4E20A

Structure of mouse tyk-2 complexed to a 3-aminoindazole inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
282
Chain Sequence
DPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYKGCCEDSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRALAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHTKFTELIGQMTVLRLTELLERGERLPRPDRCPCEIYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Non-receptor tyrosine-protein kinase TYK2
publication title Enabling structure-based drug design of Tyk2 through co-crystallization with a stabilizing aminoindazole inhibitor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 282
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e20A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e20A01
1U5QA 3FSFA 3FZRA 3MYGA 1H25A 3OVVA 2BAJA 3NYVA 2CGXA 3EIDA 4DGNA 3ZRMA 3QXPA 4G6OA 5HIBA 4BTKA 4XG8A 4EH3A 4C4HA 3U6HA 3EQCA 3QQHA 5AV2A 2QOCA 2XK4A 2WZJA 2JLDA 4JX3A 4IZ7A 4R8QA 4BYJA 4IFCA 5KX8A 3Q53A 2WQEA 2BAQA 5CWZA 2NO3A 4EYMA 3FLYA 2XIRA 4UXQA 3MI9A 1YVJA 4IB1A 4CNHA 1Z9XA 1OPJA 4GFOA 4FKIA 4F9CA 5I9ZA 3GCPA 5J7BA 5BPYA 4OTRA 2CNVA 2OH0E 3OS3A 2JGZA 5AM7A 4ASZA 4U45A 4O82A 1H1WA 4S33A 2J5EA 5LCJA 3F2RA 1H28A 1XBCA 3ATSA 2ERKA 2V7OA 1AD5A 1KSWA 1WBOA 1NT2A 3AMBA 1K3AA 1FGIA 3LQ5A 5JQ8A 4Y83A 1TVOA 4V01A 5L6OA 2OF2A 1Q41A 3EYGA 5CQUA 3VWAA 1JWHA 2W1HA 3H0ZA 3UGCA 4OT5A 4PL3A 3QALE 3C4ZA 3QHRA 4O1OA 4GK2A 3AC8A 2J7TA 2O63A 5AR7A 2HZ0A 1P14A 2CN8A 3FKNA 3WF8A 4A4LA 5IDNA 5D7AA 3VS3A 2IPXA 4QP9A 2GTMA 3DZOA 3GU5A 3M42A 3JYAA 4O0SA 2C5YA 4AS0A 2F4JA 4ID7A 2XYNA 3W8LA 3UIBA 5CLPA 2FGIA 4A9UA 4GKIA 5IA2A 3PXYA 3ZOSA 2HZNA 3PWDA 4Q9SA 3VUIA 4Z3VA 3QCXA 4ERWA 5BNJA 3GQLA 4WUAA 1PXNA 3DLSA 4BHNA 2P2IA 