4E1SA

X-ray crystal structure of the transmembrane beta-domain from intimin from ehec strain o157:h7
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
242
structure length
242
Chain Sequence
QHYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Outer Membrane Domain of Intimin and Invasin from Enterohemorrhagic E. coli and Enteropathogenic Y. pseudotuberculosis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords Intimin
total genus 69
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 4e1sA00
4E1SA 4E1TA 5G26A
chains in the Genus database with same CATH superfamily
4FRXA 2N2LA 3LK3B 3NJTA 4AYNA 2Y2XA 2F1CX 1H6S1 4FESA 4E1SA 3SY7A 2LFUA 4E1TA 2MNHA 4O3WA 3V8UA 3POXA 1T1LA 4RL9A 3VZWX 4GCSA 3POUA 4JCHA 5B66O 2R4NA 4IL6O 3BS0A 4QQ1A 4KR8A 3A2SX 4AYEC 5G26A 1BXWA 3AA0A 3DA3A 4Z3TA 4FOZA 2ERVA 2XE3A 4LSHA 4N58A 3TZGA 3VZTX 4GHBA 3NSGA 2X9KA 5AFUK 3PGRA 2GE4A 4FZLA 3VY9X 3WI4A 4GF4A 2JQYA 3WU2O 5TISO 3VE1A 4PR7A 2XE1A 2FGQX 2PORA 2XG6A 2K0LA 2M06A 3PGSA 3KZIO 1PHOA 3JCUO 3T0SA 2PRNA 5T5FA 1ZHZA 4FZMA 2R4PA 4FSPA 2F1VA 1MPFA 3AA7B 2AXTO 3AAAB 2Y0HA 5DL7A 2KXPA 3A0BO 2Y0KA 2YNKA 3AA6A 3AA0B 3WI5A 3K19A 3LK2A 1G90A 2R8AA 1P4TA 2K4TA 4AKMA 3SZVA 3SZDA 3PRNA 1OSMA 3SY9A 3HOLA 3BRYA 4RJXA 4FQEA 2QTKA 2X27X 5KAFO 3HOEA 5GV0A 5H2FO 1ORMA 5E79O 4U9CA 3A0HO 4AYID 4K3BA 2ZFGA 2XE2A 4GCPA 4O49A 5G3AA 4B61A 1MM5A 4LSIA 4N59A 5G39A 5DL6A 1THQA 4N74A 3AA6B 5DL5A 5G38A 2FGRA 2ZLDA 4G75A 4C4VA 2Y7SA 7PRNA 1QJ9A 2KC0A 2YPVA 1ZHWA 5AFUL 4FUVA 8PRNA 5B5EO 4PUXA 1Q9FA 3SYSA 5ADXL 1PRNA 3LK2B 4XNLA 2R88A 4C69X 2N2MA 2J1NA 2J4UP 3AA7A 2KDYA 3AAAA 2M07A 4O4XA 4XNKA 5JDPA 1GFOA 3T20A 3PORA 4AYDC 1E54A 3PQUA 4RLBA 1QJ8A 5FVNA 2JMMA 1BT9A 3UAQA 4AYMC 1IZNA 1ZHTA 5GTHO 1HXUA 2R4LA 4AZLA 3LK41 3POQA 5KAIO 4C4VB 5GTIO 4AKRB 2Y0LA 4KR4A 4O3YA 1GFQA 5DL8A 3RBHA 3AA1A 3AAEA 4LSEA 4D65A 1ZHYA 3BRZA 4LSFA 2WJQA 4FZNA 2IWWA 2KZ7A 3PF1A 4AUIA 2IWVA 1MM4A 3DWNA 1S5LO 2W80C 4FSOA 1GFNA 4KRAA 3LK42 4O3XB 4UB6O 5ADXK 3C5OA 2OMFA 3VY8X 5IYUA 3KVDD 4FMSA 1GFMA 1YS5A 2F1TA 3PQSA 3O0EA 2O4VA 2XTRA 3QRCA 4FRTA 3GP6A 4G76A 5PRNA 4F4BA 4N75A 3LK3A 2XE5A 4GCQA 3DWOX 2WVPA 4K3CA 4C00A 3JTYA 4D5UA 4PJ0O 1BH3A 3SYBA 1IZNB 1HXTA 1T16A 2KZ7B 2LHFA 2R4OA 3G7GA 2WJRA 3HW9A 4CTDA 6PRNA 3FYXA 3EMNX 3QRAA 4JFBA 2XMXA 4FT6A 4O4UA 3VE2A 4UB8O 3UPGA 4O3ZA 2R89A 3DA4A 1Q9GA 1OPFA 1ZHXA 2W81C 2MHLA 5D5DA 3VZUX 3UU2A 1HXXA 1GFPA 1QJPA 3T24A 4AKRA 3HWBA 4BUMX 4RJWA 2XTQA 3AA1B 3AAEB 2KXPB 3PGUA 4RLCA 3DZMA 5EE2A 4AFKA 4D64A 2ODJA
