4E18A

Alpha-e-catenin is an autoinhibited molecule that co-activates vinculin
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
255
structure length
247
Chain Sequence
QMPVFHTRTIESILEPVAQQISHLVIMHEEGEGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNEEALKNRNFTVEKMSAEINEIIRVLQLTSWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title Conformational plasticity of alpha-catenin revealed by binding interactions with vinculin
rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 105
structure length 247
sequence length 255
ec nomenclature
pdb deposition date 2012-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 4e18A01
1YDIA 1H6GA 4K1OA 3S90A 1U89A 1TR2A 5L0GA 3RF3A 1XWJA 3H2VA 4E17A 1ST6A 3VF0A 1ZW2A 2GWWA 3TJ5A 5L0DA 1RKEB 1ZVZA 5L0IA 2HSQA 5L0HA 1L7CA 2X0CA 4ONSA 1U6HA 5L0CA 1DOVA 2LQGA 1DOWA 3ZDLA 1ZW3A 4DJ9A 2L7AA 4E18A 3TJ6A 5L0JA 3T6GB 4PR9A 5L0FA 3H2UA 4W8PA 2GDCA 5FZTA 1SYQA 1RKCA 2B0HA 4IGGA 1QKRA 4EHPA 1T01A 4P9TA 2IBFA 3MYIA 1RKEA
chains in the Genus database with same CATH superfamily
2KJGA 1OXKA 3H65A 1A7DA 2Z15A 3SXYA 4CJOA 4PJMA 3QW0A 4CS9C 5A6BD 3UGPA 2DI3A 3DE9A 4BJ6A 3GANA 3UNGC 1G5ZA 3SXZA 3RH3A 3M4CA 3IQCA 4U5HA 1ORYA 3S9OA 1FMVA 2R02A 1L3PA 1BR1A 2AWYA 3AG2C 4GYTA 4MVRA 2IM8A 1D0XA 2UUHA 1ZHZA 2JX0A 3GM2A 1AVOB 3F47A 3ITFA 4KNWA 3U5SA 2AWCA 3K1IC 1U0BB 1JAFA 2ZPAA 5AC4A 3LS1A 4Q7CA 3X2QC 3VM6A 2ASRA 2KC3A 2OOCA 2O9XA 3C7JA 1TWHA 2GAQA 2GDCA 4U9EA 3ZG1A 3FDQA 2E87A 1A0BA 1TKNA 2CGEA 1QKRA 3ASOC 4CIHA 1OW7A 2Y3HA 2YLDA 3HKKA 1T6UA 4JJGA 4YJWA 4EBKA 4CBEA 4MTGA 1IW7F 1QQ3A 2J0WA 2RD9A 1KTMA 4Z9IA 1LM3B 2YL7A 2XLOA 3CZ6A 2L6HA 1HW2A 3MBGA 4QI0A 3AGUA 4YL3A 1YAUO 3PHF2 2R7SA 3NMJA 1RMVA 4U5DE 5DS4A 4OIOF 4O6NA 4RBNA 4CDVA 2V3CC 2ZD9A 1VOMA 2A69F 4LLEA 4C3BA 4MS2A 2L9JA 1V74B 2YL0A 1N1CA 4FWVA 3O10A 4BG0A 1GQAA 3IQ5A 4BJ5C 2R7OA 3J06A 3EPVA 1PCXA 5DQZA 1MMNA 2OCCC 1APCA 2UUIA 4LDQA 4PJLA 3EH1A 3R7CA 3ZIBA 4WGYA 1YZAA 2G62A 3FMSA 4XEKA 4YT2A 5A69A 4CS9A 1WWPA 1U89A 3IHUA 2LSEA 256BA 5B3IA 1JPJA 1Q0KA 3L34A 1E84A 2Q9CA 2WVQA 3B0PA 3QZCA 2VB6A 3MX3A 3TJ5A 1HY5A 3JRTA 1L7CA 4FX5A 3UR3C 2NSFA 3IEEA 5E3CA 2DB4A 4CX9A 5COMA 1DOVA 1V54C 1G4US 3IPMO 2L81A 4AK9A 3FOOA 3M4BA 4PK4A 3TJ6A 4OD4A 2XSEA 4JTCB 4DVYP 2LFFA 1YLMA 4LDRA 3G50A 3CAXA 4AL1A 5EHHA 2CNWD 4MTOA 3X1OA 4ONSA 1S05A 4K7BA 4G7ZF 1O87A 5KYXB 1RJ9B 4ER9A 4U5FE 2LK4A 4XEFA 3ZTMA 1GS9A 1LI7A 3Q7GA 1O3UA 4I44A 4JCHA 1RKEB 2PX0A 5CIVA 2Q9BA 1TFKB 1A7VA 1V4AA 2PFDA 3IQTA 4G7HF 3IQ6A 2HJ3A 3N2ZB 1ZZPA 2LIGA 1BBHA 1LE4A 4AL0A 1OCCC 1OQCA 3NMKA 1WN0A 1ZHXA 