q0XA 4PV7A 4BBZA 5LLSA 1JMKC 1UK6A 3CN7A 3AZQA 4Q05A 4MXDA 4Q82A 4AQDA 4TVKA 1BN7A 4RE6A 3D2CA 1YS2X 4UFOA 2XMQA 1H2ZA 2JF0A 2ROQA 2XQIA 2HA5A 3PDCA 4DSAA 3L1JA 1L7AA 4LYEA 5K3DA 5AK3A 4BE9A 3QVMA 1OXMA 3ED1A 4QE3A 5K3FB 2I3DA 5LIPA 4K6KA 3IULA 2PL5A 5DYWA 2CB9A 4L72A 1ETHA 5A6VA 1Q0RA 1XRLA 5CT6A 2HA3A 4G8CA 1P0PA 4OPMA 1GKKA 3RARA 4QDXA 3TGLA 1O6FA 5IKXA 1FFAA 3WKBA 4TGLA 2E3JA 3C45A 3QM1A 5LZ9A 1E3QA 4X7BA 4G1FA 4L9AA 1Q0ZA 5BV7A 3A70A 1LBSA 4MYSA 1YA4A 3LS2A 4ZXFA 5ALFA 1W1IA 1HDEA 3FYUB 2GZRA 3P2MA 3C6YA 3IA2A 2ES4A 3W9UA 5AI9A 1WHTA 2QKYA 1R3DA 3AIMA 5HF5A 4MEAA 3DOIA 4UUQA 1WPRA 5E4JA 5D6OA 5A62A 4H7FA 1ZD3A 2RIPA 1R88A 2G4LA 2AJ8A 3VVLA 3F9CA 4UHBA 1QTRA 4INZA 1I6WA 3ZLUA 4H7EA 3VDXA 1R9MA 3NUZA 4G4JA 1JJFA 2QXUA 1GT6A 1QONA 4X95A 4IQ4A 2WQZA 3QMMA 4J0HA 3QPAA 2DHEA 4G8BA 1J1IA 1XRRA 5A7GA 3AINA 4CCYB 1JU4A 5EI5A 5DTIA 1A8QA 1JT2A 1U65A 2ZYIA 3IBTA 2ACKA 3ESDA 4U2EA 3EQ8A 4UPDA 5EIEA 1GQSA 2XI4A 1CUWA 2JGKA 5AKXA 1XQWA 3V1KA 1BEZA 2XE4A 1J06A 3MUOA 5ALHA 4KE6A 3HABA 1JKMA 3PFBA 2I3ZA 3OG9A 3S2ZA 1ORVA 2OCIA 2XMCA 4X91A 4E46A 1F0NA 3ESAA 3FLBA 1F0PA 4Q1VA 3QITA 2WFLA 4G9GA 5AHXA 1TCAA 1XRNA 1EA5A 4CG1A 5AKYA 4B7ZA 1CRLA 3HYSA 4DMCA 5ALIA 3BL8A 2QJRA 4KEAA 4M0EA 4MQLA 5AKJA 4W1RA 3WYNA 1ACLA 1XQYA 4EY5A 1WB4A 4OB8A 1FFDA 2QM0A 3ESCA 4KAAA 2QT9A 5I8PA 3QPDA 1RYYA 5AKKA 4WCVA 1JFRA 2JGFA 1VLQA 3G9TA 3I2IA 3I2KA 4NZZA 2C7BA 1HBJA 2WIKA 4PW0A 2OGSA 2PBLA 1XZAA 4W1PA 1ISPA 5JAHA 4JEIA 3H1AA 2WJ4A 1CPYA 4FLEA 4C01A 5C8ZA 3L1IA 1QIJA 3BE8A 3C6BA 4QEKA 3GROA 3LCRA 3I1YA 3GA7A 2BUCA 4Y2XA 4UBKA 4Y2UA 4BYMA 3STUA 4XX1A 5ALOA 5HF9A 3B5EA 3H19A 1JJIA 3WWEA 3H04A 1EDDA 3WYDA 2HADA 1U4NA 1AURA 2OQIA 1N8SA 4NMWA 2VQ6A 1TRHA 3I1IA 3BIXA 3HLKA 5FXMA 3STVA 2H1IA 5DYTA 3HRHA 1TAHA 3BF8A 4QWWA 3W04A 2GBGA 2WG0A 3E1GA 4PF1A 1VKHA 1H22A 4N8SA 4GW3A 1XLWA 3WWDA 4YASA 1BCRA 4HVTA 2BCEA 2VT6A 1WHSA 2XMRA 2AXEA 2ORYA 4PSDA 5HCUA 4EBBA 4QLOA 3IUMA 5E2IA 1CUBA 4P92A 2FUKA 4Y2SA 1QIIA 4H7KA 5JAOA 5DNVA 5K3EA 3OC0A 3PE6A 4C87A 1AQLA 4Y7DA 2IIVA 4F21A 3O4HA 3AJAA 2C4HA 2GBFA 4BZWA 3QMWA 4ARBA 3STTA 4FTWA 4KYVA 4WY5A 2YASA 5ALQA 3O9VA 5FPPA 3I6ZA 4UBLA 2WG2A 5HF6A 3RM3A 2XUJA 5CH3A 5CURA 2XB6A 4EY6A 2CEKA 2OGZA 1ZOIA 5AI8A 4JYPA 1CQWA 1LZKA 5AM1A 1U2EA 5CT8A 3U0VA 1U8EA 2DR0A 4BC1A 2Z3ZA 4NS4A 2GBIA 3CCBA 4UHDA 4RE5A 2HA2A 4WFJA 4MJ3A 5A2GA 5CW2A 5ALTA 1W6RA 3EQ9A 3C8DA 2HL6A 1VXRA 2ZJ7A 4BB0A 3RKSA 4DNPA 3F98A 4J0CA 1QFSA 4CIBA 4X3CA 5HKAA 3V1NA 3G8YA 3G9UA 2OCGA 4H7HA 4G8DA 3T52A 2OCLA 3T4UA 2XMBA 4H7DA 3DEAA 1SCIA 1UK9A 3SC2A 4QLAA 4HXEB 1UK7A 1CVLA 1TKRA 1MAAA 1XKTA 1YA8A 2XUKA 3DYIA 4Q34A 4GWLA 5BOVA 3STYA 5BWBA 5T4FA 2JGIA 4BE4A 2ZYHA 4RNCA 2HIHA 3E4DA 3WIBA 1QTIA 2PSJA 4FNGA 2XUIA 1XZHA 4H7JA 3WK5A 3LLCA 5HFNA 1LZLA 2XQJA 2QUBA 1DQYA 1CUZA 1UT6A 2V98A 5EHQA 1PJAA 5FRDA 4KAJA 4UBMA 5JD6A 3G0DA 2R8BA 2JGLA 4EA6A 1CUVA 1D07A 4CG3A 3FNBA 3DJYA 1K8QA 2VJCA 4F5ZA 4X6XA 4IH1A 1A88A 4B82A 3G0GA 3CCCA 4MYDA 3FSGA 4N8DA 5EIAA 3KOOA 4K6HA 4GDMA 4HXGA 3G7NA 3GBSA 4KR0A 1DQZA 3E3AA 1VOTA 4FNMA 4N5IX 4C4XA 5AOAA 1Q84A 2QJWA 3F97A 2JGEA 5IH7A 5JZ9A 3BJMA 5HQ3B 1NX9A 5CXXA 3B3QA 1X70A 3NWOA 2WFMA 4FFWA 2XDWA 3WK6A 3BXPA 5AICA 3R3UA 3CXUA 4PO3X 4Q3KA 2XUDA 3R0VA 4K6GA 3BDIA 2PU7A 2G5TA 5JYCA 4DM7A 1G42A 4A16A 3AUKA 4AO6A 1CUGA 4AB1A 4DNQA 4BP9A 5FV4A 4BATA 4OYYA 3SX4A 3I2GA 1VXOA 5K3FA 4B80A 1EINA 3BIWA 3K2IA 1VJ5A 3OOSA 5JAUA 3DLTA 2WHRA 2XUQA 4LIPD 1UZAA 2ZYSA 2XQKA 3K6KA 1YB6A 3ESBA 4AZ3A 1CUEA 1UOQA 1ODSA 1DWOA 3WKEA 5ALEA 4DMHA 4O08A 3ICWA 3JW8A 3KWFA 1VZ2A 3V1MA 1H2WA 4EB0A 2RONA 1BCSA 2QR5A 2WFZA 4BRZA 1GZ7A 1Y37A 2Z8ZA 3IURA 3D4LA 4J0JA 2B20A 5ALNA 2OLEA 1USWA 1QE3A 4ZV9A 4EZIA 3WL6A 2C0PA 2ZJ6A 4KJXA 3WWOA 5FUMA 3IDAA 1C4XA 2OCKA 3HI4A 5ALXA 5DJ5A 2AJCA 4UHEA 1E8NA 3C43A 1UOPA 1MN6A 3WQHA 4X92A 1EI9A 1ZD5A 3WK4A 4BZZA 1CUFA 5LYYA 2B9VA 1XRQA 1JMYA 4EY8A 4H0CA 3R3ZA 4M0MA 4NVRA 1MNAA 3I28A 4X97A 5DNUA 3VXKA 1Y7IA 4A23A 2C0QA 1IVYA 4K5QA 3WA6A 1HL7A 1B41A 4OU4A 4Y2QA 3AIOA 5AK4A 3WJ1A 1GGVA 5EIHA 4Y2YA 2CJPA 5H3HA 2PUJA 4U2CA 3G0CA 2CUTA 2ACEA 5AH0A 5C81A 4LXGA 1ZI6A 4JNCA 1GPKA 3GELA 1ZD2P 1IUPA 4KACA 3TRDA 3W9BA 3FBWA 1CUAA 2JGMA 4CCWA 3DOHA 1B6GA 1R1DA 4HS9A 5AI4A 4DNOA 1QJ4A 5ALRA 2XUAA 4M0FA 1QIHA 2GBCA 2XMSA 4XJVA 3G0BA 4OB6A 3PICA 1BS9A 3DKRA 2HU5A 2YYSA 1QIGA 5FDFA 5HK9A 4Y9SA 2VTVA 5ALJA 1ODCA 2WSLA 3WK7A 1YASA 1HKHA 1OCEA 1CV2A 5LZ7A 4AMYA 1E5TA 5FOQA 2QS9A 4GXNA 1ZICA 1TCBA 3DYVA 2VF2A 2HFKA 3FAKA 1L7QA 1T2NA 1XQXA 4DMKA 1WOMA 1BROA 1TK3A 3ANTA 1CFJA 1OILA 4ZI5A 2HA7A 4BP8A 3BWXA 1MT3A 2PU5A 4FMPA 4DSZA 3VISA 1XROA 3STWA 3PUIA 4AXBA 3WZMA 2PSDA 3H18A 2DHDA 2G63A 7YASA 1VE6A 3DL4A 3TEJA 1G4HA 2ECFA 4KE7A 5ALZA 2V96A 4BDTA 3V9AA 1EDBA 4BVKA 2PX6A 1EB9A 2HDWA 4J3JA 4OYLA 1G66A 4PQEA 2HU8A 3ZWQA 5LZ4A 3S8YA 2ZJFA 4W63A 3R41A 1ZGBA 2WFLB 5K5EA 1PFQA 2PKYX 5YASA 1Q83A 1XRMA 4A5SA 2XMGA 1XZLA 2C5GA 1KU0A 4KE9A 5HZGA 5D7BA 