2X7OA 3W18A 4HYHA 2OFVA 1WBNA 3KULA 3ALNA 4LRJA 3ZUTA 4CMTA 3RAIA 4AFEA 1OVEA 3BRBA 3UC3A 2R3JA 4LGGA 4RIWA 3R7YA 2W5BA 1UU7A 5M57A 3KREA 2YEXA 4L3PA 5A54A 4U6RA 3SXSA 3ZFXA 2I7QA 4XLVA 4LL5A 4WSQA 3EFKA 4YC3A 5EHOA 3TUDA 1JSVA 3FZOA 5KKRB 3DS6A 4W8DA 2JIIA 3G6HA 1T46A 1A48A 4D2TA 3JR1A 5BMMA 1XBBA 2OJFE 3DGKA 2PK9A 3QYWA 3KB7A 4JBOA 5DFPA 5AFVA 1PMVA 5CSVA 3VS1A 4U0IA 4UY9A 4AZSA 3GC0A 3DFAA 2XNNA 4EK4A 3MPAA 3U51A 4DEEA 4AW2A 4ORKA 4MXCA 3AC4A 1JSUA 3QWJA 4EJNA 5KMLA 2HZ4A 1WZYA 2XYUA 4FT7A 2C1AA 4F9YA 4XS2A 2HIWA 3QUPA 4UMTA 4J71A 4FG9A 4N4SA 4BBMA 2RSVA 1FVVA 3C13A 3DQXA 3BI6A 3C51A 3A62A 3H9RA 3OT3A 3TUCA 4I3ZA 2Z7RA 3E5AA 2GPHA 3SQQA 4GL9A 2CPKE 2XRUA 1Q5KA 3F2AA 4D1ZA 4GT5A 4S34A 4DGMA 3IW7A 4DF3A 3PJ2A 5J8IA 4DCAA 2JD5A 3KA0A 5L8LA 3ZUUA 2B9HA 3ORKA 5EOBA 4QMQA 3UG1A 2ZV2A 4M0ZA 3IKAA 1VZOA 4RX8A 4R5SA 3BLQA 4PL5A 4R1VA 2FB8A 4C57A 4G17A 1NVSA 4NFNA 3BYMA 4CFFA 3HDMA 2W9ZB 4QTBA 4PPBA 3D14A 5BVFA 3PY0A 2C1BA 3I7CA 4PTCA 4CFNA 5CALA 3ZH8A 1QMZA 5JRSA 1KE7A 4MX9A 2EXCX 1H1PA 5B2KA 5IQAA 1VR2A 5J79A 2W4OA 3HUCA 4FV3A 4FZFB 1OGUA 3ENMA 4AOIA 4EH5A 2GFCA 5CAOA 2RL5A 5C4KA 4A4OA 4IM3A 3TNHA 1FGKA 1TKIA 3BKBA 5BVWA 3WILA 4BKJA 2W4JA 4BKYA 3V6RA 3HL7A 4RLLA 4ZIMA 2PVJA 2W7XA 2PZ5A 4RIYA 4FKLA 4PQNA 3BLHA 2F2CB 2XF0A 2E9VA 3NZ0A 3QTRA 4KKEA 4S31A 5AR5A 3V3VA 3V5WA 3KULB 4AQCA 4GMYA 2PE1A 3I6WA 5E1SA 4D0XA 4UWYA 5ACBC 3F82A 3ZO3A 3GNIB 3NNXA 2WU6A 4BTJA 4E73A 4RIWB 3EFWA 4RZWA 2IVUA 2VTOA 4L00A 3UVPA 5AP6A 3R7IA 4Q5HA 4MK0A 2VWBA 2WU7A 4BDBA 2BILB 2VTNA 4ZXTA 2A2AA 1AQ1A 4IB0A 3G90X 4BI2A 3VF8A 3VW8A 1M14A 3QD3A 3QZIA 3FJQE 3RNIA 5EW8A 2PVMA 4LL0A 2PWLA 2X8EA 3EL7A 3SRVA 4DEAA 4I0SA 2Q0NA 4FV4A 3E7OA 2ITOA 4YZNA 2XIYA 3UO5A 1X8BA 1KE5A 