1E2XA 1ZU4A 4JTAB 4RDAA 2PX3A 3CEXA 4BJ5A 4KNVA 2VCAA 2XLMA 4XPXA 2XL6A 3UMHA 5KYXA 3ZQYA 1LS1A 1QLEC 3LNMB 5EK0A 3RKOF 2VCBA 1FFHA 2A0BA 2XLHA 2YKZA 2ZXRA 4MVSA 4PACA 2NUPB 4DRJB 4XPYA 2EPMX 1I4YA 4W8KA 1YDIA 3U3FA 4R32A 2J8WA 2OQMA 3BEHA 3GORA 4MNDA 3TK0A 4YT4A 1D0YA 2R7VA 4DOZA 3QTHA 1F1MA 4N06A 4KI2A 3TD7A 2VH3A 1OW8A 2EILC 1WATA 2P0NA 3C18A 4E7SA 1ZVZA 2FFHA 1VB5A 1TQGA 4EBBA 3EGDB 2QUPA 4P6IC 2J0XA 2X0CA 3I5PA 2XLWA 4OIRF 3SNHA 4D4XA 1Q0DA 1D1CA 5BUOA 4EKWA 3EGXA 2PF4E 2ZXOA 3JSZA 3Q7LA 4KBLA 2NUPA 1ZW3A 3OWTA 4JEAA 4LERA 1J8YF 2QNLA 4NTFA 2OKUA 1CGNA 3PMRA 5BQGA 3K6BA 4ANJA 4E18A 2R7XA 1H9TA 4J7TA 1JPNA 5A6AA 4YT5A 4CS7A 3V7OA 4Q4ZF 2A68F 1Y4CA 2DYRC 1O5HA 2MWQA 3A11A 3EG9B 3GM3A 3KH2A 5COFA 4EHPA 3S27A 3MYIA 3LEOA 1OCRC 2XLEA 1BZ4A 2WL8A 3WG7C 2R7TA 2WZGA 3LAYA 2HJMA 1XWJA 1PD0A 3FXHA 4NTBA 3S0XA 2DGJA 3SZRA 1S7ZA 2KSFA 3VF0A 4LACB 2YLIA 2Q4FA 3US6A 5DQTA 4CSAA 1CPRA 3L1MA 4KC9A 3DZAA 3DAGA 4OINF 5TJ5E 3EG9A 1FTSA 3ZWIA 3LUTB 1YJGA 4YWQA 1YYJA 4JTDB 5KYUB 2I15A 4I1OB 1ZHWA 3O6XA 3B29A 3EFOB 4IRUA 1NG1A 3DM9B 4C3EA 5L0FA 1OR3A 3EZHA 1UFBA 2HMZA 2YL1A 3VYWA 3C8GB 5HV9A 3LESA 1Z7Qc 1QVXA 4G0HA 5B1AC 3RQFA 2F22A 2NSGA 2P61A 3C8ZA 3DMDA 3MYFA 5L3QA 2XM0A 4Q5SF 1FAPB 5KYUA 2XLDA 4JE9A 1JOGA 1ZW2A 2GA0A 4ZLDA 1YYXA 2VASA 3POVA 3JYHA 2IOQA 3AG3C 5B3SC 4MVMA 1SF8A 1U6HA 5L0CA 4C7OB 2EINC 2H7BA 5F28E 5FCLA 4G78A 4J30B 1LIHA 4DRIB 1M2OA 5T3TA 3C8GA 4XPWA 2XL8A 3TULA 2VC9A 5D91A 1MMDA 2KGOA 2OEXA 3DJNB 5CI9A 1JMWA 2XS1A 1YZCA 1ZHYA 2OU6A 3KPHA 1SZIA 3LJBA 3N24A 3NKDA 4PR9A 4BJ1A 1I5NA 3JRMO 5DS6A 1FNTc 1MQVA 2J7PA 1TWAA 4XTKA 4A2NB 1LPEA 2FAPB 4LDKA 2YZSA 5E33A 2XRHA 4ZLCA 3W8HA 3EHMA 1LVKA 3FVYA 3KKBA 3U2LA 1Q0GA 4C7OA 3NG1A 3HJCA 2Y3DA 3VAYA 4EBJA 3SEOA 4BJTA 1J8MF 1Y6DA 2HZ8A 3RQEA 3CQZA 1GM5A 2D5RB 3B0UX 1HE9A 3NMIA 1YA7O 4X0RA 2BL2A 2YVKA 3HNJA 2HSBA 3KMIA 1D0ZA 2P1AA 2C03A 3JT1A 4HE8D 1M57C 1MMAA 4JEBA 4H4KC 4PFPA 1HE1A 5B1BC 3JZ0A 1ZHTA 1VMAA 1D1BA 2BC5A 4JRZA 1VYKA 4U5GA 1E86A 5HSWA 3EJNA 3S29A 5JP7A 1UG7A 4JZAA 2EPKX 5DS5A 2R9RB 1NBBA 3CSKA 3O55A 3MLGA 1SYQA 4CDYA 2YHSA 1JR8A 1BR2A 2P6VA 5JS5A 4J7YA 4JC7A 3RW0A 4OIQF 2VCCA 3GEHA 1YA9A 4P9TA 3TQOA 4L6RA 2NG1A 5COGA 3LLIA 2A6EF 3OEOA 2I8BA 4HFKB 4DRHB 2HFIA 2WZLA 3SXMA 4BEMJ 2NUTB 1ZYRF 4N6HA 5E3AA 2XXAB 4FAPB 5L0HA 3UGOA 1VLSA 2V26A 4CSAC 3SP1A 4Z9JA 3W4YA 3NRHA 2ETSA 2HV6A 2W4MA 2RSEB 2ZXPA 1WASA 1R5ID 4JIOA 4JKVA 5EGYA 3B0VC 1VK5A 1D1AA 2WB7A 1ORSC 3DWWA 4P9FA 1RJ9A 3WODF 5IY5C 5JT4A 1A41A 3ECSA 4IGGA 2NUTA 2XXAA 1Z23A 1K05A 1OW6A 2M64A 4MQ9F 1KU2A 1RKEA 2Q3TA 1H9GA 