1DT3A 2J3QA 5ALSA 4GBGA 2VJDA 4HZGA 1XZJA 3A2MA 1C7IA 5SYMA 2RI6A 1XZDA 1GPNA 3A2NA 5ALWA 2XUPA 5CTAA 3HZOA 4ETWA 3RK4A 5A7HA 4J0KA 4N8EA 5AM2A 2WM2A 4LXIA 4PSUA 1UOOA 3OTQA 1TIBA 4Q3OA 1MTZA 2XUOA 4V2IA 1EVEA 1N1MA 4E14A 1XLVA 2LIPA 4Y2TA 4UFNA 1LGYA 4K2AA 4U2DA 2H7CA 2IX9A 3WKCA 3JWEA 1R9NA 4B83A 4OCZA 3LIIA 2PSFA 3HACA 1K5PA 2GYWA 2H7YA 1THTA 5D3ZA 5ALYA 5JD5A 2XUHA 4ZWNA 4PNZA 4BCCA 1CQZA 1AMNA 4X90A 2Y6VA 3N2ZB 1UK8A 5LKRA 4C88A 1E89A 3EBLA 4ZV7A 3R3WA 5LZ5A 4EY7A 3WLAA 4KAFA 2XT0A 3G02A 2XQFA 2DSNA 4S0XA 3WL5A 2YH2A 1HQDA 1CUIA 5AKHA 3F8SA 4UFPA 1DWPA 2XLBA 3C6ZA 4FWBA 5JANA 1AGYA 4DTCA 1VE7A 4EY4A 5DWDA 2VJAA 5KBYA 1FSSA 2WHPA 1EXWA 2HHAA 3QMVA 1EK1A 1MJ5A 4MWSA 4LHEA 5T4BA 5JATA 3IVMA 5ALGA 4GLBA 3FCYA 1IZ7A 1RWQA 3TJMA 1X2EA 1ZD4A 4D9JA 4Q3LA 5KWJA 2C5FA 3FWHA 1S8OA 3KDAA 1MX5A 5K3CA 2PSEA 3IUJA 4E11A 3BF7A 4X6YA 4BTVA 1HPLA 3R3YA 4X85A 3ZI7A 3O4GA 4FHZA 4YK7A 4C6HA 3WMRA 2W6CX 1EVQA 3AZPA 3KD2A 1LPBB 3JYHA 1O6GA 2H7XA 3C5WP 4CG2A 1UKCA 4FDMA 3WI7A 4IO0A 4EHBA 2WJ3A 3WKAA 1G5FA 3OM8A 4FKBA 2WTNA 1W75A 2BJHA 1MX9A 3VJMA 4Y2JA 3W2TA 4B81A 3ICVA 2PSHA 2VATA 4X93A 4I3FA 5K3AA 2HM7A 2QRUA 1N5MA 4ITVA 3R40A 2W22A 5ISMA 2OAGA 3SK0A 3DS8A 4DLNA 1WB5A 3O4IA 5AJHA 4B85A 3F67A 3WK9A 1CLEA 5AM3A 3M3DA 4B0OA 2RHTA 4X71A 4UBIA 5F4ZA 5JARA 4UHCA 4J0IA 2BUAA 3DQZA 5SYNA 3WKDA 1CUYA 3MVEA 2AJBA 2YXPX 1R50A 2HRQA 3FYUC 4WDRA 1XZBA 3IB3A 5DTJA 1ORWA 2ZSIA 3DD5A 2BUBA 3WL8A 2PM8A 5ALDA 5J3JA 4OSEA 2FX5A 4C4ZA 1ZI8A 3ZV7A 1MX1A 4LYDA 4WFIA 1QIFA 1LPOA 4OD0A 1GKLA 1IUNA 1WPXA 2X8BA 4JH0A 2JGJA 3ZPXA 1THGA 3ANSA 4WJLA 2XMDA 1LNSA 5KWIA 2OAEA 1BE0A 1FJ2A 5LZ8A 1AZWA 3FVRA 1EHYA 1YB7A 1E8DA 3KXPA 4DGQA 2EEPA 3LP5A 2FJ0A 3IIIA 3RLIA 3OPMA 1JJBA 1F6WA 3R3VA 2IITA 3OURA 3PI6A 5CRIA 1QO7A 4U2GA 1AKNA 3QYJA 3A2LA 1VA4A 3QBJA 4KE8A 5AKGA 4LKOA 2JEZA 4FLFA 2VEOA 5JALA 1EDEA 4Z49A 3AZOA 4GECA 4G4GA 3FYTA 2VAXA 1DT5A 1CEXA 4OU5A 4GI1A 4F60A 4P9NA 1ZJ5A 1QLWA 2B61A 5AM0A 2DQZA 3I6YA 2HA0A 5AKLA 4KRYA 2DCMA 4I4CA 5D3KA 5KREA 3HJUA 1CIJA 3ZLTA 5AKZA 5AIBA 1DWQA 3DCNA 5JIBA 2WHQA 4QDUA 4CI9A 3UMJA 5ALMA 1IUOA 2WUFA 3FYUA 1WCYA 2BGNA 1HLGA 1SOMA 2K2QB 4CIAA 1P0QA 2O2GA 1IMJA 2WU3A 4H35A 1ODTC 1Y7HA 5AO9A 5FLKA 4B9EA 2HRRA 4QWMA 3W06A 4QDOA 4YX9A 1UKAA 3WL7A 4BCDA 2XLCA 2H9YA 2O7VA 3KWJA 3SWWA 4J7AA 3D2BA 1DX6A 4X6UA 3C70A 1WB6A 3I6MA 4BVLA 5CBKA 4P08A 1ZIYA 1CUUA 4BTLA 5EHXA 3H2HA 4Y2RA 5AKIA 1EB8A 3V48A 3H2GA 3QH4A 3O9MA 3WIOA 3ZLVA 2HA6A 4CCYA 3AILA 1AX9A 2I03A 5ALVA 1XZEA 3VKFA 1M33A 4AO7A 2QUAA 2GYVA 1UXOA 2BKLA 1ZIXA 3YASA 2DFPA 4G4IA 1XZCA 1A7UA 4ZGBA 3D59A 5JADA 2WJ6A 2JEYA 5C8XA 3C8HA 5AI6A 1R4ZA 5HF8A 3MUNA 5CXUA 4BRSA 1X2BA 5AP9A 1W4LA 3PUHA 4DMFA 4B9AA 2Y2VA 4QA9A 4BDSA 5I7UA 2DQYA 1QIMA 6YASA 4FBMA 3EIOA 3PF9A 1YAHA 4WDQA 2X5XA 4X94A 1YSCA 5EHZA 1XZIA 3CN9A 2RHWA 1XKLA 5EHNA 1H2YA 4P93A 2PUHA 5EGNA 1H23A 2PVSA 1AC5A 2EDCA 2WLSA 4AN0A 1SCQA 1EH5A 4UHHA 2QTBA 1MAHA 4XIIA 4U2BA 1ACJA 2CMFA 1XFDA 3UUFA 4F0JA 2WILA 2WKWA 3NGMA 1QIDA 1XQVA 2P8SA 4U2FA 2WTMA 1XRPA 4XVCA 4H18A 5CT4A 2ZYRA 1P0MA 1UWCA 5LZ2A 2AJDA 3N0TA 3QPCA 2OPHA 1FFCA 5EFZA 4GEGA 4MWTA 4B0PA 2ZSHA 1A8SA 3FSGD 3X3HA 1N5RA 3C5VA 1AUOA 4UHFA 5T4HA 1BU8A 5JZBA 1GPLA 4AX4A 2VAVA 3EF3A 3O95A 5DYYA 2QOEA 5CMLA 5AI5A 3H17A 5AI0A 1YCDA 1KEZA 3WWCA 1SFRA 4XWGA 5ALLA 4L0CA 1BEEA 3H2IA 4HXFB 5C8VA 4C4YA 1DINA 1H2XA 1LLFA 1J2EA 4WY8A 3QZUA 1BRTA 5HKBA 5ALPA 1FFBA 3DNMA 1ZGCA 4UBJA 3GZJA 1K6EA 5IVHA 1Z68A 2JIDA 1MU0A 5IVDA 1EK2A 1KU6A 4AO8A 3H0CA 2CKMA 1L7RA 3UUEA 2XUGA 3AFIA 4FBLA 4W1QA 1MPXA 3BDVA 3VVMA 2VSQA 3O0DA 1MNQA 2CZQA 2XQGA 2QVBA 3WK8A 2WG1A 1RP1A 3G9XA 1E66A 4BAGA 5CT9A 1CUXA 1YS1X 2Z3WA 4KRXA 1C7JA 4OB7A 4JYMA 3BJRA 1TCCA 3HSSA 4HAIA 1XZMA 3G0IA 1CR6A 1MO2A 4AN1A 4E15A 3LIPA 2Z8XA 3DL7A 1T4MA 1LPAB 4FFVA 1ZJ4A 5JZSA 3D2AA 3E0XA 1J07A 3HEAA 5HFAA 2OXEA 1CUSA 3DDUA 3MGAA 4ARAA 4IHAA 4G5XA 4X00A 3WWPA 2WUGA 4ROTA 1XZGA 5E4TA 2G5PA 5AKEA 1CUDA 4BC0A 4ZRDA 3K9BA 1SCKA 1GXSA 5K3BA 1K4YA 2OQVA 2GYUA 5LKAA 3B12A 5AM4A 4YPVA 5LP1A 1W52X 4EUSA 2WIJA 4DYHA 3G9ZA 5AK5A 1DX4A 3GUUA 4QNNA 1QOZA 3I2JA 3VJLA 4Y2VA 2RGUA 2PPLA 5C7YA 2VA9A 1XZFA 2D0DA 3I2HA 4QDZA 1YR2A 1LPMA 3D5EA 5IVKA 1UFOA 4B6GA 2JBWA 4DNFA 4GHWA 4FOLA 3M83A 1EX9A 1VZ3A 5CH5A 1XZKA 1XLUA 4FLMA 4HRYA 4QZVA 2FJPA 2Z5GA 4BAZA 1JU3A 2QMQA 3H1BA 5DLPA 4J0DA 5ESRA 2AJLI 1ZI9A 1P0IA 4MEBA 2WUEA 1K63A 2XUFA 3V1LA 2HU7A 2O2HA 4BCBA 1PV1A 3FCXA 1LPSA 3PFCA 3HXKA 2WU4A 1DU4A 5JAPA 3C6XA 5JASA 4G9EA 5E4YA 1NU8A 3Q8WA 3FOBA 3D3NA 4BVJA 3Q0TA 1VA5A 2J4FA 1UKBA 5AOCA 2RAUA 4AMZA 3KSRA 2WHPB 5AOBA 4ZREA 3STXA 5AK6A 5DNWA 4UBOA 1A8UA 3F96A 4PSCA 4W9RA 3D7RA 1TQHA 4B84A 2Y1KA 1DTEA 2GZSA 2V97A 5ALKA 2XMZA 2HA4A 4RPCA 2WIDA 3DKKA 3FLEA 2VT7A 2J3DA 3AIKA 1QIEA 2WIGA 4N5HX 2I78A 4UBNA 4WFKA 5T4EA 4DIUA 2UZ0A 2WIFA 3EQ7A 5BWCA 3O4JA 1QIKA 2V9ZA 2DHCA 4H77A 3WJ2A 5A7FA 2QZPA 4W1SA 5FP0A 1LPNA 3D0KA 1FFEA 3U1TA 5AM5A 3WZLA 5HQ3A 1W76A 3H2JA 5FPQA 4RGYA 1CUJA 2OGTA 4HTAA 3FLAA 4I19A 4MQMA 3R3XA
