4E1TA

X-ray crystal structure of the transmembrane beta-domain from invasin from yersinia pseudotuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
245
structure length
245
Chain Sequence
MNRFGTAQVNLNFDKNFSLKESSLDWLAPWYDSASFLFFSQLGIRNKDSRNTLNLGVGIRTLENGWLYGLNTFYDNDLTGHNHRIGLGAEAWTDYLQLAANGYFRLNGWHSSRDFSDYKERPATGGDLRANAYLPALPQLGGKLMYEQYTGERVALFGKDNLQRNPYAVTAGINYTPVPLLTVGVDQRMGKSSKHETQWNLQMNYRFGESFQSQLSPSAVAGTRLLAESRYNLVDRNNNIVLEYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Invasin
publication title Crystal Structures of the Outer Membrane Domain of Intimin and Invasin from Enterohemorrhagic E. coli and Enteropathogenic Y. pseudotuberculosis.
pubmed doi rcsb
source organism Yersinia pseudotuberculosis
molecule tags Cell adhesion
total genus 70
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2012-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.160 Mainly Beta Beta Barrel Porin Porin 4e1tA00
4E1TA 5G26A 4E1SA
chains in the Genus database with same CATH superfamily
3K19A 2FGRA 4RL9A 2K4TA 4AYEC 2J1NA 3SZDA 2F1VA 6PRNA 1GFOA 3VZTX 1IZNB 3AA6A 2KDYA 4UB6O 1S5LO 4AZLA 2QTKA 2Y0KA 2ODJA 3BRYA 4FUVA 5FVNA 5IYUA 4AYDC 4K3CA 5GV0A 3SYSA 4AKRA 1H6S1 4FMSA 2KXPB 3AA7B 1Q9FA 4N75A 5B66O 2XE2A 1ZHTA 4B61A 1ZHYA 3JTYA 3PRNA 1T16A 1ZHWA 4O3XB 1HXTA 5EE2A 4IL6O 4PJ0O 3LK2B 3VY8X 4C00A 4PR7A 4O3YA 3C5OA 4RLCA 5T5FA 4E1SA 2XTQA 5DL7A 3HW9A 3AAAB 1HXUA 4PUXA 4LSEA 3VE2A 5TISO 4O4UA 3DA3A 5ADXL 3UAQA 5ADXK 4GCSA 3NJTA 3A2SX 3AAEA 2YNKA 5PRNA 3VY9X 3HOEA 4JFBA 4KR4A 3JCUO 1GFNA 3KZIO 3POQA 4FT6A 2K0LA 4FRTA 4LSIA 5KAFO 3RBHA 2R4OA 3SZVA 1P4TA 4N58A 4XNKA 3T20A 1OPFA 3AA1B 5KAIO 2Y0HA 3NSGA 4GHBA 4C69X 3UU2A 1E54A 3PGRA 4JCHA 2W80C 3AA0B 3PGUA 4C4VA 3LK3A 1MM5A 1MM4A 3HOLA 2R88A 2R4LA 1BXWA 3PQUA 1G90A 4N59A 4O4XA 2MHLA 4FRXA 2XE3A 1BT9A 2KZ7B 4FQEA 7PRNA 4QQ1A 2XMXA 2F1TA 3PORA 1QJ8A 5G39A 4FSPA 1GFQA 4FZMA 1GFMA 1OSMA 2LFUA 3T24A 1THQA 1YS5A 3A0HO 5G38A 3KVDD 2R4NA 4F4BA 