4E18A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
255
structure length
247
Chain Sequence
QMPVFHTRTIESILEPVAQQISHLVIMHEEGEGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
molecule keywords Vinculin
total genus 105
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A01
1L7CA 1QKRA 2B0HA 3H2UA 1U6HA 1RKCA 1DOVA 2LQGA 3TJ5A 4P9TA 1U89A 3TJ6A 5L0FA 3MYIA 1RKEB 3H2VA 5FZTA 4DJ9A 4ONSA 1ZW2A 5L0IA 3T6GB 5L0HA 1T01A 5L0GA 2IBFA 4E18A 1RKEA 2L7AA 5L0JA 1ZVZA 1H6GA 1SYQA 2GWWA 3RF3A 4K1OA 4PR9A 3VF0A 4EHPA 1ST6A 5L0CA 5L0DA 3S90A 2GDCA 1XWJA 2HSQA 3ZDLA 1DOWA 1YDIA 4IGGA 1TR2A 4E17A 2X0CA 1ZW3A 4W8PA
chains in the Genus database with same CATH superfamily
4KNWA 2YVKA 1G8XA 5JP7A 4ZLDA 2HUJA 1OKKD 1QPUA 3JRTA 4JEAA 1MNEA 1D0XA 3DAFA 2R7SA 3ZWIA 2HV7A 1UG7A 4DRJB 3V5XA 3DMDA 3IQ6A 5DS4A 2JPUA 4WABA 2KYHA 3HNLA 1MMNA 4K0DA 3NKDA 3POVA 2FGYA 2OG2A 4ULVA 3ZVRA 3EG9B 4JCZA 4LDRA 3NRHA 2MHRA 2A0UA 4JRZA 4Z9IA 1BR2A 1SYQA 3F46A 4IRUA 3B29A 3K1IA 3N0TA 3QZCA 2GDCA 4MVQA 1LS4A 4F4BA 3DXJF 4OD5A 3V5YA 1MMAA 1LKXA 4JJGA 1OXKA 3RQEA 3SP1A 2J9VA 3FOOA 3LEVA 3TOMA 2IYLD 3K66A 4N4WA 3DAGA 3EH1A 4BJ6C 1BDJB 5JS5A 2VASA 1L7CA 3EHNA 1RMVA 2OCCC 3LNRA 1LE4A 3S9OA 3RVZA 4AL1A 1BBHA 1V74B 4JE9A 4YJWA 2Q9CA 1B68A 1ZU4A 1T6UA 2ZXRA 4LDKA 2KGOA 4Z9HA 1Z5ZA 2KSFA 4HFKB 2GA0A 3UMHA 5KYWB 4C7OA 4BJTA 2OEVA 3JTLO 4N6HA 2YL7A 3ASNC 3BRJA 3AG4C 2CGEA 2ZXPA 1VOMA 1ZHXA 2KNHA 3MBGA 4KBLA 5B1BC 3TOLA 1YVIA 2JX0A 4HEAJ 1ZHZA 4O6YA 2A1DD 1CGNA 3AGUA 3G50A 3ABKC 2D5RB 1D1CA 4HE8D 2NUTA 3U5SA 5B3SC 1YYJA 2CCYA 4IARA 3U8VA 3ASOC 1HMOA 4XPXA 4Q5SF 2HMQA 2XL4A 4EBJA 2P61A 5T3TA 3LUTB 1FNTc 2P6VA 2D4UA 2Y69C 2OKUA 4XPWA 4KI2A 1JAFA 4XTKA 1RKCA 3HTKC 3JCUQ 1YARO 3ZIBA 4MVSA 2R7UA 2ICWG 1SZIA 3E9VA 4Q4ZF 1BR4A 1QZXA 2G62A 4ONSA 4C3DA 3AG1C 4HFFB 5L0IA 4DVZA 1MNDA 3UGPA 4YT8A 1T01A 1T6IA 2G3KA 1RKEA 3EQLF 2L7AA 4IWBA 3MYFA 4ANJA 3TULA 3CEXA 5L0DA 1RJ9A 1OQCA 3LLKA 2IM8A 2H7VC 2DI3A 2HJMA 1YA7O 2R02A 2I15A 3JSZA 1MMDA 2YKZA 1JOGA 4PK4A 3B9QA 5A6AA 1M2VB 2WVOA 3PDMP 1D1BA 4EKWA 3R2PA 1E85A 3H65A 4JJFA 2ZPAA 3EJNA 1NFNA 4NTBA 2YEVA 2QLAA 3QVYA 4LACB 4P6IC 3OWTA 2R7QA 4G78A 2Y3DA 2WVNA 1C03A 3C8ZA 2YLIA 3L8JA 4E7ZA 4G0HA 3FAPB 3K7DA 4JVSA 4P9FA 4YK5A 1OR3A 3RH3A 1VYIA 3IQ5A 2XL6A 2YL0A 1CPQA 3DE8A 3F47A 4XEVA 2Y3BA 2LK4A 4ER9A 1FTSA 2LCHA 1TQGA 3MX3A 1V55C 4C7OB 1ORYA 4JZAA 3DZAA 1VK5A 1HMDA 5L0HA 1TWHA 1WGWA 4I3MA 5DLJA 3LAYA 1T9KA 5DQZA 2MWQA 2X51A 2GAQA 3B0PA 2ETSA 3LJBA 3RIPA 5JLIA 1A0BA 3EZHA 4E7SA 3CZ6A 4QDLA 1TR2A 