2DYSC 3KYJA 4WGZA 1TR2A 4O6YA 3RF3A 2EPLX 2Y69C 3K1HA 3K66A 2IXNA 1HMOA 5KYYB 3FAJA 2EPOA 5L0DA 1QZXA 1M2VB 1MNDA 2XLVA 2C04A 3T9OA 3U2MA 2HSQA 2P7VA 4CDAA 1Z5ZA 2XS8A 2EIJC 4IB4A 1MMGA 4RD9A 1V55C 1HW1A 2LP4A 3JCUQ 4J32B 1B68A 2R7QA 1T5OA 5L0JA 5JRAA 3T6BA 3DJUB 2X51A 1YARO 3NKEA 1PD1A 3LLKA 4YL0A 5KYYA 1NU9C 1I4ZA 3V5XA 2LFDA 4MVUA 3RIPA 3AGTA 4CIPA 1NFOA 3EGDA 1Z6AA 3AOUA 2HV7A 3GODA 3JYYA 3ABKC 2YL3A 2L6FA 2QY9A 1AUEA 3AJMA 3TOMA 1WGWA 3W8IA 3ZSUA 3AG1C 5BQIA 4U5CE 3L8JA 1Q0MA 2GFHA 2YRFA 3C8GD 1C02A 3QVYA 4I3MA 5T1DB 1SR2A 1RXQA 2PNOA 3ZTZA 4HFFB 5F5FA 2XL4A 5GPGB 1YVIA 2LQGA 1CPQA 2A0UA 4LLCA 3NYMA 3T4RA 2J7PD 1IZMA 3V5ZA 2LD6A 3G4XA 3BRJA 4DBRA 2A1DD 2CDQA 4PFOA 3T6GB 3O39A 3DAFA 3RVZA 4JVSA 3LS0A 3AQBA 3HNLA 4U9DA 2IYLD 3C63A 2KW3C 2R7UA 2KNHA 4IAOA 4XWJA 3GEIA 5DVWA 2IBFA 1G8XA 1NSGB 2TMVP 4XLPF 2KK1A 3UMKA 1KNYA 3DI5A 1A7EA 1OKKA 3RVYA 3UMIA 3GEEA 3M1CB 1ST6A 4MTFA 3FOPA 3W2VA 4DVZA 2YWAA 2R7RA 4IWBA 3B71A 1G4WR 1M6TA 3EFOA 3AQCA 1WTYA 3Q6NA 5KYNA 2KQ9A 3WHNA 4JURI 4JCZA 1NZEA 3NYJA 3R2PA 2R25A 3NDBB 4D4NA 3QW1A 3B9QA 1BR4A 2Y3GA 2G3VA 3U9MA 1EKYA 3H2UA 4W8PA 4MW8A 1OCOC 5FZTA 3W2WA 1LE2A 3S28A 3KYIA 2R05A 4AX2A 1LI5A 1E85A 2OG2A 4E7ZA 4K1OA 1E83A 3S90A 2XM4A 1QPUA 4C3DA 3M79A 3RFYA 2WZFA 3KL4A 1C03A 1XZPA 3A9CA 3GM1A 2AVKA 3TOLA 4F4BA 5JLIA 5A6BA 4WJ0A 3E9VA 4NC3A 2JD3A 2YEVA 1W2WA 4JJFA 1DOWA 3WAQA 4AE4B 1Q0FA 4MW3A 3DE8A 2W45A 1AEPA 3JSEO 3F46A 2W4BA 3ZQVA 5JSLA 5JVEA 4U5BE 1M56C 1BDJB 3MFNA 5E2QA 3SYNA 3FHDA 1TWCA 1Z3IX 4CS8C 3GWLA 4M63A 1NU7D 2FGYA 5F5HA 4PJJA 4OIPF 4K0DA 1T01A 3I4UA 2J9WA 2R03A 2WVNA 3DXJF 2LCHA 3N0TA 3NYLA 3QVZA 2QLAA 3L8IA 3U3BA 1FR0A 2EIMC 2L6GA 1JRAA 4AE4A 5DLJA 4O6MA 1GGQA 1NFNA 3DD7A 5D92A 1TFOB 3ABMC 3AG4C 2G3KA 2GWWA 1HMDA 5A6KA 1EA8A 3U0CA 1T9KA 1ORJA 1EI7A 3GWNA 2Q9AA 4IAQA 1OCZC 2J9VA 3DM5A 1MNEA 3FAPB 3HTKC 3LEVA 4XLNF 3K1IA 4GQHA 5T3WA 4WABA 2IXPA 2D4UA 4MVZA 2YLGA 3PCVA 3K33A 3QMKA 2EPNA 2OJQA 4H54A 3I5QA 2J46A 1SMYF 2B0JA 3LNRA 4ULWA 5A6JA 3K7DA 1QSPA 2IXMA 2PP4A 4GEHA 5AC5A 2CW0F 2M4EA 4A4AA 3EQLF 3L0IA 3HNIA 3V5YA 1K40A 4EWCA 4BEJA 2Y39A 5CI8A 3RYLA 3T6JA 3OA1A 2YQYA 3EZIA 4XEVA 2R7WA 4MVOA 2CCYA 5JUAA 5K0IA 4NY3A 5L0GA 3H2VA 3G4ZA 2HS5A 4IJJA 4JW1A 1EQ1A 4E0IA 4IARA 1C17M 1K04A 2Y3BA 1LKXA 2EIKC 4OD5A 3VRCA 3C62A 4BJ6C 3JTLO 4U5EE 3HLZA 4Z9HA 4YN0B 1R4TA 2ICWG 4O79A 4YT8A 2HUJA 3E70C 2Q7RA 3S84A 2H7OA 4EIYA 1T6IA 4UDVA 3ATPA 4PJNA 1VTMP 2BE5F 4O7GA 3PDMP 4NTAA 2AU5A 2J9BA 3EHNA 4CS8A 2JPUA 2MYSA 4NQFA 3EGXB 5BQHA 2ZXWC 2IXOA 4QDLA 2KYHA 1H7IA 4YK5A 1RKCA 3ZC4A 2B0HA 3ABLC 1OKKD 