4E1YA

Alginate lyase a1-iii h192a apo form
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
353
structure length
353
Chain Sequence
GSHPFDQAVVKDPTASYVDVKARRTFLQSGQLDDRLKAALPKEYDCTTEATPNPQQGEMVIPRRYLSGNHGPVNPDYEPVVTLYRDFEKISATLGNLYVATGKPVYATCLLNMLDKWAKADALLNYDPKSQSWYQVEWSAATAAFALSTMMAEPNVDTAQRERVVKWLNRVARHQTSFPGGDTSCCNNASYWRGQEATIIGVISKDDELFRWGLGRYVQAMGLINEDGSFVHEMTRHEQSLHYQNYAMLPLTMIAETASRQGIDLYAYKENGRDIHSARKFVFAAVKNPDLIKKYASEPQDTRAFKPGRGDLNWIEYQRARFGFADELGFMTVPIFDPRTGGSGTLLAYKPQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alginate lyase
publication title Induced-fit motion of a lid loop involved in catalysis in alginate lyase A1-III
pubmed doi rcsb
source organism Sphingomonas
molecule tags Lyase
total genus 139
structure length 353
sequence length 353
chains with identical sequence B
ec nomenclature ec 4.2.2.3: Mannuronate-specific alginate lyase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05426 Alginate_lyase Alginate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.100 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Chondroitin AC/alginate lyase 4e1yA00
1QAZA 2WDAA 1HV6A 4F10A 1RWFA 1HMWA 1HN0A 2BRWA 2WCOA 1J0NA 1F9GA 1HM2A 4OK2A 1X1JA 4MMIA 3E7JA 5JMFA 4OZWA 1OJNA 4NEIA 1N7NA 2BRPA 4E1YA 2BRVX 1OJPA 2FUQA 1X1HA 1HM3A 1I8QA 1RWGA 2E22A 3E80A 4MMHA 5JMDA 1N7PA 3VSNA 2Q1FA 3VSMA 4F13A 1C82A 4OZVA 3AFLA 1OJOA 2X03A 3NFVA 4OK4A 1RWCA 1N7RA 3A0OA 1N7QA 2E24A 1CB8A 1LXMA 1EGUA 1W3YA 1X1IA 1F1SA 1RWHA 1LXKA 1N7OA 1RW9A 1RWAA 2FUTA 1HMUA 1OJMA 1J0MA 4OJZA 4FNVA 1LOHA 3NNBA
chains in the Genus database with same CATH superfamily
4ZRQA 2D5JA 2B39A 3G4FA 4Z4LA 2BB6A 1FPPB 1H3CA 3QFYA 3QFZA 1N1BA 1N4QB 3S9VA 4BOKA 1WZZA 2EACA 1RWHA 3E32B 3WIQA 3M72A 2DRSA 3QXQA 1OJMA 1QAZA 4V1RA 5ILIA 3P2CA 4M76A 3W7SA 4V1SA 1O6RA 3M7CA 3ANJA 4FUSA 3SFYB 2P0VA 1TNZB 4FXKB 1KZPB 1O1TB 5MEHA 5EAUA 4GTMB 2IEJB 1TF4A 1W3YA 2A8ZA 3N0FA 2G0DA 5KKBA 3W7XA 4LNGB 4EHMB 2VN7A 5FO8B 2BRWA 3ACSA 4CE7A 4D4BA 5ILHA 4QT9A 1H3AA 1NXCA 2GOXA 4TF4A 