2IXOA 2W45A 3C8GA 2FFHA 3C18A 2OEXA 3O55A 1HW1A 5CI9A 1S7ZA 1G5ZA 2R7OA 4PFOA 4G7ZF 2B0JA 1OR2A 3M4BA 4CS7A 4U9DA 1Z6AA 4PJLA 3NDBB 1BR1A 2L6GA 3V7OA 3SXYA 4YL0A 2EIMC 3W8HA 4CBEA 1KTMA 3FHDA 1OCCC 3H2VA 5CIVA 3UMIA 2VCCA 3ZQYA 3CSKA 4JEBA 1AEPA 3DKAA 4E0HA 2Q00A 4E18A 4CDAA 1M6TA 3JRMO 1C02A 4IJJA 1LPEA 2EIJC 2XLDA 1NU7D 4YT5A 3U9JA 4PR9A 3GEIA 4B6IA 4JC7A 3SXMA 4IAOA 1YYXA 2XM0A 2L9JA 4XPYA 2A0BA 4CIHA 1HE1A 2PX3A 4U9EA 2TMVP 3L34A 1O87A 4JKVA 2KQ9A 3A9CA 2A69F 4W8PA 1Z23A 3KMIA 4YL3A 3EZIA 3K1IC 1YZAA 1AUEA 3UGOA 5DS5A 1NFOA 1QKRA 5A6JA 1J8MF 4CSAC 3EGXA 1LI5A 3LNMB 4O6NA 2YQYA 3FOPA 5A6KA 4R32A 5L0FA 1Z63A 1TWGA 3Q6MA 5A6BD 2R05A 2J9BA 1R5ID 2CW0F 2H7OA 4N6CA 1M2OA 4NTFA 2R7RA 2YZSA 3O10A 2LD6A 1VB5A 3LS1A 5FCLA 1PCXA 1NSGB 2P7VA 2QUPA 3GODA 3KH2A 3NYJA 4ZLCA 5L0JA 3IEEA 3AQCA 1IW7F 1NU9C 2V26A 4K7BA 3V5ZA 4OD4A 3R7CA 1LVKA 2WZGA 3RKOF 4BEJA 2A6HF 5COMA 4W8KA 2R25A 3JSEO 2EIKC 4H4KC 3A11A 1OKKA 2FAPB 5KYUA 2BC5A 3AOUA 2HKVA 1IZMA 1K05A 4CJGA 3NMIA 4MVUA 3T4RA 5A6BA 5EHHA 5L3QA 1YA9A 2WL8A 1U6HA 1I5NA 3TQOA 2AU5A 1Y6DA 3EH2A 3MFNA 3NG1A 2YL1A 5KYXB 1F1MA 4YN0B 2PP4A 2YRFA 3KPHA 3MYIA 3US6A 2LSEA 4MVZA 3B0UX 2KW3C 2UUIA 3DD7A 4XQ1A 2CNWA 1TKNA 4I44A 1TFKB 4JURI 3U8PA 3W2WA 5KYYA 5KYYB 4LLCA 1VLTA 1LIHA 4RD9A 2IBFA 4AX2A 4X0RA 4CS8C 1JR8A 2LFDA 1H6GA 4EHPA 5AC5A 2OJED 2E87A 5D91A 4QI0A 2XL8A 4GYTA 5L0CA 5KYXA 2XXAA 4QI2A 1HW2A 2J0XA 3GWLA 1ZYRF 1APCA 1PV3A 1TWCA 1DOWA 4CS9C 2HMZA 4G7HF 1VTMP 3DE9A 3S0XA 1E2XA 3LESA 3OA1A 2VCAA 4JW1A 5F28E 4EUKB 3L8IA 3M15A 2QE9A 4CSAA 1NZEA 3FAJA 3ECSA 2WZFA 4J7YA 2Q4FA 3UR3C 2I8BA 2PF4E 4N06A 4U5EE 3FMSA 5T3WA 2WB7A 2RSEB 3LEOA 3JYYA 1YZCA 4DRIB 2IOQA 1O5HA 4XEFA 1E84A 1A7EA 2A68F 2ASRA 2Y3GA 4I1OB 4PJJA 2CNWD 3TD7A 1SMYF 4YT4A 3RF3A 5F5HA 2WVQA 5AC4A 1XZQA 1O3UA 3EGXB 1XWJA 1M57C 1SF8A 2XRHA 4U5DE 1OW6A 1OXBA 3X2QC 1RXQA 3W2VA 2NSGA 2XLMA 5E33A 5E3CA 3AG2C 4MNDA 3WG7C 1N1CA 4D4XA 1Z3IX 3S28A 4XEKA 3FVYA 2CDQA 5IY5C 3UMKA 3ABLC 1OCOC 4NY3A 1Q0DA 1WWPA 2W9YA 4D4NA 3EGDA 3PCVA 3SXZA 4MVOA 1I4YA 1VLSA 3VAYA 4NCQA 1U0BB 3QVZA 3WODF 2J7PA 4IB4A 1YAUO 3EGDB 3GM2A 3HNJA 4CIPA 4JTAB 1OCRC 2Z15A 1LS1A 1D1AA 1YJGA 2R03A 3IPMO 2XS1A 1ZVZA 3C63A 3I5QA 2HFIA 2O9XA 3G4XA 1Q0GA 4KC9A 1M56C 3I5PA 3RYLA 1YDIA 2A6EF 2HS5A 3C7JA 4IGGA 4C3EA 4WJ0A 4YWQA 1WOLA 1H7IA 2X0CA 1S05A 3GORA 2J45A 4JCHA 3VRCA 2XLHA 3IQCA 4J30B 2DYRC 4KNVA 1UFBA 3C8GD 4E0IA 4MTOA 5E2QA 4BJ5C 4J7TA 1A7VA 3NYLA 4OINF 1LM3B 1E86A 4M63A 3L1MA 1W2WA 4U5BE 3TJ5A 3TJ6A 1CGME 4FESA 2YLGA 5FZTA 5GPGB 1FAPB 