4E18A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
255
structure length
247
Chain Sequence
QMPVFHTRTIESILEPVAQQISHLVIMHEEGEGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 105
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A01
1U89A 3VF0A 2HSQA 1DOWA 4K1OA 5L0FA 1RKCA 1ST6A 3H2UA 4W8PA 2GWWA 2L7AA 1XWJA 1U6HA 5L0GA 1RKEA 4DJ9A 5L0IA 3RF3A 1DOVA 5L0JA 1L7CA 4ONSA 5L0DA 5L0HA 1RKEB 1ZVZA 2X0CA 4EHPA 1ZW3A 3H2VA 3ZDLA 1SYQA 4PR9A 1YDIA 4E18A 2GDCA 5FZTA 4E17A 2B0HA 4P9TA 5L0CA 1QKRA 1T01A 3T6GB 3S90A 1TR2A 1H6GA 3TJ6A 2LQGA 3TJ5A 1ZW2A 2IBFA 3MYIA 4IGGA
chains in the Genus database with same CATH superfamily
1Q0MA 2IYLD 1D0YA 2HSQA 1TWHA 3ITFA 3W8HA 4JC7A 3JSEO 4F4BA 5B1BC 3L8IA 3JRMO 2W4MA 4XLNF 3JRTA 3SXYA 1OCZC 5KYNA 4K7BA 3GEHA 3S29A 2WVQA 5EGYA 1VK5A 3C62A 1TFKB 5E2QA 2VCBA 1NFOA 2R03A 1YLMA 3W2WA 5DQTA 2IXOA 3MX3A 2DI3A 3JYHA 3FXHA 2HSBA 2L9JA 2J8WA 2WZGA 3EGDB 2Q4FA 3K6BA 1CPRA 2PP4A 2H7VC 3US6A 4AE4B 4PK4A 3LESA 2BC5A 5KYYA 1YA9A 4Q5SF 4RBNA 4YT5A 1GQAA 2OJED 2UUHA 4O6MA 1G8XA 4MTOA 1EQ1A 4G7ZF 2FAPB 3QW1A 3B0VC 1BR2A 3NYJA 1J8YF 4U5CE 3NKDA 1ST6A 2M64A 2QLAA 2YHSA 4IWBA 4XQ1A 4BJ6A 1ZYRF 2AP3A 3RW0A 3U9MA 2PX0A 4HE8D 3RVZA 4R32A 3ZQVA 1M2VB 2HZ8A 2ICWG 2LIGA 3ABLC 3LUTB 3LLIA 2OEXA 3U2MA 5L0HA 2XXAA 3RIPA 2R7XA 2I15A 2BE5F 2DYSC 4EHPA 1OW8A 3SZRA 4Z9HA 1G4US 3H2VA 2QY9A 2QNLA 2R05A 3KKBA 1I5NA 5BQGA 1Z3IX 1D1AA 2HMQA 1KTMA 4C3BA 1XZQA 1I4ZA 3GWLA 1MQVA 2YVKA 2L6GA 5L0CA 3FAPB 1H6GA 1VOMA 2Y3DA 2AWYA 2YKZA 2XRHA 5DQZA 2IOQA 3LAYA 3B71A 4YJWA 2FFHA 4O79A 1K40A 4OIRF 5COFA 4CJOA 2I8BA 3DE8A 2VH3A 5DS5A 4FWVA 2CCYA 1AVOB 2NPUA 2Y3GA 3KYIA 2LSEA 3NYLA 1LKXA 3O6XA 3TOMA 2F22A 3V5ZA 1OKKA 2XLHA 1GM5A 1L7CA 1ZHZA 2XS8A 4PFPA 3TK0A 2R7RA 3WG7C 2EIMC 3IQCA 1SMYF 3GORA 2OG2A 3OA1A 3M15A 1LVKA 4PJJA 2JX0A 4BEMJ 4DBRA 4LDQA 1MNDA 1ORYA 2YQYA 3EFOB 2XLVA 1SZIA 3RQEA 4FAPB 3KL4A 4JRZA 2WZLA 2AVKA 2ETSA 1SR2A 2HFIA 3W8IA 1QPUA 2EPLX 4CS9C 4E7ZA 2KQ9A 4XWJA 3T6BA 4E0IA 3AOUA 1TQGA 2LP4A 3NDBB 1U89A 3SXKA 3ZSUA 4AL0A 2XL8A 3JTLO 2NSGA 1Q0KA 1CGME 1RKCA 3R2PA 4C3DA 4XEFA 1ZU4A 2HMZA 4JVSA 2L7AA 3T9OA 3MLGA 3C8GD 2KSFA 3K7DA 3GODA 4NY3A 3AG1C 5L0DA 4IRUA 2CGEA 4MVQA 3N24A 3HNKA 3O10A 1RMVA 1JRAA 1AUEA 4DOZA 2Y3BA 4A4AA 1HW2A 1GGQA 4MS2A 4E7SA 2DYRC 4FESA 2J7PA 4L6RA 2KW3C 4YT8A 1Z63A 1HY5A 1YARO 4I44A 1T6QA 4ANJA 2VB6A 5JS5A 4OIPF 4LLCA 4ULVA 1T01A 3TOLA 4BJ5A 3HKKA 3FDQA 2LQGA 1J8MF 1RCPA 5A6JA 1E85A 1BDJB 1T5OA 3NMIA 2KC3A 4GEHA 2HKVA 1HMDA 1LE4A 4BJ6C 1NZEA 4P9FA 4YL3A 5KYWA 4JZAA 3V5XA 3IPMO 3LNRA 4WABA 2X51A 4GQHA 2NUTB 1NLXA 1RKEA 1HE9A 1OR2A 2YL7A 5TJ5E 3KH2A 4YT4A 4OIOF 5A6AA 4FX5A 1JPNA 3FAJA 4MVOA 3SXMA 3I4UA 3K66A 3L8JA 4ONSA 3I5QA 2PBEA 3C7JA 3DJUB 3EG9A 3GEIA 5BUOA 2OJQA 4HEAJ 3UGPA 1AEPA 2PNOA 5BQHA 3ZVRA 1M57C 2QUPA 2EPNA 1RXQA 4OINF 1IW7F 2HS5A 4C3EA 1SF8A 3EHNA 4U5HA 1F1MA 3IQ5A 4DRHB 1QKRA 2GA0A 2XL4A 3ZC4A 4A2NB 2OQMA 3DI5A 2YL3A 2KNHA 1N1CA 3ZTMA 5L3QA 4H4KC 1UFBA 1NBBA 2G3VA 5E3AA 2XS1A 3U9JA 1JOGA 4I3MA 1CGOA 3KMIA 4NTFA 3H65A 1OCRC 2LFDA 3BRJA 4Q7CA 2OCCC 4JJGA 5EK0A 3HNJA 1BR1A 2WB7A 4LDRA 5L3VA 4MNDA 3ZG1A 2P6VA 2MWQA 4IJJA 3X2QC 1CGNA 1Y6DA 3LEOA 1M6TA 1D1BA 1WN0A 3O39A 2L6FA 3LEVA 4LACB 1VTMP 3EH2A 4U9EA 1WWPA 4BJ1A 4ZLDA 4QI2A 3DWWA 4O6YA 1H9GA 1NFNA 3FVYA 1A41A 1I4YA 3FHDA 4MTGA 5FZTA 3UNGC 1NG1A 2LFFA 3B0UX 3QVYA 4P9TA 1Z23A 3S9OA 3ABKC 3EHMA 2W9YA 4N4WA 1ZW2A 2KJGA 1A7DA 1ZU5A 4J30B 4BPMA 4CS7A 5KYUB 1T6UA 4EIYA 2P0NA 2D5RB 3ECSA 2J9BA 1VYKA 5E33A 1OXBA 2OOCA 1D0ZA 1RJ9B 1OXKA 1Q0DA 4N6CA 1MMDA 5CIVA 3EQLF 2XLWA 1VMAA 2XLOA 3GWNA 3L0IA 5KYXA 2IXMA 3AG3C 4BEJA 4KBLA 1ZVZA 1EI7A 4KNWA 4Z9IA 1LS4A 3IEEA 3S28A 3VM6A 2J0XA 2J46A 3JYYA 4ER9A 3FOOA 5FCLA 4G7HF 3C8GB 1E2XA 3B9QA 2ZXPA 2HJMA 4I1MA 2XLDA 4YL0A 4BJ5C 1FMVA 1K05A 1VYIA 2R02A 3I5PA 1FTSA 3ABMC 3T6JA 3UMKA 3V7OA 1JMWA 4BG0A 4ZLCA 3AGUA 5JRAA 3Q7LA 1C17M 5EHHA 5COMA 5JVEA 4YN0B 1E83A 2Q9BA 3Q7GA 3IQ6A 3RH3A 4JCZA 4CIPA 1DOWA 3W4YA 2ZXWC 5F5FA 2NUPB 2V26A 1ZHTA 2E87A 1Q0FA 3CZ6A 5JSLA 4CS8C 3LS1A 2WZFA 2A0UA 1OKKD 3O55A 1U6HA 2YEVA 5AC4A 3S0XA 2YLIA 2FGYA 5IY5C 3WAQA 2R7QA 2R25A 4JURI 1ZHWA 3S27A 4BJTA 5A6BD 1HW1A 2EPOA 2EPKX 4AX2A 3WODF 1JR8A 3SNHA 3ZDLA 2J9VA 3NKEA 5E3CA 3VRCA 3A11A 4PJNA 3U8PA 3HJCA 2VASA 1O5HA 4NQFA 5COGA 3MFNA 1CPQA 3SYNA 2L81A 3T6GB 5F28E 1A0BA 2AWCA 2RD9A 3RKOF 1V4AA 3MYIA 2R7UA 3W2VA 2A0BA 2XLMA 5T1DB 1LM3B 1OCCC 1WOLA 4CIHA 3G4XA 1E84A 2XXAB 1OCOC 2Q9CA 2Y69C 2WVOA 4U5BE 1LIHA 2GFHA 3AQBA 1BBHA 4DBQA 1NU9C 3EGDA 4PJLA 2EIJC 3MBGA 3Q6MA 4D4XA 2D4UA 3N2ZB 1H7IA 1ZW3A 2J7PD 3L34A 1SYQA 3LS0A 4AE4A 1VB5A 4G78A 4KNVA 4XPXA 4O7GA 2V3CC 1MMNA 1PV3A 1FR0A 3CSKA 3AG4C 3KPHA 4JJFA 3K1IA 3S90A 4WJ0A 3G50A 1YYXA 4EBKA 3TJ5A 1V54C 1ZHXA 2WL8A 3EZHA 3E9VA 3U0CA 4IGGA 5KYYB 3VF0A 1NU7D 4GYTA 4YK5A 3LLKA 1TWGA 2XL6A 1O3UA 2VCCA 2XLEA 4K1OA 2LD6A 5F5HA 1JPJA 1YAUO 3N0TA 4DRJB 1KNYA 1M2VA 3HTKC 2ASRA 1M56C 2BL2A 2M4EA 4CS8A 4G7OF 2JPUA 2GAQA 3DM5A 3GEEA 1YZCA 2B0JA 4YL1A 1PCXA 4D4NA 1APCA 4PFOA 3M4BA 4RD9A 2X0CA 3SXZA 2CNWD 1QVXA 2Y39A 3DD7A 1YDIA 4LLEA 2NSFA 