chains in the Genus database with same CATH topology
4FRXA 2N2LA 3LK3B 4AYNA 2Y2XA 1H6S1 4FESA 4E1SA 3SY7A 2LFUA 4E1TA 2MNHA 4O3WA 3V8UA 3POXA 4RL9A 3VZWX 4GCSA 3POUA 4JCHA 4QQ1A 4KR8A 3A2SX 4AYEC 5G26A 1BXWA 3AA0A 3DA3A 4Z3TA 4FOZA 2ERVA 2XE3A 4LSHA 4N58A 3TZGA 3VZTX 4GHBA 3NSGA 5AFUK 2GE4A 4FZLA 3VY9X 3WI4A 4GF4A 3VE1A 2XE1A 2FGQX 2PORA 2XG6A 2K0LA 2M06A 1PHOA 3T0SA 2PRNA 5T5FA 1ZHZA 4FZMA 4FSPA 2F1VA 1MPFA 3AA7B 3AAAB 2Y0HA 5DL7A 2KXPA 3AA0B 2Y0KA 2YNKA 3AA6A 3WI5A 1G90A 3K19A 3LK2A 1P4TA 2K4TA 4AKMA 3SZVA 3SZDA 3PRNA 1OSMA 3SY9A 3HOLA 4RJXA 2QTKA 2X27X 3HOEA 5GV0A 1ORMA 4U9CA 4AYID 2ZFGA 2XE2A 4GCPA 4O49A 4B61A 1MM5A 4LSIA 4N59A 5DL6A 1THQA 5DL5A 3AA6B 7PRNA 2FGRA 2ZLDA 4G75A 2Y7SA 1QJ9A 2KC0A 2YPVA 1ZHWA 5AFUL 4FUVA 8PRNA 5ADXL 4PUXA 1Q9FA 3SYSA 1PRNA 3LK2B 4XNLA 4C69X 2N2MA 2J1NA 2J4UP 3AA7A 2KDYA 3AAAA 2M07A 4O4XA 4XNKA 5JDPA 1GFOA 3T20A 3PORA 4AYDC 1E54A 3PQUA 4RLBA 1QJ8A 5FVNA 2JMMA 1BT9A 3UAQA 4AYMC 1IZNA 1ZHTA 1HXUA 4AZLA 3LK41 3POQA 4AKRB 2Y0LA 4KR4A 4O3YA 1GFQA 5DL8A 3RBHA 3AA1A 3AAEA 4LSEA 4D65A 1ZHYA 4LSFA 4FZNA 2KZ7A 4AUIA 1MM4A 2W80C 4FSOA 1GFNA 4KRAA 3LK42 4O3XB 5ADXK 3C5OA 2OMFA 3VY8X 5IYUA 3KVDD 4FMSA 1GFMA 1YS5A 2F1TA 3PQSA 3O0EA 2O4VA 2XTRA 3QRCA 4FRTA 3GP6A 4G76A 5PRNA 4F4BA 3LK3A 2XE5A 4GCQA 3JTYA 4D5UA 1BH3A 3SYBA 1IZNB 1HXTA 2KZ7B 2LHFA 3G7GA 3HW9A 6PRNA 3FYXA 3EMNX 3QRAA 4JFBA 2XMXA 4FT6A 4O4UA 3VE2A 3UPGA 4O3ZA 3DA4A 1Q9GA 1OPFA 1ZHXA 2W81C 2MHLA 5D5DA 3VZUX 3UU2A 1HXXA 1GFPA 1QJPA 3T24A 4AKRA 3HWBA 4BUMX 4RJWA 2XTQA 3AA1B 3AAEB 2KXPB 5EE2A 4RLCA 4AFKA 4D64A 2ODJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1S A;  4E1T A;  5G26 A; 
#chains in the Genus database with same CATH topology
 4FRX A;  2N2L A;  3LK3 B;  3NJT A;  4AYN A;  2Y2X A;  2F1C X;  1H6S 1;  4FES A;  4E1S A;  3SY7 A;  2LFU A;  4E1T A;  2MNH A;  4O3W A;  3V8U A;  3POX A;  1T1L A;  4RL9 A;  3VZW X;  4GCS A;  3POU A;  4JCH A;  5B66 O;  2R4N A;  4IL6 O;  3BS0 A;  4QQ1 A;  4KR8 A;  3A2S X;  4AYE C;  5G26 A;  1BXW A;  3AA0 A;  3DA3 A;  4Z3T A;  4FOZ A;  2ERV A;  2XE3 A;  4LSH A;  4N58 A;  3TZG A;  3VZT X;  4GHB A;  3NSG A;  2X9K A;  5AFU K;  3PGR A;  2GE4 A;  4FZL A;  3VY9 X;  3WI4 A;  4GF4 A;  2JQY A;  3WU2 