4E18A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
255
structure length
247
Chain Sequence
b'QMPVFHTRTIESILEPVAQQISHLVIMHEEGEGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNEEALKNRNFTVEKMSAEINEIIRVLQLTSWD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 105
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A01
3ZDLA 4P9TA 1DOWA 1XWJA 1H6GA 2X0CA 4EHPA 1U89A 2GWWA 4DJ9A 5L0CA 3T6GB 1TR2A 3S90A 5L0HA 1U6HA 1QKRA 3TJ6A 1ZVZA 3TJ5A 1YDIA 1T01A 5L0GA 4K1OA 4IGGA 5L0JA 4E18A 5FZTA 1RKEB 3H2VA 2GDCA 2IBFA 1ZW3A 5L0IA 1DOVA 1ZW2A 4PR9A 4W8PA 3MYIA 1RKEA 1SYQA 1ST6A 4E17A 2B0HA 2LQGA 3RF3A 3VF0A 5L0DA 1RKCA 1L7CA 2L7AA 4ONSA 5L0FA 2HSQA 3H2UA
chains in the Genus database with same CATH superfamily
1Y4CA 1JRAA 4CIHA 3X2QC 5B1BC 2LP4A 2YLIA 1T6UA 2J46A 4MVMA 3O55A 1TFKB 3KYIA 1TR2A 1ZYRF 2C04A 4BJTA 3U9MA 1JMWA 2Y3GA 2PFDA 3RYLA 1JAFA 2L6GA 4N6HA 2A1DD 3Q6MA 1PCXA 1JPJA 2FFHA 3LLIA 2AWCA 5L0GA 2IXPA 1PD1A 3ZTZA 4K1OA 2HV6A 2Q00A 4RDAA 3FOOA 3DZAA 3S9OA 2GDCA 3B0PA 4EBKA 2H8AA 4O6MA 1ZW3A 3L0IA 5TJ5E 2FGYA 4I1MA 1ZW2A 3GM2A 3CEXA 4I44A 4PR9A 4W8PA 1A0BA 2WVOA 3TULA 2MYSA 3ASNC 5KYUB 4H54A 4YN0B 4U5GA 5DVWA 1WN0A 4BG0A 1DOWA 3AGTA 3ZSUA 3NYLA 5KYXA 2XL4A 4GQHA 4PJNA 2EIJC 2HZ8A 2L6HA 3C62A 5K0IA 3ZC4A 4FX5A 1FMWA 3NRHA 1HW2A 4AL0A 3G4ZA 5A6BA 1GM5A 1OKKA 1MNEA 3CSKA 3TK0A 3VM6A 1TQGA 2A0UA 4G0HA 3HLZA 2ZXPA 3POVA 5JS5A 2OG2A 1S7ZA 4CSAC 3K6BA 1RMVA 1G5ZA 2EPLX 3IEEA 2BE5F 3HNLA 1NSGB 4E17A 1YAUO 3Q7GA 1IW7F 4U9EA 3Q6NA 3AJMA 3U0CA 2R7XA 5FCLA 4KNWA 3FHDA 3NDBB 1UFBA 1LE4A 1WOLA 1TWGA 4WGYA 3TOMA 1A7DA 1VLTA 2RD9A 2GWWA 3EH2A 3HNIA 4OINF 2X0CA 2XS8A 3RW0A 1OXBA 4BJ1A 4K7BA 1LI7A 4BJ6C 4YL1A 3U5SA 1H9TA 3JZ0A 3O10A 4BJ6A 1QLEC 3L8IA 2Y3BA 3DJUB 3L34A 4IRUA 2H7OA 3FXHA 5BUOA 1D0ZA 2YLGA 2WVNA 3N0TA 3N24A 2WZFA 5A6BD 1J8YF 1OKKD 3LS0A 2IBFA 2R7RA 1EA8A 1Q0DA 1PV3A 3ABLC 3SXKA 3G4XA 1YA9A 3C8ZA 4PJLA 2DYRC 5KYXB 1FAPB 1YARO 4LLCA 1E85A 5L0FA 2YL7A 2ZD9A 5T3WA 1BR1A 3GEEA 1C03A 5KYYA 4JEAA 3JSEO 3R2PA 3C63A 5EGYA 3C18A 3ASOC 3ZG1A 2XRHA 3KMIA 3EHMA 3V7OA 4DBRA 3VYWA 1CPRA 3OWTA 4CDYA 3UGPA 4G7OF 2Q3TA 1AVOB 3RQEA 3EH1A 2HMZA 1F1MA 3UMHA 1ZHZA 2P61A 2W45A 2NPUA 1R5ID 1OCRC 4AX2A 4DVYP 2Y39A 2ICWG 2NSGA 1GS9A 2R7TA 4IAOA 1LI5A 4OIRF 3PDMP 3NKEA 4RD9A 2M4EA 1JR8A 4Z9HA 1OW7A 1WGWA 4Z9IA 2NUTA 3S27A 3C8GD 2L81A 1OCOC 2AP3A 2CYDA 3S0XA 4ER9A 4FESA 1A7VA 1Q0KA 3I4UA 2XLDA 3H65A 5A69A 3GEIA 2LFFA 3DM9B 4U5CE 1KNYA 2M64A 1T9KA 4PACA 2P1AA 4H4KC 1ZHXA 2R05A 3V5XA 3B71A 4K0DA 4FWVA 1ZU5A 1ZVZA 