4KTRA 2EABA 1C82A 1SQCA 4GL3A 3RENA 3G6JB 2WIIB 2WYNA 3N0GA 3H2WA 1GA2A 1X1IA 4ZRPA 3OEDA 2FUTA 1GXNA 1C3DA 1HMUA 3P5RA 3E73A 2AHFA 5M7IA 3Q73B 3ACTA 4AYQA 3D5SA 3EQAA 1LTXB 1NC5A 1KKTA 1WU4A 4D4CA 3S4CA 5IK9A 3PZ1B 1TN6B 5IK6A 3KLSA 4OK2A 3W5MA 2ONHA 2NOJA 2AFAA 4L6XA 5IM1A 5ILKA 3X17A 3WKIA 1V7XA 1H13A 3RX5A 3VSMA 3WKGA 2EAEA 3NFVA 3EUVB 4OK4A 3W7TA 1F9DA 2RGKA 3E33B 1NL4B 1UMPA 1RWAA 1KZOB 3M02A 4FNVA 1KSDA 3QT3A 1FMIA 1FCEA 4JJJA 1XW2A 1JCRB 1N4RB 2E22A 1L1YA 4GTSB 3E30B 3SAEA 2FV0A 3QWTA 1GHQA 3PMMA 1JCSB 3D5RA 1RWCA 3A0OA 1LD8B 2WY7A 2VN4A 1H54A 1G9JA 2JG0A 3G4DA 1J0MA 5JPMB 1UG9A 2WDAA 1TNUB 3C72B 3QDEA 3SDTA 1GXMA 2RI9A 3HXEB 3WUXA 3DRAB 1N4PB 1FBOA 1H39A 4MMHA 2WINB 5CD2A 1H35A 3WIWA 3S4DA 2WY8A 5GZKA 1QSJA 3WKHA 1N4SB 3GLYA 5IK0A 1V7VA 2XQWA 2ONGA 1GLMA 2AHGA 1DL2A 2GZ6A 3KSQB 1X9DA 3QXFA 4D4AA 1N22A 3M78A 1RWFA 3M7LA 1HCUA 2WCOA 1O1RB 1KWFA 4RNQA 1F9OA 4FXGB 3DPYB 4C1SA 1LD7B 3DSUB 4D4DA 1QBQB 3E80A 4KKJA 5IKHA 5JMDA 1N21A 4L0GA 3AFLA 3SFXB 3M76A 2YIKA 2CQTA 1LF6A 5FO7B 1CEMA 3M75A 1EGUA 1SA4B 3RJ3A 1KRFA 2DROA 1GXOA 2Z07A 1V7WA 3TF4A 1HN0A 1O6QA 1F9GA 3ON6A 2A73B 3PYBA 3QT9A 1CLCA 1V5CA 1H14A 4GTVB 4AYPA 3SDRA 1NI1B 1TNYB 2SQCA 4Q2BA 4GTTB 1FAEA 1XWQA 3SDUA 3WIRA 3M71A 3NNBA 1H3BA 4F10A 1O6HA 1IS9A 3CIHA 1N1ZA 1HM2A 5DHKA 1HXAA 1W6KA 3Q79B 1FT2B 3ANKA 3EU8A 3HXDB 3HXBB 4YCRA 1FO2A 4F13A 1N23A 3RX8A 4WVCA 4KKIA 1OJOA 2F6DA 4ZH1A 3DSXB 2G02A 1H37A 1N7RA 5ILJA 1MZCB 1O5MB 1G6IA 1R76A 4Z4JA 1N7OA 4YDEB 3M7BA 1O79A 3SDQA 2V8IA 2CQSA 3ANIA 4YDOB 5CA3A 3GT5A 3M7EA 1FBWA 5JMFA 1HXGA 4NEIA 1JCQB 2BRVX 3KSLB 1N7PA 2V3PA 4WVBA 3W7WA 4GAXA 1WU6A 4DOEA 2JF4A 3Q7FB 3VXDA 3PZ3B 2BBCA 5IKAA 1F1SA 4AYOA 2D8LA 3QG0A 5EASA 2H6HB 3P5PA 3WC3A 4CJ1A 4LNBB 4OZWA 4EL8A 2FBAA 5JPNB 1W6JA 2ZISB 2OKXA 1DCEB 4BOJA 1JS4A 3M01A 2I07B 3CU7A 2R2LB 2DRRA 1N94B 1N9AB 1IA6A 3E34B 3W7UA 3QSPA 1H12A 3S4AA 5E2JA 3Q75B 4DI5A 5FOBB 2XWBB 1H36A 5GY3A 1TN8B 1TNOB 3D3IA 1FT1B 2ZZRA 4CJ0A 3K11A 5ILYA 1J0NA 1L2AA 1X1JA 3T33A 3K7XA 2ZIRB 3M00A 1KSCA 2H6FB 3H7LA 5AGDA 2V8JA 