3X1OA 1FMWA 3QTHA 2PNOA 4MW3A 2EILC 5L0GA 3S27A 4CX9A 2DYSC 2NUPA 4DBQA 3ZC4A 2V3CC 3RW0A 5BQIA 5BUOA 4MVMA 2KJGA 4O7GA 3M79A 1ZZPA 3K33A 5HV9A 3ATPA 2OOCA 2Q9BA 2R7WA 1VYKA 1C17M 3CQZA 3DWWA 3SXKA 2NSFA 4DVYP 3EFOA 4EIYA 5DS6A 4PFPA 2L81A 2B0HA 2DGJA 1T6QA 2MYSA 2ZXOA 3HJCA 1NLXA 3Q7GA 4FX5A 4Q7CA 1WATA 3NMJA 3O39A 3AJMA 1TWAA 1RJ9B 2W4MA 1GS9A 1OW7A 2BL2A 5B1AC 4AE4A 1ORJA 5KYNA 1U89A 1QLEC 1RKEB 3EHMA 4LLEA 256BA 4ULWA 2OQMA 3QW1A 4MTFA 3HKKA 4NC3A 2PFDA 3QW0A 5KYUB 4OIPF 1G4US 1JMWA 4FWVA 2KC3A 2NPUA 1I4ZA 2Y39A 3SNHA 4CS8A 3RQGA 2HSQA 2P0NA 1FFHA 3DI5A 3B0VC 4OIQF 5HSWA 2KK1A 3EFOB 1GGQA 4MTGA 4E17A 4BJ1A 1OCZC 3B71A 3KYIA 4RBNA 4AK9A 2J8WA 4JIOA 2VCBA 1J8YF 1GM5A 3UNGC 4BG0A 3U2LA 2H8AA 2F22A 1Q0FA 2J9WA 2NUPB 3KL4A 2BE5F 3RVYA 3TK0A 4DOZA 1JPJA 3T6JA 3C62A 3T6GB 2C04A 5BQGA 1R4TA 2AVKA 3Q6NA 3AQBA 2JD3A 1A41A 3DM9B 3JZ0A 3NKEA 4YT2A 3CAXA 4FAPB 1SR2A 2G3VA 2M4EA 1ZHYA 4K1OA 4MQ9F 3VF0A 2VH3A 2R7VA 5DQTA 3ZDLA 3ZQVA 3ZTMA 3RQFA 2YHSA 1CGOA 4I1MA 3GEEA 1WN0A 3U3BA 5COGA 4MW8A 4RDAA 1BZ4A 2XLWA 2EPLX 5D92A 1ZW3A 1MQVA 3HLZA 4EWCA 3K6BA 3GANA 3S29A 2EPNA 2IXMA 1AVOB 5JVEA 1V54C 2PBEA 5E3AA 3I4UA 2YWAA 4JTCB 1QSPA 4MS2A 3N24A 3OEOA 2RD9A 3EG9A 3G4ZA 3U9MA 4DJ9A 5A69A 4BEMJ 1PD1A 3ZG1A 2AP3A 3NYMA 4LDQA 5JRAA 3L0IA 3M1CB 1Z7Qc 3U3FA 1RCPA 2Q7RA 3VM6A 1V4AA 4OIRF 3C8GB 3IQTA 1NBBA 3WAQA 4EBKA 3DJUB 3JYHA 3N2ZB 3SYNA 4H54A 1FMVA 2LFFA 4PJNA 4MVRA 2AWCA 1A7DA 4O79A 4A4AA 1EQ1A 1KNYA 2Y3HA 2AWYA 3LS0A 1QQ3A 1LE2A 2J9UA 2W4BA 3GM1A 2YL3A 5EK0A 3S84A 1KU2A 4OIOF 4DRHB 2QY9A 3H2UA 1Y4CA 1K04A 2P1AA 4C3BA 1T5OA 1NG1A 2DB4A 2HSBA 2LQGA 1JPNA 5AGFA 1D0ZA 4P9TA 4DXWA 1H9TA 3EPVA 3HNKA 4XLPF 1GQAA 1ZU5A 4CDYA 1ZW2A 4CJOA 4YL1A 2GFHA 5F5FA 1EI7A 1MMGA 3RFYA 2R7XA 1VMAA 4JTDB 2HZ8A 2J7PD 2CYDA 4J32B 1WASA 2C03A 4U5GA 1Q0MA 2GWWA 5CI8A 4GQHA 1E83A 1M2VA 3U0CA 3DJNB 3PHF2 4DBRA 4NQFA 2ZD9A 1ZHTA 5COFA 1PD0A 3SZRA 4U5FE 3IHUA 4WGZA 2XLEA 3LLIA 3J06A 1HE9A 4U5CE 3JT1A 5JUAA 3KKBA 1CPRA 4A2NB 1LI7A 3DM5A 5EGYA 1Q0KA 2XS8A 4GEHA 3FDQA 1L3PA 4CDVA 2H7BA 4G7OF 1EA8A 1ORSC 3VYWA 1YLMA 2J46A 2XXAB 4AE4B 3KYJA 2R9RB 4AL0A 1HY5A 2EPOA 3FXHA 2EINC 4LERA 4PJMA 3BEHA 2L6FA 3Q7LA 3MLGA 2XLOA 5B3IA 2QTVA 1H9GA 5DVWA 4O6MA 1JRAA 2NG1A 2ZXWC 4BJ5A 2R7TA 3W8IA 2IXNA 1D0YA 3ZSUA 2NUTB 2XSEA 5L3VA 4Z9JA 3S90A 2J0WA 2EPKX 2LP4A 1WTYA 3M4CA 4U5HA 4UDVA 3SEOA 2XLVA 3AG3C 5T1DB 1FFTC 3QMKA 2L6HA 2WZLA 4PACA 3T9OA 3WHNA 3ZTZA 2Q3TA 1XZPA 3K1HA 2HV6A 4IAQA 1FR0A 3GWNA 2EPMX 5KYWA 3HNIA 5TJ5E 1TFOB 4BJ6A 2M64A 2VB6A 1DOVA 3E70C 4WGYA 3O6XA 5K0IA 2HJ3A 3AGTA 3T6BA 2IXPA 2VC9A 2QNLA 1QVXA 2XM4A 2Q9AA 2YLDA 3PMRA 1K40A 5JSLA 3GM3A 3ITFA 1ST6A 2LIGA 3NMKA 4NTAA 5BQHA 2UUHA 4EBBA 2PX0A 2OU6A 4L6RA 3GEHA 4XLNF 5JT4A 4CS9A 1OW8A 1ZHWA 2OJQA 4XWJA 1EKYA 3U2MA 1G4WR 3ABMC 4BPMA 3W4YA