3TOLA 1G4US 3L8JA 3C7JA 2YWAA 1VYIA 1Z5ZA 3C8GB 4HFFB 4OIOF 1VLSA 2XM4A 1BR2A 3GANA 5E3CA 3KH2A 4JTCB 4HE8D 3B9QA 1AEPA 2QNLA 4AE4A 4P6IC 1E2XA 3GM3A 2XLWA 2D4UA 4YL0A 3ZVRA 4D4XA 4PK4A 5F5FA 1LPEA 3MFNA 2KYHA 1MMGA 2LQGA 3FVYA 3LNMB 3I5PA 2KSFA 3NMKA 3NYMA 2LK4A 2W9YA 3NG1A 2KW3C 1T6IA 2UUIA 3LJBA 1Z63A 1I4YA 2NSFA 2ZXRA 3DE8A 3DXJF 3JSZA 4XTKA 4U5EE 1OW6A 2RSEB 4QI0A 1BZ4A 3UR3C 4LACB 1QPUA 4F4BA 4Q4ZF 2VCCA 2R9RB 3FMSA 2W4BA 3TJ5A 4A4AA 1YDIA 5CI9A 5COMA 3W4YA 3JTLO 5GPGB 4CX9A 4CIPA 3ZTMA 1VTMP 1NU7D 3LNRA 3M15A 2X51A 2YHSA 2YL0A 2C03A 3DE9A 3EGXA 4J30B 5EK0A 2NUTB 5COFA 3QW0A 1XZPA 1YYJA 2J45A 1TFOB 3IQTA 4LLEA 5DQTA 4WJ0A 4CS9A 2R7OA 5CI8A 2A6EF 2DGJA 3RF3A 2JX0A 3AG4C 3MX3A 4JJGA 4ULVA 4WABA 2L7AA 2ZXOA 3HJCA 4JE9A 4ONSA 3IPMO 5E33A 1ORYA 4MS2A 4IAQA 4J7TA 2PX0A 1A41A 3FAPB 3DKAA 1Q0MA 1NZEA 2J8WA 2TMVP 3U3FA 1EQ1A 5KYNA 1N1CA 2HS5A 4MVOA 3U3BA 2LD6A 4DXWA 1Z23A 3S90A 5A6AA 4MW3A 1TKNA 4LERA 4LDQA 2VASA 4E0HA 4UDVA 3QVZA 2XXAA 2LSEA 4X0RA 1Z3IX 4AE4B 5JLIA 4IJJA 5BQHA 2XLHA 1TWHA 1Z6AA 2WZLA 3GWLA 3S28A 2LCHA 3K7DA 3AG2C 4QDLA 1R4TA 2YL1A 3U8VA 3RVYA 2EPMX 3TD7A 1MQVA 3SXMA 1U0BB 4QI2A 2GA0A 2Q9AA 4XPXA 1QSPA 2Q4FA 1RKEA 3ZIBA 1ST6A 4XWJA 1C02A 3AOUA 5T3TA 1RJ9A 3GEHA 3F46A 4HEAJ 3W2WA 3J06A 1L7CA 1T6QA 2E87A 2HSQA 1D0YA 3QZCA 3WG7C 2FAPB 2XS1A 4PFPA 5DS5A 4U9DA 5L0CA 2CW0F 1LVKA 1M57C 2HV7A 2XLOA 4EBJA 3AG1C 4JCZA 2HJ3A 1OCZC 3RFYA 4AK9A 4KC9A 256BA 3JRTA 3EFOA 5HV9A 4G7ZF 2EINC 1M2VA 3EGXB 1D1AA 1YJGA 2YL3A 3EZIA 1PD0A 1T01A 2XLMA 4NTBA 3IQ6A 3SYNA 1CGNA 3K66A 5D92A 1AUEA 3LAYA 2QUPA 2A68F 4C3BA 2Y69C 4JTAB 3RQGA 3MBGA 2VB6A 4MVSA 2R7UA 2CDQA 3C8GA 2PNOA 5BQGA 2I8BA 4CBEA 3MYIA 1WWPA 3LUTB 3WODF 4MVUA 1ZHWA 2B0HA 5A6JA 3S84A 1ORSC 1K04A 5JUAA 3S29A 2EPKX 2H7BA 2PX3A 2R25A 2UUHA 4JEBA 4JURI 4P9TA 2VC9A 4YK5A 3UMIA 4BEMJ 3CAXA 5DS4A 5CIVA 1U89A 2XXAB 1I4ZA 2WL8A 4XLPF 5F28E 4YT5A 4JZAA 3W2VA 2DYSC 2LIGA 4I3MA 4MW8A 3AQBA 3EJNA 1L3PA 3B0VC 4E18A 1M2OA 3OA1A 1RKEB 1C17M 4RBNA 1H9GA 2XL6A 1RJ9B 2JPUA 4MVRA 1D0XA 3EQLF 4JC7A 3LESA 4U5BE 5DQZA 4EHPA 1ORJA 1SYQA 4A2NB 2KNHA 5E3AA 3DI5A 3A9CA 3NMIA 1D1CA 5JT4A 1EKYA 3RQFA 1MMAA 3L1MA 4ZLCA 1E86A 2YRFA 4OD5A 3JYHA 4CDVA 2G3KA 3EFOB 5JVEA 3V5ZA 1M2VB 1RXQA 2IXMA 4CS7A 2HJMA 4EUKB 2G62A 2IYLD 3T4RA 3AG3C 3ABMC 3V5YA 5COGA 2QY9A 2PP4A 1QZXA 4O79A 1I5NA 4DRJB 5EHHA 4GEHA 3SEOA 2CNWA 4N4WA 4ULWA 3RVZA 2EIKC 3IQCA 4MTOA 2R7VA 1V55C 3A11A 4EBBA 1RCPA 1J8MF 2J7PA 4CJGA 4CS8C 3E9VA 3U2LA 3SXZA 4E7ZA 3JRMO 1GQAA 3JT1A 1NFNA 3B0UX 2OEXA 4XLNF 2R7WA 1APCA 