4E1TA

X-ray crystal structure of the transmembrane beta-domain from invasin from yersinia pseudotuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MNRFGTAQVNLNFDKNFSLKESSLDWLAPWYDSASFLFFSQLGIRNKDSRNTLNLGVGIRTLENGWLYGLNTFYDNDLTGHNHRIGLGAEAWTDYLQLAANGYFRLNGWHSSRDFSDYKERPATGGDLRANAYLPALPQLGGKLMYEQYTGERVALFGKDNLQRNPYAVTAGINYTPVPLLTVGVDQRMGKSSKHETQWNLQMNYRFGESFQSQLSPSAVAGTRLLAESRYNLVDRNNNIVLEYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Outer Membrane Domain of Intimin and Invasin from Enterohemorrhagic E. coli and Enteropathogenic Y. pseudotuberculosis.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Cell adhesion
molecule keywords Invasin
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 4e1tA00
5G26A 4E1SA 4E1TA
chains in the Genus database with same CATH superfamily
2LHFA 3NSGA 3DWOX 3AA6B 4N75A 4JFBA 4FZMA 2F1CX 4FMSA 5DL6A 2MHLA 3LK42 5TISO 3AA0A 4PUXA 1BXWA 2ODJA 3A2SX 5DL5A 2R4OA 5E79O 5JDPA 2KXPB 3VZTX 2IWVA 2XTRA 1QJ8A 3GP6A 5G26A 4C00A 3BRYA 3T24A 3WI5A 5GV0A 1Q9GA 3NJTA 3HWBA 3AAAA 1GFMA 3QRAA 2XG6A 4FQEA 2OMFA 4O3WA 3SYBA 3SZVA 2KZ7B 5FVNA 3QRCA 3VZUX 3PRNA 1OPFA 4E1TA 5ADXK 4N74A 5G39A 4AYID 5B5EO 2Y2XA 2WJQA 2R4PA 4FESA 3AAAB 4G75A 2KC0A 3WI4A 4CTDA 3RBHA 2K4TA 4AFKA 4XNLA 1OSMA 4QQ1A 4AYDC 3PQUA 2IWWA 1QJ9A 1PHOA 2Y7SA 5KAIO 3O0EA 2PORA 4U9CA 2FGQX 3T20A 3UAQA 3BS0A 3PGUA 4FZNA 3PGRA 4FZLA 4D5UA 2X27X 2KDYA 3SYSA 5AFUL 4PJ0O 1GFOA 4N58A 4O3XB 3AAEA 3EMNX 5ADXL 2JMMA 1MM4A 4LSIA 3AA6A 4LSFA 1ORMA 2KZ7A 3JCUO 4XNKA 4AYEC 3HW9A 5DL7A 1ZHTA 5H2FO 3UPGA 4O3ZA 4FT6A 1HXUA 4AKRA 2ZFGA 1H6S1 2GE4A 4KR4A 2MNHA 4N59A 5GTIO 3KVDD 3PGSA 1HXTA 3SY9A 1G90A 4AKRB 4E1SA 3POQA 3FYXA 4GHBA 1GFNA 2PRNA 3SY7A 4F4BA 5D5DA 2QTKA 3A0BO 2XTQA 3HOLA 3PF1A 1S5LO 2N2LA 3AAEB 3POXA 4D64A 4JCHA 3DZMA 2ERVA 4RLCA 1HXXA 5G38A 4RLBA 3AA1A 1YS5A 3PORA 4K3BA 2FGRA 7PRNA 1IZNB 4AYNA 2Y0LA 5G3AA 5PRNA 2O4VA 4K3CA 5DL8A 5EE2A 1ZHWA 2Y0KA 