4XTKA 3RQFA 5K0IA 1OQCA 5D91A 3X1OA 1QZXA 3QVZA 4JE9A 2KGOA 4JTCB 1YA7O 2DB4A 5A6KA 2QTVA 3TQOA 2L6HA 1T9KA 5JP7A 4J32B 2P1AA 1U0BB 2ZPAA 2EINC 3C63A 4JEAA 4JTDB 4KI2A 2W4BA 4HFKB 4CBEA 4MVMA 4IB4A 3ATPA 4EUKB 1A7EA 4WGYA 3EPVA 256BA 4J7TA 4XPYA 3BEHA 3AQCA 3F46A 5GPGB 1H9TA 1V74B 1PD0A 1Z7Qc 3NYMA 1MNEA 4IAOA 3EJNA 4CDYA 1EKYA 1KU2A 1V55C 1ZHYA 3E70C 3TULA 2TMVP 2QE9A 3EFOA 2J0WA 4E18A 2Z15A 2A6HF 4C7OA 1G5ZA 2CYDA 5CI8A 5B3SC 5T3TA 1TWCA 3GANA 4I1OB 2H8AA 2RSEB 3OEOA 1VLSA 4MVSA 4H54A 4QDLA 1HE1A 1TWAA 2XSEA 2YLGA 3A9CA 4OD4A 5JLIA 2IBFA 4N6HA 3CEXA 4NTAA 4PJMA 4X0RA 4RDAA 3OWTA 2Q00A 2YZSA 1MMAA 5DS6A 5A69A 1XZPA 2HJ3A 3HNIA 1ORJA 4ULWA 2JD3A 3R7CA 4U5GA 1EA8A 1D0XA 1W2WA 2CW0F 2EIKC 2CDQA 2J9WA 2ZXRA 3KYJA 1Z6AA 1WATA 2J45A 3PCVA 1K04A 3Q6NA 3U3BA 1QQ3A 4U9DA 4EBJA 3DM9B 2P7VA 3LNMB 1YYJA 4CDVA 4IARA 3EZIA 2YWAA 5HSWA 1PD1A 2A6EF 2G3KA 2HV7A 1LI7A 3GM3A 3T4RA 3POVA 3TD7A 3EGXA 3K1IC 4JTAB 2PX3A 3DMDA 4MW8A 4EBBA 3J06A 4EWCA 4NCQA 3B29A 3AG2C 3GM1A 2O9XA 3HLZA 3NRHA 3NG1A 2W45A 4J7YA 1G4WR 2PFDA 2EPMX 1WTYA 3DKAA 4LDKA 3ZQYA 3AGTA 3MYFA 4JCHA 2IXNA 2LK4A 2NUTA 1O87A 1YZAA 3ZIBA 2AU5A 1M2OA 3H2UA 4U5DE 5KYWB 4QI0A 5L0GA 4DJ9A 4CJGA 3RF3A 4AL1A 3LJBA 4PACA 3B0PA 1BR4A 1MMGA 3DXJF 5L0JA 1WASA 1RKEB 1Y4CA 2YRFA 2ZXOA 2P61A 1FAPB 1UG7A 1LI5A 1S05A 1YJGA 4U5EE 2YL1A 5AGFA 2NG1A 5DLJA 4YWQA 4HFFB 3QW0A 2R7OA 1L3PA 2MYSA 3EG9B 2GDCA 3DJNB 3M79A 3ZTZA 2YL0A 2VCAA 2VC9A 2Q3TA 4MVUA 4XEKA 3WHNA 1OW7A 3RFYA 4CSAA 2H7BA 3QTHA 1TR2A 3TJ6A 5CI9A 5DS4A 2EILC 3IHUA 3M4CA 4B6IA 3NMKA 3NMJA 4KC9A 5JUAA 3PMRA 2H7OA 4OIQF 1LPEA 4P6IC 4OD5A 5L0FA 1E86A 2IXPA 3JSZA 1A7VA 1GS9A 3U3FA 1VLTA 1OW6A 4MW3A 3U2LA 3FOPA 3QZCA 4K0DA 2Q7RA 3SP1A 3G4ZA 2A69F 1DOVA 4LERA 4M63A 2Y3HA 1FMWA 1WGWA 3UMHA 5A6BA 3PDMP 4YT2A 4EKWA 4C7OB 3DE9A 2HV6A 2HUJA 4NC3A 3GM2A 1FFHA 4MVRA 2UUIA 5KYUA 3M1CB 1D1CA 4Q4ZF 3C18A 1IZMA 5JT4A 3K33A 4N06A 4DVYP 3AJMA 1R5ID 1TFOB 2C03A 2KK1A 1RJ9A 2OKUA 2KYHA 4MQ9F 2YLDA 2R7SA 3DAGA 3CQZA 3DAFA 1QSPA 1LS1A 2OU6A 2OEVA 1Q0GA 2R9RB 4JKVA 4MVZA 4W8PA 1XWJA 5B3IA 3UGOA 4XEVA 4WGZA 3SEOA 2XM4A 4JIOA 3C8GA 3QMKA 4AK9A 5T3WA 5KYXB 4G0HA 5B1AC 2LCHA 4DVZA 5AC5A 1TKNA 3S84A 2DGJA 1ORSC 1QLEC 3L1MA 3V5YA 2MHRA 2R7TA 4U5FE 4CX9A 3EGXB 4CDAA 1ZZPA 1NSGB 3FMSA 3CAXA 1T6IA 4JEBA 1BZ4A 3VAYA 1LE2A 3HNLA 2NUPA 1OR3A 1S7ZA 2IM8A 2PF4E 3RVYA 2ZD9A 3RYLA 2J9UA 3ASNC 3EH1A 3C8ZA 2WVNA 3DZAA 3UMIA 2G62A 2GWWA 4MTFA 4W8KA 4O6NA 3ZWIA 4NTBA 4DXWA 5L0IA 2XM0A 3JT1A 5BQIA 1HMOA 4DRIB 1FFTC 1Z5ZA 2A68F 4JW1A 4IAQA 4XPWA 3VYWA 1R4TA 1YVIA 5DVWA 4PR9A 4Z9JA 3F47A 3RQGA 1FNTc 2C04A 3U8VA 3UR3C 2R7WA 3PHF2 2CNWA 3K1HA 2A1DD 1B68A 3JZ0A 5HV9A 4CSAC 4E17A 1C02A 2Q9AA 2B0HA 3U5SA 4E0HA 3IQTA 3JCUQ 2R7VA 5D92A 4UDVA 4CS9A 3ASOC 1JAFA 4XLPF 1C03A