2EIMC 2OQMA 4YT4A 3FOPA 1CGOA 3K1IC 4E7SA 2HSBA 1NU9C 2ZPAA 1WATA 2P0NA 3K1IA 4CS8A 5HSWA 4NQFA 2YKZA 4I1OB 1Z7Qc 3TQOA 4JW1A 3CQZA 1V54C 4KNVA 1W2WA 2WZGA 2PF4E 2XL8A 4MQ9F 2AVKA 1FFTC 1LIHA 2J9UA 3EZHA 2P6VA 2B0JA 2O9XA 3B29A 1HW1A 2Q9BA 2VCAA 3QMKA 4JVSA 3VAYA 4MTFA 1H7IA 1LM3B 2OCCC 1Q0FA 4N06A 3DM5A 1NG1A 3KYJA 4OIQF 1VK5A 2NUPA 2CNWD 3ABKC 3EHNA 1HE1A 2A6HF 2W4MA 4JRZA 4NY3A 4Q5SF 4PFOA 1JOGA 1WTYA 4CS9C 1ZU4A 2L9JA 2OEVA 3CZ6A 2J7PD 2QLAA 4JJFA 1IZMA 2IM8A 3EGDA 3KKBA 2GFHA 3UMKA 3O6XA 2HFIA 2I15A 4MVZA 1M56C 2ETSA 4O7GA 4XQ1A 1OXKA 5E2QA 4J7YA 4C7OA 2H7VC 3U2MA 3GM1A 1FMVA 1HE9A 2MHRA 4G78A 3TJ6A 4C3DA 4YJWA 2ZXWC 4JCHA 2OJQA 4Q7CA 4B6IA 3EG9A 3HKKA 2QTVA 4NCQA 1V4AA 3DJNB 4PJMA 3ITFA 4YWQA 2XM0A 3VRCA 1MMNA 3ATPA 4JKVA 4BJ5C 2ASRA 1Q0GA 2WVQA 4FAPB 5A6KA 2V3CC 4BJ5A 2OU6A 5L0IA 1DOVA 4ZLDA 1Y6DA 3ECSA 3ZQYA 1QQ3A 4Z9JA 1A7EA 4U5FE 3O39A 2Y3HA 1FNTc 3DAGA 4M63A 2G3VA 5AGFA 4AL1A 1FR0A 2YZSA 2GAQA 3R7CA 2J0XA 4LDRA 4NC3A 1JPNA 2JD3A 1NLXA 1TWCA 3I5QA 4YL3A 3K1HA 3T6GB 3X1OA 5AC5A 1CGME 2XSEA 4E0IA 3PHF2 3HNKA 3F47A 2MWQA 2OOCA 1K05A 3QW1A 4HFKB 5B3SC 4IARA 2R02A 2NUPB 1SMYF 1FFHA 2IOQA 1LS1A 4P9FA 2HKVA 4XEVA 2HMQA 1BBHA 1G8XA 2DB4A 2DI3A 4O6YA 5FZTA 2A0BA 2NG1A 3NKDA 3E70C 5L3VA 4CSAA 1ZZPA 1OW8A 1EI7A 2KK1A 5F5HA 1NBBA 2R7QA 5AC4A 3EGDB 1MMDA 2CCYA 2CGEA 3SNHA 4R32A 3SZRA 2KJGA 4XEFA 1OCCC 1T5OA 4C3EA 4C7OB 1ZHTA 3T9OA 2LFDA 2OKUA 5L3QA 3G50A 4N6CA 1E84A 3MYFA 1S05A 2HUJA 1HY5A 2BC5A 2KGOA 4NTFA 3EG9B 3OEOA 1GGQA 5L0HA 4IWBA 2Q7RA 1QKRA 4MTGA 1OR3A 4PJJA 2IXOA 3DAFA 3T6BA 2L6FA 3RKOF 5DLJA 1MNDA 4EIYA 3U9JA 4DRHB 1B68A 3IHUA 2Q9CA 2AU5A 5L0JA 3AQCA 5KYWA 1YZAA 3NMJA 1O5HA 1VMAA 2V26A 4XPYA 2EPNA 3EPVA 3N2ZB 4JIOA 4G7HF 4JTDB 4MNDA 1XZQA 3HNJA 1WASA 3T6JA 2EILC 4YT2A 4DOZA 5B3IA 1RKCA 2J9WA 2YVKA 1LS4A 1O87A 1OQCA 2Z15A 4EKWA 1VOMA 5JP7A 2XLEA 3LS1A 3ZDLA 4J32B 2YEVA 5D91A 1D1BA 3BEHA 1LE2A 5JSLA 4YT8A 2PBEA 4NTAA 3Q7LA 1HMOA 1VB5A 4WGZA 3SP1A 3US6A 5DS6A 5IY5C 2R03A 1HMDA 1BDJB 3UGOA 4XPWA 4BEJA 1NFOA 1SR2A 2OJED 3DMDA 3LLKA 4OD4A 5JRAA 1E83A 2F22A 2J9VA 3LEVA 3BRJA 3PMRA 4GYTA 1KU2A 3FAJA 2A69F 3H2VA 3AGUA 2EPOA 3M4BA 4KBLA 3U8PA 2P7VA 1O3UA 3ZWIA 4DRIB 1K40A 1BR4A 3LEOA 4IB4A 4OIPF 4DVZA 5BQIA 3KL4A 4ANJA 2J9BA 3WHNA 3W8IA 3VF0A 4U5HA 2WB7A 1QVXA 3ZQVA 1OR2A 2YLDA 1YLMA 1YZCA 2AWYA 1VYKA 1M6TA 1UG7A 3DWWA 2YQYA 1SF8A 3H2UA 1XWJA 4LDKA 2IXNA 3M1CB 1H6GA 3K33A 3MLGA 3RH3A 4CJOA 3M79A 1CPQA 5KYUA 4CDAA 3GODA 3W8HA 4DJ9A 4DBQA 4BPMA 4W8KA 4KI2A 1YYXA 3QTHA 4EWCA 1KTMA 2Y3DA 1U6HA 2XLVA 5B1AC 3PCVA 2KQ9A 2D5RB 5KYWB 2J0WA 3QVYA 2R7SA 4L6RA 2VH3A 4XEKA 1TWAA 1ZHYA 3RIPA 3HTKC 3JCUQ 3KPHA 3M4CA 4IGGA 4O6NA 2BL2A 4D4NA 3IQ5A 3SXYA 1YVIA 2KC3A 3GORA 5T1DB 3UNGC 3JYYA 2VCBA 4MVQA 1FTSA 1SZIA 4U5DE 3FDQA 3WAQA 1V74B 3DD7A 1LKXA 5KYYB 5L0DA 1G4WR 3NYJA 2QE9A 3GWNA 1YA7O