chains in the Genus database with same CATH topology
1L7CA 1QKRA 2B0HA 3H2UA 1U6HA 1RKCA 1DOVA 2LQGA 3TJ5A 4P9TA 1U89A 3TJ6A 5L0FA 3MYIA 1RKEB 3H2VA 5FZTA 4DJ9A 4ONSA 1ZW2A 5L0IA 3T6GB 5L0HA 1T01A 5L0GA 2IBFA 4E18A 1RKEA 2L7AA 5L0JA 1ZVZA 1H6GA 1SYQA 2GWWA 3RF3A 4K1OA 4PR9A 3VF0A 4EHPA 1ST6A 5L0CA 5L0DA 3S90A 2GDCA 1XWJA 2HSQA 3ZDLA 1DOWA 1YDIA 4IGGA 1TR2A 4E17A 2X0CA 1ZW3A 4W8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L7C A;  1QKR A;  2B0H A;  3H2U A;  1U6H A;  1RKC A;  1DOV A;  2LQG A;  3TJ5 A;  4P9T A;  1U89 A;  3TJ6 A;  5L0F A;  3MYI A;  1RKE B;  3H2V A;  5FZT A;  4DJ9 A;  4ONS A;  1ZW2 A;  5L0I A;  3T6G B;  5L0H A;  1T01 A;  5L0G A;  2IBF A;  4E18 A;  1RKE A;  2L7A A;  5L0J A;  1ZVZ A;  1H6G A;  1SYQ A;  2GWW A;  3RF3 A;  4K1O A;  4PR9 A;  3VF0 A;  4EHP A;  1ST6 A;  5L0C A;  5L0D A;  3S90 A;  2GDC A;  1XWJ A;  2HSQ A;  3ZDL A;  1DOW A;  1YDI A;  4IGG A;  1TR2 A;  4E17 A;  2X0C A;  1ZW3 A;  4W8P A; 
#chains in the Genus database with same CATH topology
 4KNW A;  2YVK A;  1G8X A;  5JP7 A;  4ZLD A;  2HUJ A;  1OKK D;  1QPU A;  3JRT A;  4JEA A;  1MNE A;  1D0X A;  3DAF A;  2R7S A;  3ZWI A;  2HV7 A;  1UG7 A;  4DRJ B;  3V5X A;  3DMD A;  3IQ6 A;  5DS4 A;  2JPU A;  4WAB A;  2KYH A;  3HNL A;  1MMN A;  4K0D A;  3NKD A;  3POV A;  2FGY A;  2OG2 A;  4ULV A;  3ZVR A;  3EG9 B;  4JCZ A;  4LDR A;  3NRH A;  2MHR A;  2A0U A;  4JRZ A;  4Z9I A;  1BR2 A;  1SYQ A;  3F46 A;  4IRU A;  3B29 A;  3K1I A;  3N0T A;  3QZC A;  2GDC A;  4MVQ A;  1LS4 A;  4F4B A;  3DXJ F;  4OD5 A;  3V5Y A;  1MMA A;  1LKX A;  4JJG A;  1OXK A;  3RQE A;  3SP1 A;  2J9V A;  3FOO A;  3LEV A;  3TOM A;  2IYL D;  3K66 A;  4N4W A;  3DAG A;  3EH1 A;  4BJ6 C;  1BDJ B;  5JS5 A;  2VAS A;  1L7C A;  3EHN A;  1RMV A;  2OCC C;  3LNR A;  1LE4 A;  3S9O A;  3RVZ A;  4AL1 A;  1BBH A;  1V74 B;  4JE9 A;  4YJW A;  2Q9C A;  1B68 A;  1ZU4 A;  1T6U A;  2ZXR A;  4LDK A;  2KGO A;  4Z9H A;  1Z5Z A;  2KSF A;  4HFK B;  2GA0 A;  3UMH A;  5KYW B;  4C7O A;  4BJT A;  2OEV A;  3JTL O;  4N6H A;  2YL7 A;  3ASN C;  3BRJ A;  3AG4 C;  2CGE A;  2ZXP A;  1VOM A;  1ZHX A;  2KNH A;  3MBG A;  4KBL A;  5B1B C;  3TOL A;  1YVI A;  2JX0 A;  4HEA J;  1ZHZ A;  4O6Y A;  2A1D D;  1CGN A;  3AGU A;  3G50 A;  3ABK C;  2D5R B;  