4E1SA

X-ray crystal structure of the transmembrane beta-domain from intimin from ehec strain o157:h7
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
242
structure length
242
Chain Sequence
QHYGTAEVNLQSGNNFDGSSLDFLLPFYDSEKMLAFGQVGARYIDSRFTANLGAGQRFFLPANMLGYNVFIDQDFSGDNTRLGIGGEYWRDYFKSSVNGYFRMSGWHESYNKKDYDERPANGFDIRFNGYLPSYPALGAKLIYEQYYGDNVALFNSDKLQSNPGAATVGVNYTPIPLVTMGIDYRHGTGNENDLLYSMQFRYQFDKSWSQQIEPQYVNELRTLSGSRYDLVQRNNNIILEYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intimin
publication title Crystal Structures of the Outer Membrane Domain of Intimin and Invasin from Enterohemorrhagic E. coli and Enteropathogenic Y. pseudotuberculosis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 69
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2012-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 4e1sA00
4E1SA 4E1TA 5G26A
chains in the Genus database with same CATH superfamily
2Y0LA 1BXWA 2KZ7B 2KZ7A 3DWNA 4KR4A 3G7GA 3PQUA 4PR7A 4O3XB 1OSMA 3PGSA 1HXUA 3POUA 4N59A 4O3WA 4D65A 1T16A 3BRZA 5AFUK 1PRNA 1MM5A 5D5DA 4CTDA 3VZTX 2R4PA 2XE2A 3WU2O 3VY8X 4LSEA 3PF1A 3HWBA 4D5UA 3WI4A 3JCUO 4RL9A 4AYDC 2QTKA 3DWOX 2WVPA 4D64A 5T5FA 4LSFA 4FZLA 4FUVA 3SYSA 3PGRA 2XG6A 3PGUA 4GHBA 4FSOA 3TZGA 4AKMA 3VY9X 2Y0KA 4PUXA 3PQSA 2F1CX 4GCQA 3RBHA 2MNHA 1BH3A 4UB6O 4FOZA 2KC0A 4GF4A 4RLCA 5DL7A 3DA4A 2PORA 2WJRA 4AYMC 3AA7B 3AA7A 4XNLA 3VZWX 5IYUA 3A0HO 6PRNA 2OMFA 3SZDA 3POXA 2F1VA 2R89A 3HOLA 4G75A 2F1TA 2R88A 5TISO 4RJXA 2N2MA 2Y2XA 3KVDD 2AXTO 1Q9FA 3T20A 7PRNA 4O3YA 3A2SX 1ZHTA 3WI5A 4AUIA 4KRAA 2K4TA 1P4TA 4O49A 1T1LA 4PJ0O 1ZHYA 4BUMX 1QJ9A 5PRNA 1QJPA 2XE5A 2FGQX 4N58A 3SYBA 1GFMA 4GCSA 2MHLA 4O3ZA 3HOEA 3O0EA 2GE4A 2N2LA 2XTQA 4QQ1A 4RLBA 4AZLA 1QJ8A 4U9CA 3POQA 5B66O 1G90A 2JMMA 2W80C 4AYID 4C00A 3VZUX 2PRNA 1GFPA 4FRTA 2ZLDA 5G26A 2ZFGA 3DZMA 1GFOA 3NJTA 2LHFA 2XE3A 3AA0B 3AA0A 3QRAA 3K19A 4K3BA 3LK3B 1OPFA 3LK3A 4FMSA 5E79O 4N75A 4F4BA 3BRYA 