chains in the Genus database with same CATH superfamily
1U2GA 4H16A 1MFZA 1PR3A 1HA3A 5ARCA 5G02A 3RTDA 4J1TA 3F0TA 3I6QA 4BGIA 3DNPA 4M1OA 4K86A 3EDOA 3QX9A 4N82A 4F6RB 3C5EA 1NF2A 1N2IA 2X0RA 4ZT5A 4NMXB 2R11A 3OQIB 4B35A 1YZYA 4TPKA 5JS6A 1W7AA 4HX5A 3RK0A 2WJWA 1EAYA 4DSNA 1SG6A 3CKYA 3OJXA 1BMFD 1KSHA 2H2IA 1IEVA 1ISIA 1NW4A 3RH0A 3UA4A 2Q5EA 2QUIA 4JCOA 2VI5A 2J8ZA 1EEXB 2E4UA 3P19A 1PNOA 2B37A 2EEZA 3GQBB 3G2MA 3HBJA 3C7AA 3KFXA 5CT5A 3X2EA 3QSYA 1ZM7A 1LV7A 5L40A 1YD7A 3T1YB 4D9KA 1DO0A 2AOTB 1GSAA 1HXHA 2VNAA 1ZINA 4ZVKA 1RWVA 4ZOBA 3G59A 4XQ0A 5CH8A 4HFMA 2UZ4A 1EAMA 2C58A 2XKAA 3LXMA 4Z0TA 2HR1A 3LC1O 1U9IA 4J0GA 3T5CA 1YGYA 5DBOA 4YAFA 1YUBA 1GGFA 2HMVA 2CKDA 4Q9NA 5ALUA 2DLDA 2OZLB 5AIAA 1NOIA 3VR1A 4RD6A 4ND3A 3W8RA 2V7BA 3CX4A 5FI3A 5CDSA 3ERCA 1WM1A 2HIAA 4M53A 4ND8B 1BXKA 3CBQA 3OOEA 4Z8YA 3GUCA 5MN5A 1Z0IA 1Z73A 4EF6A 1KI3A 2BTQB 2O0HA 5JD4A 3WIEA 4ALMA 3GFFA 3ZHZA 4AG3A 4F4FA 1M76A 2UV8A 3ILSA 3B82A 4BNKA 3S81A 9ABPA 1ECPA 3GLFE 1Y4SA 1ANKA 1ZMRA 3OT1B 4MR8A 4LHVA 4BB9A 4F9EA 1U7WA 3QX8A 3IAEA 2C95A 2BDUA 1YZ3A 6AT1A 3PUVA 1XV5A 1UZLA 3RKRA 1YHZA 3CV3A 4FE3A 2OG1A 4IH9A 4DWOA 1XA3A 4PS1A 3T4XA 1Z15A 1T26A 2ZVDA 5CB4A 1RXSA 4JUIA 3TGWA 2CJWB 3QKSB 1SHJA 2XXBA 1P2TA 2HBYA 2PK3A 3IOYA 4EJ6A 2O7RA 3K5IA 4YUZA 3LGAA 3B6EA 4XCXA 2BAGA 5JPIA 1XD2B 2J33A 3QW2A 4MLPA 4M0PA 5JH7F 3CW8X 3C74A 1A9ZA 5KYYB 3MWGA 5BSEA 1E18A 3KE8A 3PG5A 3PJGA 1ECJA 2ORIA 2ZB2A 4Q6WA 1IXRC 3IUNA 3VJKA 3TBHA 1L5HA 1TZMA 2O2JA 2MSLA 3PTLA 3Q72A 2PTHA 2Q9UA 2PGLA 2C2YA 5DU2A 4LYFA 4N0PA 3G9QA 3RRZA 4ZOAA 8MHTA 2G17A 4HEQA 4R40A 3AR4A 4PV7A 4RK7A 3PR3A 3RG2A 4G2NA 1DKNA 3ANNA 2C9BA 4BWGA 2AZ4A 2XCQA 2ONYA 2F1JA 3ABIA 4Y6PA 5HE8A 5I45A 1UK6A 1YBFA 3AOGA 3M6AA 1TEZA 1V39A 5M5BA 3IFSA 3AZQA 4N3GA 4Q05A 4YCCA 3LDFA 1BWQA 4KLNA 3RBVA 3NLLA 4EKGA 5LM3A 3IKTA 3U4HA 2VJQA 4Q82A 2E6KA 3OJEA 3RFFA 1AKUA 1M2EA 5LBTA 2WK1A 1H69A 2GSDA 3DVQX 4LY0A 3VRHA 4UTVA 1L4HA 1PHRA 4BQNA 2XCRB 3VNQA 2GRJA 3D2CA 2BFDA 5F5NA 5HMMA 1YRWA 5HKLA 2ANBA 2XIJA 4WOPA 4G0QA 2OSVA 4P7BA 2C2MA 3B5IA 1UDAA 5DTRA 2GXAA 4CMBA 5BSVA 2UAGA 4ESHA 2JEOA 2V65A 2J45A 2VP9A 1XDUA 5AJTA 1ECGA 2H07A 2XQIA 2PS9A 3A4MA 4I9FA 1SGWA 5JY1A 4RD3A 5JEDA 3NH6A 4IVNA 1JT9A 4DSAA 1TA4A 1ZYUA 3IEPA 3E7PA 4JENA 3TWOA 1UMCB 4C4SA 3I64A 1FTWA 3SVZA 1KYTA 1WD5A 3FMOB 4LYEA 4UU7A 4FJ1A 3AUFA 5K3DA 3TFWA 1MJHA 2V3VA 4IILA 3HH8A 3QVMA 1OXMA 4URYR 3E22A 3HNRA 1JPUA 3WO0A 2ON6A 2LVBA 5K3FB 3ZJ5A 1L5KA 3DC7A 2WYHA 4RZQA 4E1BA 5H9WA 5ESXA 5HSGA 1F12A 1NWHA 2JGDA 2PFGA 2ODPA 2PL5A 3EGDB 3ETNA 5DYWA 1WW3A 2AK2A 1R6UA 4MWEA 4U7TB 1EFKA 5GOZA 1ONOA 4ZYTA 5A6VA 5KWVA 2FRVA 5J1SB 4WXPA 3O2JA 2HA3A 3K0CC 4YROA 3GOQA 1E1CA 3K05A 1GG2A 1EM8B 1PJBA 4RHUA 1KP2A 3K31A 4GPTA 1ZNXA 2QT0A 1Z28A 3KR9A 4RHCA 2DQ4A 1NKVA 2J5XA 4FILA 4UHKA 5TT0A 1V8OA 2BGTA 4IXDA 3JQ7A 4MYHA 2RG1A 4AZ3B 5IKMA 5IKXA 1AVTA 3O91A 5EMLA 3RAGA 3SPXA 2E3JA 2D2IA 4LPSA 3VDNB 2YKGA 4JT4A 2H63A 4QU9A 3C45A 1TK9A 3FW1A 3QM1A 5LZ9A 4MW7A 2BDEA 3FFBA 1GFZA 2I66A 3BKWA 3PWZA 2DLNA 3B1YA 4KN6A 3JWGA 1Z75A 1ORHA 2YJTD 3B9BA 2VHXA 4XARA 4WKGA 5HZHA 4EO9A 4TKZA 3F1KA 3L8ZA 1HI9A 1TJ3A 3PFNA 2FFJA 3V8EA 5BV7A 1KYIA 2XAAA 3TIGA 4EHJA 1NF8A 3ABZA 3TFQA 1LBSA 5D3QA 2G71A 4LZOA 2PEYA 1M0SA 3LS2A 3S7ZA 3UPTA 2W2MA 4BEBA 1QZUA 4Y6SA 1O4VA 3SHFA 2Z5VA 3LCMA 4H1HA 3TOXA 3FYUB 4D8YA 4EVIA 1MFPA 4R41A 5HUQA 4HAOA 2QN9A 5COAA 2G9RA 1M7HA 3GNLA 3KKEA 3B2EA 4II2A 3ZDZB 4EKDA 2F9LA 1JGTA 4XIFA 3TZQA 1R3DA 5HF5A 4I66A 3PBKA 4MEAA 4UUQA 4IY1A 1KL7A 1WPRA 5G1OA 1IM2A 1MHTA 2HCJB 4I8DA 4OK5A 1C7ZA 3H9JA 5TQ2B 1TW3A 2VSOA 1W19A 2BR4A 5C8YA 4H7FA 1ZD3A 5JJCA 4B3JA 5ABPA 3VV3A 4WA7A 3IJEB 2XXAB 2AJ8A 1TB4A 4MUGA 3GVIA 3B7WA 2AXQA 5FUYA 4INZA 1I6WA 5DI9A 5ANRB 4WECA 3TQCA 2JANA 2WHEA 4QFMA 1C8LA 4IGKA 4IG9A 4Z4FA 3A1VA 1C30A 4W8GA 2VC2B 1LX7A 5BVGA 3GZ4A 3IEIA 1XXHB 1W5BA 3O47A 3OBBA 4NKRA 3SR4A 1GT6A 5LUAA 3JVEA 4LZNA 2GEDA 4X95A 5EE3A 3GEGA 1MEEA 4HNSA 3N9IA 2YXLA 3HKEA 2Q3JA 3KQTA 4CMIA 4Z4GA 2EIXA 4XYLA 2HHJA 2VK1A 1A5SB 1E0SA 2HSDA 3GLHA 1J1IA 3D6UA 2Q2WA 4Q1DA 3A10A 3N74A 4L75A 5A7GA 3AJDA 4K88A 1P4JA 1X1CA 3FPSA 3KVVA 3PITA 2BM0A 3F3KA 3NHZA 3LTNC 1UWKA 3GU3A 4NLLA 3L05A 1JU4A 1DKLA 2B8EA 2JIZD 5DTIA 3CRZA 1JT2A 1U65A 1AQYA 4DARA 3TYXA 2R7MA 3IBTA 3L02A 4PYLA 1Y34E 3ETHA 3I9OA 3L7OA 5CFRA 4PAMA 2ZB3A 1Q50A 3EQ8A 1I7LA 4Y8VA 3ZJYA 4UPDA 4PR0A 1BNCA 5KOHA 1KAQA 2C88A 3BGSA 1QUEA 3DEZA 2JGKA 4RUKA 4S12A 3VYUB 2DPLA 2AI3A 4KLAA 5CVDA 3R7BA 3E6AA 1MAUA 3GP3A 2XZOA 4NMHA 2VF4X 1RCUA 3JQQA 3L8YA 3M9WA 2XT9A 3O82A 2XE4A 1SQ0A 4FWIB 4GPIB 1VHQA 3AB8A 3FVVA 4AYTA 5ALHA 2H59A 2Q1SA 3H9UA 4I6JA 3VTKA 2JI8A 3UV3A 4D44A 4YRZA 1JKMA 2J41A 3KQLA 1ODLA 1VI5A 3V6LA 4IZIA 4BGEA 3I1JA 1IH8A 1KZ4A 2PD6A 3NTLA 1C3VA 3ORYA 1NIJA 2H2WA 4H9GA 3HB1A 4LBWA 1E2EA 3S2ZA 4EQ6A 1ORVA 4EKNB 1P5RA 1FMFA 2WT9A 