1D1C A;  4HE8 D;  2NUT A;  3U5S A;  5B3S C;  1YYJ A;  2CCY A;  4IAR A;  3U8V A;  3ASO C;  1HMO A;  4XPX A;  4Q5S F;  2HMQ A;  2XL4 A;  4EBJ A;  2P61 A;  5T3T A;  3LUT B;  1FNT c;  2P6V A;  2D4U A;  2Y69 C;  2OKU A;  4XPW A;  4KI2 A;  1JAF A;  4XTK A;  1RKC A;  3HTK C;  3JCU Q;  1YAR O;  3ZIB A;  4MVS A;  2R7U A;  2ICW G;  1SZI A;  3E9V A;  4Q4Z F;  1BR4 A;  1QZX A;  2G62 A;  4ONS A;  4C3D A;  3AG1 C;  4HFF B;  5L0I A;  4DVZ A;  1MND A;  3UGP A;  4YT8 A;  1T01 A;  1T6I A;  2G3K A;  1RKE A;  3EQL F;  2L7A A;  4IWB A;  3MYF A;  4ANJ A;  3TUL A;  3CEX A;  5L0D A;  1RJ9 A;  1OQC A;  3LLK A;  2IM8 A;  2H7V C;  2DI3 A;  2HJM A;  1YA7 O;  2R02 A;  2I15 A;  3JSZ A;  1MMD A;  2YKZ A;  1JOG A;  4PK4 A;  3B9Q A;  5A6A A;  1M2V B;  2WVO A;  3PDM P;  1D1B A;  4EKW A;  3R2P A;  1E85 A;  3H65 A;  4JJF A;  2ZPA A;  3EJN A;  1NFN A;  4NTB A;  2YEV A;  2QLA A;  3QVY A;  4LAC B;  4P6I C;  3OWT A;  2R7Q A;  4G78 A;  2Y3D A;  2WVN A;  1C03 A;  3C8Z A;  2YLI A;  3L8J A;  4E7Z A;  4G0H A;  3FAP B;  3K7D A;  4JVS A;  4P9F A;  4YK5 A;  1OR3 A;  3RH3 A;  1VYI A;  3IQ5 A;  2XL6 A;  2YL0 A;  1CPQ A;  3DE8 A;  3F47 A;  4XEV A;  2Y3B A;  2LK4 A;  4ER9 A;  1FTS A;  2LCH A;  1TQG A;  3MX3 A;  1V55 C;  4C7O B;  1ORY A;  4JZA A;  3DZA A;  1VK5 A;  1HMD A;  5L0H A;  1TWH A;  1WGW A;  4I3M A;  5DLJ A;  3LAY A;  1T9K A;  5DQZ A;  2MWQ A;  2X51 A;  2GAQ A;  3B0P A;  2ETS A;  3LJB A;  3RIP A;  5JLI A;  1A0B A;  3EZH A;  4E7S A;  3CZ6 A;  4QDL A;  1TR2 A;  2IXO A;  2W45 A;  3C8G A;  2FFH A;  3C18 A;  2OEX A;  3O55 A;  1HW1 A;  5CI9 A;  1S7Z A;  1G5Z A;  2R7O A;  4PFO A;  4G7Z F;  2B0J A;  1OR2 A;  3M4B A;  4CS7 A;  4U9D A;  1Z6A A;  4PJL A;  3NDB B;  1BR1 A;  2L6G A;  3V7O A;  3SXY A;  4YL0 A;  2EIM C;  3W8H A;  4CBE A;  1KTM A;  3FHD A;  1OCC C;  3H2V A;  5CIV A;  3UMI A;  2VCC A;  3ZQY A;  3CSK A;  4JEB A;  1AEP A;  3DKA A;  4E0H A;  2Q00 A;  4E18 A;  4CDA A;  1M6T A;  3JRM O;  1C02 A;  4IJJ A;  1LPE A;  2EIJ C;  2XLD A;  1NU7 D;  4YT5 A;  3U9J A;  4PR9 A;  3GEI A;  4B6I A;  4JC7 A;  3SXM A;  4IAO A;  1YYX A;  2XM0 A;  2L9J A;  4XPY A;  2A0B A;  4CIH A;  1HE1 A;  2PX3 A;  4U9E A;  2TMV P;  3L34 A;  1O87 A;  4JKV A;  2KQ9 A;  3A9C A;  2A69 F;  4W8P A;  1Z23 A;  3KMI A;  4YL3 A;  3EZI A;  3K1I C;  1YZA A;  1AUE A;  3UGO A;  5DS5 A;  1NFO A;  1QKR A;  5A6J A;  1J8M F;  4CSA C;  3EGX A;  1LI5 A;  3LNM B;  4O6N A;  2YQY A;  3FOP A;  5A6K A;  4R32 A;  5L0F A;  1Z63 A;  1TWG A;  3Q6M A;  5A6B D;  2R05 A;  2J9B A;  1R5I D;  2CW0 