5AGFA 3RQGA 3U8VA 3ZVRA 1CGOA 4DBQA 1Z63A 1NLXA 5KYWB 2NPUA 1M2VA 3EH2A 1CGME 2AP3A 1H6GA 2QE9A 4QI2A 1RCPA 1T6QA 2PBEA 1XZQA 2Q00A 1TWGA 1VYIA 3M15A 5L3VA 4E17A 2CNWA 4FESA 4B6IA 4G7OF 1PV3A 1WOLA 2OEVA 4HEAJ 4I1MA 4NCQA 4ULVA 1OR2A 2HKVA 4E0HA 4CJGA 2W9YA 5L0IA 1FFTC 2OJED 2QTVA 2A6HF 4N6CA 1FMWA 4EUKB 2CYDA 2MHRA 3U8PA 3ZDLA 4DJ9A 4DXWA 5KYWA 2L7AA 2H7VC 3DKAA 1ZU5A 4MVQA 3SXKA 4YL1A 4BPMA 2J9UA 2H8AA 3HNKA 3Q6MA 4XQ1A 2WVOA 3ASNC 1LS4A 1OXBA 1VLTA 2HMQA 4N4WA 3U9JA 2J45A
chains in the Genus database with same CATH topology
1YDIA 1H6GA 4K1OA 3S90A 1U89A 1TR2A 5L0GA 3RF3A 1XWJA 3H2VA 4E17A 1ST6A 3VF0A 1ZW2A 2GWWA 3TJ5A 5L0DA 1RKEB 1ZVZA 5L0IA 2HSQA 5L0HA 1L7CA 2X0CA 4ONSA 1U6HA 5L0CA 1DOVA 2LQGA 1DOWA 3ZDLA 1ZW3A 4DJ9A 2L7AA 4E18A 3TJ6A 5L0JA 3T6GB 4PR9A 5L0FA 3H2UA 4W8PA 2GDCA 5FZTA 1SYQA 1RKCA 2B0HA 4IGGA 1QKRA 4EHPA 1T01A 4P9TA 2IBFA 3MYIA 1RKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YDI A;  1H6G A;  4K1O A;  3S90 A;  1U89 A;  1TR2 A;  5L0G A;  3RF3 A;  1XWJ A;  3H2V A;  4E17 A;  1ST6 A;  3VF0 A;  1ZW2 A;  2GWW A;  3TJ5 A;  5L0D A;  1RKE B;  1ZVZ A;  5L0I A;  2HSQ A;  5L0H A;  1L7C A;  2X0C A;  4ONS A;  1U6H A;  5L0C A;  1DOV A;  2LQG A;  1DOW A;  3ZDL A;  1ZW3 A;  4DJ9 A;  2L7A A;  4E18 A;  3TJ6 A;  5L0J A;  3T6G B;  4PR9 A;  5L0F A;  3H2U A;  4W8P A;  2GDC A;  5FZT A;  1SYQ A;  1RKC A;  2B0H A;  4IGG A;  1QKR A;  4EHP A;  1T01 A;  4P9T A;  2IBF A;  3MYI A;  1RKE A; 
#chains in the Genus database with same CATH topology
 2KJG A;  1OXK A;  3H65 A;  1A7D A;  2Z15 A;  3SXY A;  4CJO A;  4PJM A;  3QW0 A;  4CS9 C;  5A6B D;  3UGP A;  2DI3 A;  3DE9 A;  4BJ6 A;  3GAN A;  3UNG C;  1G5Z A;  3SXZ A;  3RH3 A;  3M4C A;  3IQC A;  4U5H A;  1ORY A;  3S9O A;  1FMV A;  2R02 A;  1L3P A;  1BR1 A;  2AWY A;  3AG2 C;  4GYT A;  4MVR A;  2IM8 A;  1D0X A;  2UUH A;  1ZHZ A;  2JX0 A;  3GM2 A;  1AVO B;  3F47 A;  3ITF A;  4KNW A;  3U5S A;  2AWC A;  3K1I C;  1U0B B;  1JAF A;  2ZPA A;  5AC4 A;  3LS1 A;  4Q7C A;  3X2Q C;  3VM6 A;  2ASR A;  2KC3 A;  2OOC A;  2O9X A;  3C7J A;  1TWH A;  2GAQ A;  2GDC A;  4U9E A;  3ZG1 A;  3FDQ A;  2E87 A;  1A0B A;  1TKN A;  2CGE A;  1QKR A;  3ASO C;  4CIH A;  1OW7 A;  2Y3H A;  2YLD A;  3HKK A;  1T6U A;  4JJG A;  4YJW A;  4EBK A;  4CBE A;  4MTG A;  1IW7 F;  1QQ3 A;  2J0W A;  2RD9 A;  1KTM A;  4Z9I A;  1LM3 B;  2YL7 A;  2XLO A;  3CZ6 A;  2L6H A;  1HW2 A;  3MBG A;  4QI0 A;  3AGU A;  4YL3 A;  1YAU O;  3PHF 2;  2R7S A;  3NMJ A;  1RMV A;  4U5D E;  5DS4 A;  4OIO F;  4O6N A;  4RBN A;  4CDV A;  2V3C C;  2ZD9 A;  1VOM A;  2A69 