1IZNA 3DWNA 2W80C 1GFPA 3AA1B 3KZIO 4LSHA 3WU2O 4FUVA 2WVPA 2WJRA 1ZHYA 1ZHXA 2XE5A 4PR7A 4UB8O 3LK41 4AKMA 1E54A 4FSPA 1MM5A 2YPVA 2R4LA 4UB6O 4IL6O 2K0LA 4RJXA 4GCPA 2XMXA 2LFUA 3JTYA 4GCSA 5B66O 4Z3TA 5KAFO 3TZGA 3AA7A 5AFUK 3LK3B 2ZLDA 3K19A 4O49A 4FRXA 1BH3A 2R89A 3PQSA 2Y0HA 3DA4A 3HOEA 2YNKA 4B61A 1MPFA 3SZDA 5IYUA 3AA7B 1QJPA 3C5OA 2W81C 2R88A 2J4UP 1T16A 5T5FA 3VY8X 4C69X 4FSOA 2F1TA 3UU2A 4RJWA 3T0SA 3VE2A 1P4TA 4O3YA 2F1VA 4D65A 2XE2A 6PRNA 3BRZA 2R8AA 2R4NA 4KR8A 2X9KA 1Q9FA 3V8UA 3VE1A 2JQYA 3AA0B 3POUA 4FOZA 4O4XA 4BUMX 3LK2B 4AUIA 4C4VA 2KXPA 2XE3A 1BT9A 2M07A 3LK3A 1GFQA 1T1LA 1THQA 1ZHZA 4FRTA 3LK2A 4O4UA 4RL9A 4C4VB 4G76A 3DA3A 1PRNA 2N2MA 3G7GA 3VZWX 2AXTO 4KRAA 3A0HO 4AZLA 2XE1A 4LSEA 4GF4A 4AYMC 5GTHO 3VY9X 4GCQA 2J1NA 8PRNA 2M06A
chains in the Genus database with same CATH topology
2LHFA 3NSGA 3AA6B 4JFBA 4FZMA 5DL6A 4FMSA 2MHLA 3LK42 3AA0A 4PUXA 1BXWA 2ODJA 3A2SX 5DL5A 5JDPA 2KXPB 3VZTX 2XTRA 1QJ8A 3GP6A 5G26A 3T24A 3WI5A 5GV0A 1Q9GA 3QRAA 3HWBA 3AAAA 1GFMA 4O3WA 2OMFA 3SYBA 3SZVA 2KZ7B 5FVNA 3QRCA 3VZUX 3PRNA 1OPFA 4E1TA 5ADXK 4AYID 2Y2XA 4G75A 4FESA 3AAAB 3WI4A 2KC0A 3RBHA 2K4TA 4AFKA 4XNLA 1OSMA 4QQ1A 4AYDC 3PQUA 1QJ9A 1PHOA 2Y7SA 3O0EA 2PORA 4U9CA 2FGQX 3T20A 3UAQA 4FZNA 4FZLA 4D5UA 2X27X 2KDYA 3SYSA 5AFUL 1GFOA 4N58A 4O3XB 3AAEA 3EMNX 5ADXL 2JMMA 1MM4A 4LSIA 3AA6A 4LSFA 1ORMA 2KZ7A 4XNKA 4AYEC 3HW9A 5DL7A 1ZHTA 3UPGA 4O3ZA 4FT6A 1HXUA 4AKRA 2ZFGA 1H6S1 2GE4A 4KR4A 2MNHA 4N59A 3KVDD 3SY9A 1HXTA 1G90A 4AKRB 4E1SA 3POQA 3FYXA 4GHBA 1GFNA 2PRNA 3SY7A 4F4BA 5D5DA 2QTKA 3HOLA 2XTQA 2N2LA 3AAEB 3POXA 4D64A 4JCHA 2ERVA 4RLCA 1HXXA 4RLBA 3AA1A 1YS5A 3PORA 2FGRA 7PRNA 1IZNB 4AYNA 2Y0LA 5PRNA 2O4VA 5DL8A 5EE2A 1ZHWA 2Y0KA 1IZNA 2W80C 1GFPA 3AA1B 4LSHA 4FUVA 1ZHYA 1ZHXA 2XE5A 3LK41 4AKMA 1E54A 4FSPA 1MM5A 2YPVA 2K0LA 4RJXA 4GCPA 2XMXA 2LFUA 3JTYA 2M06A 4GCSA 4Z3TA 3TZGA 3AA7A 5AFUK 3LK3B 2ZLDA 3K19A 4O49A 4FRXA 1BH3A 