3IONA 2UZBA 3FI3A 2CMWA 2WQNA 4BR3A 3CTHA 3BZ3A 3IGGA 4FT9A 5EKNA 4GG7A 1Z57A 1PMNA 4M84A 3TIZA 4TRLA 3BHYA 4OTWA 3SLSA 4D2VA 4NWMA 4O0WA 3RCJA 3LXLA 5L2QA 4LRMA 5BVOA 4CXAA 3UJGA 3ODYX 4XG6A 1J3HA 4DLJA 1U4DA 2I0EA 2X2KA 5B0XA 3RNYA 3QWKA 4G3CA 4MBLA 3R8PA 4IX6A 2VTTA 5AP0A 4C3RA 1PXKA 4G6LA 3LFDA 3LZBA 1RJBA 4CT1A 4DG0E 5IH5A 1YDSE 4TXCA 3WZDA 2AC5A 2PSQA 2O3PA 3GCUA 4F64A 2XNGA 2ZMCA 5IPJA 4DH1A 4YHTA 3QCYA 4TNBA 2QO2A 2IVVA 3TEIA 4FKTA 5JQ5A 4F70A 3DAJA 1IAHA 1BL6A 4FGBA 1PXPA 3KC3A 3QAME 3FXWA 4RJ5A 5AA9A 1PKDA 3FLQA 2ONLC 5HO7A 3A61A 1PXOA 3MVMA 3ZZEA 4UX9A 1P2AA 4XG3A 4NU1A 3PE1A 5AR8A 4AXAA 1WBWA 3JVRA 2W5AA 3LMHA 1O6KA 4IAFA 1OIRA 4NEUA 4DFXE 5IA0A 4J97A 4NT4A 3FC2A 3F3TA 3OXIA 5IQEA 3IDPA 4O6LA 2PVFA 4E6AA 3AC3A 2F7EE 5L6WL 2JDRA 4DCEA 2JKKA 3V5JA 2REIA 4XX9A 5EM6A 4BVUA 4BCPA 2X9FA 2V62A 3THBA 4C0TA 3QQJA 4RIYB 4XNEA 4XV3A 4CVAA 3TV7A 4RQKA 3VJOA 4I6HA 4EONA 4KNBA 3EH9A 4PPCA 3WZKA 2XM8A 3CD3A 3E8CA 3I5NA 1B39A 1R1WA 1W0XC 3OY1A 3LCSA 4JAIA 4TNDA 3VHEA 4ANLA 4E4XA 5A4QA 2HXLA 4TYJA 2BR1A 2W1DA 3A7FA 4XYFA 5C1QB 3FMEA 5CU6A 3RM7A 5K3YA 5E91A 5CXZA 5HTCA 3DU8A 4C36A 5HVJA 2YHVA 4FVPA 4AUAA 2OGVA 4BDGA 3KCFA 5CSXA 4FKJA 4LQMA 5IQCA 2WD1A 1PXLA 4RJ6A 4C37A 5IA5A 1SNXA 2UZEA 4HZRA 2GQGA 4M12A 2NPQA 3TI1A 3UOLA 4M14A 3V8SA 2G2IA 5FD2A 3ULIA 5EQEA 3UZPA 3GC9A 2WOTA 4DBNA 2WTIA 4IBMA 2X9EA 4ZMEA 4X3FA 4AOJA 2FA2A 5M44A 4CKJA 5A6OA 3WZUA 5CZHA 3AD4A 4X6RA 4IM0A 3R8VA 3ROCA 3NUAA 3MDYA 2B9IA 3NAYA 1M7QA 3PDTA 3BGZA 3F9NA 4FTNA 4HYUA 3MA6A 4RT7A 3DB8A 5AUWA 1BMKA 4RBLA 5CI6A 5CEPA 2BCJA 3RJCA 4FA2A 1QPCA 4UWBA 1OIYA 4LMNA 4WBOA 3MVJA 4C2VA 1M52A 4JOAA 2C3JA 3O7LB 3COKA 5ACKA 1DI8A 5HIEA 5CS6A 3I7BA 3JY9A 3BLRA 2WTKB 3B8QA 3NUUA 5FRIA 1CDKA 