chains in the Genus database with same CATH topology
1U89A 3VF0A 2HSQA 1DOWA 4K1OA 5L0FA 1RKCA 1ST6A 3H2UA 4W8PA 2GWWA 2L7AA 1XWJA 1U6HA 5L0GA 1RKEA 4DJ9A 5L0IA 3RF3A 1DOVA 5L0JA 1L7CA 4ONSA 5L0DA 5L0HA 1RKEB 1ZVZA 2X0CA 4EHPA 1ZW3A 3H2VA 3ZDLA 1SYQA 4PR9A 1YDIA 4E18A 2GDCA 5FZTA 4E17A 2B0HA 4P9TA 5L0CA 1QKRA 1T01A 3T6GB 3S90A 1TR2A 1H6GA 3TJ6A 2LQGA 3TJ5A 1ZW2A 2IBFA 3MYIA 4IGGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U89 A;  3VF0 A;  2HSQ A;  1DOW A;  4K1O A;  5L0F A;  1RKC A;  1ST6 A;  3H2U A;  4W8P A;  2GWW A;  2L7A A;  1XWJ A;  1U6H A;  5L0G A;  1RKE A;  4DJ9 A;  5L0I A;  3RF3 A;  1DOV A;  5L0J A;  1L7C A;  4ONS A;  5L0D A;  5L0H A;  1RKE B;  1ZVZ A;  2X0C A;  4EHP A;  1ZW3 A;  3H2V A;  3ZDL A;  1SYQ A;  4PR9 A;  1YDI A;  4E18 A;  2GDC A;  5FZT A;  4E17 A;  2B0H A;  4P9T A;  5L0C A;  1QKR A;  1T01 A;  3T6G B;  3S90 A;  1TR2 A;  1H6G A;  3TJ6 A;  2LQG A;  3TJ5 A;  1ZW2 A;  2IBF A;  3MYI A;  4IGG A; 
#chains in the Genus database with same CATH topology
 1Q0M A;  2IYL D;  1D0Y A;  2HSQ A;  1TWH A;  3ITF A;  3W8H A;  4JC7 A;  3JSE O;  4F4B A;  5B1B C;  3L8I A;  3JRM O;  2W4M A;  4XLN F;  3JRT A;  3SXY A;  1OCZ C;  5KYN A;  4K7B A;  3GEH A;  3S29 A;  2WVQ A;  5EGY A;  1VK5 A;  3C62 A;  1TFK B;  5E2Q A;  2VCB A;  1NFO A;  2R03 A;  1YLM A;  3W2W A;  5DQT A;  2IXO A;  3MX3 A;  2DI3 A;  3JYH A;  3FXH A;  2HSB A;  2L9J A;  2J8W A;  2WZG A;  3EGD B;  2Q4F A;  3K6B A;  1CPR A;  2PP4 A;  2H7V C;  3US6 A;  4AE4 B;  4PK4 A;  3LES A;  2BC5 A;  5KYY A;  1YA9 A;  4Q5S F;  4RBN A;  4YT5 A;  1GQA A;  2OJE D;  2UUH A;  4O6M A;  1G8X A;  4MTO A;  1EQ1 A;  4G7Z F;  2FAP B;  3QW1 A;  3B0V C;  1BR2 A;  3NYJ A;  1J8Y F;  4U5C E;  3NKD A;  1ST6 A;  2M64 A;  2QLA A;  2YHS A;  4IWB A;  4XQ1 A;  4BJ6 A;  1ZYR F;  2AP3 A;  3RW0 A;  3U9M A;  2PX0 A;  4HE8 D;  3RVZ A;  4R32 A;  3ZQV A;  1M2V B;  2HZ8 A;  2ICW G;  2LIG A;  3ABL C;  3LUT B;  3LLI A;  2OEX A;  3U2M A;  5L0H A;  2XXA A;  3RIP A;  2R7X A;  2I15 A;  2BE5 F;  2DYS C;  4EHP A;  1OW8 A;  3SZR A;  4Z9H A;  1G4U S;  3H2V A;  2QY9 A;  2QNL A;  2R05 A;  3KKB A;  1I5N A;  5BQG A;  1Z3I X;  1D1A A;  2HMQ A;  1KTM A;  4C3B A;  1XZQ A;  1I4Z A;  3GWL A;  1MQV A;  2YVK A;  2L6G A;  5L0C A;  3FAP B;  1H6G A;  1VOM A;  