3PQSA 2Y0HA 3DA4A 3HOEA 2YNKA 4B61A 1MPFA 3SZDA 5IYUA 3AA7B 1QJPA 3C5OA 2W81C 2J4UP 5T5FA 3VY8X 4C69X 4FSOA 2F1TA 3UU2A 4RJWA 3T0SA 3VE2A 1P4TA 4O3YA 2F1VA 4D65A 2XE2A 6PRNA 4KR8A 3V8UA 1Q9FA 3VE1A 3AA0B 3POUA 4O4XA 4FOZA 4BUMX 3LK2B 4AUIA 2KXPA 2XE3A 1BT9A 2M07A 3LK3A 1GFQA 1ZHZA 1THQA 4FRTA 4O4UA 3LK2A 4RL9A 4G76A 3DA3A 1PRNA 2N2MA 3G7GA 3VZWX 4KRAA 4AZLA 2XE1A 4LSEA 4GF4A 4AYMC 3VY9X 4GCQA 2J1NA 8PRNA 2XG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G26 A;  4E1S A;  4E1T A; 
#chains in the Genus database with same CATH topology
 2LHF A;  3NSG A;  3DWO X;  3AA6 B;  4N75 A;  4JFB A;  4FZM A;  2F1C X;  4FMS A;  5DL6 A;  2MHL A;  3LK4 2;  5TIS O;  3AA0 A;  4PUX A;  1BXW A;  2ODJ A;  3A2S X;  5DL5 A;  2R4O A;  5E79 O;  5JDP A;  2KXP B;  3VZT X;  2IWV A;  2XTR A;  1QJ8 A;  3GP6 A;  5G26 A;  4C00 A;  3BRY A;  3T24 A;  3WI5 A;  5GV0 A;  1Q9G A;  3NJT A;  3HWB A;  3AAA A;  1GFM A;  3QRA A;  2XG6 A;  4FQE A;  2OMF A;  4O3W A;  3SYB A;  3SZV A;  2KZ7 B;  5FVN A;  3QRC A;  3VZU X;  3PRN A;  1OPF A;  4E1T A;  5ADX K;  4N74 A;  5G39 A;  4AYI D;  5B5E O;  2Y2X A;  2WJQ A;  2R4P A;  4FES A;  3AAA B;  4G75 A;  2KC0 A;  3WI4 A;  4CTD A;  3RBH A;  2K4T A;  4AFK A;  4XNL A;  1OSM A;  4QQ1 A;  4AYD C;  3PQU A;  2IWW A;  1QJ9 A;  1PHO A;  2Y7S A;  5KAI O;  3O0E A;  2POR A;  4U9C A;  2FGQ X;  3T20 A;  3UAQ A;  3BS0 A;  3PGU A;  4FZN A;  3PGR A;  4FZL A;  4D5U A;  2X27 X;  2KDY A;  3SYS A;  5AFU L;  4PJ0 O;  1GFO A;  4N58 A;  4O3X B;  3AAE A;  3EMN X;  5ADX L;  2JMM A;  1MM4 A;  4LSI A;  3AA6 A;  4LSF A;  1ORM A;  2KZ7 A;  3JCU O;  4XNK A;  4AYE C;  3HW9 A;  5DL7 A;  1ZHT A;  5H2F O;  3UPG A;  4O3Z A;  4FT6 A;  1HXU A;  4AKR A;  2ZFG A;  1H6S 1;  2GE4 A;  4KR4 A;  2MNH A;  4N59 A;  5GTI O;  3KVD D;  3PGS A;  1HXT A;  3SY9 A;  1G90 A;  4AKR B;  4E1S A;  3POQ A;  3FYX A;  4GHB A;  1GFN A;  2PRN A;  3SY7 A;  4F4B A;  5D5D A;  2QTK A;  3A0B O;  2XTQ A;  3HOL A;  3PF1 A;  1S5L O;  2N2L A;  3AAE B;  3POX A;  4D64 A;  4JCH A;  3DZM A;  2ERV A;  4RLC A;  1HXX A;  5G38 A;  4RLB A;  3AA1 A;  1YS5 A;  3POR A;  4K3B A;  2FGR A;  7PRN A;  1IZN B;  4AYN A;  2Y0L A;  5G3A A;  5PRN A;  2O4V A;  4K3C A;  5DL8 A;  5EE2 A;  1ZHW A;  2Y0K A;  1IZN A;  3DWN A;  2W80 C;  1GFP A;  3AA1 B;  3KZI O;  4LSH A;  3WU2 O;  4FUV A;  2WVP A;  2WJR A;  1ZHY A;  1ZHX A;  2XE5 A;  4PR7 A;  4UB8 O;  3LK4 1;  4AKM A;  1E54 A;  4FSP A;  1MM5 A;  2YPV A;  2R4L A;  4UB6 O;  4IL6 O;  2K0L A;  4RJX A;  4GCP A;  2XMX A;  2LFU A;  3JTY A;  4GCS A;  5B66 O;  4Z3T A;  5KAF O;  3TZG A;  3AA7 A;  5AFU K;  3LK3 B;  2ZLD A;  3K19 A;  4O49 A;  4FRX A;  1BH3 A;  2R89 A;  3PQS A;  2Y0H A;  3DA4 A;  3HOE A;  2YNK A;  4B61 A;  1MPF A;  3SZD A;  5IYU A;  3AA7 B;  1QJP A;  3C5O A;  2W81 C;  2R88 A;  2J4U P;  1T16 A;  5T5F A;  3VY8 X;  4C69 X;  4FSO A;  2F1T A;  3UU2 A;  4RJW A;  3T0S A;  3VE2 A;  1P4T A;  4O3Y A;  2F1V A;  4D65 A;  2XE2 A;  6PRN A;  3BRZ A;  2R8A A;  2R4N A;  4KR8 A;  2X9K A;  1Q9F A;  3V8U A;  3VE1 A;  2JQY A;  3AA0 B;  3POU A;  4FOZ A;  4O4X A;  4BUM X;  3LK2 B;  4AUI A;  4C4V A;  2KXP A;  2XE3 A;  1BT9 A;  2M07 A;  3LK3 A;  1GFQ A;  1T1L A;  1THQ A;  1ZHZ A;  4FRT A;  3LK2 A;  4O4U A;  4RL9 A;  4C4V B;  4G76 A;  3DA3 A;  1PRN A;  2N2M A;  3G7G A;  3VZW X;  2AXT O;  4KRA A;  3A0H O;  4AZL A;  2XE1 A;  4LSE A;  4GF4 A;  4AYM C;  5GTH O;  3VY9 X;  4GCQ A;  2J1N A;  8PRN A;  2M06 A; 
#chains in the Genus database with same CATH homology
 2LHF A;  3NSG A;  3AA6 B;  4JFB A;  4FZM A;  5DL6 A;  4FMS A;  2MHL A;  3LK4 2;  3AA0 A;  4PUX A;  1BXW A;  2ODJ A;  3A2S X;  5DL5 A;  5JDP A;  2KXP B;  3VZT X;  2XTR A;  1QJ8 A;  3GP6 A;  5G26 A;  3T24 A;  3WI5 A;  5GV0 A;  1Q9G A;  3QRA A;  3HWB A;  3AAA A;  1GFM A;  4O3W A;  2OMF A;  3SYB A;  3SZV A;  2KZ7 B;  5FVN A;  3QRC A;  3VZU X;  3PRN A;  1OPF A;  4E1T A;  5ADX K;  4AYI