3ZUVA 2QOLA 2VTPA 2VWIA 5F9EA 2I0VA 2UZWE 3AG9A 3ZSHA 4Z55A 5ANDA 3TNWA 4E20A 4NZWB 4GK4A 4AZVA 2J0IA 1UV5A 1TQMA 3P78A 2AC3A 4G3EA 4OBQA 4M13A 4RJ3A 1KOAA 4RVTA 3RP9A 5AEPA 4U5JA 5L2WA 4WRGA 2ZAZA 3I5ZA 4PUZA 4YNEA 5C27A 3SX9A 4EJ7A 3VAPA 4FTJA 4U7ZA 2P3GX 5D1JA 5I9YA 1OL2A 1XH8A 2WIPA 3EQPA 1R39A 4FTKA 5C8KA 4QYFA 3I1AA 4AT3A 4MD9E 5IMXA 1MUOA 5AJQA 5J9ZA 2VTSA 2YLEA 4JRNA 3GU6A 4FOBA 5FTOA 2CKQA 2WIHA 3QC4A 1OITA 4G5PA 3R9HA 4HVHA 3L9NA 3PYYA 3ZTXA 3LM0A 1UU3A 1OPKA 3FKOA 1YXTA 3FXXA 2ITYA 4FT0A 4ZS0A 3OEFX 3I4BA 4HVIA 4M66A 2H34A 2XK3A 4JDKA 4Y5QA 5IQBA 2IVSA 4DFLA 2IN6A 3V5LA 3HAVA 3ZLXA 4QMVA 1OIQA 2XNOA 2ZMDA 1BKXA 3PWYA 3TJDA 3ITZA 3F3WA 1RQQA 3O7LD 4X21A 1YI4A 4N57A 5BYLA 2QO9A 3RAHA 3GU4A 2RKUA 3ACJA 4LMUA 4TWOA 2XVDA 2VTQA 3R7OA 1E1XA 1Z5MA 3P1AA 2EU9A 4EZ3A 2WMAA 3QX4A 3RPOA 5DBXA 1JBPE 3O8TA 1YDRE 2H9VA 2QI8A 4WSYA 5FXRA 2WELA 1GZOA 4W4VA 2BFYA 2O2UA 2OU7A 2PVNA 4IVAA 5HE3A 1W7HA 2X0GA 4ZJVA 4YZCA 3MB7A 4FV7A 2PVYA 4MF1A 4LI5A 4A4XA 5C26A 3SHEA 4R78A 5FM2A 4FSMA 3G0FA 5E8TA 5LVLA 4D58A 3IOKA 4DT9A 3DNEA 4JR7A 4D9UA 4IACA 3ZMMA 5EK7A 4X3FB 3MESA 4BZNA 4O7RA 3UOHA 4XMOA 5A4TA 3COMA 2C3LA 3R7GA 2WGJA 4QP8A 5HX8A 5L6PA 2PTKA 5IA4A 4FTOA 1P4FA 2YDKA 4E4MA 3ORNA 4B9DA 2XK9A 3UO4A 4QTEA 2B7AA 4DH8A 4UN0C 3OCTA 4O91A 3Q04A 3MPMA 5J5TA 2ITVA 5FEQA 3EZRA 4CKRA 2WNTA 4TWPA 4YSMA 5FLFA 1W82A 2QQ7A 3HLLA 4MNFA 3F61A 4RWIA 4DN5A 3KF4A 3DLZA 2OLCA 3TKUA 2C68A 4ZY6A 1M7NA 1J1CA 4G6NA 3Q4CA 4L53A 3QKLA 5DN3A 3NDMA 3E88A 3R0TA 3UIMA 5C8MA 2A4LA 4OTIA 1H1RA 4A9RA 1OPLA 2PUUA 1UNHA 4EK5A 1U46A 4AN2A 4L6QA 5T6KA 3D5VA 2BIKB 3EQDA 3CCNA 4JDHA 5AM6A 4FV6A 5CT7A 2YIYA 4EBVA 2XK8A 3DJ7A 3Q5IA 4ONAA 4EOSA 2XKDA 2ITPA 4R3CA 4GRBA 4YP8A 5CEQA 1BLXA 