2ZCUA 4Y9DA 3GDHA 4XGNA 4D80A 1L4LA 4C43A 4X7MA 4E46A 3ESAA 3B3JA 3FLBA 4O8ZA 5KINB 3ZQ6A 1VL6A 3QITA 4BU0A 1C5KA 3A8TA 2AG6A 1E3LA 2G70A 3T5AA 5E3JA 2QIOA 3BFKA 3OQJA 4N1AA 3AL0C 5JCJD 2CD9A 5IDXA 4RZXA 1G6Q1 2JA1A 5AHXA 2NU9A 3K0CA 3AKDA 2EJBA 2NU8B 4JJIA 1X9HA 5TGZA 3Q7QA 1L4EA 4N5MA 2P8JA 1PKXA 2YFKA 3D64A 4RV4A 1SU7A 5K01A 3IE0A 1NF9A 1T4BA 4L6AA 1T5TA 3HYSA 3AU8A 3R3JA 4ZVMA 3ISVA 2J3MA 1IQRA 2IYUA 5ALIA 3M4JA 3EFBA 1SQ6A 1UQTA 4M0EA 1ESMA 2QQGA 2H48A 4Q4CA 1YBMA 4GP7A 3OQOA 4R6XA 2JAXA 4KVGA 1CYEA 1LLDA 1GYPA 2V0CA 1BEUB 1M6EX 1VE1A 1LQTA 5CHYA 2YV1A 2QGZA 1UCFA 1QP8A 1LBIA 1E3EA 1N3BA 1OFHA 2HJVA 3H4IA 4J3NA 4FKZA 1UKVY 1P2DA 4NYMQ 5KQLA 1YULA 2IYZA 4OB8A 3PLNA 4NQZA 4WXYB 3UC5A 1IK6A 1QHGA 1GTG1 3MWLA 2Y0CA 1YL7A 3CT6A 4I55F 4MUKA 3ITDA 4LFAB 1QHSA 4EF4A 3KSAC 4KR6A 1R5OA 1W8DA 2ZIUB 3WNCA 4D8TA 3RU9A 5TQJA 1MOQA 1KK1A 2VNJA 2HK8A 3E35A 3K0HA 4Q4AB 4YRPA 3WGNA 4EEZA 1Q57A 3I2KA 4HNTA 1NC1A 1Z7EA 5F76A 4B6FA 1CQXA 4E1VA 2NXNA 3OEED 3NGXA 2NSJA 3C14C 1ZHHA 3A9UA 1MQ8B 2C7BA 2AA3A 2WFAA 1TYDE 3EXEB 3WLNA 1XCBA 3WXBA 5KKNB 4PW0A 2OGSA 3I6BA 4EARA 2OCXA 4BVEA 5D7NA 1V95A 4GGOA 1PUXA 4HUQA 3CF6R 3FOCA 3OQ6A 5DASA 3SD7A 3TCKA 3E27A 3TUZC 2X5NA 3S2FA 2QMUA 1TZBA 3FTPA 1PD1A 2X2FA 5BMVA 1B3BA 3VVBA 1E62A 4X7PA 1ZUD1 3QFCA 1KOFA 3P0FA 4RLSA 3EWAA 4KQKA 5C31A 5A9TA 4JBGA 4JQSA 2EW8A 1H0SA 3BD7A 3GGOA 2PV7A 1IOZA 3E9YA 4G25A 4QOEA 5IC6A 3COPA 3I83A 4R31A 2FCAA 3H3XA 2A5JA 2GF2A 3L5OA 3TD9A 3UXMA 4GL2A 9MHTA 4C01A 5C8ZA 1E1MA 1MABB 4BP3A 3AESB 3IL2A 1R5BA 3SP1A 4U8GA 4Y98A 4EFMA 3I5MA 1T3SA 5JV5A 2PVPA 1CJTC 3THOA 4EPYA 1PT6A 4PLWA 4ZO7A 4QBKA 2NV0A 4JR2A 5GMOA 3DXYA 2IYEA 3FUUA 2CJXA 5DTQA 3PPYA 2BUCA 2GRUA 1NUAA 4GXQA 4AJKA 3P26A 4F56A 3FWYA 5F2KA 2FWAA 3QX7A 2ZI9A 4UBKA 3W3AA 4EDHA 1KEVA 1FU8A 3ASYA 3I5YA 1GKIA 2B2XA 3CZRA 1RJGA 3RWMB 3WNQA 5I47A 1MZVA 5A9SA 1AUVA 2H0AA 4NSNA 1GNPA 3GVPA 4N6NA 2YJGA 2O0MA 1SU6A 3MRVA 1GNRA 3OFVA 5DI3A 5IN5A 4F4CA 2X3FA 5FADA 4D4MA 1CDOA 1DAHA 1M2GA 4R7ZA 2HADA 1XDZA 3OZIA 3KKNA 2ZBEA 1HX7A 2BD0A 1DDGA 1TQ4A 1KH3A 2CF6A 1JRLA 2D8AA 2QZZA 3FLMA 5E7QA 4MYTA 5I7FA 1WZUA 2EBHX 2MSDB 2E5FA 1N6OA 2VNIA 1NLFA 1N8SA 1UOEA 3D1JA 3ZE8A 2NVWA 3KR2A 2VQ6A 3MJSA 1P74A 1WPQA 2D06A 2DTXA 1ABFA 1XTQA 2OORC 3DBVO 3GNSA 4LYGA 2C5BA 4MCIA 5FLEX 3ZHCA 5KUTA 5KHAA 3HLKA 3BMNA 1MBZA 1XXHE 4RJIA 5DYTA 3W4IA 2VHCA 1YC2A 4ZI7F 3WE7A 3C3JA 3UGKA 2OHOA 1HNWB 1UJ2A 3EAFA 3R6WA 4DLVA 3FGOA 1EFTA 3PU6A 3WIDA 2EIHA 2M1XA 4F93B 5C46F 3K9NA 3ENVA 3NM6B 2VBGA 1G7CA 5EXPA 2M32A 4YDSA 2NVOA 3AO0B 4PF1A 1F8XA 1Q5PA 1ENOA 2VK4A 4FPXA 1UAAA 5JHHB 1BCRA 4R9SA 4HVTA 2BCEA 3ZVNA 1EFVB 3OH8A 2K5UA 2VT6A 4FDTA 2GMWA 2ORYA 4ZHSA 4CR8A 3E84A 1KBZA 1OXBB 2AFIB 4HDRA 5FNVA 1Z2EA 2HT6A 2FUKA 3JARA 4RSGA 4M0LA 4H7KA 1M75A 5JAOA 3ASUA 5CD1A 3BG5A 5K3EA 1HE8B 3OC0A 2VDMB 4JUCA 1UF9A 2QLBA 3HCDA 2FZVA 4AURA 3VJRA 4LKRA 2JJ2A 2IXDA 4PLPA 3WY9A 2J08A 3FUVA 1HRKA 2W0SA 1OAAA 3EYWA 3AJAA 4FIZA 1TEXA 3LCJA 1LI7A 5H3LA 1NRJB 1FUYB 2GBFA 3JZIA 4JGGA 3WFZA 2ONZA 4KO3S 1Z4KA 3BGWA 3D4NA 3DWGA 4BPBA 1S7GA 1V35A 1WZIA 1KS9A 3FHLA 4KFRA 3ZNPA 3ZWXA 3EZLA 3HFSA 5DK4A 3TCNA 5K2MA 5G40A 4CTOA 1NBAA 3RRXA 3O9VA 4W9NC 3NAMA 2WRZA 2XZTA 5JUWA 2FZLA 3L40A 3RYFA 3EVBA 1GGNA 1X94A 2D74A 5FJIA 1KC1A 1KFEB 2ORED 5ERXA 1Q1EA 5HJ5A 3EVNA 4LYHA 1AMOA 2H54A 2WWXA 3QVSA 2W6NA 2VHTA 3UICA 3PTAA 5HRAA 3TZKA 4NDZA 3VU8A 3HWX1 3I5AA 3P4UA 2AN9A 221PA 3HYRA 3QK7A 4BECA 1SPBS 3VHXA 3JWHA 4WNYA 2WSMA 1YVRA 4V38A 3TLXA 4JLNA 4UEQA 3MWDA 5HTKA 1UXIA 4EYOA 4A0GA 3PIRA 4FC7A 3KQPA 4MQEA 4DUZB 4BX9A 1DEAA 1YB1A 1YHNA 2D1SA 2V6MA 2F48A 2FOIA 1KMMA 3K16A 3OFKA 1SA0A 1CB7A 2X8JA 2D1TA 2GETA 2G6BA 4UQPA 5AM1A 3BMOB 3TKAA 1EFRD 1GFIA 1JTVA 1MPTA 2R5FA 3QY0A 5EPEA 1U8EA 2I9PA 4NV0A 3UG6A 2AR0A 3P96A 3T7DA 2BHNA 4W9MC 2GBIA 5JBNA 1GGJA 3I9LA 1WNFA 1WV1A 3H9CA 4IGAA 4QYTA 4JR1A 5J5CA 3S4YA 3NETA 4WEQA 4JA2A 2IBSA 3QUAA 1D2NA 1QHHB 1MP0A 3HVIA 4Q1CA 4MJ3A 1PGJA 3LA6A 4R01A 1GHTA 4TL7A 5CX4A 1FQOA 4PQRA 1LC0A 4OHVA 2COEA 3T95A 5BMVF 1W6RA 2OFWA 1WIWA 4MPRA 4V0RA 1M2FA 4QBFA 2CW5A 3C8DA 1DARA 3QRWA 3G8BA 3UHAA 3IC5A 2UXCB 1X0VA 1FUKA 4MMXB 1JH9A 1D03A 2DSTA 4M22A 1VYVA 3G79A 1RBMA 3D1VA 3T9EA 1FYEA 3UK6A 4EFDA 5LQCA 4X41A 4LZPA 4WI1A 1PL6A 4J0CA 4XR4A 2NADA 4PG7A 1J23A 4GF5A 1AT1A 5FTLA 5T5QA 2C04A 1ZGJA 2J32A 3KM0A 2H4ZA 4UEKA 2M6KA 1VGVA 2QV0A 3OPQA 3LHIA 1GSHA 4G8DA 2L18A 3R8XA 3T4UA 1ZUNB 1A95A 3MCUA 2XKBA 4CV3A 1KZ7B 3HI6A 3P5BA 4PZ0A 4UEWA 1LKZA 3IPXA 1UK9A 5C3UA 3V8PA 2OORA 3A4YA 5EQJB 3RIHA 1SO8A 3B7GA 3FTDA 2PMDA 3SC2A 5CFQA 4HXEB 3N2NA 4MW4A 5E1OA 1GTVA 1RC1A 1UK7A 1UJMA 1XJWA 1YJBA 2CE7A 2O3SA 3SXPA 4AJNA 4FGLA 4CM8A 1V48A 2XUKA 1KP9A 4AXXA 4D4HA 1H85A 3ET4A 4TTSA 3MT7A 2JCGA 4Q34A 1KEKA 4FUTA 5BOVA 5HE9A 1CRZA 3IPLA 3U7JA 5GTDA 3EWNA 2JZNA 3NDJA 4ZDWA 3STYA 5JH7B 2X8LA 2ZPUA 4YT5A 4B3DA 1Q1ZA 3QKRB 5AJXA 5BWBA 2QE6A 2WF5A 4YNBA 2GHTA 2JGIA 3A9VA 5T4FA 5JBQA 