D;  2Y2X A;  4G75 A;  4FES A;  3AAA B;  3WI4 A;  2KC0 A;  3RBH A;  2K4T A;  4AFK A;  4XNL A;  1OSM A;  4QQ1 A;  4AYD C;  3PQU A;  1QJ9 A;  1PHO A;  2Y7S A;  3O0E A;  2POR A;  4U9C A;  2FGQ X;  3T20 A;  3UAQ A;  4FZN A;  4FZL A;  4D5U A;  2X27 X;  2KDY A;  3SYS A;  5AFU L;  1GFO A;  4N58 A;  4O3X B;  3AAE A;  3EMN X;  5ADX L;  2JMM A;  1MM4 A;  4LSI A;  3AA6 A;  4LSF A;  1ORM A;  2KZ7 A;  4XNK A;  4AYE C;  3HW9 A;  5DL7 A;  1ZHT A;  3UPG A;  4O3Z A;  4FT6 A;  1HXU A;  4AKR A;  2ZFG A;  1H6S 1;  2GE4 A;  4KR4 A;  2MNH A;  4N59 A;  3KVD D;  3SY9 A;  1HXT A;  1G90 A;  4AKR B;  4E1S A;  3POQ A;  3FYX A;  4GHB A;  1GFN A;  2PRN A;  3SY7 A;  4F4B A;  5D5D A;  2QTK A;  3HOL A;  2XTQ A;  2N2L A;  3AAE B;  3POX A;  4D64 A;  4JCH A;  2ERV A;  4RLC A;  1HXX A;  4RLB A;  3AA1 A;  1YS5 A;  3POR A;  2FGR A;  7PRN A;  1IZN B;  4AYN A;  2Y0L A;  5PRN A;  2O4V A;  5DL8 A;  5EE2 A;  1ZHW A;  2Y0K A;  1IZN A;  2W80 C;  1GFP A;  3AA1 B;  4LSH A;  4FUV A;  1ZHY A;  1ZHX A;  2XE5 A;  3LK4 1;  4AKM A;  1E54 A;  4FSP A;  1MM5 A;  2YPV A;  2K0L A;  4RJX A;  4GCP A;  2XMX A;  2LFU A;  3JTY A;  2M06 A;  4GCS A;  4Z3T A;  3TZG A;  3AA7 A;  5AFU K;  3LK3 B;  2ZLD A;  3K19 A;  4O49 A;  4FRX A;  1BH3 A;  3PQS A;  2Y0H A;  3DA4 A;  3HOE A;  2YNK A;  4B61 A;  1MPF A;  3SZD A;  5IYU A;  3AA7 B;  1QJP A;  3C5O A;  2W81 C;  2J4U P;  5T5F A;  3VY8 X;  4C69 X;  4FSO A;  2F1T A;  3UU2 A;  4RJW A;  3T0S A;  3VE2 A;  1P4T A;  4O3Y A;  2F1V A;  4D65 A;  2XE2 A;  6PRN A;  4KR8 A;  3V8U A;  1Q9F A;  3VE1 A;  3AA0 B;  3POU A;  4O4X A;  4FOZ A;  4BUM X;  3LK2 B;  4AUI A;  2KXP A;  2XE3 A;  1BT9 A;  2M07 A;  3LK3 A;  1GFQ A;  1ZHZ A;  1THQ A;  4FRT A;  4O4U A;  3LK2 A;  4RL9 A;  4G76 A;  3DA3 A;  1PRN A;  2N2M A;  3G7G A;  3VZW X;  4KRA A;  4AZL A;  2XE1 A;  4LSE A;  4GF4 A;  4AYM C;  3VY9 X;  4GCQ A;  2J1N A;  8PRN A;  2XG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...