3BHTA 1OECA 4M0YA 4B99A 1R0PA 3I0OA 1ZYDA 1FOTA 4GUBA 3P5KA 4WG4A 5HEZA 5L2TA 4QD6A 3ORLA 3F66A 4I24A 3MFSA 2OZOA 3L1SA 3EJ1A 3A99A 5TOZA 4FL2A 1U54B 3EFLA 4FSRA 3GI3A 5AV3A 5LMBA 4X2JA 2F7ZE 3OTUA 2P0CA 2VTHA 1PYXA 2UW9A 4MXOA 2YAAA 3T3UA 5IMEA 4DH5A 4CD0A 5HBEA 4F1MA 5ANEA 1Y8GA 4O83A 3F3UA 5CEMA 3K2LA 2PYWA 3C5IA 4EK3A 2PVKA 4I94A 5CEIA 3H10A 1Y6BA 3PSCA 3QRUA 5CU3A 1IA9A 5F1ZA 4WNPA 4XOYA 3B2TA 2VO6A 3A2CA 4FV0A 3R7EA 2X81A 3RZBA 3VBVA 4CQGA 5CEKA 2HK5A 3OXZA 3EQBA 4I21A 4DH7A 1XWSA 4NTSA 3L8SA 3TACA 2C6OA 3KU2A 1UNGA 5CU2A 3HRCA 2YAKA 3LOKA 1Q24A 5M55A 2UW7A 3MPTA 4XG4A 4XJ0A 2ERZE 3W2CA 5KMOA 3G9LX 3EQFA 4G9CA 4QP3A 4QPAA 1PY5A 3ZC6A 3S00A 1XHAA 3KFAA 3SGCA 2R3HA 4QMXA 3FQEA 4K1BA 4HOKA 1IAJA 3ANQA 4MEDA 4KIOA 3LLAA 3QFVA 5LMKC 4YJSA 2R3MA 4F9BA 1PYEA 3KVWA 3GC8A 4FZ6A 4AW5A 2GNLA 3LXNA 1OKZA 4CZUA 2VWYA 3BU3A 4NCTA 5CYIA 3FMHA 5EHLA 4I6FA 4F7SA 4FEVA 5C9CA 4TWCA 5IA3A 4C33A 2C6IA 3O17A 4OBPA 4X6QC 4P5QA 4IHPA 4LV8A 5IEYA 2JKQA 3Q6UA 4J52A 4UMRA 3R01A 4FKPA 4D1XA 5M53A 4F1OA 2UW6A 2OXYA 2W99B 4EH4A 3FMMA 4IE9A 3N51A 4JT3A 4FK6A 5IQIA 4ZEGA 4DH3A 3NYNA 4OGRA 5TKDA 3PE2A 5CU0A 2WQBA 1KV1A 3P7CA 5HG8A 3AT4A 4A9YA 4AZEA 1ZAOA 4H39A 3H4JA 3POZA 3FDNA 4DTKA 3DCVA 2Y4IC 4N0SA 3Q6WA 3S2PA 3U6IA 4ZK5A 3TZ9A 2HY81 4IX4A 1JSTA 5E8UA 2XCKA 3RGFA 3TNQB 1UU8A 5DLSA 4NIFA 3VF9A 1YXUA 3CGOA 3PRIA 4WNMA 1XKKA 3DKOA 4C7TA 3A7HA 3BYSA 1YXVA 4QP4A 5IUIA 3U8WA 3MH0A 3S4QA 3VC4A 2OW3A 4AZTA 5AV4A 4ZTSA 3CE3A 4JLCA 4BTMA 4FG8A 1OIUA 2C6LA 4XUFA 2XZSA 2GHMA 5HLPA 2XIKA 4IB3A 5KO1A 5M06A 4N70A 4YJRA 3EQRA 4EOKA 4BZDA 3LCTA 3CPBA 4JBPA 3SD0A 5EFQA 1JKTA 2KULA 2HW7A 2YIQA 3SDJA 3E8DA 1G8AA 3UOKA 4NJ3A 4ZZNA 4C8BA 4BCGA 1W98A 2J9MA 2BVAA 4HVDA 3R9DA 4WKQA 