4KXVA 2JGRA 3MSXA 4BE4A 2H4XA 3T7CA 1CERA 3S2GA 4MS4B 1PN3A 4OJYA 5A6SA 4LBVA 1JZTA 1E9EA 2PSJA 4R8KA 4UAGA 1BFUA 2RBGA 2XNKA 1SU4A 3K8YA 4IRXA 2EP7A 3HFRA 4XI9A 2CEAA 4GE0A 3SYNA 1ONNA 3IAFA 3NIDB 1L3BA 2ZBFA 4RD1A 1XZHA 4KUHA 4XSGA 2QN1A 3K4HA 4UC0A 3S1AB 2B1GA 1RQNA 1J6UA 4KQIA 1VPDA 2CNDA 4F3NA 1F8GA 1E59A 4D81A 4PNEA 5BOSA 3KZKA 5BWMA 2O59A 3ZVMA 1QBKC 4UTOA 1ORDA 2P35A 5EHQA 4RTOA 3HYLA 2AN1A 3HO8A 3ROQA 4DYDA 1PEAA 1FDRA 1PJAA 5FRDA 3A1NA 5LOVA 1G59A 4P4SB 1QHEA 2OY0A 3NT5A 4KQ6A 4MUBA 4X8HA 4BFVA 1ZO8A 2OBYA 2R8BA 3CRW1 3P9NA 2JGLA 3ZHXA 2P90A 4KXLA 4NFYA 1J2TA 3TB4A 5BWNA 1B42A 4MUNA 4UD2A 2JGAA 4CTKA 1XEWY 3NOVA 4LOAA 4CG3A 4HEHA 2V7PA 4W9NA 3EPRA 1UZUA 1R8SA 4B3RB 2YR0A 4N7BA 3D0RA 3RJTA 2VZEA 3Q12A 4B09A 5HP4A 1A88A 4B82A 2OOSA 1OWNA 2G08A 1CF2O 1KDRA 3VH4A 3EK2A 3KOOA 3LO5A 2P3LA 4I4TA 4K6HA 1DXYA 3OLZA 4GDMA 3GT4A 5EUBA 3SFVA 4E3ZA 4JJGA 4KR0A 2AFIE 4WLOA 4QUKA 5DLDA 4LK2A 2D1RA 2ERYA 4FNMA 1NVGA 2ZRHA 2X4GA 1WA5A 3BGDA 1QFZA 3Q3CA 4AC9A 1Q84A 2Y0PA 4D41A 1JJAA 4ROSA 1XRSB 2C07A 1GU0A 4FXOA 5PNTA 1UFKA 4NZ9A 2R3SA 1PFKA 1WY7A 1E7YA 3FMGA 3QG1A 5EE0A 5AUPB 1SC4A 1SEPA 2IP4A 3BCUA 2CXXA 4XKJA 3W4KA 4EVRA 5KYXA 1J8YF 2W6JA 3GYGA 3BJMA 1M67A 4J0FA 1BDMA 3GJQA 5K0EA 1DKUA 1HEIA 1JEQB 2B98A 2IYSA 3B3QA 1SZDA 2ZDGA 3KT8A 1YDGA 3NWOA 3RYIB 3EASA 3E9RA 3ADOA 4QBHA 4HT3B 1ZCJA 1R00A 3BXPA 4RDIA 3GUHA 3FUWA 3UANA 3KYBA 3UUWA 2HCBA 1E3WB 3F2VA 3CXUA 3TQRA 4DDKA 4DTIA 4DXAA 5BT9A 4Q3KA 1D6SA 2ARKA 4E51A 4DR1B 4HWOA 3GJ6A 1QHYA 2WPDA 4CETA 3GNTA 4X3PA 5F1YA 1Q1BA 1VCOA 2R48A 4YDQA 4RGQA 3H7IA 3K7EA 4ON9A 3PNKA 4HDOB 4XH9B 2R5NA 2Z4RA 3FDZA 1UDWA 3ZUPA 4B3BA 1B8NA 3UJDA 2DAPA 1CUGA 1YOBA 5FPYA 3AFGA 3C39A 1LLQA 2F4NA 3SIWA 3NEPX 3CRVA 4I7EA 5BV2P 3EVFA 2G8LA 3JV7A 1X77A 2HMTA 2QDXA 4Q4LA 4GZ3A 2QIPA 2XB8A 2NZXA 3Q7TA 4OHMA 1JG3A 4OYYA 4QJ3A 5EKSA 1FNCA 3DMRA 2L42A 4NNPA 1KI1A 1T5DX 5BRNA 1K9SA 3KJHA 4ZEOA 2INGX 1FJGB 1QQ5A 3DDCA 3WAGA 2ZB7A 3BRWD 4PLVA 1ELOA 3K9WA 4RPLA 2BFPA 2BFCA 3DT6A 2Q5QA 4X6LA 2O05A 2V58A 1VKOA 3MS2A 1JA9A 2FEOA 4CV0A 3IPCA 3K2IA 3U48A 1V9SA 1A9QA 2GDZA 2QYOA 4E31A 2XUQA 2J5KA 4DE5A 5BWLA 2PJRA 4E5PA 1VHLA 2PT7A 3DZDA 3TNFA 3TQHA 3AYXB 4G1BA 5IN4A 1Z45A 4B5KA 3WMWA 1W2HA 1YB6A 3EGWA 2WVHA 4LQDA 4M1YA 4XXHA 4DMLA 4EYKA 1CD5A 4KVFA 4R84A 2FVYA 5KOJB 4WEOA 1C7QA 4PO8A 1I2MA 2E55A 3WKEA 2Q28A 2JAWA 2GZ2A 3EUWA 5GONA 2CL6X 5CB4B 1ZEJA 2ZIVB 1KNXA 1W85B 1BDBA 1EP9A 2WV7A 3CPHA 3GJSA 5FBZA 3HDYA 4O0MA 4BIIA 4XWWA 2Q1TA 1SELA 1JR3E 1CF9A 3DNFA 4DBVO 3EIHA 5ILGA 2Y1OA 3Q3IA 5JMPA 4ZJUA 4GXRA 4N01A 1MXFA 1WWKA 4IWXA 4X65B 1FLVA 1P3Y1 2VS1A 1XOIA 3JAKA 2H5LA 3MWYW 4BIMA 4DDVA 3TEMA 3KB2A 4XX0A 2B4TO 3MT8A 3V8VA 4GGPA 4R54A 3EGXB 3UT0A 3EPHA 3CCFA 2UUAB 4BNDA 1K3UB 2X0EA 5ICEA 3LUDA 2NTNA 3QEOA 3RC8A 3N3AC 1B0UA 2AW5A 2BMJA 1FEZA 2CBXA 2DWOA 4EZIA 3WL6A 5JNWA 2C0PA 1MOPA 2X4DA 1F3OA 5GVSA 4DQXA 3WWOA 4W5OA 1H05A 3NATA 2OVBA 3MELA 4LJ7A 3SE7A 3JXEA 2OM6A 3MOGA 4UATA 3LQ4A 4KNWA 3VH2A 2WD8A 3DMNA 5M04A 4W5RA 4O63O 2PGJA 1K7FB 3LPNA 2V5VA 3F71A 1CCWA 4NAUA 3L07A 1E1YA 4BJ3A 4XDZA 3O3CA 4RKEA 1NG9A 4DLTA 1GNVA 1P7CA 2H2AA 4EYEA 1VLJA 3EZNA 4MZDA 4QJBA 4UD6A 1ZD5A 3U39A 4CNQA 2D62A 2E4ZA 1HOXA 1I6KA 2GN6A 3GPBA 2A14A 3AQ4A 5H0IA 5LYYA 2QZJA 4AS3A 1Z62A 2AEEA 3E61A 1U3FA 3MPOA 4NULA 5HKOA 1VBNA 1SC6A 1JMYA 3A1CA 3E7DA 3JZAA 5TEWA 3OCJA 2QRGA 2CLSA 4EY8A 4FYKA 1C9KA 2ZTHA 1TDJA 4L0MA 3R3ZA 3C3MA 4NVRA 5FH9A 5KWSA 5LD2C 3IOMA 5LBUA 2IU3A 5HYVA 1QK4A 2PT9A 4OKNA 3VYRB 4UVDA 3LA8A 2AH5A 4E5KA 1T8TA 2RGDA 4PQFA 3BB3A 3NHSA 2VA8A 3E9CA 4FQ7A 1JBEA 2FR1A 1J8FA 4RH1A 5MFPA 1B8UA 2WDPA 4BO9A 4RH3A 1A5ZA 1DIAA 2C8JA 4JOCA 4HATA 4X0EA 1G64A 5DNYB 3FUXA 4YO7A 4URUR 4OU4A 1DAIA 1JV2B 2FF5A 2I6TA 2J9GA 3AIOA 3FETA 4QUDA 5AK4A 1GGVA 5EIHA 1E1CB 1C3OA 2CJPA 1E3IA 1J9EA 3EG5A 2PUJA 2YN0A 5H3HA 3EIEA 5B64A 4KGZA 2H2HA 2Z58A 4I55B 2Q3MA 1QF7A 1SKMA 1PKEA 3JQ7B 2JH9A 2ACEA 4BNZA 2GN9A 5LB4A 3VVCA 3HN7A 1NF3A 2JLAA 1GVHA 1G3IA 3ZBTA 4YLYA 4CGZA 4HNRA 4JNCA 1P9LA 1BS1A 3DHYA 3QA3E 4HJXA 5I9SA 1SCUA 1KXZA 1T43A 1CWUA 2P41A 4OHFA 4RF3A 1WLYA 3WLMA 5HXAA 4S0ZA 2TMKA 1WUIS 4F9GA 4OH1A 1L7EA 5AW9A 1TMKA 4BN0A 2PZGA 1OT3A 1ML4A 2QVXX 4GI7A 2CNBA 4DNOA 4QTXA 2X42A 5EG5A 4IAOA 3K20A 1GZ5A 1GKYA 3UT5A 2QEQA 1UBJS 1U8XX 1PD0A 1E2KA 2CY0A 2HPHA 1OSNA 5HCIA 3NONA 3LGSA 4XJVA 2NO0A 1YBVA 3EXIB 3F5QA 3WMXA 2DTEA 4KNYA 3DKRA 1WP4A 2PMWB 4BBAA 3SJCA 2HU5A 3ZBUA 5F1OA 2XGSA 4A6XA 1H4VB 4MKGA 5FDFA 2IU6A 1N3IA 4LF4B 1NVFA 1OGYA 2NUBA 3RI3A 3NVMB 5F5LA 2JCSA 4K0RA 3TJRA 1HEUA 5ITWA 4B3MB 3AUTA 1CY7A 3G88A 1P73A 2H1LA 5IKOA 1IRIA 3DE1X 1NDHA 3IP6A 3MCTA 2HNBA 2FSGA 4BZPA 5J4KA 5H1YA 3AERA 4XB2A 4DVJA 4DEYA 4YH1A 1HKHA 1HQYE 1OCEA 4YY3B 3O94A 5IMBA 5ADUS 1JKJA 1TZKA 3VTAA 1C80A 4BEVA 1I94B 4FQ5A 1E1QA 1C30B 2QS9A 3OMLA 5BVGB 1ZICA 1RQLA 2GNOA 2HF8A 4R2IA 2X4LA 5JD3A 1Z63A 4ICIA 4HSGA 4YJ3F 2BF4A 3DE3X 2NSYA 1WVIA 1XQXA 4JFRA 4IQFA 