2Y3D A;  2AWY A;  2YKZ A;  2XRH A;  5DQZ A;  2IOQ A;  3LAY A;  3B71 A;  4YJW A;  2FFH A;  4O79 A;  1K40 A;  4OIR F;  5COF A;  4CJO A;  2I8B A;  3DE8 A;  2VH3 A;  5DS5 A;  4FWV A;  2CCY A;  1AVO B;  2NPU A;  2Y3G A;  3KYI A;  2LSE A;  3NYL A;  1LKX A;  3O6X A;  3TOM A;  2F22 A;  3V5Z A;  1OKK A;  2XLH A;  1GM5 A;  1L7C A;  1ZHZ A;  2XS8 A;  4PFP A;  3TK0 A;  2R7R A;  3WG7 C;  2EIM C;  3IQC A;  1SMY F;  3GOR A;  2OG2 A;  3OA1 A;  3M15 A;  1LVK A;  4PJJ A;  2JX0 A;  4BEM J;  4DBR A;  4LDQ A;  1MND A;  1ORY A;  2YQY A;  3EFO B;  2XLV A;  1SZI A;  3RQE A;  4FAP B;  3KL4 A;  4JRZ A;  2WZL A;  2AVK A;  2ETS A;  1SR2 A;  2HFI A;  3W8I A;  1QPU A;  2EPL X;  4CS9 C;  4E7Z A;  2KQ9 A;  4XWJ A;  3T6B A;  4E0I A;  3AOU A;  1TQG A;  2LP4 A;  3NDB B;  1U89 A;  3SXK A;  3ZSU A;  4AL0 A;  2XL8 A;  3JTL O;  2NSG A;  1Q0K A;  1CGM E;  1RKC A;  3R2P A;  4C3D A;  4XEF A;  1ZU4 A;  2HMZ A;  4JVS A;  2L7A A;  3T9O A;  3MLG A;  3C8G D;  2KSF A;  3K7D A;  3GOD A;  4NY3 A;  3AG1 C;  5L0D A;  4IRU A;  2CGE A;  4MVQ A;  3N24 A;  3HNK A;  3O10 A;  1RMV A;  1JRA A;  1AUE A;  4DOZ A;  2Y3B A;  4A4A A;  1HW2 A;  1GGQ A;  4MS2 A;  4E7S A;  2DYR C;  4FES A;  2J7P A;  4L6R A;  2KW3 C;  4YT8 A;  1Z63 A;  1HY5 A;  1YAR O;  4I44 A;  1T6Q A;  4ANJ A;  2VB6 A;  5JS5 A;  4OIP F;  4LLC A;  4ULV A;  1T01 A;  3TOL A;  4BJ5 A;  3HKK A;  3FDQ A;  2LQG A;  1J8M F;  1RCP A;  5A6J A;  1E85 A;  1BDJ B;  1T5O A;  3NMI A;  2KC3 A;  4GEH A;  2HKV A;  1HMD A;  1LE4 A;  4BJ6 C;  1NZE A;  4P9F A;  4YL3 A;  5KYW A;  4JZA A;  3V5X A;  3IPM O;  3LNR A;  4WAB A;  2X51 A;  4GQH A;  2NUT B;  1NLX A;  1RKE A;  1HE9 A;  1OR2 A;  2YL7 A;  5TJ5 E;  3KH2 A;  4YT4 A;  4OIO F;  5A6A A;  4FX5 A;  1JPN A;  3FAJ A;  4MVO A;  3SXM A;  3I4U A;  3K66 A;  3L8J A;  4ONS A;  3I5Q A;  2PBE A;  3C7J A;  3DJU B;  3EG9 A;  3GEI A;  5BUO A;  2OJQ A;  4HEA J;  3UGP A;  1AEP A;  2PNO A;  5BQH A;  3ZVR A;  1M57 C;  2QUP A;  2EPN A;  1RXQ A;  4OIN F;  1IW7 F;  2HS5 A;  4C3E A;  1SF8 A;  3EHN A;  4U5H A;  1F1M A;  3IQ5 A;  4DRH B;  1QKR A;  2GA0 A;  2XL4 A;  3ZC4 A;  4A2N B;  2OQM A;  3DI5 A;  2YL3 A;  2KNH A;  1N1C A;  3ZTM A;  5L3Q A;  4H4K C;  1UFB A;  1NBB A;  2G3V A;  5E3A A;  2XS1 A;  3U9J A;  1JOG A;  4I3M A;  1CGO A;  3KMI A;  4NTF A;  3H65 A;  1OCR C;  2LFD A;  3BRJ A;  4Q7C A;  2OCC C;  4JJG A;  5EK0 A;  3HNJ A;  1BR1 A;  2WB7 A;  4LDR A;  5L3V A;  4MND A;  3ZG1 A;  2P6V A;  2MWQ A;  4IJJ A;  3X2Q C;  1CGN A;  1Y6D A;  3LEO A;  1M6T A;  1D1B A;  1WN0 A;  3O39 