2Y7SA 3AA6B 4RJXA 2PORA 5H2FO 3FYXA 2FGQX 3TZGA 2LHFA 2JMMA 3T0SA 3LK3B 4G75A 4AKRB 2IWWA 3DA4A 1BH3A 3DWOX 3HWBA 2F1CX 3BRZA 1T1LA 3SYBA 3WI5A 4BUMX 3EMNX 4RJWA 2M06A 1PRNA 4FOZA 1HXXA 3WI4A 5E79O 4D65A 5GTHO 2X27X 4K3BA 1IZNA 4O3ZA 2XE1A 3UPGA 4AYNA 1QJPA 3G7GA 3VZUX 3QRAA 3V8UA 3GP6A 2AXTO 4FESA 3LK42 3DZMA 3O0EA 5AFUL 3AA7A 2PRNA 3AAEB 4U9CA 3SY9A 4RLBA 3VZWX 4O3WA 4LSFA 2N2LA 2WJQA 2WJRA 2R89A 3LK2A 1QJ9A 4KRAA 2XTRA 1PHOA 2W81C 2XG6A 3SY7A 4D64A 4GCPA 3PGSA 3AAAA 4D5UA 3DWNA 4Z3TA 5B5EO 1ZHXA 3POXA 4GF4A 4N74A 3PF1A 4AYMC 5DL5A 3PQSA 2ZFGA 4C4VB 1ORMA 4AUIA 2IWVA 4G76A 2J4UP 3AA1A 1Q9GA 5JDPA 2OMFA 4FZLA 4KR8A 1ZHZA 2XE5A 2R8AA 4LSHA 5DL8A 5G26A 3BS0A 3WU2O 8PRNA 2N2MA 1GFPA 2JQYA 3LK41 4E1TA 2YPVA 5DL6A 2ZLDA 2ERVA 3A0BO 2O4VA 2KC0A 3AA0A 4FZNA 1MPFA 4GCQA 2WVPA 2KXPA 2Y2XA 3QRCA 4FSOA 4O49A 3POUA 4CTDA 5AFUK 2MNHA 2R4PA 5G3AA 4AYID 4UB8O 2X9KA 2KZ7A 2GE4A 2M07A 4XNLA 2Y0LA 3VE1A 4AFKA 4AKMA 5GTIO 5D5DA
chains in the Genus database with same CATH topology
3K19A 2FGRA 4RL9A 2K4TA 4AYEC 2J1NA 3SZDA 2F1VA 6PRNA 1GFOA 3VZTX 1IZNB 3AA6A 2KDYA 4AZLA 2QTKA 2Y0KA 2ODJA 5FVNA 4FUVA 5IYUA 4AYDC 5GV0A 3SYSA 4AKRA 1H6S1 4FMSA 2KXPB 3AA7B 1Q9FA 2XE2A 1ZHTA 4B61A 1ZHYA 3JTYA 3PRNA 4O3XB 1ZHWA 3VY8X 1HXTA 5EE2A 3LK2B 4O3YA 3C5OA 4RLCA 5T5FA 4E1SA 2XTQA 5DL7A 3HW9A 3AAAB 1HXUA 4PUXA 4LSEA 3VE2A 5ADXL 4O4UA 3DA3A 3UAQA 5ADXK 4GCSA 3A2SX 3AAEA 2YNKA 5PRNA 3VY9X 3HOEA 4JFBA 4KR4A 3POQA 1GFNA 3RBHA 4LSIA 4FT6A 2K0LA 4FRTA 3SZVA 3T20A 1P4TA 4N58A 4XNKA 1OPFA 3AA1B 2Y0HA 3NSGA 4GHBA 4C69X 3UU2A 1E54A 4JCHA 2W80C 3AA0B 3LK3A 1MM5A 1MM4A 3HOLA 1BXWA 3PQUA 1G90A 4N59A 4O4XA 2MHLA 4FRXA 2XE3A 1BT9A 2KZ7B 7PRNA 4QQ1A 2XMXA 2F1TA 3PORA 1QJ8A 4FSPA 1GFQA 4FZMA 1GFMA 1OSMA 2LFUA 3T24A 1THQA 1YS5A 3KVDD 4F4BA 2Y7SA 3AA6B 4RJXA 2PORA 3FYXA 2FGQX 3TZGA 2LHFA 2JMMA 3T0SA 3LK3B 4G75A 4AKRB 3DA4A 1BH3A 3HWBA 3SYBA 4BUMX 3WI5A 3EMNX 4RJWA 2M06A 1PRNA 4FOZA 1HXXA 3WI4A 4D65A 2X27X 3UPGA 1IZNA 4O3ZA 2XE1A 