chains in the Genus database with same CATH topology
3ZDLA 4P9TA 1DOWA 1XWJA 1H6GA 2X0CA 4EHPA 1U89A 2GWWA 4DJ9A 5L0CA 3T6GB 1TR2A 3S90A 5L0HA 1U6HA 1QKRA 3TJ6A 1ZVZA 3TJ5A 1YDIA 1T01A 5L0GA 4K1OA 4IGGA 5L0JA 4E18A 5FZTA 1RKEB 3H2VA 2GDCA 2IBFA 1ZW3A 5L0IA 1DOVA 1ZW2A 4PR9A 4W8PA 3MYIA 1RKEA 1SYQA 1ST6A 4E17A 2B0HA 2LQGA 3RF3A 3VF0A 5L0DA 1RKCA 1L7CA 2L7AA 4ONSA 5L0FA 2HSQA 3H2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDL A;  4P9T A;  1DOW A;  1XWJ A;  1H6G A;  2X0C A;  4EHP A;  1U89 A;  2GWW A;  4DJ9 A;  5L0C A;  3T6G B;  1TR2 A;  3S90 A;  5L0H A;  1U6H A;  1QKR A;  3TJ6 A;  1ZVZ A;  3TJ5 A;  1YDI A;  1T01 A;  5L0G A;  4K1O A;  4IGG A;  5L0J A;  4E18 A;  5FZT A;  1RKE B;  3H2V A;  2GDC A;  2IBF A;  1ZW3 A;  5L0I A;  1DOV A;  1ZW2 A;  4PR9 A;  4W8P A;  3MYI A;  1RKE A;  1SYQ A;  1ST6 A;  4E17 A;  2B0H A;  2LQG A;  3RF3 A;  3VF0 A;  5L0D A;  1RKC A;  1L7C A;  2L7A A;  4ONS A;  5L0F A;  2HSQ A;  3H2U A; 
#chains in the Genus database with same CATH topology
 1Y4C A;  1JRA A;  4CIH A;  3X2Q C;  5B1B C;  2LP4 A;  2YLI A;  1T6U A;  2J46 A;  4MVM A;  3O55 A;  1TFK B;  3KYI A;  1TR2 A;  1ZYR F;  2C04 A;  4BJT A;  3U9M A;  1JMW A;  2Y3G A;  2PFD A;  3RYL A;  1JAF A;  2L6G A;  4N6H A;  2A1D D;  3Q6M A;  1PCX A;  1JPJ A;  2FFH A;  3LLI A;  2AWC A;  5L0G A;  2IXP A;  1PD1 A;  3ZTZ A;  4K1O A;  2HV6 A;  2Q00 A;  4RDA A;  3FOO A;  3DZA A;  3S9O A;  2GDC A;  3B0P A;  4EBK A;  2H8A A;  4O6M A;  1ZW3 A;  3L0I A;  5TJ5 E;  2FGY A;  4I1M A;  1ZW2 A;  3GM2 A;  3CEX A;  4I44 A;  4PR9 A;  4W8P A;  1A0B A;  2WVO A;  3TUL A;  2MYS A;  3ASN C;  5KYU B;  4H54 A;  4YN0 B;  4U5G A;  5DVW A;  1WN0 A;  4BG0 A;  1DOW A;  3AGT A;  3ZSU A;  3NYL A;  5KYX A;  2XL4 A;  4GQH A;  4PJN A;  2EIJ C;  2HZ8 A;  2L6H A;  3C62 A;  5K0I A;  3ZC4 A;  4FX5 A;  1FMW A;  3NRH A;  1HW2 A;  4AL0 A;  3G4Z A;  5A6B A;  1GM5 A;  1OKK A;  1MNE A;  3CSK A;  3TK0 A;  3VM6 A;  1TQG A;  2A0U A;  4G0H A;  3HLZ A;  2ZXP A;  3POV A;  5JS5 A;  2OG2 A;  1S7Z A;  4CSA C;  3K6B A;  1RMV A;  1G5Z A;  2EPL X;  3IEE A;  2BE5 F;  3HNL A;  1NSG B;  4E17 A;  1YAU O;  3Q7G A;  1IW7 F;  4U9E A;  3Q6N A;  3AJM A;  3U0C A;  2R7X A;  5FCL A;  4KNW A;  3FHD A;  3NDB B;  1UFB