F;  2H7O A;  4N6C A;  1M2O A;  4NTF A;  2R7R A;  2YZS A;  3O10 A;  2LD6 A;  1VB5 A;  3LS1 A;  5FCL A;  1PCX A;  1NSG B;  2P7V A;  2QUP A;  3GOD A;  3KH2 A;  3NYJ A;  4ZLC A;  5L0J A;  3IEE A;  3AQC A;  1IW7 F;  1NU9 C;  2V26 A;  4K7B A;  3V5Z A;  4OD4 A;  3R7C A;  1LVK A;  2WZG A;  3RKO F;  4BEJ A;  2A6H F;  5COM A;  4W8K A;  2R25 A;  3JSE O;  2EIK C;  4H4K C;  3A11 A;  1OKK A;  2FAP B;  5KYU A;  2BC5 A;  3AOU A;  2HKV A;  1IZM A;  1K05 A;  4CJG A;  3NMI A;  4MVU A;  3T4R A;  5A6B A;  5EHH A;  5L3Q A;  1YA9 A;  2WL8 A;  1U6H A;  1I5N A;  3TQO A;  2AU5 A;  1Y6D A;  3EH2 A;  3MFN A;  3NG1 A;  2YL1 A;  5KYX B;  1F1M A;  4YN0 B;  2PP4 A;  2YRF A;  3KPH A;  3MYI A;  3US6 A;  2LSE A;  4MVZ A;  3B0U X;  2KW3 C;  2UUI A;  3DD7 A;  4XQ1 A;  2CNW A;  1TKN A;  4I44 A;  1TFK B;  4JUR I;  3U8P A;  3W2W A;  5KYY A;  5KYY B;  4LLC A;  1VLT A;  1LIH A;  4RD9 A;  2IBF A;  4AX2 A;  4X0R A;  4CS8 C;  1JR8 A;  2LFD A;  1H6G A;  4EHP A;  5AC5 A;  2OJE D;  2E87 A;  5D91 A;  4QI0 A;  2XL8 A;  4GYT A;  5L0C A;  5KYX A;  2XXA A;  4QI2 A;  1HW2 A;  2J0X A;  3GWL A;  1ZYR F;  1APC A;  1PV3 A;  1TWC A;  1DOW A;  4CS9 C;  2HMZ A;  4G7H F;  1VTM P;  3DE9 A;  3S0X A;  1E2X A;  3LES A;  3OA1 A;  2VCA A;  4JW1 A;  5F28 E;  4EUK B;  3L8I A;  3M15 A;  2QE9 A;  4CSA A;  1NZE A;  3FAJ A;  3ECS A;  2WZF A;  4J7Y A;  2Q4F A;  3UR3 C;  2I8B A;  2PF4 E;  4N06 A;  4U5E E;  3FMS A;  5T3W A;  2WB7 A;  2RSE B;  3LEO A;  3JYY A;  1YZC A;  4DRI B;  2IOQ A;  1O5H A;  4XEF A;  1E84 A;  1A7E A;  2A68 F;  2ASR A;  2Y3G A;  4I1O B;  4PJJ A;  2CNW D;  3TD7 A;  1SMY F;  4YT4 A;  3RF3 A;  5F5H A;  2WVQ A;  5AC4 A;  1XZQ A;  1O3U A;  3EGX B;  1XWJ A;  1M57 C;  1SF8 A;  2XRH A;  4U5D E;  1OW6 A;  1OXB A;  3X2Q C;  1RXQ A;  3W2V A;  2NSG A;  2XLM A;  5E33 A;  5E3C A;  3AG2 C;  4MND A;  3WG7 C;  1N1C A;  4D4X A;  1Z3I X;  3S28 A;  4XEK A;  3FVY A;  2CDQ A;  5IY5 C;  3UMK A;  3ABL C;  1OCO C;  4NY3 A;  1Q0D A;  1WWP A;  2W9Y A;  4D4N A;  3EGD A;  3PCV A;  3SXZ A;  4MVO A;  1I4Y A;  1VLS A;  3VAY A;  4NCQ A;  1U0B B;  3QVZ A;  3WOD F;  2J7P A;  4IB4 A;  1YAU O;  3EGD B;  3GM2 A;  3HNJ A;  4CIP A;  4JTA B;  1OCR C;  2Z15 A;  1LS1 A;  1D1A A;  1YJG A;  2R03 A;  3IPM O;  2XS1 A;  1ZVZ A;  3C63 A;  3I5Q A;  2HFI A;  2O9X A;  3G4X A;  1Q0G A;  4KC9 A;  1M56 C;  3I5P A;  3RYL A;  1YDI A;  2A6E F;  2HS5 A;  3C7J A;  4IGG A;  4C3E A;  4WJ0 A;  4YWQ A;  1WOL A;  1H7I A;  2X0C A;  1S05 A;  3GOR A;  2J45 A;  4JCH A;  3VRC A;  2XLH A;  3IQC A;  4J30 B;  2DYR