O;  5TIS O;  3VE1 A;  4PR7 A;  2XE1 A;  2FGQ X;  2POR A;  2XG6 A;  2K0L A;  2M06 A;  3PGS A;  3KZI O;  1PHO A;  3JCU O;  3T0S A;  2PRN A;  5T5F A;  1ZHZ A;  4FZM A;  2R4P A;  4FSP A;  2F1V A;  1MPF A;  3AA7 B;  2AXT O;  3AAA B;  2Y0H A;  5DL7 A;  2KXP A;  3A0B O;  2Y0K A;  2YNK A;  3AA6 A;  3AA0 B;  3WI5 A;  3K19 A;  3LK2 A;  1G90 A;  2R8A A;  1P4T A;  2K4T A;  4AKM A;  3SZV A;  3SZD A;  3PRN A;  1OSM A;  3SY9 A;  3HOL A;  3BRY A;  4RJX A;  4FQE A;  2QTK A;  2X27 X;  5KAF O;  3HOE A;  5GV0 A;  5H2F O;  1ORM A;  5E79 O;  4U9C A;  3A0H O;  4AYI D;  4K3B A;  2ZFG A;  2XE2 A;  4GCP A;  4O49 A;  5G3A A;  4B61 A;  1MM5 A;  4LSI A;  4N59 A;  5G39 A;  5DL6 A;  1THQ A;  4N74 A;  3AA6 B;  5DL5 A;  5G38 A;  2FGR A;  2ZLD A;  4G75 A;  4C4V A;  2Y7S A;  7PRN A;  1QJ9 A;  2KC0 A;  2YPV A;  1ZHW A;  5AFU L;  4FUV A;  8PRN A;  5B5E O;  4PUX A;  1Q9F A;  3SYS A;  5ADX L;  1PRN A;  3LK2 B;  4XNL A;  2R88 A;  4C69 X;  2N2M A;  2J1N A;  2J4U P;  3AA7 A;  2KDY A;  3AAA A;  2M07 A;  4O4X A;  4XNK A;  5JDP A;  1GFO A;  3T20 A;  3POR A;  4AYD C;  1E54 A;  3PQU A;  4RLB A;  1QJ8 A;  5FVN A;  2JMM A;  1BT9 A;  3UAQ A;  4AYM C;  1IZN A;  1ZHT A;  5GTH O;  1HXU A;  2R4L A;  4AZL A;  3LK4 1;  3POQ A;  5KAI O;  4C4V B;  5GTI O;  4AKR B;  2Y0L A;  4KR4 A;  4O3Y A;  1GFQ A;  5DL8 A;  3RBH A;  3AA1 A;  3AAE A;  4LSE A;  4D65 A;  1ZHY A;  3BRZ A;  4LSF A;  2WJQ A;  4FZN A;  2IWW A;  2KZ7 A;  3PF1 A;  4AUI A;  2IWV A;  1MM4 A;  3DWN A;  1S5L O;  2W80 C;  4FSO A;  1GFN A;  4KRA A;  3LK4 2;  4O3X B;  4UB6 O;  5ADX K;  3C5O A;  2OMF A;  3VY8 X;  5IYU A;  3KVD D;  4FMS A;  1GFM A;  1YS5 A;  2F1T A;  3PQS A;  3O0E A;  2O4V A;  2XTR A;  3QRC A;  4FRT A;  3GP6 A;  4G76 A;  5PRN A;  4F4B A;  4N75 A;  3LK3 A;  2XE5 A;  4GCQ A;  3DWO X;  2WVP A;  4K3C A;  4C00 A;  3JTY A;  4D5U A;  4PJ0 O;  1BH3 A;  3SYB A;  1IZN B;  1HXT A;  1T16 A;  2KZ7 B;  2LHF A;  2R4O A;  3G7G A;  2WJR A;  3HW9 A;  4CTD A;  6PRN A;  3FYX A;  3EMN X;  3QRA A;  4JFB A;  2XMX A;  4FT6 A;  4O4U A;  3VE2 A;  4UB8 O;  3UPG A;  4O3Z A;  2R89 A;  3DA4 A;  1Q9G A;  1OPF A;  1ZHX A;  2W81 C;  2MHL A;  5D5D A;  3VZU X;  3UU2 A;  1HXX A;  1GFP A;  1QJP A;  3T24 A;  4AKR A;  3HWB A;  4BUM X;  4RJW A;  2XTQ A;  3AA1 B;  3AAE B;  2KXP B;  3PGU A;  4RLC A;  3DZM A;  5EE2 A;  4AFK A;  4D64 A;  2ODJ A; 