A;  1LE4 A;  1WOL A;  1TWG A;  4WGY A;  3TOM A;  1A7D A;  1VLT A;  2RD9 A;  2GWW A;  3EH2 A;  3HNI A;  4OIN F;  2X0C A;  2XS8 A;  3RW0 A;  1OXB A;  4BJ1 A;  4K7B A;  1LI7 A;  4BJ6 C;  4YL1 A;  3U5S A;  1H9T A;  3JZ0 A;  3O10 A;  4BJ6 A;  1QLE C;  3L8I A;  2Y3B A;  3DJU B;  3L34 A;  4IRU A;  2H7O A;  3FXH A;  5BUO A;  1D0Z A;  2YLG A;  2WVN A;  3N0T A;  3N24 A;  2WZF A;  5A6B D;  1J8Y F;  1OKK D;  3LS0 A;  2IBF A;  2R7R A;  1EA8 A;  1Q0D A;  1PV3 A;  3ABL C;  3SXK A;  3G4X A;  1YA9 A;  3C8Z A;  4PJL A;  2DYR C;  5KYX B;  1FAP B;  1YAR O;  4LLC A;  1E85 A;  5L0F A;  2YL7 A;  2ZD9 A;  5T3W A;  1BR1 A;  3GEE A;  1C03 A;  5KYY A;  4JEA A;  3JSE O;  3R2P A;  3C63 A;  5EGY A;  3C18 A;  3ASO C;  3ZG1 A;  2XRH A;  3KMI A;  3EHM A;  3V7O A;  4DBR A;  3VYW A;  1CPR A;  3OWT A;  4CDY A;  3UGP A;  4G7O F;  2Q3T A;  1AVO B;  3RQE A;  3EH1 A;  2HMZ A;  1F1M A;  3UMH A;  1ZHZ A;  2P61 A;  2W45 A;  2NPU A;  1R5I D;  1OCR C;  4AX2 A;  4DVY P;  2Y39 A;  2ICW G;  2NSG A;  1GS9 A;  2R7T A;  4IAO A;  1LI5 A;  4OIR F;  3PDM P;  3NKE A;  4RD9 A;  2M4E A;  1JR8 A;  4Z9H A;  1OW7 A;  1WGW A;  4Z9I A;  2NUT A;  3S27 A;  3C8G D;  2L81 A;  1OCO C;  2AP3 A;  2CYD A;  3S0X A;  4ER9 A;  4FES A;  1A7V A;  1Q0K A;  3I4U A;  2XLD A;  3H65 A;  5A69 A;  3GEI A;  2LFF A;  3DM9 B;  4U5C E;  1KNY A;  2M64 A;  1T9K A;  4PAC A;  2P1A A;  4H4K C;  1ZHX A;  2R05 A;  3V5X A;  3B71 A;  4K0D A;  4FWV A;  1ZU5 A;  1ZVZ A;  3TOL A;  1G4U S;  3L8J A;  3C7J A;  2YWA A;  1VYI A;  1Z5Z A;  3C8G B;  4HFF B;  4OIO F;  1VLS A;  2XM4 A;  1BR2 A;  3GAN A;  5E3C A;  3KH2 A;  4JTC B;  4HE8 D;  3B9Q A;  1AEP A;  2QNL A;  4AE4 A;  4P6I C;  1E2X A;  3GM3 A;  2XLW A;  2D4U A;  4YL0 A;  3ZVR A;  4D4X A;  4PK4 A;  5F5F A;  1LPE A;  3MFN A;  2KYH A;  1MMG A;  2LQG A;  3FVY A;  3LNM B;  3I5P A;  2KSF A;  3NMK A;  3NYM A;  2LK4 A;  2W9Y A;  3NG1 A;  2KW3 C;  1T6I A;  2UUI A;  3LJB A;  1Z63 A;  1I4Y A;  2NSF A;  2ZXR A;  3DE8 A;  3DXJ F;  3JSZ A;  4XTK A;  4U5E E;  1OW6 A;  2RSE B;  4QI0 A;  1BZ4 A;  3UR3 C;  4LAC B;  1QPU A;  4F4B A;  4Q4Z F;  2VCC A;  2R9R B;  3FMS A;  2W4B A;  3TJ5 A;  4A4A A;  1YDI A;  5CI9 A;  5COM A;  3W4Y A;  3JTL O;  5GPG B;  4CX9 A;  4CIP A;  3ZTM A;  1VTM P;  1NU7 D;  3LNR A;  3M15 A;  2X51 A;  2YHS A;  2YL0 A;  2C03 A;  3DE9 A;  3EGX A;  4J30 B;  5EK0 A;  2NUT B;  5COF A;  3QW0 A;  1XZP A;  1YYJ A;  2J45 A;  1TFO B;  3IQT A;  4LLE A;  5DQT A;  4WJ0 A;  4CS9 A;  2R7O A;  5CI8 A;  2A6E F;  2DGJ A;  3RF3 A;  2JX0 A;  3AG4 C;  3MX3 A;  