5ILZA 4ZH5A 2B4FA 1HZFA 2X03A 5DGRA 4Q88A 3M73A 5C05A 1IA7A 2BEDB 3PYAA 1K72A 3W5NA 1ULVA 3A3VA 1D8EB 4MBGB 1LOHA 1GAIA 4XUVA 3SDVA 1GSZA 1HV6A 1UT9A 2BB5A 4GTPB 3HXCB 1V5DA 2DRQA 1KFGA 4MMIA 3AFJA 4E1YA 1N20A 1N24A 3Q7AB 1XWTA 2V3NA 3VSNA 2JJBA 5IL8A 2FV1A 2RI8A 5CZLA 1TN7B 1S63B 1S64B 3DSTB 1X81B 1N7QA 2E24A 1GAHA 1CB8A 1WU5A 1LXKA 1RW9A 4J5TA 3RRSA 4OJZA 5DHIA 1G9GA 1AGMA 1AYXA 1G87A 4L9PB 4D94A 4DODA 2XFGA 1FP3A 3S4BA 5IL3A 1OJPA 1X1HA 3WKFA 1VD5A 3PZ2B 3QRYA 4AYRA 4KTPA 1KS8A 3LZ9A 3Q78B 2V8KA 1DOGA 3M74A 5EATA 4LNVA 3SQCA 3RSYA 2XWJB 5GW7A 1HMWA 3QPFA 2J5CA 5DGQA 2F0YB 2EADA 3E7JA 2H6IB 1OJNA 2FUZA 3DSVB 2QNOA 4GTOB 2FUQA 3E6UA 2PMVA 3RX7A 1LF9A 3OXUA 2Q1FA 3GZKA 4OZVA 2GH4A 4ONTA 1D8DB 4MU9A 3EZ8A 1LXMA 1FO3A 1N95B 3H3KA 5FO9B 5M7YA 2H6GB 1HX9A 4GTQB 4GTRB 5ILDA 3KQ4A 3DSSB 4WU0A 1QQFA 3M77A 3HXFB 1RQ5A 4WVAA 1N7NA 2BRPA 2ZBLA 4LIXA 1HM3A 1I8QA 1RWGA 1TNBB 4TXTA 1O1SB 2NVPA 2PN5A 3PZ4B 3DSWB 4ZG8A 3EU5B 3E37B 1SA5B 1HXCA 1KREA 4FJQA 3VW5A
chains in the Genus database with same CATH topology
1QAZA 2WDAA 1HV6A 4F10A 1RWFA 1HMWA 1HN0A 2BRWA 2WCOA 1J0NA 1F9GA 1HM2A 4OK2A 1X1JA 4MMIA 3E7JA 5JMFA 4OZWA 1OJNA 4NEIA 1N7NA 2BRPA 4E1YA 2BRVX 1OJPA 2FUQA 1X1HA 1HM3A 1I8QA 1RWGA 2E22A 3E80A 4MMHA 5JMDA 1N7PA 3VSNA 2Q1FA 3VSMA 4F13A 1C82A 4OZVA 3AFLA 1OJOA 2X03A 3NFVA 4OK4A 1RWCA 1N7RA 3A0OA 1N7QA 2E24A 1CB8A 1LXMA 1EGUA 1W3YA 1X1IA 1F1SA 1RWHA 1LXKA 1N7OA 1RW9A 1RWAA 2FUTA 1HMUA 1OJMA 1J0MA 4OJZA 4FNVA 1LOHA 3NNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QAZ A;  2WDA A;  1HV6 A;  4F10 A;  1RWF A;  1HMW A;  1HN0 A;  2BRW A;  2WCO A;  1J0N A;  1F9G A;  1HM2 A;  4OK2 A;  1X1J A;  4MMI A;  3E7J A;  5JMF A;  4OZW A;  1OJN A;  4NEI A;  1N7N A;  2BRP A;  4E1Y A;  2BRV X;  1OJP A;  2FUQ A;  1X1H A;  1HM3 A;  1I8Q A;  1RWG A;  2E22 A;  3E80 A;  4MMH A;  5JMD A;  1N7P A;  3VSN A;  2Q1F A;  3VSM A;  4F13 A;  1C82 A;  4OZV A;  3AFL A;  1OJO A;  2X03 A;  3NFV A;  4OK4 A;  1RWC A;  1N7R A;  3A0O A;  1N7Q A;  2E24 A;  1CB8 A;  1LXM A;  1EGU A;  1W3Y A;  1X1I A;  1F1S A;  1RWH A;  1LXK A;  1N7O A;  1RW9 A;  1RWA A;  2FUT A;  1HMU A;  1OJM A;  1J0M A;  4OJZ A;  4FNV A;  1LOH A;  3NNB A; 