#chains in the Genus database with same CATH homology
 4FRX A;  2N2L A;  3LK3 B;  4AYN A;  2Y2X A;  1H6S 1;  4FES A;  4E1S A;  3SY7 A;  2LFU A;  4E1T A;  2MNH A;  4O3W A;  3V8U A;  3POX A;  4RL9 A;  3VZW X;  4GCS A;  3POU A;  4JCH A;  4QQ1 A;  4KR8 A;  3A2S X;  4AYE C;  5G26 A;  1BXW A;  3AA0 A;  3DA3 A;  4Z3T A;  4FOZ A;  2ERV A;  2XE3 A;  4LSH A;  4N58 A;  3TZG A;  3VZT X;  4GHB A;  3NSG A;  5AFU K;  2GE4 A;  4FZL A;  3VY9 X;  3WI4 A;  4GF4 A;  3VE1 A;  2XE1 A;  2FGQ X;  2POR A;  2XG6 A;  2K0L A;  2M06 A;  1PHO A;  3T0S A;  2PRN A;  5T5F A;  1ZHZ A;  4FZM A;  4FSP A;  2F1V A;  1MPF A;  3AA7 B;  3AAA B;  2Y0H A;  5DL7 A;  2KXP A;  3AA0 B;  2Y0K A;  2YNK A;  3AA6 A;  3WI5 A;  1G90 A;  3K19 A;  3LK2 A;  1P4T A;  2K4T A;  4AKM A;  3SZV A;  3SZD A;  3PRN A;  1OSM A;  3SY9 A;  3HOL A;  4RJX A;  2QTK A;  2X27 X;  3HOE A;  5GV0 A;  1ORM A;  4U9C A;  4AYI D;  2ZFG A;  2XE2 A;  4GCP A;  4O49 A;  4B61 A;  1MM5 A;  4LSI A;  4N59 A;  5DL6 A;  1THQ A;  5DL5 A;  3AA6 B;  7PRN A;  2FGR A;  2ZLD A;  4G75 A;  2Y7S A;  1QJ9 A;  2KC0 A;  2YPV A;  1ZHW A;  5AFU L;  4FUV A;  8PRN A;  5ADX L;  4PUX A;  1Q9F A;  3SYS A;  1PRN A;  3LK2 B;  4XNL A;  4C69 X;  2N2M A;  2J1N A;  2J4U P;  3AA7 A;  2KDY A;  3AAA A;  2M07 A;  4O4X A;  4XNK A;  5JDP A;  1GFO A;  3T20 A;  3POR A;  4AYD C;  1E54 A;  3PQU A;  4RLB A;  1QJ8 A;  5FVN A;  2JMM A;  1BT9 A;  3UAQ A;  4AYM C;  1IZN A;  1ZHT A;  1HXU A;  4AZL A;  3LK4 1;  3POQ A;  4AKR B;  2Y0L A;  4KR4 A;  4O3Y A;  1GFQ A;  5DL8 A;  3RBH A;  3AA1 A;  3AAE A;  4LSE A;  4D65 A;  1ZHY A;  4LSF A;  4FZN A;  2KZ7 A;  4AUI A;  1MM4 A;  2W80 C;  4FSO A;  1GFN A;  4KRA A;  3LK4 2;  4O3X B;  5ADX K;  3C5O A;  2OMF A;  3VY8 X;  5IYU A;  3KVD D;  4FMS A;  1GFM A;  1YS5 A;  2F1T A;  3PQS A;  3O0E A;  2O4V A;  2XTR A;  3QRC A;  4FRT A;  3GP6 A;  4G76 A;  5PRN A;  4F4B A;  3LK3 A;  2XE5 A;  4GCQ A;  3JTY A;  4D5U A;  1BH3 A;  3SYB A;  1IZN B;  1HXT A;  2KZ7 B;  2LHF A;  3G7G A;  3HW9 A;  6PRN A;  3FYX A;  3EMN X;  3QRA A;  4JFB A;  2XMX A;  4FT6 A;  4O4U A;  3VE2 A;  3UPG A;  4O3Z A;  3DA4 A;  1Q9G A;  1OPF A;  1ZHX A;  2W81 C;  2MHL A;  5D5D A;  3VZU X;  3UU2 A;  1HXX A;  1GFP A;  1QJP A;  3T24 A;  4AKR A;  3HWB A;  4BUM X;  4RJW A;  2XTQ A;  3AA1 B;  3AAE B;  2KXP B;  5EE2 A;  4RLC A;  4AFK A;  4D64 A;  2ODJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...