4JJG A;  4ULV A;  4WAB A;  2L7A A;  2ZXO A;  3HJC A;  4JE9 A;  4ONS A;  3IPM O;  5E33 A;  1ORY A;  4MS2 A;  4IAQ A;  4J7T A;  2PX0 A;  1A41 A;  3FAP B;  3DKA A;  1Q0M A;  1NZE A;  2J8W A;  2TMV P;  3U3F A;  1EQ1 A;  5KYN A;  1N1C A;  2HS5 A;  4MVO A;  3U3B A;  2LD6 A;  4DXW A;  1Z23 A;  3S90 A;  5A6A A;  4MW3 A;  1TKN A;  4LER A;  4LDQ A;  2VAS A;  4E0H A;  4UDV A;  3QVZ A;  2XXA A;  2LSE A;  4X0R A;  1Z3I X;  4AE4 B;  5JLI A;  4IJJ A;  5BQH A;  2XLH A;  1TWH A;  1Z6A A;  2WZL A;  3GWL A;  3S28 A;  2LCH A;  3K7D A;  3AG2 C;  4QDL A;  1R4T A;  2YL1 A;  3U8V A;  3RVY A;  2EPM X;  3TD7 A;  1MQV A;  3SXM A;  1U0B B;  4QI2 A;  2GA0 A;  2Q9A A;  4XPX A;  1QSP A;  2Q4F A;  1RKE A;  3ZIB A;  1ST6 A;  4XWJ A;  1C02 A;  3AOU A;  5T3T A;  1RJ9 A;  3GEH A;  3F46 A;  4HEA J;  3W2W A;  3J06 A;  1L7C A;  1T6Q A;  2E87 A;  2HSQ A;  1D0Y A;  3QZC A;  3WG7 C;  2FAP B;  2XS1 A;  4PFP A;  5DS5 A;  4U9D A;  5L0C A;  2CW0 F;  1LVK A;  1M57 C;  2HV7 A;  2XLO A;  4EBJ A;  3AG1 C;  4JCZ A;  2HJ3 A;  1OCZ C;  3RFY A;  4AK9 A;  4KC9 A;  256B A;  3JRT A;  3EFO A;  5HV9 A;  4G7Z F;  2EIN C;  1M2V A;  3EGX B;  1D1A A;  1YJG A;  2YL3 A;  3EZI A;  1PD0 A;  1T01 A;  2XLM A;  4NTB A;  3IQ6 A;  3SYN A;  1CGN A;  3K66 A;  5D92 A;  1AUE A;  3LAY A;  2QUP A;  2A68 F;  4C3B A;  2Y69 C;  4JTA B;  3RQG A;  3MBG A;  2VB6 A;  4MVS A;  2R7U A;  2CDQ A;  3C8G A;  2PNO A;  5BQG A;  2I8B A;  4CBE A;  3MYI A;  1WWP A;  3LUT B;  3WOD F;  4MVU A;  1ZHW A;  2B0H A;  5A6J A;  3S84 A;  1ORS C;  1K04 A;  5JUA A;  3S29 A;  2EPK X;  2H7B A;  2PX3 A;  2R25 A;  2UUH A;  4JEB A;  4JUR I;  4P9T A;  2VC9 A;  4YK5 A;  3UMI A;  4BEM J;  3CAX A;  5DS4 A;  5CIV A;  1U89 A;  2XXA B;  1I4Z A;  2WL8 A;  4XLP F;  5F28 E;  4YT5 A;  4JZA A;  3W2V A;  2DYS C;  2LIG A;  4I3M A;  4MW8 A;  3AQB A;  3EJN A;  1L3P A;  3B0V C;  4E18 A;  1M2O A;  3OA1 A;  1RKE B;  1C17 M;  4RBN A;  1H9G A;  2XL6 A;  1RJ9 B;  2JPU A;  4MVR A;  1D0X A;  3EQL F;  4JC7 A;  3LES A;  4U5B E;  5DQZ A;  4EHP A;  1ORJ A;  1SYQ A;  4A2N B;  2KNH A;  5E3A A;  3DI5 A;  3A9C A;  3NMI A;  1D1C A;  5JT4 A;  1EKY A;  3RQF A;  1MMA A;  3L1M A;  4ZLC A;  1E86 A;  2YRF A;  4OD5 A;  3JYH A;  4CDV A;  2G3K A;  3EFO B;  5JVE A;  3V5Z A;  1M2V B;  1RXQ A;  2IXM A;  4CS7 A;  2HJM A;  4EUK B;  2G62 A;  2IYL D;  3T4R A;  3AG3 C;  3ABM C;  3V5Y A;  5COG A;  2QY9 A;  2PP4 A;  1QZX A;  4O79 A;  1I5N A;  4DRJ B;  5EHH A;  4GEH A;  3SEO A;  2CNW A;  4N4W A;  4ULW A;  3RVZ A;  2EIK C;  3IQC A;  4MTO A;  2R7V A;  1V55 C;  3A11 A;  4EBB A;  1RCP A;  1J8M F;  2J7P A;  4CJG A;  4CS8 C;  3E9V A;  3U2L A;  3SXZ A;  4E7Z A;  3JRM O;  1GQA A;  3JT1 A;  1NFN A;  3B0U X;  2OEX A;  4XLN F;  2R7W A;  1APC A;  2EIM C;  2OQM A;  4YT4 A;  3FOP A;  1CGO A;  3K1I C;  4E7S A;  2HSB A;  1NU9 C;  2ZPA A;  1WAT A;  2P0N A;  3K1I A;  4CS8 A;  5HSW A;  4NQF A;  2YKZ A;  4I1O B;  1Z7Q c;  3TQO A;  4JW1 A;  3CQZ A;  1V54 C;  4KNV A;  1W2W A;  2WZG A;  2PF4 E;  2XL8 A;  4MQ9 F;  2AVK A;  1FFT C;  1LIH A;  2J9U A;  3EZH A;  2P6V A;  2B0J A;  2O9X A;  3B29 A;  1HW1 A;  2Q9B A;  2VCA A;  3QMK A;  4JVS A;  3VAY A;  4MTF A;  1H7I A;  1LM3 B;  2OCC C;  1Q0F A;  4N06 A;  3DM5 A;  1NG1 A;  3KYJ A;  4OIQ F;  1VK5 A;  2NUP A;  2CNW D;  3ABK C;  3EHN A;  1HE1 A;  2A6H F;  2W4M A;  4JRZ A;  4NY3 A;  4Q5S F;  4PFO A;  1JOG A;  1WTY A;  4CS9 C;  1ZU4 A;  2L9J A;  2OEV A;  3CZ6 A;  2J7P D;  2QLA A;  4JJF A;  1IZM A;  2IM8 A;  3EGD A;  3KKB A;  2GFH A;  3UMK A;  3O6X A;  2HFI A;  2I15 A;  4MVZ A;  1M56 C;  2ETS A;  4O7G A;  4XQ1 A;  1OXK A;  5E2Q A;  4J7Y A;  4C7O A;  2H7V C;  3U2M A;  3GM1 A;  1FMV A;  1HE9 A;  2MHR A;  4G78 A;  3TJ6 A;  4C3D A;  4YJW A;  2ZXW C;  4JCH A;  2OJQ A;  4Q7C A;  4B6I A;  3EG9 A;  3HKK A;  2QTV A;  4NCQ A;  1V4A A;  3DJN B;  4PJM A;  3ITF A;  4YWQ A;  2XM0 A;  3VRC A;  1MMN A;  3ATP A;  4JKV A;  4BJ5 C;  2ASR A;  1Q0G A;  2WVQ A;  4FAP B;  5A6K A;  2V3C C;  4BJ5 A;  2OU6 A;  5L0I A;  1DOV A;  4ZLD A;  1Y6D A;  3ECS A;  3ZQY A;  1QQ3 A;  4Z9J A;  1A7E A;  4U5F E;  3O39 A;  2Y3H A;  1FNT c;  3DAG A;  4M63 A;  2G3V A;  5AGF A;  4AL1 A;  1FR0 A;  2YZS A;  2GAQ A;  3R7C A;  2J0X A;  4LDR A;  4NC3 A;  1JPN A;  2JD3 A;  1NLX A;  1TWC A;  3I5Q A;  4YL3 A;  3K1H A;  3T6G B;  3X1O A;  5AC5 A;  1CGM E;  2XSE A;  4E0I A;  3PHF 2;  3HNK A;  3F47 A;  2MWQ A;  2OOC A;  1K05 A;  3QW1 A;  4HFK B;  5B3S C;  4IAR A;  2R02 A;  2NUP B;  1SMY F;  1FFH A;  2IOQ A;  1LS1 A;  4P9F A;  2HKV A;  4XEV A;  2HMQ A;  1BBH A;  1G8X A;  2DB4 A;  2DI3 A;  4O6Y A;  5FZT A;  2A0B A;  2NG1 A;  3NKD A;  3E70 C;  5L3V A;  4CSA A;  1ZZP A;  1OW8 A;  1EI7 A;  2KK1 A;  5F5H A;  1NBB A;  2R7Q A;  5AC4 A;  3EGD B;  1MMD A;  2CCY A;  2CGE A;  3SNH A;  4R32 A;  3SZR A;  2KJG A;  4XEF A;  1OCC C;  1T5O A;  4C3E A;  4C7O B;  1ZHT A;  3T9O A;  2LFD A;  2OKU A;  5L3Q A;  3G50 A;  4N6C A;  1E84 A;  3MYF A;  1S05 A;  2HUJ A;  1HY5 A;  2BC5 A;  2KGO A;  4NTF A;  3EG9 B;  3OEO A;  1GGQ A;  5L0H A;  4IWB A;  2Q7R A;  1QKR A;  4MTG A;  1OR3 A;  4PJJ A;  2IXO A;  3DAF