4AYNA 1QJPA 3G7GA 3VZUX 3QRAA 3V8UA 3GP6A 4FESA 3LK42 3O0EA 5AFUL 3AA7A 2PRNA 3AAEB 4U9CA 3SY9A 4RLBA 3VZWX 4O3WA 4LSFA 2N2LA 3LK2A 1QJ9A 4KRAA 2XTRA 1PHOA 2W81C 2XG6A 3SY7A 4D64A 4GCPA 3AAAA 4D5UA 4Z3TA 1ZHXA 3POXA 4GF4A 4AYMC 5DL5A 3PQSA 2ZFGA 1ORMA 4AUIA 4G76A 2J4UP 3AA1A 1Q9GA 5JDPA 2OMFA 4FZLA 4KR8A 1ZHZA 2XE5A 4LSHA 5DL8A 5G26A 8PRNA 2N2MA 1GFPA 3LK41 4E1TA 2YPVA 5DL6A 2ZLDA 2ERVA 3AA0A 2O4VA 2KC0A 4FZNA 4GCQA 1MPFA 2KXPA 2Y2XA 3QRCA 4FSOA 4O49A 3POUA 5AFUK 2MNHA 4AYID 2KZ7A 2GE4A 2M07A 4XNLA 2Y0LA 3VE1A 4AFKA 4AKMA 5D5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E1T A;  5G26 A;  4E1S A; 
#chains in the Genus database with same CATH topology
 3K19 A;  2FGR A;  4RL9 A;  2K4T A;  4AYE C;  2J1N A;  3SZD A;  2F1V A;  6PRN A;  1GFO A;  3VZT X;  1IZN B;  3AA6 A;  2KDY A;  4UB6 O;  1S5L O;  4AZL A;  2QTK A;  2Y0K A;  2ODJ A;  3BRY A;  4FUV A;  5FVN A;  5IYU A;  4AYD C;  4K3C A;  5GV0 A;  3SYS A;  4AKR A;  1H6S 1;  4FMS A;  2KXP B;  3AA7 B;  1Q9F A;  4N75 A;  5B66 O;  2XE2 A;  1ZHT A;  4B61 A;  1ZHY A;  3JTY A;  3PRN A;  1T16 A;  1ZHW A;  4O3X B;  1HXT A;  5EE2 A;  4IL6 O;  4PJ0 O;  3LK2 B;  3VY8 X;  4C00 A;  4PR7 A;  4O3Y A;  3C5O A;  4RLC A;  5T5F A;  4E1S A;  2XTQ A;  5DL7 A;  3HW9 A;  3AAA B;  1HXU A;  4PUX A;  4LSE A;  3VE2 A;  5TIS O;  4O4U A;  3DA3 A;  5ADX L;  3UAQ A;  5ADX K;  4GCS A;  3NJT A;  3A2S X;  3AAE A;  2YNK A;  5PRN A;  3VY9 X;  3HOE A;  4JFB A;  4KR4 A;  3JCU O;  1GFN A;  3KZI O;  3POQ A;  4FT6 A;  2K0L A;  4FRT A;  4LSI A;  5KAF O;  3RBH A;  2R4O A;  3SZV A;  1P4T A;  4N58 A;  4XNK A;  3T20 A;  1OPF A;  3AA1 B;  5KAI O;  2Y0H A;  3NSG A;  4GHB A;  4C69 X;  3UU2 A;  1E54 A;  3PGR A;  4JCH A;  2W80 C;  3AA0 B;  3PGU A;  4C4V A;  3LK3 A;  1MM5 A;  1MM4 A;  3HOL A;  2R88 A;  2R4L A;  1BXW A;  3PQU A;  1G90 A;  4N59 A;  4O4X A;  2MHL A;  4FRX A;  2XE3 A;  1BT9 A;  2KZ7 B;  4FQE A;  7PRN A;  4QQ1 A;  2XMX A;  2F1T A;  3POR A;  1QJ8 A;  5G39 A;  4FSP