A;  2L6F A;  3LEV A;  4LAC B;  1VTM P;  3EH2 A;  4U9E A;  1WWP A;  4BJ1 A;  4ZLD A;  4QI2 A;  3DWW A;  4O6Y A;  1H9G A;  1NFN A;  3FVY A;  1A41 A;  1I4Y A;  3FHD A;  4MTG A;  5FZT A;  3UNG C;  1NG1 A;  2LFF A;  3B0U X;  3QVY A;  4P9T A;  1Z23 A;  3S9O A;  3ABK C;  3EHM A;  2W9Y A;  4N4W A;  1ZW2 A;  2KJG A;  1A7D A;  1ZU5 A;  4J30 B;  4BPM A;  4CS7 A;  5KYU B;  1T6U A;  4EIY A;  2P0N A;  2D5R B;  3ECS A;  2J9B A;  1VYK A;  5E33 A;  1OXB A;  2OOC A;  1D0Z A;  1RJ9 B;  1OXK A;  1Q0D A;  4N6C A;  1MMD A;  5CIV A;  3EQL F;  2XLW A;  1VMA A;  2XLO A;  3GWN A;  3L0I A;  5KYX A;  2IXM A;  3AG3 C;  4BEJ A;  4KBL A;  1ZVZ A;  1EI7 A;  4KNW A;  4Z9I A;  1LS4 A;  3IEE A;  3S28 A;  3VM6 A;  2J0X A;  2J46 A;  3JYY A;  4ER9 A;  3FOO A;  5FCL A;  4G7H F;  3C8G B;  1E2X A;  3B9Q A;  2ZXP A;  2HJM A;  4I1M A;  2XLD A;  4YL0 A;  4BJ5 C;  1FMV A;  1K05 A;  1VYI A;  2R02 A;  3I5P A;  1FTS A;  3ABM C;  3T6J A;  3UMK A;  3V7O A;  1JMW A;  4BG0 A;  4ZLC A;  3AGU A;  5JRA A;  3Q7L A;  1C17 M;  5EHH A;  5COM A;  5JVE A;  4YN0 B;  1E83 A;  2Q9B A;  3Q7G A;  3IQ6 A;  3RH3 A;  4JCZ A;  4CIP A;  1DOW A;  3W4Y A;  2ZXW C;  5F5F A;  2NUP B;  2V26 A;  1ZHT A;  2E87 A;  1Q0F A;  3CZ6 A;  5JSL A;  4CS8 C;  3LS1 A;  2WZF A;  2A0U A;  1OKK D;  3O55 A;  1U6H A;  2YEV A;  5AC4 A;  3S0X A;  2YLI A;  2FGY A;  5IY5 C;  3WAQ A;  2R7Q A;  2R25 A;  4JUR I;  1ZHW A;  3S27 A;  4BJT A;  5A6B D;  1HW1 A;  2EPO A;  2EPK X;  4AX2 A;  3WOD F;  1JR8 A;  3SNH A;  3ZDL A;  2J9V A;  3NKE A;  5E3C A;  3VRC A;  3A11 A;  4PJN A;  3U8P A;  3HJC A;  2VAS A;  1O5H A;  4NQF A;  5COG A;  3MFN A;  1CPQ A;  3SYN A;  2L81 A;  3T6G B;  5F28 E;  1A0B A;  2AWC A;  2RD9 A;  3RKO F;  1V4A A;  3MYI A;  2R7U A;  3W2V A;  2A0B A;  2XLM A;  5T1D B;  1LM3 B;  1OCC C;  1WOL A;  4CIH A;  3G4X A;  1E84 A;  2XXA B;  1OCO C;  2Q9C A;  2Y69 C;  2WVO A;  4U5B E;  1LIH A;  2GFH A;  3AQB A;  1BBH A;  4DBQ A;  1NU9 C;  3EGD A;  4PJL A;  2EIJ C;  3MBG A;  3Q6M A;  4D4X A;  2D4U A;  3N2Z B;  1H7I A;  1ZW3 A;  2J7P D;  3L34 A;  1SYQ A;  3LS0 A;  4AE4 A;  1VB5 A;  4G78 A;  4KNV A;  4XPX A;  4O7G A;  2V3C C;  1MMN A;  1PV3 A;  1FR0 A;  3CSK A;  3AG4 C;  3KPH A;  4JJF A;  3K1I A;  3S90 A;  4WJ0 A;  3G50 A;  1YYX A;  4EBK A;  3TJ5 A;  1V54 C;  1ZHX A;  2WL8 A;  3EZH A;  3E9V A;  3U0C A;  4IGG A;  5KYY B;  3VF0 A;  1NU7 D;  4GYT A;  4YK5 A;  3LLK A;  1TWG A;  2XL6 A;  1O3U A;  2VCC A;  2XLE A;  4K1O A;  2LD6 A;  5F5H A;  1JPJ A;  1YAU O;  3N0T A;  4DRJ B;  1KNY A;  1M2V