A;  3T6B A;  2L6F A;  3RKO F;  5DLJ A;  1MND A;  4EIY A;  3U9J A;  4DRH B;  1B68 A;  3IHU A;  2Q9C A;  2AU5 A;  5L0J A;  3AQC A;  5KYW A;  1YZA A;  3NMJ A;  1O5H A;  1VMA A;  2V26 A;  4XPY A;  2EPN A;  3EPV A;  3N2Z B;  4JIO A;  4G7H F;  4JTD B;  4MND A;  1XZQ A;  3HNJ A;  1WAS A;  3T6J A;  2EIL C;  4YT2 A;  4DOZ A;  5B3I A;  1RKC A;  2J9W A;  2YVK A;  1LS4 A;  1O87 A;  1OQC A;  2Z15 A;  4EKW A;  1VOM A;  5JP7 A;  2XLE A;  3LS1 A;  3ZDL A;  4J32 B;  2YEV A;  5D91 A;  1D1B A;  3BEH A;  1LE2 A;  5JSL A;  4YT8 A;  2PBE A;  4NTA A;  3Q7L A;  1HMO A;  1VB5 A;  4WGZ A;  3SP1 A;  3US6 A;  5DS6 A;  5IY5 C;  2R03 A;  1HMD A;  1BDJ B;  3UGO A;  4XPW A;  4BEJ A;  1NFO A;  1SR2 A;  2OJE D;  3DMD A;  3LLK A;  4OD4 A;  5JRA A;  1E83 A;  2F22 A;  2J9V A;  3LEV A;  3BRJ A;  3PMR A;  4GYT A;  1KU2 A;  3FAJ A;  2A69 F;  3H2V A;  3AGU A;  2EPO A;  3M4B A;  4KBL A;  3U8P A;  2P7V A;  1O3U A;  3ZWI A;  4DRI B;  1K40 A;  1BR4 A;  3LEO A;  4IB4 A;  4OIP F;  4DVZ A;  5BQI A;  3KL4 A;  4ANJ A;  2J9B A;  3WHN A;  3W8I A;  3VF0 A;  4U5H A;  2WB7 A;  1QVX A;  3ZQV A;  1OR2 A;  2YLD A;  1YLM A;  1YZC A;  2AWY A;  1VYK A;  1M6T A;  1UG7 A;  3DWW A;  2YQY A;  1SF8 A;  3H2U A;  1XWJ A;  4LDK A;  2IXN A;  3M1C B;  1H6G A;  3K33 A;  3MLG A;  3RH3 A;  4CJO A;  3M79 A;  1CPQ A;  5KYU A;  4CDA A;  3GOD A;  3W8H A;  4DJ9 A;  4DBQ A;  4BPM A;  4W8K A;  4KI2 A;  1YYX A;  3QTH A;  4EWC A;  1KTM A;  2Y3D A;  1U6H A;  2XLV A;  5B1A C;  3PCV A;  2KQ9 A;  2D5R B;  5KYW B;  2J0W A;  3QVY A;  2R7S A;  4L6R A;  2VH3 A;  4XEK A;  1TWA A;  1ZHY A;  3RIP A;  3HTK C;  3JCU Q;  3KPH A;  3M4C A;  4IGG A;  4O6N A;  2BL2 A;  4D4N A;  3IQ5 A;  3SXY A;  1YVI A;  2KC3 A;  3GOR A;  5T1D B;  3UNG C;  3JYY A;  2VCB A;  4MVQ A;  1FTS A;  1SZI A;  4U5D E;  3FDQ A;  3WAQ A;  1V74 B;  3DD7 A;  1LKX A;  5KYY B;  5L0D A;  1G4W R;  3NYJ A;  2QE9 A;  3GWN A;  1YA7 O; 
#chains in the Genus database with same CATH homology
 3ZDL A;  4P9T A;  1DOW A;  1XWJ A;  1H6G A;  2X0C A;  4EHP A;  1U89 A;  2GWW A;  4DJ9 A;  5L0C A;  3T6G B;  1TR2 A;  3S90 A;  5L0H A;  1U6H A;  1QKR A;  3TJ6 A;  1ZVZ A;  3TJ5 A;  1YDI A;  1T01 A;  5L0G A;  4K1O A;  4IGG A;  5L0J A;  4E18 A;  5FZT A;  1RKE B;  3H2V A;  2GDC A;  2IBF A;  1ZW3 A;  5L0I A;  1DOV A;  1ZW2 A;  4PR9 A;  4W8P A;  3MYI A;  1RKE A;  1SYQ A;  1ST6 A;  4E17 A;  2B0H A;  2LQG A;  3RF3 A;  3VF0 A;  5L0D A;  1RKC A;  1L7C A;  2L7A A;  4ONS A;  5L0F A;  2HSQ A;  3H2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...