A;  1GFQ A;  4FZM A;  1GFM A;  1OSM A;  2LFU A;  3T24 A;  1THQ A;  1YS5 A;  3A0H O;  5G38 A;  3KVD D;  2R4N A;  4F4B A;  2Y7S A;  3AA6 B;  4RJX A;  2POR A;  5H2F O;  3FYX A;  2FGQ X;  3TZG A;  2LHF A;  2JMM A;  3T0S A;  3LK3 B;  4G75 A;  4AKR B;  2IWW A;  3DA4 A;  1BH3 A;  3DWO X;  3HWB A;  2F1C X;  3BRZ A;  1T1L A;  3SYB A;  3WI5 A;  4BUM X;  3EMN X;  4RJW A;  2M06 A;  1PRN A;  4FOZ A;  1HXX A;  3WI4 A;  5E79 O;  4D65 A;  5GTH O;  2X27 X;  4K3B A;  1IZN A;  4O3Z A;  2XE1 A;  3UPG A;  4AYN A;  1QJP A;  3G7G A;  3VZU X;  3QRA A;  3V8U A;  3GP6 A;  2AXT O;  4FES A;  3LK4 2;  3DZM A;  3O0E A;  5AFU L;  3AA7 A;  2PRN A;  3AAE B;  4U9C A;  3SY9 A;  4RLB A;  3VZW X;  4O3W A;  4LSF A;  2N2L A;  2WJQ A;  2WJR A;  2R89 A;  3LK2 A;  1QJ9 A;  4KRA A;  2XTR A;  1PHO A;  2W81 C;  2XG6 A;  3SY7 A;  4D64 A;  4GCP A;  3PGS A;  3AAA A;  4D5U A;  3DWN A;  4Z3T A;  5B5E O;  1ZHX A;  3POX A;  4GF4 A;  4N74 A;  3PF1 A;  4AYM C;  5DL5 A;  3PQS A;  2ZFG A;  4C4V B;  1ORM A;  4AUI A;  2IWV A;  4G76 A;  2J4U P;  3AA1 A;  1Q9G A;  5JDP A;  2OMF A;  4FZL A;  4KR8 A;  1ZHZ A;  2XE5 A;  2R8A A;  4LSH A;  5DL8 A;  5G26 A;  3BS0 A;  3WU2 O;  8PRN A;  2N2M A;  1GFP A;  2JQY A;  3LK4 1;  4E1T A;  2YPV A;  5DL6 A;  2ZLD A;  2ERV A;  3A0B O;  2O4V A;  2KC0 A;  3AA0 A;  4FZN A;  1MPF A;  4GCQ A;  2WVP A;  2KXP A;  2Y2X A;  3QRC A;  4FSO A;  4O49 A;  3POU A;  4CTD A;  5AFU K;  2MNH A;  2R4P A;  5G3A A;  4AYI D;  4UB8 O;  2X9K A;  2KZ7 A;  2GE4 A;  2M07 A;  4XNL A;  2Y0L A;  3VE1 A;  4AFK A;  4AKM A;  5GTI O;  5D5D A; 
#chains in the Genus database with same CATH homology
 3K19 A;  2FGR A;  4RL9 A;  2K4T A;  4AYE C;  2J1N A;  3SZD A;  2F1V A;  6PRN A;  1GFO A;  3VZT X;  1IZN B;  3AA6 A;  2KDY A;  4AZL A;  2QTK A;  2Y0K A;  2ODJ A;  5FVN A;  4FUV A;  5IYU A;  4AYD C;  5GV0 A;  3SYS A;  4AKR A;  1H6S 1;  4FMS A;  2KXP B;  3AA7 B;  1Q9F A;  2XE2 A;  1ZHT A;  4B61 A;  1ZHY A;  3JTY A;  3PRN A;  4O3X B;  1ZHW A;  