C;  4KNV A;  1UFB A;  3C8G D;  4E0I A;  4MTO A;  5E2Q A;  4BJ5 C;  4J7T A;  1A7V A;  3NYL A;  4OIN F;  1LM3 B;  1E86 A;  4M63 A;  3L1M A;  1W2W A;  4U5B E;  3TJ5 A;  3TJ6 A;  1CGM E;  4FES A;  2YLG A;  5FZT A;  5GPG B;  1FAP B;  3X1O A;  1FMW A;  3QTH A;  2PNO A;  4MW3 A;  2EIL C;  5L0G A;  3S27 A;  4CX9 A;  2DYS C;  2NUP A;  4DBQ A;  3ZC4 A;  2V3C C;  3RW0 A;  5BQI A;  5BUO A;  4MVM A;  2KJG A;  4O7G A;  3M79 A;  1ZZP A;  3K33 A;  5HV9 A;  3ATP A;  2OOC A;  2Q9B A;  2R7W A;  1VYK A;  1C17 M;  3CQZ A;  3DWW A;  3SXK A;  2NSF A;  4DVY P;  3EFO A;  4EIY A;  5DS6 A;  4PFP A;  2L81 A;  2B0H A;  2DGJ A;  1T6Q A;  2MYS A;  2ZXO A;  3HJC A;  1NLX A;  3Q7G A;  4FX5 A;  4Q7C A;  1WAT A;  3NMJ A;  3O39 A;  3AJM A;  1TWA A;  1RJ9 B;  2W4M A;  1GS9 A;  1OW7 A;  2BL2 A;  5B1A C;  4AE4 A;  1ORJ A;  5KYN A;  1U89 A;  1QLE C;  1RKE B;  3EHM A;  4LLE A;  256B A;  4ULW A;  2OQM A;  3QW1 A;  4MTF A;  3HKK A;  4NC3 A;  2PFD A;  3QW0 A;  5KYU B;  4OIP F;  1G4U S;  1JMW A;  4FWV A;  2KC3 A;  2NPU A;  1I4Z A;  2Y39 A;  3SNH A;  4CS8 A;  3RQG A;  2HSQ A;  2P0N A;  1FFH A;  3DI5 A;  3B0V C;  4OIQ F;  5HSW A;  2KK1 A;  3EFO B;  1GGQ A;  4MTG A;  4E17 A;  4BJ1 A;  1OCZ C;  3B71 A;  3KYI A;  4RBN A;  4AK9 A;  2J8W A;  4JIO A;  2VCB A;  1J8Y F;  1GM5 A;  3UNG C;  4BG0 A;  3U2L A;  2H8A A;  2F22 A;  1Q0F A;  2J9W A;  2NUP B;  3KL4 A;  2BE5 F;  3RVY A;  3TK0 A;  4DOZ A;  1JPJ A;  3T6J A;  3C62 A;  3T6G B;  2C04 A;  5BQG A;  1R4T A;  2AVK A;  3Q6N A;  3AQB A;  2JD3 A;  1A41 A;  3DM9 B;  3JZ0 A;  3NKE A;  4YT2 A;  3CAX A;  4FAP B;  1SR2 A;  2G3V A;  2M4E A;  1ZHY A;  4K1O A;  4MQ9 F;  3VF0 A;  2VH3 A;  2R7V A;  5DQT A;  3ZDL A;  3ZQV A;  3ZTM A;  3RQF A;  2YHS A;  1CGO A;  4I1M A;  3GEE A;  1WN0 A;  3U3B A;  5COG A;  4MW8 A;  4RDA A;  1BZ4 A;  2XLW A;  2EPL X;  5D92 A;  1ZW3 A;  1MQV A;  3HLZ A;  4EWC A;  3K6B A;  3GAN A;  3S29 A;  2EPN A;  2IXM A;  1AVO B;  5JVE A;  1V54 C;  2PBE A;  5E3A A;  3I4U A;  2YWA A;  4JTC B;  1QSP A;  4MS2 A;  3N24 A;  3OEO A;  2RD9 A;  3EG9 A;  3G4Z A;  3U9M A;  4DJ9 A;  5A69 A;  4BEM J;  1PD1 A;  3ZG1 A;  2AP3 A;  3NYM A;  4LDQ A;  5JRA A;  3L0I A;  3M1C B;  1Z7Q c;  3U3F A;  1RCP A;  2Q7R A;  3VM6 A;  1V4A A;  4OIR F;  3C8G B;  3IQT A;  1NBB A;  3WAQ A;  4EBK A;  3DJU B;  3JYH A;  3N2Z B;  3SYN A;  4H54 A;  1FMV A;  2LFF A;  4PJN A;  4MVR A;  2AWC A;  1A7D A;  4O79 A;  4A4A A;  1EQ1 A;  1KNY A;  2Y3H A;  2AWY A;  3LS0 A;  1QQ3 A;  1LE2 A;  2J9U A;  2W4B A;  3GM1 A;  2YL3 A;  5EK0 A;  3S84 A;  1KU2 A;  4OIO F;  4DRH B;  2QY9 A;  3H2U A;  1Y4C A;  1K04 A;  2P1A A;  4C3B A;  1T5O A;  1NG1 A;  2DB4 A;  2HSB A;  2LQG A;  1JPN A;  5AGF A;  1D0Z A;  4P9T A;  4DXW A;  1H9T A;  3EPV A;  3HNK A;  4XLP F;  1GQA A;  1ZU5 A;  4CDY A;  1ZW2 A;  4CJO A;  4YL1 A;  2GFH A;  5F5F A;  1EI7 A;  1MMG A;  3RFY A;  2R7X A;  1VMA A;  4JTD B;  2HZ8 A;  2J7P D;  2CYD A;  4J32 B;  1WAS A;  2C03 A;  4U5G A;  1Q0M A;  2GWW A;  5CI8 A;  4GQH A;  1E83 A;  1M2V A;  3U0C A;  3DJN B;  3PHF 2;  4DBR A;  4NQF A;  2ZD9 A;  1ZHT A;  5COF A;  1PD0 A;  3SZR A;  4U5F E;  3IHU A;  4WGZ A;  2XLE A;  3LLI A;  3J06 A;  1HE9 A;  4U5C E;  3JT1 A;  5JUA A;  3KKB A;  1CPR A;  4A2N B;  1LI7 A;  3DM5 A;  5EGY A;  1Q0K A;  2XS8 A;  4GEH A;  3FDQ A;  1L3P A;  4CDV A;  2H7B A;  4G7O F;  1EA8 A;  1ORS C;  3VYW A;  1YLM A;  2J46 A;  2XXA B;  4AE4 B;  3KYJ A;  2R9R B;  4AL0 A;  1HY5 A;  2EPO A;  3FXH A;  2EIN C;  4LER A;  4PJM A;  3BEH A;  2L6F A;  3Q7L A;  3MLG A;  2XLO A;  5B3I A;  2QTV A;  1H9G A;  5DVW A;  4O6M A;  1JRA A;  2NG1 A;  2ZXW C;  4BJ5 A;  2R7T A;  3W8I A;  2IXN A;  1D0Y A;  3ZSU A;  2NUT B;  2XSE A;  5L3V A;  4Z9J A;  3S90 A;  2J0W A;  2EPK X;  2LP4 A;  1WTY A;  3M4C A;  4U5H A;  4UDV A;  3SEO A;  2XLV A;  3AG3 C;  5T1D B;  1FFT C;  3QMK A;  2L6H A;  2WZL A;  4PAC A;  3T9O A;  3WHN A;  3ZTZ A;  2Q3T A;  1XZP A;  3K1H A;  2HV6 A;  4IAQ A;  1FR0 A;  3GWN A;  2EPM X;  5KYW A;  3HNI A;  5TJ5 E;  1TFO B;  4BJ6 A;  2M64 A;  2VB6 A;  1DOV A;  3E70 C;  4WGY A;  3O6X A;  5K0I A;  2HJ3 A;  3AGT A;  3T6B A;  2IXP A;  2VC9 A;  2QNL A;  1QVX A;  2XM4 A;  2Q9A A;  2YLD A;  3PMR A;  1K40 A;  5JSL A;  3GM3 A;  3ITF A;  1ST6 A;  2LIG A;  3NMK A;  4NTA A;  5BQH A;  2UUH A;  4EBB A;  2PX0 A;  2OU6 A;  4L6R A;  3GEH A;  4XLN F;  5JT4 A;  4CS9 A;  1OW8 A;  1ZHW A;  2OJQ A;  4XWJ A;  1EKY A;  3U2M A;  1G4W R;  3ABM C;  4BPM A;  3W4Y A; 
#chains in the Genus database with same CATH homology
 1L7C A;  1QKR A;  2B0H A;  3H2U A;  1U6H A;  1RKC A;  1DOV A;  2LQG A;  3TJ5 A;  4P9T A;  1U89 A;  3TJ6 A;  5L0F A;  3MYI A;  1RKE B;  3H2V A;  5FZT A;  4DJ9 A;  4ONS A;  1ZW2 A;  5L0I A;  3T6G B;  5L0H A;  1T01 A;  5L0G A;  2IBF A;  4E18 A;  1RKE A;  2L7A A;  5L0J A;  1ZVZ A;  1H6G A;  1SYQ A;  2GWW A;  3RF3 A;  4K1O A;  4PR9 A;  3VF0 A;  4EHP A;  1ST6 A;  5L0C A;  5L0D A;  3S90 A;  2GDC A;  1XWJ A;  2HSQ A;  3ZDL A;  1DOW A;  1YDI A;  4IGG A;  1TR2 A;  4E17 A;  2X0C A;  1ZW3 A;  4W8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...