F;  4LLE A;  4C3B A;  4MS2 A;  2L9J A;  1V74 B;  2YL0 A;  1N1C A;  4FWV A;  3O10 A;  4BG0 A;  1GQA A;  3IQ5 A;  4BJ5 C;  2R7O A;  3J06 A;  3EPV A;  1PCX A;  5DQZ A;  1MMN A;  2OCC C;  1APC A;  2UUI A;  4LDQ A;  4PJL A;  3EH1 A;  3R7C A;  3ZIB A;  4WGY A;  1YZA A;  2G62 A;  3FMS A;  4XEK A;  4YT2 A;  5A69 A;  4CS9 A;  1WWP A;  1U89 A;  3IHU A;  2LSE A;  256B A;  5B3I A;  1JPJ A;  1Q0K A;  3L34 A;  1E84 A;  2Q9C A;  2WVQ A;  3B0P A;  3QZC A;  2VB6 A;  3MX3 A;  3TJ5 A;  1HY5 A;  3JRT A;  1L7C A;  4FX5 A;  3UR3 C;  2NSF A;  3IEE A;  5E3C A;  2DB4 A;  4CX9 A;  5COM A;  1DOV A;  1V54 C;  1G4U S;  3IPM O;  2L81 A;  4AK9 A;  3FOO A;  3M4B A;  4PK4 A;  3TJ6 A;  4OD4 A;  2XSE A;  4JTC B;  4DVY P;  2LFF A;  1YLM A;  4LDR A;  3G50 A;  3CAX A;  4AL1 A;  5EHH A;  2CNW D;  4MTO A;  3X1O A;  4ONS A;  1S05 A;  4K7B A;  4G7Z F;  1O87 A;  5KYX B;  1RJ9 B;  4ER9 A;  4U5F E;  2LK4 A;  4XEF A;  3ZTM A;  1GS9 A;  1LI7 A;  3Q7G A;  1O3U A;  4I44 A;  4JCH A;  1RKE B;  2PX0 A;  5CIV A;  2Q9B A;  1TFK B;  1A7V A;  1V4A A;  2PFD A;  3IQT A;  4G7H F;  3IQ6 A;  2HJ3 A;  3N2Z B;  1ZZP A;  2LIG A;  1BBH A;  1LE4 A;  4AL0 A;  1OCC C;  1OQC A;  3NMK A;  1WN0 A;  1ZHX A;  1E2X A;  1ZU4 A;  4JTA B;  4RDA A;  2PX3 A;  3CEX A;  4BJ5 A;  4KNV A;  2VCA A;  2XLM A;  4XPX A;  2XL6 A;  3UMH A;  5KYX A;  3ZQY A;  1LS1 A;  1QLE C;  3LNM B;  5EK0 A;  3RKO F;  2VCB A;  1FFH A;  2A0B A;  2XLH A;  2YKZ A;  2ZXR A;  4MVS A;  4PAC A;  2NUP B;  4DRJ B;  4XPY A;  2EPM X;  1I4Y A;  4W8K A;  1YDI A;  3U3F A;  4R32 A;  2J8W A;  2OQM A;  3BEH A;  3GOR A;  4MND A;  3TK0 A;  4YT4 A;  1D0Y A;  2R7V A;  4DOZ A;  3QTH A;  1F1M A;  4N06 A;  4KI2 A;  3TD7 A;  2VH3 A;  1OW8 A;  2EIL C;  1WAT A;  2P0N A;  3C18 A;  4E7S A;  1ZVZ A;  2FFH A;  1VB5 A;  1TQG A;  4EBB A;  3EGD B;  2QUP A;  4P6I C;  2J0X A;  2X0C A;  3I5P A;  2XLW A;  4OIR F;  3SNH A;  4D4X A;  1Q0D A;  1D1C A;  5BUO A;  4EKW A;  3EGX A;  2PF4 E;  2ZXO A;  3JSZ A;  3Q7L A;  4KBL A;  2NUP A;  1ZW3 A;  3OWT A;  4JEA A;  4LER A;  1J8Y F;  2QNL A;  4NTF A;  2OKU A;  1CGN A;  3PMR A;  5BQG A;  3K6B A;  4ANJ A;  4E18 A;  2R7X A;  1H9T A;  4J7T A;  1JPN A;  5A6A A;  4YT5 A;  4CS7 A;  3V7O A;  4Q4Z F;  2A68 F;  1Y4C A;  2DYR C;  1O5H A;  2MWQ A;  3A11 A;  3EG9 B;  3GM3 A;  3KH2 A;  5COF A;  4EHP A;  3S27 A;  3MYI A;  3LEO A;  1OCR C;  2XLE A;  1BZ4 A;  2WL8 A;  3WG7 C;  2R7T A;  2WZG A;  3LAY A;  2HJM A;  1XWJ A;  1PD0 A;  3FXH A;  4NTB A;  3S0X A;  2DGJ A;  3SZR A;  1S7Z A;  2KSF A;  3VF0 A;  4LAC B;  2YLI A;  2Q4F A;  3US6 A;  5DQT A;  