4JCHA 3JTYA 4GCPA 2X27X 4FRXA 3GP6A 2X9KA 3A0BO 3LK41 8PRNA 3UPGA 1ZHXA 3BS0A 3QRCA 4N74A 4LSIA 3AA1B 5DL8A 4UB8O 3DA3A 5ADXK 2O4VA 1ZHWA 5AFUL 3UAQA 2JQYA 3AA6B 3LK42 3AA6A 4C69X 2FGRA 1E54A 3AAEB 1ORMA 5G39A 3SY7A 3LK2B 3LK2A 3VE2A 4KR8A 5G38A 3T0SA 1ZHZA 2KDYA 2XMXA 4AYNA 5JDPA 1GFQA 1HXTA 4JFBA 2XE1A 4FESA 4AFKA 4XNKA 2ERVA 2YNKA 4IL6O 5B5EO 1S5LO 5GTHO 5GV0A 4FT6A 4FZNA 4FQEA 4Z3TA 3EMNX 3FYXA 5KAFO 1MM4A 1BT9A 2J1NA 4E1TA 1YS5A 1THQA 4K3CA 5KAIO 5H2FO 3NSGA 5DL5A 4C4VB 4C4VA 1Q9GA 2XTRA 4FZMA 4AKRB 4LSHA 4AKRA 1IZNB 5EE2A 1IZNA 4O4UA 4RJWA 2WJQA 4AYEC 2YPVA 4G76A 5GTIO 3UU2A 2R4OA 3AA1A 3AAAB 3AAAA 4FSPA 3PRNA 1H6S1 4B61A 2KXPB 2IWWA 2KXPA 2Y7SA 5FVNA 2Y0HA 2R4LA 3KZIO 3SZVA 5ADXL 2J4UP 2M07A 3AAEA 3C5OA 1MPFA 3SY9A 5DL6A 2W81C 1HXXA 3T24A 3HW9A 3VE1A 2LFUA 4E1SA 1PHOA 4O4XA 2K0LA 3V8UA 2IWVA 3PORA 2M06A 2ODJA 2R8AA 5G3AA 1GFNA 2R4NA
chains in the Genus database with same CATH topology
2Y0LA 1BXWA 2KZ7B 2KZ7A 4KR4A 3G7GA 3PQUA 4O3XB 1OSMA 1HXUA 3POUA 4N59A 4O3WA 4D65A 5AFUK 1PRNA 1MM5A 5D5DA 3VZTX 2XE2A 3VY8X 4LSEA 3HWBA 4D5UA 3WI4A 4RL9A 4AYDC 2QTKA 4D64A 5T5FA 4LSFA 4FZLA 4FUVA 3SYSA 2XG6A 4GHBA 4FSOA 3TZGA 4AKMA 3VY9X 2Y0KA 4PUXA 3PQSA 4GCQA 3RBHA 2MNHA 1BH3A 5DL7A 4FOZA 2KC0A 4GF4A 4RLCA 3DA4A 2PORA 4AYMC 3AA7B 3AA7A 4XNLA 3VZWX 5IYUA 6PRNA 2OMFA 3SZDA 3POXA 2F1VA 3HOLA 4G75A 2F1TA 4RJXA 2N2MA 2Y2XA 3KVDD 1Q9FA 3T20A 7PRNA 4O3YA 3A2SX 1ZHTA 3WI5A 4AUIA 4KRAA 2K4TA 1P4TA 4O49A 1ZHYA 4BUMX 1QJ9A 5PRNA 1QJPA 2XE5A 2FGQX 4N58A 3SYBA 1GFMA 4GCSA 2MHLA 4O3ZA 3HOEA 3O0EA 2GE4A 2N2LA 2XTQA 4QQ1A 4RLBA 4AZLA 1QJ8A 4U9CA 3POQA 1G90A 2JMMA 4AYID 3VZUX 2PRNA 1GFPA 4FRTA 2ZLDA 5G26A 2ZFGA 1GFOA 2LHFA 2XE3A 3AA0B 3AA0A 3QRAA 3K19A 3LK3B 1OPFA 3LK3A 4FMSA 4F4BA 4JCHA 3JTYA 4GCPA 2X27X 4FRXA 3GP6A 3UPGA 3LK41 8PRNA 1ZHXA 3QRCA 5DL8A 4LSIA 3AA1B 5ADXK 3DA3A 2O4VA 1ZHWA 5AFUL 3UAQA 4C69X 3AA6B 3LK42 3AA6A 2FGRA 1E54A 3AAEB 1ORMA 3SY7A 3LK2B 3LK2A 3VE2A 4KR8A 3T0SA 