A;  3HTK C;  2ASR A;  1M56 C;  2BL2 A;  2M4E A;  4CS8 A;  4G7O F;  2JPU A;  2GAQ A;  3DM5 A;  3GEE A;  1YZC A;  2B0J A;  4YL1 A;  1PCX A;  4D4N A;  1APC A;  4PFO A;  3M4B A;  4RD9 A;  2X0C A;  3SXZ A;  2CNW D;  1QVX A;  2Y39 A;  3DD7 A;  1YDI A;  4LLE A;  2NSF A;  4XTK A;  3RQF A;  5K0I A;  1OQC A;  5D91 A;  3X1O A;  1QZX A;  3QVZ A;  4JE9 A;  2KGO A;  4JTC B;  1YA7 O;  2DB4 A;  5A6K A;  2QTV A;  3TQO A;  2L6H A;  1T9K A;  5JP7 A;  4J32 B;  2P1A A;  1U0B B;  2ZPA A;  2EIN C;  3C63 A;  4JEA A;  4JTD B;  4KI2 A;  2W4B A;  4HFK B;  4CBE A;  4MVM A;  4IB4 A;  3ATP A;  4EUK B;  1A7E A;  4WGY A;  3EPV A;  256B A;  4J7T A;  4XPY A;  3BEH A;  3AQC A;  3F46 A;  5GPG B;  1H9T A;  1V74 B;  1PD0 A;  1Z7Q c;  3NYM A;  1MNE A;  4IAO A;  3EJN A;  4CDY A;  1EKY A;  1KU2 A;  1V55 C;  1ZHY A;  3E70 C;  3TUL A;  2TMV P;  2QE9 A;  3EFO A;  2J0W A;  4E18 A;  2Z15 A;  2A6H F;  4C7O A;  1G5Z A;  2CYD A;  5CI8 A;  5B3S C;  5T3T A;  1TWC A;  3GAN A;  4I1O B;  2H8A A;  2RSE B;  3OEO A;  1VLS A;  4MVS A;  4H54 A;  4QDL A;  1HE1 A;  1TWA A;  2XSE A;  2YLG A;  3A9C A;  4OD4 A;  5JLI A;  2IBF A;  4N6H A;  3CEX A;  4NTA A;  4PJM A;  4X0R A;  4RDA A;  3OWT A;  2Q00 A;  2YZS A;  1MMA A;  5DS6 A;  5A69 A;  1XZP A;  2HJ3 A;  3HNI A;  1ORJ A;  4ULW A;  2JD3 A;  3R7C A;  4U5G A;  1EA8 A;  1D0X A;  1W2W A;  2CW0 F;  2EIK C;  2CDQ A;  2J9W A;  2ZXR A;  3KYJ A;  1Z6A A;  1WAT A;  2J45 A;  3PCV A;  1K04 A;  3Q6N A;  3U3B A;  1QQ3 A;  4U9D A;  4EBJ A;  3DM9 B;  2P7V A;  3LNM B;  1YYJ A;  4CDV A;  4IAR A;  3EZI A;  2YWA A;  5HSW A;  1PD1 A;  2A6E F;  2G3K A;  2HV7 A;  1LI7 A;  3GM3 A;  3T4R A;  3POV A;  3TD7 A;  3EGX A;  3K1I C;  4JTA B;  2PX3 A;  3DMD A;  4MW8 A;  4EBB A;  3J06 A;  4EWC A;  4NCQ A;  3B29 A;  3AG2 C;  3GM1 A;  2O9X A;  3HLZ A;  3NRH A;  3NG1 A;  2W45 A;  4J7Y A;  1G4W R;  2PFD A;  2EPM X;  1WTY A;  3DKA A;  4LDK A;  3ZQY A;  3AGT A;  3MYF A;  4JCH A;  2IXN A;  2LK4 A;  2NUT A;  1O87 A;  1YZA A;  3ZIB A;  2AU5 A;  1M2O A;  3H2U A;  4U5D E;  5KYW B;  4QI0 A;  5L0G A;  4DJ9 A;  4CJG A;  3RF3 A;  4AL1 A;  3LJB A;  4PAC A;  3B0P A;  1BR4 A;  1MMG A;  3DXJ F;  5L0J A;  1WAS A;  1RKE B;  1Y4C A;  2YRF A;  2ZXO A;  2P61 A;  1FAP B;  1UG7 A;  1LI5 A;  1S05 A;  1YJG A;  4U5E E;  2YL1 A;  5AGF A;  2NG1 A;  5DLJ A;  4YWQ A;  4HFF B;  3QW0 A;  2R7O A;  1L3P A;  2MYS A;  3EG9 B;  2GDC A;  3DJN B;  3M79 A;  3ZTZ A;  2YL0 A;  2VCA A;  2VC9 A;  2Q3T A;  4MVU A;  4XEK A;  3WHN A;  1OW7 A;  3RFY A;  4CSA A;  2H7B A;  3QTH