4CSA A;  1CPR A;  3L1M A;  4KC9 A;  3DZA A;  3DAG A;  4OIN F;  5TJ5 E;  3EG9 A;  1FTS A;  3ZWI A;  3LUT B;  1YJG A;  4YWQ A;  1YYJ A;  4JTD B;  5KYU B;  2I15 A;  4I1O B;  1ZHW A;  3O6X A;  3B29 A;  3EFO B;  4IRU A;  1NG1 A;  3DM9 B;  4C3E A;  5L0F A;  1OR3 A;  3EZH A;  1UFB A;  2HMZ A;  2YL1 A;  3VYW A;  3C8G B;  5HV9 A;  3LES A;  1Z7Q c;  1QVX A;  4G0H A;  5B1A C;  3RQF A;  2F22 A;  2NSG A;  2P61 A;  3C8Z A;  3DMD A;  3MYF A;  5L3Q A;  2XM0 A;  4Q5S F;  1FAP B;  5KYU A;  2XLD A;  4JE9 A;  1JOG A;  1ZW2 A;  2GA0 A;  4ZLD A;  1YYX A;  2VAS A;  3POV A;  3JYH A;  2IOQ A;  3AG3 C;  5B3S C;  4MVM A;  1SF8 A;  1U6H A;  5L0C A;  4C7O B;  2EIN C;  2H7B A;  5F28 E;  5FCL A;  4G78 A;  4J30 B;  1LIH A;  4DRI B;  1M2O A;  5T3T A;  3C8G A;  4XPW A;  2XL8 A;  3TUL A;  2VC9 A;  5D91 A;  1MMD A;  2KGO A;  2OEX A;  3DJN B;  5CI9 A;  1JMW A;  2XS1 A;  1YZC A;  1ZHY A;  2OU6 A;  3KPH A;  1SZI A;  3LJB A;  3N24 A;  3NKD A;  4PR9 A;  4BJ1 A;  1I5N A;  3JRM O;  5DS6 A;  1FNT c;  1MQV A;  2J7P A;  1TWA A;  4XTK A;  4A2N B;  1LPE A;  2FAP B;  4LDK A;  2YZS A;  5E33 A;  2XRH A;  4ZLC A;  3W8H A;  3EHM A;  1LVK A;  3FVY A;  3KKB A;  3U2L A;  1Q0G A;  4C7O A;  3NG1 A;  3HJC A;  2Y3D A;  3VAY A;  4EBJ A;  3SEO A;  4BJT A;  1J8M F;  1Y6D A;  2HZ8 A;  3RQE A;  3CQZ A;  1GM5 A;  2D5R B;  3B0U X;  1HE9 A;  3NMI A;  1YA7 O;  4X0R A;  2BL2 A;  2YVK A;  3HNJ A;  2HSB A;  3KMI A;  1D0Z A;  2P1A A;  2C03 A;  3JT1 A;  4HE8 D;  1M57 C;  1MMA A;  4JEB A;  4H4K C;  4PFP A;  1HE1 A;  5B1B C;  3JZ0 A;  1ZHT A;  1VMA A;  1D1B A;  2BC5 A;  4JRZ A;  1VYK A;  4U5G A;  1E86 A;  5HSW A;  3EJN A;  3S29 A;  5JP7 A;  1UG7 A;  4JZA A;  2EPK X;  5DS5 A;  2R9R B;  1NBB A;  3CSK A;  3O55 A;  3MLG A;  1SYQ A;  4CDY A;  2YHS A;  1JR8 A;  1BR2 A;  2P6V A;  5JS5 A;  4J7Y A;  4JC7 A;  3RW0 A;  4OIQ F;  2VCC A;  3GEH A;  1YA9 A;  4P9T A;  3TQO A;  4L6R A;  2NG1 A;  5COG A;  3LLI A;  2A6E F;  3OEO A;  2I8B A;  4HFK B;  4DRH B;  2HFI A;  2WZL A;  3SXM A;  4BEM J;  2NUT B;  1ZYR F;  4N6H A;  5E3A A;  2XXA B;  4FAP B;  5L0H A;  3UGO A;  1VLS A;  2V26 A;  4CSA C;  3SP1 A;  4Z9J A;  3W4Y A;  3NRH A;  2ETS A;  2HV6 A;  2W4M A;  2RSE B;  2ZXP A;  1WAS A;  1R5I D;  4JIO A;  4JKV A;  5EGY A;  3B0V C;  1VK5 A;  1D1A A;  2WB7 A;  1ORS C;  3DWW A;  4P9F A;  1RJ9 A;  3WOD F;  5IY5 C;  5JT4 A;  1A41 A;  3ECS A;  4IGG A;  2NUT A;  2XXA A;  1Z23 A;  1K05 A;  1OW6 A;  2M64 A;  4MQ9 F;  1KU2 A;  1RKE A;  2Q3T A;  1H9G A;  2DYS C;  3KYJ A;  4WGZ A;  1TR2 A;  4O6Y A;  3RF3 A;  2EPL X;  2Y69 C;  3K1H A;  3K66 