1ZHZA 2KDYA 2XMXA 4AYNA 5JDPA 1GFQA 1HXTA 4JFBA 2XE1A 4FESA 4AFKA 4XNKA 2ERVA 2YNKA 5GV0A 4FT6A 4FZNA 4Z3TA 3EMNX 3FYXA 1MM4A 1BT9A 2J1NA 4E1TA 1YS5A 1THQA 3NSGA 5DL5A 1Q9GA 2XTRA 4FZMA 4AKRB 4LSHA 4AKRA 1IZNB 5EE2A 1IZNA 4O4UA 4RJWA 4AYEC 2YPVA 4G76A 3UU2A 3AA1A 3AAAB 3AAAA 4FSPA 3PRNA 1H6S1 4B61A 2KXPB 2KXPA 2Y7SA 5FVNA 2Y0HA 5ADXL 3SZVA 2J4UP 2M07A 3AAEA 3C5OA 1MPFA 3SY9A 5DL6A 2W81C 1HXXA 3T24A 3HW9A 3VE1A 2LFUA 4E1SA 1PHOA 4O4XA 2K0LA 3V8UA 3PORA 2M06A 2ODJA 1GFNA 2W80C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1S A;  4E1T A;  5G26 A; 
#chains in the Genus database with same CATH topology
 2Y0L A;  1BXW A;  2KZ7 B;  2KZ7 A;  3DWN A;  4KR4 A;  3G7G A;  3PQU A;  4PR7 A;  4O3X B;  1OSM A;  3PGS A;  1HXU A;  3POU A;  4N59 A;  4O3W A;  4D65 A;  1T16 A;  3BRZ A;  5AFU K;  1PRN A;  1MM5 A;  5D5D A;  4CTD A;  3VZT X;  2R4P A;  2XE2 A;  3WU2 O;  3VY8 X;  4LSE A;  3PF1 A;  3HWB A;  4D5U A;  3WI4 A;  3JCU O;  4RL9 A;  4AYD C;  2QTK A;  3DWO X;  2WVP A;  4D64 A;  5T5F A;  4LSF A;  4FZL A;  4FUV A;  3SYS A;  3PGR A;  2XG6 A;  3PGU A;  4GHB A;  4FSO A;  3TZG A;  4AKM A;  3VY9 X;  2Y0K A;  4PUX A;  3PQS A;  2F1C X;  4GCQ A;  3RBH A;  2MNH A;  1BH3 A;  4UB6 O;  4FOZ A;  2KC0 A;  4GF4 A;  4RLC A;  5DL7 A;  3DA4 A;  2POR A;  2WJR A;  4AYM C;  3AA7 B;  3AA7 A;  4XNL A;  3VZW X;  5IYU A;  3A0H O;  6PRN A;  2OMF A;  3SZD A;  3POX A;  2F1V A;  2R89 A;  3HOL A;  4G75 A;  2F1T A;  2R88 A;  5TIS O;  4RJX A;  2N2M A;  2Y2X A;  3KVD D;  2AXT O;  1Q9F A;  3T20 A;  7PRN A;  4O3Y A;  3A2S X;  1ZHT A;  3WI5 A;  4AUI A;  4KRA A;  2K4T A;  1P4T A;  4O49 A;  1T1L A;  4PJ0 O;  1ZHY A;  4BUM X;  1QJ9 A;  5PRN A;  1QJP A;  2XE5 A;  2FGQ X;  4N58 A;  3SYB A;  1GFM A;  4GCS A;  2MHL A;  4O3Z A;  3HOE A;  3O0E A;  2GE4 A;  2N2L A;  2XTQ A;  4QQ1 A;  4RLB A;  4AZL A;  1QJ8 A;  4U9C A;  3POQ A;  5B66 O;  1G90 A;  2JMM A;  2W80 C;  4AYI D;  4C00 A;  3VZU X;  2PRN A;  1GFP A;  4FRT