A;  1TR2 A;  3TJ6 A;  5CI9 A;  5DS4 A;  2EIL C;  3IHU A;  3M4C A;  4B6I A;  3NMK A;  3NMJ A;  4KC9 A;  5JUA A;  3PMR A;  2H7O A;  4OIQ F;  1LPE A;  4P6I C;  4OD5 A;  5L0F A;  1E86 A;  2IXP A;  3JSZ A;  1A7V A;  1GS9 A;  3U3F A;  1VLT A;  1OW6 A;  4MW3 A;  3U2L A;  3FOP A;  3QZC A;  4K0D A;  2Q7R A;  3SP1 A;  3G4Z A;  2A69 F;  1DOV A;  4LER A;  4M63 A;  2Y3H A;  1FMW A;  1WGW A;  3UMH A;  5A6B A;  3PDM P;  4YT2 A;  4EKW A;  4C7O B;  3DE9 A;  2HV6 A;  2HUJ A;  4NC3 A;  3GM2 A;  1FFH A;  4MVR A;  2UUI A;  5KYU A;  3M1C B;  1D1C A;  4Q4Z F;  3C18 A;  1IZM A;  5JT4 A;  3K33 A;  4N06 A;  4DVY P;  3AJM A;  1R5I D;  1TFO B;  2C03 A;  2KK1 A;  1RJ9 A;  2OKU A;  2KYH A;  4MQ9 F;  2YLD A;  2R7S A;  3DAG A;  3CQZ A;  3DAF A;  1QSP A;  1LS1 A;  2OU6 A;  2OEV A;  1Q0G A;  2R9R B;  4JKV A;  4MVZ A;  4W8P A;  1XWJ A;  5B3I A;  3UGO A;  4XEV A;  4WGZ A;  3SEO A;  2XM4 A;  4JIO A;  3C8G A;  3QMK A;  4AK9 A;  5T3W A;  5KYX B;  4G0H A;  5B1A C;  2LCH A;  4DVZ A;  5AC5 A;  1TKN A;  3S84 A;  2DGJ A;  1ORS C;  1QLE C;  3L1M A;  3V5Y A;  2MHR A;  2R7T A;  4U5F E;  4CX9 A;  3EGX B;  4CDA A;  1ZZP A;  1NSG B;  3FMS A;  3CAX A;  1T6I A;  4JEB A;  1BZ4 A;  3VAY A;  1LE2 A;  3HNL A;  2NUP A;  1OR3 A;  1S7Z A;  2IM8 A;  2PF4 E;  3RVY A;  2ZD9 A;  3RYL A;  2J9U A;  3ASN C;  3EH1 A;  3C8Z A;  2WVN A;  3DZA A;  3UMI A;  2G62 A;  2GWW A;  4MTF A;  4W8K A;  4O6N A;  3ZWI A;  4NTB A;  4DXW A;  5L0I A;  2XM0 A;  3JT1 A;  5BQI A;  1HMO A;  4DRI B;  1FFT C;  1Z5Z A;  2A68 F;  4JW1 A;  4IAQ A;  4XPW A;  3VYW A;  1R4T A;  1YVI A;  5DVW A;  4PR9 A;  4Z9J A;  3F47 A;  3RQG A;  1FNT c;  2C04 A;  3U8V A;  3UR3 C;  2R7W A;  3PHF 2;  2CNW A;  3K1H A;  2A1D D;  1B68 A;  3JZ0 A;  5HV9 A;  4CSA C;  4E17 A;  1C02 A;  2Q9A A;  2B0H A;  3U5S A;  4E0H A;  3IQT A;  3JCU Q;  2R7V A;  5D92 A;  4UDV A;  4CS9 A;  3ASO C;  1JAF A;  4XLP F;  1C03 A; 
#chains in the Genus database with same CATH homology
 1U89 A;  3VF0 A;  2HSQ A;  1DOW A;  4K1O A;  5L0F A;  1RKC A;  1ST6 A;  3H2U A;  4W8P A;  2GWW A;  2L7A A;  1XWJ A;  1U6H A;  5L0G A;  1RKE A;  4DJ9 A;  5L0I A;  3RF3 A;  1DOV A;  5L0J A;  1L7C A;  4ONS A;  5L0D A;  5L0H A;  1RKE B;  1ZVZ A;  2X0C A;  4EHP A;  1ZW3 A;  3H2V A;  3ZDL A;  1SYQ A;  4PR9 A;  1YDI A;  4E18 A;  2GDC A;  5FZT A;  4E17 A;  2B0H A;  4P9T A;  5L0C A;  1QKR A;  1T01 A;  3T6G B;  3S90 A;  1TR2 A;  1H6G A;  3TJ6 A;  2LQG A;  3TJ5 A;  1ZW2 A;  2IBF A;  3MYI A;  4IGG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...