A;  2IXN A;  1HMO A;  5KYY B;  3FAJ A;  2EPO A;  5L0D A;  1QZX A;  1M2V B;  1MND A;  2XLV A;  2C04 A;  3T9O A;  3U2M A;  2HSQ A;  2P7V A;  4CDA A;  1Z5Z A;  2XS8 A;  2EIJ C;  4IB4 A;  1MMG A;  4RD9 A;  1V55 C;  1HW1 A;  2LP4 A;  3JCU Q;  4J32 B;  1B68 A;  2R7Q A;  1T5O A;  5L0J A;  5JRA A;  3T6B A;  3DJU B;  2X51 A;  1YAR O;  3NKE A;  1PD1 A;  3LLK A;  4YL0 A;  5KYY A;  1NU9 C;  1I4Z A;  3V5X A;  2LFD A;  4MVU A;  3RIP A;  3AGT A;  4CIP A;  1NFO A;  3EGD A;  1Z6A A;  3AOU A;  2HV7 A;  3GOD A;  3JYY A;  3ABK C;  2YL3 A;  2L6F A;  2QY9 A;  1AUE A;  3AJM A;  3TOM A;  1WGW A;  3W8I A;  3ZSU A;  3AG1 C;  5BQI A;  4U5C E;  3L8J A;  1Q0M A;  2GFH A;  2YRF A;  3C8G D;  1C02 A;  3QVY A;  4I3M A;  5T1D B;  1SR2 A;  1RXQ A;  2PNO A;  3ZTZ A;  4HFF B;  5F5F A;  2XL4 A;  5GPG B;  1YVI A;  2LQG A;  1CPQ A;  2A0U A;  4LLC A;  3NYM A;  3T4R A;  2J7P D;  1IZM A;  3V5Z A;  2LD6 A;  3G4X A;  3BRJ A;  4DBR A;  2A1D D;  2CDQ A;  4PFO A;  3T6G B;  3O39 A;  3DAF A;  3RVZ A;  4JVS A;  3LS0 A;  3AQB A;  3HNL A;  4U9D A;  2IYL D;  3C63 A;  2KW3 C;  2R7U A;  2KNH A;  4IAO A;  4XWJ A;  3GEI A;  5DVW A;  2IBF A;  1G8X A;  1NSG B;  2TMV P;  4XLP F;  2KK1 A;  3UMK A;  1KNY A;  3DI5 A;  1A7E A;  1OKK A;  3RVY A;  3UMI A;  3GEE A;  3M1C B;  1ST6 A;  4MTF A;  3FOP A;  3W2V A;  4DVZ A;  2YWA A;  2R7R A;  4IWB A;  3B71 A;  1G4W R;  1M6T A;  3EFO A;  3AQC A;  1WTY A;  3Q6N A;  5KYN A;  2KQ9 A;  3WHN A;  4JUR I;  4JCZ A;  1NZE A;  3NYJ A;  3R2P A;  2R25 A;  3NDB B;  4D4N A;  3QW1 A;  3B9Q A;  1BR4 A;  2Y3G A;  2G3V A;  3U9M A;  1EKY A;  3H2U A;  4W8P A;  4MW8 A;  1OCO C;  5FZT A;  3W2W A;  1LE2 A;  3S28 A;  3KYI A;  2R05 A;  4AX2 A;  1LI5 A;  1E85 A;  2OG2 A;  4E7Z A;  4K1O A;  1E83 A;  3S90 A;  2XM4 A;  1QPU A;  4C3D A;  3M79 A;  3RFY A;  2WZF A;  3KL4 A;  1C03 A;  1XZP A;  3A9C A;  3GM1 A;  2AVK A;  3TOL A;  4F4B A;  5JLI A;  5A6B A;  4WJ0 A;  3E9V A;  4NC3 A;  2JD3 A;  2YEV A;  1W2W A;  4JJF A;  1DOW A;  3WAQ A;  4AE4 B;  1Q0F A;  4MW3 A;  3DE8 A;  2W45 A;  1AEP A;  3JSE O;  3F46 A;  2W4B A;  3ZQV A;  5JSL A;  5JVE A;  4U5B E;  1M56 C;  1BDJ B;  3MFN A;  5E2Q A;  3SYN A;  3FHD A;  1TWC A;  1Z3I X;  4CS8 C;  3GWL A;  4M63 A;  1NU7 D;  2FGY A;  5F5H A;  4PJJ A;  4OIP F;  4K0D A;  1T01 A;  3I4U A;  2J9W A;  2R03 A;  2WVN A;  3DXJ F;  2LCH A;  3N0T A;  3NYL A;  3QVZ A;  2QLA A;  3L8I A;  3U3B A;  1FR0 A;  2EIM C;  2L6G A;  1JRA A;  4AE4 A;  5DLJ A;  4O6M A;  1GGQ A;  1NFN A;  3DD7 A;  5D92 A;  1TFO B;  3ABM C;  3AG4 C;  2G3K A;  2GWW A;  1HMD A;  5A6K A;  1EA8 A;  