A;  2ZLD A;  5G26 A;  2ZFG A;  3DZM A;  1GFO A;  3NJT A;  2LHF A;  2XE3 A;  3AA0 B;  3AA0 A;  3QRA A;  3K19 A;  4K3B A;  3LK3 B;  1OPF A;  3LK3 A;  4FMS A;  5E79 O;  4N75 A;  4F4B A;  3BRY A;  4JCH A;  3JTY A;  4GCP A;  2X27 X;  4FRX A;  3GP6 A;  2X9K A;  3A0B O;  3LK4 1;  8PRN A;  3UPG A;  1ZHX A;  3BS0 A;  3QRC A;  4N74 A;  4LSI A;  3AA1 B;  5DL8 A;  4UB8 O;  3DA3 A;  5ADX K;  2O4V A;  1ZHW A;  5AFU L;  3UAQ A;  2JQY A;  3AA6 B;  3LK4 2;  3AA6 A;  4C69 X;  2FGR A;  1E54 A;  3AAE B;  1ORM A;  5G39 A;  3SY7 A;  3LK2 B;  3LK2 A;  3VE2 A;  4KR8 A;  5G38 A;  3T0S A;  1ZHZ A;  2KDY A;  2XMX A;  4AYN A;  5JDP A;  1GFQ A;  1HXT A;  4JFB A;  2XE1 A;  4FES A;  4AFK A;  4XNK A;  2ERV A;  2YNK A;  4IL6 O;  5B5E O;  1S5L O;  5GTH O;  5GV0 A;  4FT6 A;  4FZN A;  4FQE A;  4Z3T A;  3EMN X;  3FYX A;  5KAF O;  1MM4 A;  1BT9 A;  2J1N A;  4E1T A;  1YS5 A;  1THQ A;  4K3C A;  5KAI O;  5H2F O;  3NSG A;  5DL5 A;  4C4V B;  4C4V A;  1Q9G A;  2XTR A;  4FZM A;  4AKR B;  4LSH A;  4AKR A;  1IZN B;  5EE2 A;  1IZN A;  4O4U A;  4RJW A;  2WJQ A;  4AYE C;  2YPV A;  4G76 A;  5GTI O;  3UU2 A;  2R4O A;  3AA1 A;  3AAA B;  3AAA A;  4FSP A;  3PRN A;  1H6S 1;  4B61 A;  2KXP B;  2IWW A;  2KXP A;  2Y7S A;  5FVN A;  2Y0H A;  2R4L A;  3KZI O;  3SZV A;  5ADX L;  2J4U P;  2M07 A;  3AAE A;  3C5O A;  1MPF A;  3SY9 A;  5DL6 A;  2W81 C;  1HXX A;  3T24 A;  3HW9 A;  3VE1 A;  2LFU A;  4E1S A;  1PHO A;  4O4X A;  2K0L A;  3V8U A;  2IWV A;  3POR A;  2M06 A;  2ODJ A;  2R8A A;  5G3A A;  1GFN A;  2R4N A; 
#chains in the Genus database with same CATH homology
 2Y0L A;  1BXW A;  2KZ7 B;  2KZ7 A;  4KR4 A;  3G7G A;  3PQU A;  4O3X B;  1OSM A;  1HXU A;  3POU A;  4N59 A;  4O3W A;  4D65 A;  5AFU K;  1PRN A;  1MM5 A;  5D5D A;  3VZT X;  2XE2 A;  3VY8 X;  4LSE A;  3HWB A;  4D5U A;  3WI4 A;  4RL9 A;  4AYD C;  2QTK A;  4D64 A;  5T5F A;  4LSF A;  4FZL A;  4FUV A;  3SYS A;  2XG6 A;  4GHB A;  4FSO A;  3TZG A;  4AKM A;  3VY9 X;  