2JI9A 2V6GA 3CEHA 1E2GA 3HKEB 2B3TA 2AKAB 5I4KA 1FDSA 2HF7A 3Q88A 3GLHB 1FRQA 2M9MA 3FD8A 5GONF 1BROA 1ITZA 1FYXA 2VT3A 1I36A 3OT5A 1TK3A 1OA1A 3K1AB 4PYOA 3AI1A 1OILA 3EVZA 3GEPA 4XPIA 1E1KA 1VYHA 2NZVG 2VK2A 2V0GA 1MT3A 1PDVA 3UW1A 1HNXB 2OC9A 3VISA 3W2HA 1JF8A 3G2NA 4GR9A 1VCHA 1L5YA 5I01A 1K8ZB 2OYSA 1E32A 1Z2NX 4G86A 3V4ZA 2JPDA 4M1MA 3ODGA 1WKBA 2VDJA 3QX3A 4AKGA 1A2BA 2C8VA 2YRWA 4ZI7B 2Q4BA 1NW7A 1YFZA 2PWZA 3PUIA 5C3MA 2PSDA 3VYTB 3KZOA 3LYLA 4LBYA 2G63A 3SIPA 7YASA 2PKQP 4CDNA 3DEHA 1RPAA 3ROXA 3IP1A 3AP3A 3GP8A 3IS3A 5EOVA 3ZG6A 2A9VA 2PX4A 2I99A 2HRCA 1SBZA 2BISA 2V0NA 4HAWA 2Q3FA 2V96A 4BDTA 1D2CA 3LKVA 3V9AA 4GKJB 2N46A 4PO9A 4AZVA 2GAOA 4HAUA 2KS6A 4NJOA 2EYQA 1CW2B 3JQAD 5ERYA 5FWNA 1RDFA 3ABOB 3W8NA 4L1KA 3G2LA 4XVRA 4B3FX 3ZDCA 2PX6A 1CQPA 5CVUA 3R74A 2HDWA 4KO8A 4RAQA 1ISFA 1G66A 3IDFA 4RJ2A 1JAIA 3N76A 3LOPA 4N5DA 3THRA 1BMFA 1U0FA 5K6AC 3PJEA 4CT0A 2FSFA 4L5CA 4O02B 5EP1A 5I7SA 3IVRA 3F5MA 4PGMA 1RBZA 1D0SA 2YWHA 2H9IA 2WT8A 3MXOA 3WLIA 4CTJA 3IP8A 5FYDA 5KS2A 1PUIA 4RXMA 1L6IA 2MYNA 5LQKA 3R41A 2XOKD 1ZGBA 1O5TA 4RBNA 4WVLA 1L4BA 2Q50A 3CRRA 1PQ4A 1Q2UA 2FZGA 4I6GA 1PFQA 1XDWA 2FEPA 4DM3A 5YASA 5K5EA 5EWJA 3AHCA 2JFQA 2WD7B 1U2PA 2ZBDA 4A8TA 3L06A 1DJNA 1W581 2Q4RA 3NOOA 2C5GA 3P0IA 1Q77A 4I1RA 3LCUA 3W5IA 3SBDA 1U98A 3ID6C 3MLEA 2HT1A 4O5AA 2IP2A 1FS4A 1E7RA 3AHJA 3NDRA 3NYRA 4LVNA 1R0CA 1QO0D 3U6KA 2VHEA 3IE1A 4MS3B 1M8FA 3PVZA 1ONPA 4FSXA 3PNSA 4LOHA 2O19A 2H1VA 1I4DD 2Y3IA 4L95C 5ICSA 1P44A 4HS4A 5IK2D 1LBQA 3AVTA 2KW5A 4TTTS 3TX6A 4F5WA 1J97A 1L8LA 1WL8A 3LUHA 1Z36A 4M0DA 2IHJA 2RFLA 4DCPA 3AG6A 5P8WA 4CKEA 2BDTA 3Q10A 4HZGA 1UJBA 1KO1A 3QU4A 4MV9A 1FX1A 4HX2A 1N34B 2YY6A 3U5TA 4DRYA 1W49A 2ZTMA 3MERA 3UCEA 3NO4A 4IWYA 1M74A 3RT7A 1O0CA 3A2NA 1C9DB 1VL0A 3QI7A 3TW8A 1WXIA 2XUPA 3NKVA 4IDBA 3BIOA 4MVJD 4M89A 4OQXA 5TMBA 4ZKDA 5IAEA 2C54A 3R5HA 1CY1A 3U26A 5JS7A 4INPA 3BC1A 3CO0S 3KEQA 3HZOA 4ETWA 4HNVA 5A7HA 4H3SA 3IVAA 2I55A 1SBCA 2WM2A 4CL3A 1E2QA 3EXHC 2J30A 4DRXB 3SXUB 3NRJA 2R68A 4D7AA 3AJ9A 4PSUA 3V4FA 3OTQA 1AHNA 1TIBA 3HNOA 4PX5A 4V2IA 3W4JA 1ZKMA 4P80A 4U5QA 4YO8A 3JWJA 4ZZ0A 5A03A 1U7HA 4X54A 2QAIA 4PRZA 4QARA 3AJEA 4K40A 1T0UA 3LT5A 3QBDA 4QGHA 4XUDA 1WXFA 4IDNA 4H1VA 4B4UA 5BMVB 2PZFA 3W2EA 3NZEA 3H2SA 1G8YA 3UB4A 3GN2A 2ST1A 2CHEA 2H7CA 1N3YA 3LTEA 4Z4IA 1ZL2A 3SDSA 1LJ8A 2O50A 2W6QA 1B6TA 4G1CA 4LVCA 3SIRA 1GV1A 4DV6B 1OBCA 2QM8A 1RRPA 2XODA 3CZQA 3I8SA 3GXBA 1G20A 4OCZA 1FTSA 3OLYA 2E9SA 3ZWBA 5KQGA 3LCVB 2CCJA 1FMTA 1SQFA 2D1QA 4KWCA 2EF0A 4I2NA 1UBUS 3KV3O 2H1SA 2GYWA 2BJWA 5G41A 2XUHA 1TLLA 4ZWNA 2VVTA 4MHSA 4PNZA 4DLAA 4BCCA 1R6TA 2IV2X 4EI7A 4EM6A 2E1RA 1CQZA 1AOXA 2P6UA 4F3RA 4BP1A 1MT0A 2J85A 1UC5B 3IDSA 5DXFA 2WNSA 4EX6A 3E03A 2Y6VA 4IRMA 3GIWA 4A8HA 2VF8A 3BH7A 5M7EA 2ZCJA 1E89A 2O2XA 3EBLA 4U7HA 1ZD1A 1DCMA 1QLJA 2FMIA 4EY7A 1P3JA 4ABTA 3NTVA 1NQOA 3VHRA 3WLAA 5HIKA 2O7NA 4X8LA 4A0FA 1UMDA 5U4XA 4HOYA 4R98A 1EUQA 5DM0A 3Q40A 4JU8A 3G02A 4GL4A 4OHRA 1P2GA 1II9A 2DSNA 5J2TF 1GZUA 1INLA 5DI3B 1DBPA 4CM7A 4ZO4A 1U8FO 4FCWA 2UUPA 4RHXA 1PNTA 4PGHA 3ZD6A 5JJKA 4P83A 3ZJVA 3SLGA 1DWPA 2OV2A 3JX9A 3PLAE 2IEZA 3PX3A 5IH3A 4DDMA 4N40A 1FYVA 3C41J 3O3MB 1UKYA 4LA4A 2C1EA 3DAFA 1B74A 1S9DA 4L28A 2RHRA 3NVKI 2QBYA 2IHYA 4JBNA 1HT3A 1F20A 1NN3A 4AG6A 3DSRA 4F91B 3LVBA 4JVOA 4LWZA 3L7IA 5JO0A 4ND1A 1S4MA 4JYZA 2VHQA 1FSSA 3HA3A 1IY1A 2PZEA 2MU1A 3NASA 4X60A 1UXHA 1NDUA 2R6JA 1YS7A 1KY4A 2FWMX 1KDTA 4M7WA 5K6AA 4MWSA 3FI0A 3FNIA 4BNXA 5CIWA 3R1IA 5EJ9A 4P6VF 4B6EA 3ZE2B 2F6RA 2B69A 4RVUA 3MEQA 1X87A 3KEFA 4MIYA 1P2UA 2GCPA 2KX7A 4HPXB 3TLKA 4ED9A 3MJ4A 3GRKA 3D7SA 1QM5A 1X2EA 2HB6A 5EINA 2D4HA 4G01B 3U5ZB 1RWNA 3IR6A 4DSUA 1P4GA 2QP3A 2YFYA 1RPTA 2O6HA 4IYJA 4QHSA 3TJZA 4ZGWA 3W8EA 1XL0A 1JQLB 2RHJA 1U7ZA 3RG8A 1Z5WA 3M1YA 3FWHA 1L0BA 4G1MB 3O8OA 1Z0AA 4P0PB 1IVNA 1MTOA 2WABA 2XYQA 1S2NA 4EB6A 4RPHA 1ZD9A 5L3VA 4C1BA 2I4LA 1A7KA 1EJ2A 4NBSA 3IP9A 3ZXUB 5CIYA 4UVGA 2O8FA 3VR5H 3DLAA 1KKLA 1BOFA 1HPLA 3K0BA 3SGLA 4O1HA 3ZI7A 1TC2A 2FH5B 2JBAA 2W0MA 4M60A 3I30X 4WNCA 5TMEA 2YBDA 3P9XA 4YK7A 3KEGA 3MA0A 4MKXA 4LE2A 4XEUA 2FZ5A 3L6RA 1GG8A 1ZW1A 1U0OC 3AZPA 2ZANA 3KPYA 4JHXA 4FHDA 1D6NA 1DO2A 1ENPA 1LPBB 4LNHA 5FBLB 5CAEA 4GPAA 2ZULA 5C51B 5F4BA 4REQB 1UKCA 1RJ9A 1ZJJA 4PZCA 4QQFA 3MWKA 2JVKA 1Y1LA 3E2IA 3IAHA 3AF4A 4EHBA 3PRKE 2I2XB 2WJ3A 3B7PA 4I5DA 5F78A 1W73A 2C7VA 2I80A 3M6MD 4CIVA 2RGEA 1QCYA 3EXHA 4YAKA 2D54A 3FYHA 2JLUA 2CWWA 4DMMA 2XBUA 2BJHA 1GD1O 2OXCA 3G2QA 3VHXB 5CR9A 4D3YA 3KC2A 2XGJA 3KELA 3KK0A 2FN7A 2M1ZA 3EG9B 4U02A 1QKIA 4V02A 5BV8A 2OQRA 3ES9A 1YRHA 2PSHA 5CFOA 5CXQA 4W5NA 1CRWG 3U7HB 3HRKA 4I3FA 3FWPA 2A94A 1NGSA 1OVMA 1Z7GA 2JIZA 3FVQA 5K3AA 2EJTA 1Z5VA 2N47A 3K0FB 4FZRA 1N5MA 4ITVA 3SC4A 2WM3A 3SOPA 4PCAA 4CFYA 3LBHA 2IZ5A 1NX6A 4QBTA 4BO6A 3O4IA 1YF3A 4B85A 2GO1A 1ZISA 4O2BF 1PW7A 4B75A 1E4EA 4RVNA 1D2GA 2Q3HA 1QORA 2SKDA 3F67A 1T9HA 3H5LA 1E77A 