#chains in the Genus database with same CATH topology
 4ZRQ A;  2D5J A;  2B39 A;  3G4F A;  4Z4L A;  2BB6 A;  1FPP B;  1H3C A;  3QFY A;  3QFZ A;  1N1B A;  1N4Q B;  3S9V A;  4BOK A;  1WZZ A;  2EAC A;  1RWH A;  3E32 B;  3WIQ A;  3M72 A;  2DRS A;  3QXQ A;  1OJM A;  1QAZ A;  4V1R A;  5ILI A;  3P2C A;  4M76 A;  3W7S A;  4V1S A;  1O6R A;  3M7C A;  3ANJ A;  4FUS A;  3SFY B;  2P0V A;  1TNZ B;  4FXK B;  1KZP B;  1O1T B;  5MEH A;  5EAU A;  4GTM B;  2IEJ B;  1TF4 A;  1W3Y A;  2A8Z A;  3N0F A;  2G0D A;  5KKB A;  3W7X A;  4LNG B;  4EHM B;  2VN7 A;  5FO8 B;  2BRW A;  3ACS A;  4CE7 A;  4D4B A;  5ILH A;  4QT9 A;  1H3A A;  1NXC A;  2GOX A;  4TF4 A;  4KTR A;  2EAB A;  1C82 A;  1SQC A;  4GL3 A;  3REN A;  3G6J B;  2WII B;  2WYN A;  3N0G A;  3H2W A;  1GA2 A;  1X1I A;  4ZRP A;  3OED A;  2FUT A;  1GXN A;  1C3D A;  1HMU A;  3P5R A;  3E73 A;  2AHF A;  5M7I A;  3Q73 B;  3ACT A;  4AYQ A;  3D5S A;  3EQA A;  1LTX B;  1NC5 A;  1KKT A;  1WU4 A;  4D4C A;  3S4C A;  5IK9 A;  3PZ1 B;  1TN6 B;  5IK6 A;  3KLS A;  4OK2 A;  3W5M A;  2ONH A;  2NOJ A;  2AFA A;  4L6X A;  5IM1 A;  5ILK A;  3X17 A;  3WKI A;  1V7X A;  1H13 A;  3RX5 A;  3VSM A;  3WKG A;  2EAE A;  3NFV A;  3EUV B;  4OK4 A;  3W7T A;  1F9D A;  2RGK A;  3E33 B;  1NL4 B;  1UMP A;  1RWA A;  1KZO B;  3M02 A;  4FNV A;  1KSD A;  3QT3 A;  1FMI A;  1FCE A;  4JJJ A;  1XW2 A;  1JCR B;  1N4R B;  2E22 A;  1L1Y A;  4GTS B;  3E30 B;  3SAE A;  2FV0 A;  3QWT A;  1GHQ A;  3PMM A;  1JCS B;  3D5R A;  1RWC A;  3A0O A;  1LD8 B;  2WY7 A;  2VN4 A;  1H54 A;  1G9J A;  2JG0 A;  3G4D A;  1J0M A;  5JPM B;  1UG9 A;  2WDA A;  1TNU B;  3C72 B;  3QDE A;  3SDT A;  1GXM A;  2RI9 A;  3HXE B;  3WUX A;  3DRA B;  1N4P B;  1FBO A;  1H39 A;  4MMH A;  2WIN B;  5CD2 A;  1H35 A;  3WIW A;  3S4D A;  2WY8 A;  5GZK A;  1QSJ A;  3WKH A;  1N4S B;  3GLY A;  5IK0 A;  1V7V A;  2XQW A;  2ONG A;  1GLM A;  2AHG A;  1DL2 A;  2GZ6 A;  3KSQ B;  1X9D A;  3QXF A;  4D4A A;  1N22 A;  3M78 A;  1RWF A;  3M7L A;  1HCU A;  2WCO A;  1O1R B;  1KWF A;  4RNQ A;  1F9O A;  4FXG B;  3DPY B;  4C1S A;  1LD7 B;  3DSU B;  4D4D A;  1QBQ B;  3E80 A;  4KKJ A;  5IKH A;  5JMD A;  1N21 A;  4L0G A;  3AFL A;  3SFX B;  3M76 A;  2YIK A;  2CQT A;  1LF6 A;  5FO7 B;  1CEM A;  3M75 A;  1EGU A;  1SA4 B;  3RJ3 A;  1KRF A;  2DRO A;  1GXO A;  2Z07 A;  1V7W A;  3TF4 A;  1HN0 A;  1O6Q A;  1F9G A;  3ON6 A;  2A73 B;  3PYB A;  3QT9 A;  1CLC A;  1V5C A;  1H14 A;  4GTV B;  4AYP A;  3SDR A;  1NI1 B;  1TNY B;  2SQC A;  4Q2B A;  4GTT B;  1FAE A;  1XWQ A;  3SDU A;  3WIR A;  3M71 A;  3NNB A;  1H3B A;  4F10 A;  1O6H A;  1IS9 A;  3CIH A;  1N1Z A;  1HM2 A;  5DHK A;  1HXA A;  1W6K A;  3Q79 B;  1FT2 B;  3ANK A;  3EU8 A;  3HXD B;  3HXB B;  4YCR A;  1FO2 A;  4F13 A;  1N23 A;  3RX8 A;  4WVC A;  4KKI A;  1OJO A;  2F6D A;  4ZH1 A;  3DSX B;  2G02 A;  1H37 A;  1N7R A;  5ILJ A;  1MZC B;  1O5M B;  1G6I A;  1R76 A;  4Z4J A;  1N7O A;  4YDE B;  3M7B A;  1O79 A;  3SDQ A;  2V8I A;  2CQS A;  3ANI A;  4YDO B;  5CA3 A;  3GT5 A;  3M7E A;  1FBW A;  5JMF A;  1HXG A;  4NEI A;  1JCQ B;  2BRV X;  3KSL B;  1N7P A;  2V3P A;  4WVB A;  3W7W A;  4GAX A;  1WU6 A;  4DOE A;  2JF4 A;  3Q7F B;  3VXD A;  3PZ3 B;  2BBC A;  5IKA A;  1F1S A;  4AYO A;  2D8L A;  3QG0 A;  5EAS A;  2H6H B;  3P5P A;  3WC3 A;  4CJ1 A;  4LNB B;  4OZW A;  4EL8 A;  2FBA A;  5JPN B;  1W6J A;  2ZIS B;  2OKX A;  1DCE B;  4BOJ A;  1JS4 A;  3M01 A;  2I07 B;  3CU7 A;  2R2L B;  2DRR A;  1N94 B;  1N9A B;  1IA6 A;  3E34 B;  3W7U A;  3QSP A;  1H12 A;  3S4A A;  5E2J A;  3Q75 B;  4DI5 A;  5FOB B;  2XWB B;  1H36 A;  5GY3 A;  1TN8 B;  1TNO B;  3D3I A;  1FT1 B;  2ZZR A;  4CJ0 A;  3K11 A;  5ILY A;  1J0N A;  1L2A A;  1X1J A;  3T33 A;  3K7X A;  2ZIR B;  3M00 A;  1KSC A;  2H6F B;  3H7L A;  5AGD A;  2V8J A;  5ILZ A;  4ZH5 A;  2B4F A;  1HZF A;  2X03 A;  5DGR A;  4Q88 A;  3M73 A;  5C05 A;  1IA7 A;  2BED B;  3PYA A;  1K72 A;  3W5N A;  1ULV A;  3A3V A;  1D8E B;  4MBG B;  1LOH A;  1GAI A;  4XUV A;  3SDV A;  1GSZ A;  1HV6 A;  1UT9 A;  2BB5 A;  4GTP B;  3HXC B;  1V5D A;  2DRQ A;  1KFG A;  4MMI A;  3AFJ A;  4E1Y A;  1N20 A;  1N24 A;  3Q7A B;  1XWT A;  2V3N A;  3VSN A;  2JJB A;  5IL8 A;  2FV1 A;  2RI8 A;  5CZL A;  1TN7 B;  1S63 B;  1S64 B;  3DST B;  1X81 B;  1N7Q A;  2E24 A;  1GAH A;  1CB8 A;  1WU5 A;  1LXK A;  1RW9 A;  4J5T A;  3RRS A;  4OJZ A;  5DHI A;  1G9G A;  1AGM A;  1AYX A;  1G87 A;  4L9P B;  4D94 A;  4DOD A;  2XFG A;  1FP3 A;  3S4B A;  5IL3 A;  1OJP A;  1X1H A;  3WKF A;  1VD5 A;  3PZ2 B;  3QRY A;  4AYR A;  4KTP A;  1KS8 A;  3LZ9 A;  3Q78 B;  2V8K A;  1DOG A;  3M74 A;  5EAT A;  4LNV A;  3SQC A;  3RSY A;  2XWJ B;  5GW7 A;  1HMW A;  3QPF A;  2J5C A;  5DGQ A;  2F0Y B;  2EAD A;  3E7J A;  2H6I B;  1OJN A;  2FUZ A;  3DSV B;  2QNO A;  4GTO B;  2FUQ A;  3E6U A;  2PMV A;  3RX7 A;  1LF9 A;  3OXU A;  2Q1F A;  3GZK A;  4OZV A;  2GH4 A;  4ONT A;  1D8D B;  4MU9 A;  3EZ8 A;  1LXM A;  1FO3 A;  1N95 B;  3H3K A;  5FO9 B;  5M7Y A;  2H6G B;  1HX9 A;  4GTQ B;  4GTR B;  5ILD A;  3KQ4 A;  3DSS B;  4WU0 A;  1QQF A;  3M77 A;  3HXF B;  1RQ5 A;  4WVA A;  1N7N A;  2BRP A;  2ZBL A;  4LIX A;  1HM3 A;  1I8Q A;  1RWG A;  1TNB B;  4TXT A;  1O1S B;  2NVP A;  2PN5 A;  3PZ4 B;  3DSW B;  4ZG8 A;  3EU5 B;  3E37 B;  1SA5 B;  1HXC A;  1KRE A;  4FJQ A;  3VW5 A; 
#chains in the Genus database with same CATH homology
 1QAZ A;  2WDA A;  1HV6 A;  4F10 A;  1RWF A;  1HMW A;  1HN0 A;  2BRW A;  2WCO A;  1J0N A;  1F9G A;  1HM2 A;  4OK2 A;  1X1J A;  4MMI A;  3E7J A;  5JMF A;  4OZW A;  1OJN A;  4NEI A;  1N7N A;  2BRP A;  4E1Y A;  2BRV X;  1OJP A;  2FUQ A;  1X1H A;  1HM3 A;  1I8Q A;  1RWG A;  2E22 A;  3E80 A;  4MMH A;  5JMD A;  1N7P A;  3VSN A;  2Q1F A;  3VSM A;  4F13 A;  1C82 A;  4OZV A;  3AFL A;  1OJO A;  2X03 A;  3NFV A;  4OK4 A;  1RWC A;  1N7R A;  3A0O A;  1N7Q A;  2E24 A;  1CB8 A;  1LXM A;  1EGU A;  1W3Y A;  1X1I A;  1F1S A;  1RWH A;  1LXK A;  1N7O A;  1RW9 A;  1RWA A;  2FUT A;  1HMU A;  1OJM A;  1J0M A;  4OJZ A;  4FNV A;  1LOH A;  3NNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...