2Y0K A;  4PUX A;  3PQS A;  4GCQ A;  3RBH A;  2MNH A;  1BH3 A;  5DL7 A;  4FOZ A;  2KC0 A;  4GF4 A;  4RLC A;  3DA4 A;  2POR A;  4AYM C;  3AA7 B;  3AA7 A;  4XNL A;  3VZW X;  5IYU A;  6PRN A;  2OMF A;  3SZD A;  3POX A;  2F1V A;  3HOL A;  4G75 A;  2F1T A;  4RJX A;  2N2M A;  2Y2X A;  3KVD D;  1Q9F A;  3T20 A;  7PRN A;  4O3Y A;  3A2S X;  1ZHT A;  3WI5 A;  4AUI A;  4KRA A;  2K4T A;  1P4T A;  4O49 A;  1ZHY A;  4BUM X;  1QJ9 A;  5PRN A;  1QJP A;  2XE5 A;  2FGQ X;  4N58 A;  3SYB A;  1GFM A;  4GCS A;  2MHL A;  4O3Z A;  3HOE A;  3O0E A;  2GE4 A;  2N2L A;  2XTQ A;  4QQ1 A;  4RLB A;  4AZL A;  1QJ8 A;  4U9C A;  3POQ A;  1G90 A;  2JMM A;  4AYI D;  3VZU X;  2PRN A;  1GFP A;  4FRT A;  2ZLD A;  5G26 A;  2ZFG A;  1GFO A;  2LHF A;  2XE3 A;  3AA0 B;  3AA0 A;  3QRA A;  3K19 A;  3LK3 B;  1OPF A;  3LK3 A;  4FMS A;  4F4B A;  4JCH A;  3JTY A;  4GCP A;  2X27 X;  4FRX A;  3GP6 A;  3UPG A;  3LK4 1;  8PRN A;  1ZHX A;  3QRC A;  5DL8 A;  4LSI A;  3AA1 B;  5ADX K;  3DA3 A;  2O4V A;  1ZHW A;  5AFU L;  3UAQ A;  4C69 X;  3AA6 B;  3LK4 2;  3AA6 A;  2FGR A;  1E54 A;  3AAE B;  1ORM A;  3SY7 A;  3LK2 B;  3LK2 A;  3VE2 A;  4KR8 A;  3T0S A;  1ZHZ A;  2KDY A;  2XMX A;  4AYN A;  5JDP A;  1GFQ A;  1HXT A;  4JFB A;  2XE1 A;  4FES A;  4AFK A;  4XNK A;  2ERV A;  2YNK A;  5GV0 A;  4FT6 A;  4FZN A;  4Z3T A;  3EMN X;  3FYX A;  1MM4 A;  1BT9 A;  2J1N A;  4E1T A;  1YS5 A;  1THQ A;  3NSG A;  5DL5 A;  1Q9G A;  2XTR A;  4FZM A;  4AKR B;  4LSH A;  4AKR A;  1IZN B;  5EE2 A;  1IZN A;  4O4U A;  4RJW A;  4AYE C;  2YPV A;  4G76 A;  3UU2 A;  3AA1 A;  3AAA B;  3AAA A;  4FSP A;  3PRN A;  1H6S 1;  4B61 A;  2KXP B;  2KXP A;  2Y7S A;  5FVN A;  2Y0H A;  5ADX L;  3SZV A;  2J4U P;  2M07 A;  3AAE A;  3C5O A;  1MPF A;  3SY9 A;  5DL6 A;  2W81 C;  1HXX A;  3T24 A;  3HW9 A;  3VE1 A;  2LFU A;  4E1S A;  1PHO A;  4O4X A;  2K0L A;  3V8U A;  3POR A;  2M06 A;  2ODJ A;  1GFN A;  2W80 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...