3P52A 1OY1A 4RY0A 2LTAA 4YN3A 5AM3A 1C14A 4HWSA 1W93A 3NWPA 2OV3A 2GK7A 5EZQA 3PFWO 4XYMA 1PNVA 2QL6A 1Y8RA 4UBIA 4BS9A 3OX1A 3DTTA 5F4ZA 3R5TA 5IYZA 3K72B 4RAOA 2VJKA 4UJ5A 3ZWPA 2PAFA 2VQSA 1WMBA 3PDHA 5SYNA 3MMZA 1E6WA 4OXQA 3ZDQA 3MVEA 2WZBA 4GX5A 3BL6A 4MS1A 1AHHA 1MEJA 2GGSA 1SCJA 1TM2A 4QOIA 3NHPA 1TJYA 4NMLA 2JAOA 3QF7A 1U5BB 5M29A 1F17A 5AR1A 5EJ6A 5GM1A 2OP1A 3WDMA 4WZBB 3ANXA 5ICFA 1XDBA 4TKLA 3BTSA 3KU1A 1PLKA 3AVPA 3ND8A 3RSOA 2REOA 1E3DA 3W5CA 1WXEA 1II0A 3DFKA 3ZIDA 5UKDA 3O74A 4XZ3A 4L78A 1P61B 1FXWA 3IT3A 4NE9A 4OQPA 3DKPA 3LXRA 2RGAA 1AHPA 1V9CA 2FX5A 2CFIA 5JCJA 3KE9A 3MMPA 3PD0A 4PLHA 4MVJH 3SC2B 4C4ZA 4V0KA 4LN1A 2F59A 4BLRA 5JWHA 4DIKA 4CM8B 4RD2A 4H6WA 2V59A 5DF1A 4LYJA 1XTKA 2MMGA 4MW1A 1NPDA 1ZOSA 4LYDA 3O3NB 4TLBA 3C0KA 3H9EO 5E9WA 3TR5A 4X1IB 5K45A 4DC9A 1IUNA 2EJUA 3D6JA 4OY3A 2W6MA 3C3KA 1YK1A 3QLVA 4OQDA 1S1MA 3U3RA 1OC2A 3ILYA 4WVFA 3ZE6A 1DPFA 2CXHA 2POCA 1SBQA 4ZD6A 2OFXA 3ST7A 1V5EA 2JGJA 4FT4A 5JVDF 4C78A 2KHZA 3IH5A 1THGA 1QRSA 2ID7A 4AU1A 4WJLA 5GGYA 3PEUA 4E0BA 1DIHA 2Q6LA 2ZIZA 5KWIA 3OU7A 1S6YA 2A9JA 1OBVA 2OBNA 2Z4TA 3DO5A 3BRCA 1R0KA 5K6RA 4V2UA 3N0XA 4LXYA 1B14A 4O1IA 4BTEA 2ID9A 4DT1A 3ZHTA 2FZ4A 3JQ8A 3EZ9A 4R8LA 4J43A 4XWYA 5BOSB 1TM4E 1V16A 3LOQA 1T5IA 2GWRA 1KY3A 1Q7RA 2VXOA 1WF3A 3CM0A 3OEEA 1AZWA 5JC1A 1L5LA 4DXDA 3UFBA 4WXRA 4F5DA 1BX3A 1DJQA 1KRWA 4D79A 1ZMBA 2RB4A 3E1SA 2JD0A 2VXBA 2Q99A 3M4ZA 3QA9A 3KUXA 2VWQA 4Y6QA 1A9PA 1TT7A 3OPMA 1JJBA 4BNMA 4ER6A 2Z6AA 1SB8A 3ZDXB 1GA6A 3HB9A 5BQPA 1ZFNA 3PI6A 1QO7A 3HP1A 3IELA 3CKLA 4U2GA 3RLFA 2H18A 3QYJA 2A35A 1YU6A 3ICEA 3A2LA 1HL3A 4NBUA 3A11A 4DVGA 1LK5A 2WYIA 2ZRDA 4JUFA 5FBWB 3R0IA 5IM5A 4I0WB 4IEIA 4TSRA 1J1ZA 5JALA 1NXWA 3DGEC 4Z49A 3GCGA 3L0SA 3A28A 3L6EA 1C0KA 2Z4SA 3JVDA 4G4GA 5F7XA 1ZKDA 3BCHA 3FYTA 5JXGA 2VAXA 3GRZA 2VNHA 1I13A 3QXHA 4C2BA 3HVRA 4OG2A 2JFWA 3QG5A 4OU5A 3GGCA 2JI7A 4Q93A 4RPJA 3HBNA 3PXAA 4ILEA 4AZ0B 1COZA 4GZLA 4LF5B 1ABEA 1WZ2A 4F60A 3K35A 3FNFA 4HAXA 1E9SA 4JK3A 3H16A 4LMPA 5K0SA 2LV8A 1FFSA 1YK0A 5LNK1 4TXHA 1GYQA 2G88A 4TMFA 1UPCA 1FJXA 1QCZA 4ARCA 4ZCQA 2O4CA 1NRWA 5JZVA 1FFYA 3AKZA 1CY4A 1FYFA 3CVUA 2PZJA 3FWKA 1SUWA 3JD3A 4JC0A 5CFLA 1OF1A 1RAEA 1ULAA 2XYPA 2DT5A 4OL0A 2IBMA 3ZWDA 2HA0A 2G9QA 3E9QA 3JSAA 2DCMA 2FA9A 2J9FA 5SY6A 4N6GA 4ADSG 1IJKA 3R6LA 2VAWA 1NV9A 3BXHA 5CDFA 3KOXA 4B4DA 1KVUA 4YTEA 7GPBA 1WETA 5AIBA 4XLLA 2QN2A 3DCNA 4HPJB 5JIBA 4LV6A 2H17A 2JIBA 2PFKA 1JNXX 2FPSA 1RCFA 2BEJA 2QTMA 2V7TA 3FDZB 3I04A 1FA9A 3LL7A 4JZYA 4NWIA 3UMJA 3V4PB 4F3CA 3RVPA 1NNUA 1JR6A 1Z4PX 3MJHA 2IEYA 4JROA 3OPYA 4KQ1A 1WCYA 4MGIR 1SQSA 1YMQA 1SOMA 3BD6A 3G0OA 1FP4A 2ESRA 2MT9A 4X1OA 2C7QA 3F2IA 4NCHA 4LTDA 1J20A 5AJVB 4M9QA 3H97A 4RA9A 2KWIA 4OHUA 2O2GA 3D7NA 3WGLA 4JITA 2B4QA 3EY4A 4UEJA 5AO9A 2OYRA 2Q3LA 5IYZF 4B9EA 3DL2A 4HH3C 1E2HA 1T9KA 1T6BY 4QDKA 3B3GA 4QATA 4CODB 4V0OA 4AYXA 1A97A 3JALB 4NH4A 1N2ZA 1K27A 4ZP1A 3WL7A 5I4BA 4EVSA 5KWEA 4DA4A 1IWOA 2LCIA 3KNZA 4UE3S 4GZ5A 3R7NA 4J7AA 4CMHA 3GZNB 5JOQA 1Z5NA 3R9XA 4NXNB 3AEXA 2AHRA 3SU8A 4WLEA 2NXEA 3C70A 2ZKLA 3PX2A 4DCGA 4YP1A 4W5WA 1C1DA 4D25A 4P08A 3ASZA 3C15C 1A98A 1OWLA 4YJ3B 2IZZA 2ATCA 4AMGA 2XKKA 3N75A 1FXWF 2FPIB 5K8LA 4TTIA 2FEXA 1E3MA 4K6FA 3MCZA 3UB2A 3O9MA 5GONB 4LDJA 4FFDA 1M8GA 4DLXA 3WDLA 2IS1A 3HVJA 1GZ3A 1K9VF 3W7AA 3BFVA 1YZTA 2GN0A 4AO7A 4LMRA 2XD9A 5KHOC 1NVBA 2X14A 4WZBE 1LDYA 5HBGA 3MB5A 3NBAA 2C3OA 5E6UB 3N07A 3B36A 1ZIXA 2YHIA 3OIGA 1YUNA 4M3NA 3VZRA 2DFPA 3AOEA 3QQPA 3TSAA 1NQ5A 4C05A 2LD4A 1GNLA 4ZGBA 2YV4A 4DBLC 1X7WA 1KBOA 2YYYA 5F9MA 2AI2A 3NBYC 5TNXA 4Z3OA 3FZGA 2JEYA 1OU0A 3NVAA 4Y9TA 1RLMA 1LTHR 3TL6A 4ER3A 1U2RA 1R6DA 2VRCD 2SICE 3ZZTA 3CR7A 5E0OA 3CX6A 5HUJA 2BM8A 4CUZA 1G18A 3AEKA 1DBIA 4D43A 4RTJA 4RTPA 4R3NA 1KDZA 3VPGA 1E92A 4KMMA 1C8KA 5CXUA 4BRSA 4CLRA 1X2BA 3BCRA 3ZU4A 3SLKA 2WZDA 1NURA 4C7BA 2GKGA 3NHYA 1QAQA 1AK2A 2EV9A 4HDSA 1EFRA 5EKUA 3UHJA 4Q47A 3MM4A 2HZ7A 4B9AA 4BDSA 4GR4A 2V9CA 3N3BC 1T3HA 1MJNA 1QYDA 2H65A 1KEWA 1QIMA 2OBLA 2WB4A 1QAMA 1EHCA 1IEXA 4R83A 1YKGA 1ZDMA 2QY6A 1R0RE 3D6VA 3E5HA 4LGCA 5H70A 2CLEB 1DBWA 4YDHB 2G77B 1FQWA 4DG9A 3REFA 2AE1A 4IX1A 2ET6A 4JB0A 2AQ8A 1R4MB 2AMJA 4MYUA 3REQA 4M1SA 1YSCA 4DSTA 1ZC3A 3SZGA 6ABPA 5EEGA 3QNUA 4CKBB 4GT1A 1P80A 2QLTA 5ALOA 2ZBUA 3IDQA 5DXJA 2HY7A 2VDWA 1UBGA 2RHWA 3BRQA 5ADHA 4PAOA 3KTFA 3UK0A 3IB6A 1HSOA 2FUG1 1JHYA 3Q7RA 4HLCA 3WLJA 2EJVA 2QLLA 5DOZA 2FN3A 3LC2O 4P93A 2PUHA 3WP1B 4KR2A 1CJSA 5I51A 3LUPA 3DLHA 3AEUA 1AC5A 3OHMA 5H4GA 5ITVA 3GMSA 1Q95A 1C3OB 4KUEA 4KL8S 4P5EA 3VZCA 3VZQA 3VC3A 2HH9A 2NWQA 2A9OA 1QCCA 2FZCA 1EHIA 2ID4A 3VPSA 1F4LA 3KKQA 1V3UA 5D8DA 1TCUA 2JFFA 1EH5A 3B3AA 2X8WA 3T06B 2QTBA 1F9AA 4PICA 4BQQA 4L4RA 4DV4B 4FWTA 4UDXX 4HNUA 2PBFA 1BHSA 2PKXA 4HFNA 2ZT6A 2PKQO 3HUTA 2YJ3A 4MPDA 3WADA 1VPEA 3BQ9A 4RPKA 4TQGA 1UXJA 5IJXA 3MF4A 1UODA 3FKSD 1DB3A 3PQ5A 3TUIC 3OOYA 4M8KA 3AUYA 3UUFA 4PPGA 1PGPA 