3VY8 X;  1HXT A;  5EE2 A;  3LK2 B;  4O3Y A;  3C5O A;  4RLC A;  5T5F A;  4E1S A;  2XTQ A;  5DL7 A;  3HW9 A;  3AAA B;  1HXU A;  4PUX A;  4LSE A;  3VE2 A;  5ADX L;  4O4U A;  3DA3 A;  3UAQ A;  5ADX K;  4GCS A;  3A2S X;  3AAE A;  2YNK A;  5PRN A;  3VY9 X;  3HOE A;  4JFB A;  4KR4 A;  3POQ A;  1GFN A;  3RBH A;  4LSI A;  4FT6 A;  2K0L A;  4FRT A;  3SZV A;  3T20 A;  1P4T A;  4N58 A;  4XNK A;  1OPF A;  3AA1 B;  2Y0H A;  3NSG A;  4GHB A;  4C69 X;  3UU2 A;  1E54 A;  4JCH A;  2W80 C;  3AA0 B;  3LK3 A;  1MM5 A;  1MM4 A;  3HOL A;  1BXW A;  3PQU A;  1G90 A;  4N59 A;  4O4X A;  2MHL A;  4FRX A;  2XE3 A;  1BT9 A;  2KZ7 B;  7PRN A;  4QQ1 A;  2XMX A;  2F1T A;  3POR A;  1QJ8 A;  4FSP A;  1GFQ A;  4FZM A;  1GFM A;  1OSM A;  2LFU A;  3T24 A;  1THQ A;  1YS5 A;  3KVD D;  4F4B A;  2Y7S A;  3AA6 B;  4RJX A;  2POR A;  3FYX A;  2FGQ X;  3TZG A;  2LHF A;  2JMM A;  3T0S A;  3LK3 B;  4G75 A;  4AKR B;  3DA4 A;  1BH3 A;  3HWB A;  3SYB A;  4BUM X;  3WI5 A;  3EMN X;  4RJW A;  2M06 A;  1PRN A;  4FOZ A;  1HXX A;  3WI4 A;  4D65 A;  2X27 X;  3UPG A;  1IZN A;  4O3Z A;  2XE1 A;  4AYN A;  1QJP A;  3G7G A;  3VZU X;  3QRA A;  3V8U A;  3GP6 A;  4FES A;  3LK4 2;  3O0E A;  5AFU L;  3AA7 A;  2PRN A;  3AAE B;  4U9C A;  3SY9 A;  4RLB A;  3VZW X;  4O3W A;  4LSF A;  2N2L A;  3LK2 A;  1QJ9 A;  4KRA A;  2XTR A;  1PHO A;  2W81 C;  2XG6 A;  3SY7 A;  4D64 A;  4GCP A;  3AAA A;  4D5U A;  4Z3T A;  1ZHX A;  3POX A;  4GF4 A;  4AYM C;  5DL5 A;  3PQS A;  2ZFG A;  1ORM A;  4AUI A;  4G76 A;  2J4U P;  3AA1 A;  1Q9G A;  5JDP A;  2OMF A;  4FZL A;  4KR8 A;  1ZHZ A;  2XE5 A;  4LSH A;  5DL8 A;  5G26 A;  8PRN A;  2N2M A;  1GFP A;  3LK4 1;  4E1T A;  2YPV A;  5DL6 A;  2ZLD A;  2ERV A;  3AA0 A;  2O4V A;  2KC0 A;  4FZN A;  4GCQ A;  1MPF A;  2KXP A;  2Y2X A;  3QRC A;  4FSO A;  4O49 A;  3POU A;  5AFU K;  2MNH A;  4AYI D;  2KZ7 A;  2GE4 A;  2M07 A;  4XNL A;  2Y0L A;  3VE1 A;  4AFK A;  4AKM A;  5D5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...