3U0C A;  1T9K A;  1ORJ A;  1EI7 A;  3GWN A;  2Q9A A;  4IAQ A;  1OCZ C;  2J9V A;  3DM5 A;  1MNE A;  3FAP B;  3HTK C;  3LEV A;  4XLN F;  3K1I A;  4GQH A;  5T3W A;  4WAB A;  2IXP A;  2D4U A;  4MVZ A;  2YLG A;  3PCV A;  3K33 A;  3QMK A;  2EPN A;  2OJQ A;  4H54 A;  3I5Q A;  2J46 A;  1SMY F;  2B0J A;  3LNR A;  4ULW A;  5A6J A;  3K7D A;  1QSP A;  2IXM A;  2PP4 A;  4GEH A;  5AC5 A;  2CW0 F;  2M4E A;  4A4A A;  3EQL F;  3L0I A;  3HNI A;  3V5Y A;  1K40 A;  4EWC A;  4BEJ A;  2Y39 A;  5CI8 A;  3RYL A;  3T6J A;  3OA1 A;  2YQY A;  3EZI A;  4XEV A;  2R7W A;  4MVO A;  2CCY A;  5JUA A;  5K0I A;  4NY3 A;  5L0G A;  3H2V A;  3G4Z A;  2HS5 A;  4IJJ A;  4JW1 A;  1EQ1 A;  4E0I A;  4IAR A;  1C17 M;  1K04 A;  2Y3B A;  1LKX A;  2EIK C;  4OD5 A;  3VRC A;  3C62 A;  4BJ6 C;  3JTL O;  4U5E E;  3HLZ A;  4Z9H A;  4YN0 B;  1R4T A;  2ICW G;  4O79 A;  4YT8 A;  2HUJ A;  3E70 C;  2Q7R A;  3S84 A;  2H7O A;  4EIY A;  1T6I A;  4UDV A;  3ATP A;  4PJN A;  1VTM P;  2BE5 F;  4O7G A;  3PDM P;  4NTA A;  2AU5 A;  2J9B A;  3EHN A;  4CS8 A;  2JPU A;  2MYS A;  4NQF A;  3EGX B;  5BQH A;  2ZXW C;  2IXO A;  4QDL A;  2KYH A;  1H7I A;  4YK5 A;  1RKC A;  3ZC4 A;  2B0H A;  3ABL C;  1OKK D;  5AGF A;  3RQG A;  3U8V A;  3ZVR A;  1CGO A;  4DBQ A;  1Z63 A;  1NLX A;  5KYW B;  2NPU A;  1M2V A;  3EH2 A;  1CGM E;  2AP3 A;  1H6G A;  2QE9 A;  4QI2 A;  1RCP A;  1T6Q A;  2PBE A;  1XZQ A;  2Q00 A;  1TWG A;  1VYI A;  3M15 A;  5L3V A;  4E17 A;  2CNW A;  4FES A;  4B6I A;  4G7O F;  1PV3 A;  1WOL A;  2OEV A;  4HEA J;  4I1M A;  4NCQ A;  4ULV A;  1OR2 A;  2HKV A;  4E0H A;  4CJG A;  2W9Y A;  5L0I A;  1FFT C;  2OJE D;  2QTV A;  2A6H F;  4N6C A;  1FMW A;  4EUK B;  2CYD A;  2MHR A;  3U8P A;  3ZDL A;  4DJ9 A;  4DXW A;  5KYW A;  2L7A A;  2H7V C;  3DKA A;  1ZU5 A;  4MVQ A;  3SXK A;  4YL1 A;  4BPM A;  2J9U A;  2H8A A;  3HNK A;  3Q6M A;  4XQ1 A;  2WVO A;  3ASN C;  1LS4 A;  1OXB A;  1VLT A;  2HMQ A;  4N4W A;  3U9J A;  2J45 A; 
#chains in the Genus database with same CATH homology
 1YDI A;  1H6G A;  4K1O A;  3S90 A;  1U89 A;  1TR2 A;  5L0G A;  3RF3 A;  1XWJ A;  3H2V A;  4E17 A;  1ST6 A;  3VF0 A;  1ZW2 A;  2GWW A;  3TJ5 A;  5L0D A;  1RKE B;  1ZVZ A;  5L0I A;  2HSQ A;  5L0H A;  1L7C A;  2X0C A;  4ONS A;  1U6H A;  5L0C A;  1DOV A;  2LQG A;  1DOW A;  3ZDL A;  1ZW3 A;  4DJ9 A;  2L7A A;  4E18 A;  3TJ6 A;  5L0J A;  3T6G B;  4PR9 A;  5L0F A;  3H2U A;  4W8P A;  2GDC A;  5FZT A;  1SYQ A;  1RKC A;  2B0H A;  4IGG A;  1QKR A;  4EHP A;  1T01 A;  4P9T A;  2IBF A;  3MYI A;  1RKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...