3RPEA 1MUUA 4CM1A 1SCUB 4UU0A 2JW5A 3E8SA 1W8IA 2F8LA 2PMBA 3ICPA 4U2FA 3FN4A 2YTZA 1M34A 3COSA 4AK9A 4ERNA 4XVCA 5KTPA 1TYCA 4JN6B 1VSTA 3ZHVA 1KO8A 4FINA 4Q3EA 3V1TC 4C4PA 5KYNA 3MAAC 4I1PA 5I48A 2RH9B 2P0EA 2W2QA 4FGWA 4BFZA 3FPHA 4JJEA 1RTTA 3R23A 1Z7YA 4OBEA 3IBGA 2CNLA 4HDNA 2FWPA 3RHFA 3VFDA 2OHJA 3UT5B 4LFBB 4KO4S 1TKAA 1U0GA 3TQIA 3OTOB 2VG8A 2J3KA 4KWIA 3OWHA 3HXPA 1NR5A 4B0PA 2F9MA 2JAQA 5CLQA 3AUJB 1E5DA 1HYBA 2VCHA 4RYLA 1FFXA 3N6VA 3ND7A 4IF6A 2ECQA 2AC2A 2B7LA 2RG7A 4JB2A 3RSGA 1XHLA 3C5VA 1WY5A 1SG0A 5AMXA 4CEIA 3LO8A 4BBJA 2XITA 4EECA 1BU8A 3CF2A 3ZHSA 5JZBA 1G2IA 1UP7A 3RNLA 3PVSA 5IC5A 4G0OA 4B2LA 2O8BA 7REQA 3EF3A 3O95A 5DYYA 2JI6A 3DF9A 5M3BA 2O23A 3OF2A 2XY4A 5AI5A 1QV9A 1Y1KE 5AI0A 3SYMA 3BTOA 4A4DA 4EHLA 3WWCA 3L6UA 2P5YA 3E9ZA 1SBIA 2A3RA 3SDZA 1BEEA 3BZBA 4RMNA 1GPBA 3HA5A 1XZ8A 4I1IA 1QWOA 3A9WA 4HXFB 5LNK6 4EIWA 2WMYA 3RUIA 5B1DA 1OXTA 5B37A 2PRIA 1OYOA 1JLKA 2PNJA 5J2TB 2EKBA 2DU8A 5AHWA 3UNXA 3W6UA 1RWXA 3RIMA 3AUUA 3R8CA 1IWPB 2FW6A 5E6SB 4CQLA 1DBQA 4CQNA 1YE8A 1Z4MA 3V7UA 1E79D 3WQQA 1YUMA 4HYYA 3U4GA 1H42A 1M2VB 1CR0A 2V1XA 4IR7A 3WB0A 5HKBA 1I3KA 4OMDA 5CVVA 3WGYA 3OOJA 4PY2A 3PNOA 1OXVA 2VYVD 5ICGA 4NU5A 4IJVA 3UJNA 2HO5A 5COQA 3LLUA 3H5IA 5IVHA 1YCHA 5K0ZA 4YEDA 3P45A 1Z68A 3UXEA 4JL5A 3RASA 3BXOA 5JWRA 2NXCA 5SYAA 1ZNZA 5IVDA 2EX4A 2F3PA 1BTOA 5DGCA 1WDTA 5T6MA 5TVKA 3IQWA 2HTFA 2YWRA 3N05A 4AN4A 5A04A 3SQWA 1EK2A 2Z56A 5KDLA 1KU6A 4NTZA 3E9EA 2RHGB 2QM7A 4GGMX 4G8JA 4AO8A 2QRJA 2PZ8A 4LRXA 1TU3A 2CLLB 1L7RA 2Q6TA 1EVZA 3ANLA 2XUGA 2WE7A 2AR7A 4FBLA 5J43A 1MPXA 3R5XA 1SN7A 2BOVA 2QORA 5EJ5A 3LHSA 1OHHD 3VVMA 4NONA 2HYIC 1TAUA 3N0WA 3DWIA 3KKKA 2NVUA 2ZQ5A 3EARA 4Y1FA 1M2JA 2CZQA 2QU8A 1VG9B 2Z5FA 5KSZA 2GCOA 2C3PA 4YLEA 2QVBA 5G2OA 4LJ8A 3WK8A 1I4LD 2YV3A 3L5KA 5PGMA 1TTPB 2QVLA 3UJ8A 5BNIA 3VR4H 5FUMA 3AMVA 1IFXA 3G9XA 4HEJA 4LVOA 4UUPA 5L7YA 4QT4A 3X1KA 4X20B 2Y05A 4OLAA 2Q2NA 4P84A 4XOUA 3HZHA 4KRXA 3KJGA 4IGEA 1G16A 3OSUA 1SKQA 3I42A 4ALKA 4M21A 3U17A 4DADA 4L5IA 4ZDKA 4HAIA 2Y27A 4PTLA 5BMOA 4EYQA 1L8OA 1G60A 2JLQA 4ESOA 3G0IA 3DE6X 5EWJB 1CR6A 1Z8FA 2MHCA 1IHXA 2JARA 3BRWA 5KNBH 1KQNA 1S7CA 1D4FA 1LPAB 3NPMA 2YIDA 4JMPA 2XRFA 5B4VA 1KQGA 1DJLA 1H4QA 1ZJ4A 1V11A 1MRNA 4R8SA 1WQ4A 2QTGA 2FLVA 3GFTA 5HIAA 1ZSNA 5ELXA 3MT9A 1SRRA 4EHDA 1CUSA 2HWXA 3MGAA 4DLBA 5D01A 1A1SA 2DX7A 3EX7C 2FQWA 3Q0IA 3HXTA 5L51A 3FUTA 1DRJA 4X00A 1BYUA 1F2UA 2ECOA 2FF7A 2P7HA 2UYGA 3PGLA 4BWFB 5EHGA 5B1YA 2VJPA 4AIRA 3NM4A 1U0SY 5WRFA 4ROTA 1E61A 4HQNA 3VR6D 2HQSA 1RM4A 1HV8A 1I2DA 2OO7A 1NI3A 4GMGA 4BC0A 4TTJA 4EZBA 4JLJA 4QUIA 3W05A 2BFAA 1JALA 2JFZA 3FMFA 3H75A 4ATNA 1RZRD 5LKAA 4D3DA 3H4TA 1Z6ZA 3OLVA 4KQWA 4L4ZA 1PZEA 2ZJ2A 4HAVA 1T8SA 2VPYA 1KFKB 1M6NA 3NIWA 3CINA 2QMHA 4JLUA 3RWBA 1WMSA 5C0OE 5LWQA 5MN6A 1QXSA 2WIJA 1P9OA 5AK5A 1DX4A 3UAWA 2QTNA 1QOZA 2JAHA 3I2JA 1MC4A 4BFUA 5L4LA 3PIIA 4M7RA 4BNNA 4EG7A 2OQ2A 1K89A 4JIMA 2RGUA 4B8ZA 2ZE8A 1BQEA 1XZFA 1FL9A 4DA9A 3AKCA 5JFTA 2P4SA 5HQTA 2VQDA 3AR7A 2A5YB 4QDZA 2I91A 3MCWA 2DBVO 5EQTA 3DB2A 3KYDA 4P53A 3TG2A 1TU0A 1LPMA 5DX1A 1C50A 1RAFA 5EMMA 4FHEA 1LEHA 3GLTA 4FX5A 3EVTA 1UFOA 4D9IA 1EIWA 1PS9A 4MPJA 3W8FA 2FW8A 5BSFA 4FDVA 4LFCB 3GPCA 4FW8A 4E94A 1AXRA 4O2AA 4Y1EA 3OIVA 4FS8A 4G89A 4K0KB 4TZ0A 2GSWA 2I7VA 1A50B 1LBEA 3AHDA 4OSPA 4EKEA 1EX9A 1WG8A 1RS0A 5CW1A 1H2RS 3CZ9A 4Z9FA 3TUJC 4B71A 1YNSA 2PA3A 2FN4A 4Y67A 2SKCA 1XLUA 3WLLA 1KIAA 5J5AA 1K4KA 2FUG6 1U0EA 4HRYA 3V00A 2FJPA 3WGGA 1NTOA 4QZVA 5LLDA 7MHTA 1II8B 2DY0A 2O7QA 4GPBA 5KEIA 4KV7A 2RJNA 4HFJA 2ZAMA 3D3KA 4RSRA 4MRNA 2FMHA 2PZAA 2AJLI 3F8WA 2IYLD 3V33A 4HUTA 3KOWA 4JV5B 4MEBA 4MP8A 4FEEA 4RD0A 2FRDC 1JLSA 3IHKA 1HRDA 3P9KA 4YQFA 2AG1A 5AXCA 1UMDB 2B2CA 4RADA 3WISA 3KT6A 1MO4A 2IZ7A 4HHEA 3X0DA 3WV5A 5C7OO 5JRZA 1H4SA 3GFSA 3LRXA 3QU7A 2AC4A 3PFCA 3PC2A 4DKXA 4UM9B 5F9FA 5FB3A 1U1IA 1DQRA 3LQYA 1OI7A 3EIQA 5EXXA 3AF2A 2R1ZA 2BFEB 2OV6A 4OVKA 3V4OA 1RAHA 3LHKA 3ORRA 4Q1BA 1GTSA 1XR3A 3LP6A 3CUKA 4RPIA 5FHQA 1DJPA 2C2HA 4LQLA 2GK3A 3EZXA 5E4YA 3KALA 4A6EA 2ZU6A 2J3JA 3RS0A 4IXNA 3RRYA 2G1KA 2FWIA 2ZVJA 4IQ0A 4ALIA 3E7XA 4PHFA 5AOCA 4D46A 4R3WA 1G38A 1ESCA 3GRUA 5JVDB 4BGDA 5AVTA 4KOAA 2K6GA 2QK4A 1L4YA 3EVAA 2B1RA 1HFKA 3HJTA 4PPNA 1YONA 1KE2A 1XAGA 2XRYA 4KQXA 4O25A 2AFHE 4I8XA 4O4JA 3HA2A 4J8PA 4EAQA 1K6IA 2HCTA 5KDDA 2C7GA 1JG4A 3H5AA 1IY8A 1ONBA 3SXJA 4UDNA 1M1YA 2GTIA 3TIFA 3D8HA 3JD4A 2IS6A 1UP6A 5E95A 2R79A 4XJSA 4B6QA 4KSBA 5GJVC 1ZWKA 4XGRA 2Y1KA 1KRXA 4EW3A 2PRYA 1M0WA 1YKFA 2GBPA 2YOHA 1LQUA 4KR7A 1DTEA 3BSYA 4C0XA 2N9UA 4BB5A 3W5HA 1Z5UA 3C3CA 1VHDA 2DPMA 2VHJA 2IOYA 1OIWA 2OZVA 3ZVRA 1OA0A 2Q4EA 3O8OB 2HA4A 3DTVD 3BM5A 5FOXA 4JU9A 3RSQA 1Z2PX 1RXUA 4RPCA 4ARUA 2EFDB 1AZSC 1X86B 3TDKA 2BKVA 2PUFA 4XGKA 3G7UA 2NMVA 2WIDA 5F2OA 3OICA 4C6TA 3ONNA 3LX8A 3FLEA 1IN5A 1RIIA 4GNRA 4ZTBA 1MVLA 3A7EA 2J3DA 4WCFC 1WZCA 2IPAB 2AN4A 2XTNA 3D3WB 3OCYA 2VO1A 4O3FA 5DLYA