4XP2A 2WO6A 4O2ZA 3P4KA 5K4JA 1OL6A 3TT0A 4L44A 3BYOA 5M4FA 4QO9A 2YISA 3LFSA 3AC1A 3MFTA 2NNWB 3EMGA 5TE0A 3F3VA 1URCA 2BFXA 2QR7A 1GIJA 1WBSA 2V5QA 3BBTB 3Q3BA 4BN1A 4DAWA 2Y7JA 4LRKA 5KCVA 4BCQA 3C9WA 1HCLA 3CBLA 3MTLA 3BEAA 3TM0A 5E8SA 2YM4A 4MVFA 3IDBA 4ZLZA 3FYJX 2CKPA 4PP9A 3MN3A 5TR6A 2Y0AA 1R78A 4IB5A 4PRJA 4QQTA 3CSVA 2E2BA 1H24A 1FVTA 2CHLA 1ZY5A 1ERKA 2X2LA 3QBNA 3MIAA 2VU3A 4KKGA 3VUHA 2ZV8A 3GEQA 3NYXA 1JKSA 2OSCA 1V0BA 4C4JA 1FMOE 1OL1A 4KKHA 5HGIA 3BHUA 3U9CA 3SA0A 3QL8A 4LGHA 1RW8A 3SAYA 4EL9A 4UB7A 2BKKA 4KB8A 4ZMFA 5J1VA 4MBIA 3WOWA 3UYTA 3TKHA 3LVPA 2JIVA 4QYHA 4YZBA 2E9UA 5H8EA 5AUYA 3ZLWA 2BUJA 3P08A 4IADA 4F08A 2R4BA 4IH8A 2QLUA 4S2ZA 4FUYA 3PA4A 5H9BA 4ANBA 1MRYA 2GNFA 3ZZWA 5J9YA 1Q4LA 2QURA 3KL8A 3OZ6A 4BDJA 5GIPE 3PP1A 3NIZA 4NM7A 4PMSA 3D15A 4IW0A 4NW6A 3CY3A 3GT8A 3I81A 3ZM4A 3D5WA 1AGWA 4GKHA 2XNBA 3FMDA 4XRLA 3BWJA 2X39A 3R9OA 4O0XA 2V55A 4IC8A 1H0WA 1ZYJA 2WTKC 3IW5A 4V05A 3UNJA 5AP3A 3FPQA 2JKOA 4DC2A 3VBXA 4NIFB 2PMLX 3ET7A 3L8VA 4YPSA 3SV0A 2BHHA 3UODA 3PP0A 1KE8A 5HCXA 2WPAA 5CI7A 3I6UA 1Q8WA 4QMNA 5AP1A 2Z2WA 1YXSA 3NNVA 4M15A 2IZSA 2R0UA 1BX6A 4UWCA 4YU2A 1KE6A 4FT5A 2UVXA 2VTMA 3FLWA 3QZFA 2B9FA 3C4WA 4FMQA 4K6ZA 2CGVA 2VWZA 2YCFA 3UOJA 3QTSA 3VS0A 2C6DA 4GIIA 4QPMA 1GZNA 2ZJWA 1BI7A 2OH4A 3F5PA 4XBUA 2HENA 4EOIA 2B9JA 4BDCA 5LVPA 5KZIA 1ZXEA 3DFCB 3U54A 4A07A 3GU7A 4RQVA 3LCOA 4NSTA 3VQHA 3ZFMA 3K5UA 4QMLA 2V0DA 3BWFA 2QOKA 5FQDC 3U4UA 4E4LA 3WF6A 3UYSA 2QOBA 5CEOA 4D2PA 3SW7A 1WMKA 3C0HA 1PXMA 3OTVA 4ASXA 5KNJA 2QC6A 2HCKA 4NUSA 4FTMA 2QHNA 4PF4A 3TUBA 4NFMA 4K11A 4AFJA 2G1TA 4RFZA 2CN5A 5DWRA 4YLLA 2OWBA 2OO8X 3CP9A 4U97A 4AZFA 4EK6A 4EQUA 2C6MA 5DT3A 4C02A 2H96A 5LOHA 4HVSA 1NXKA 3CPCA 4NM3A 3QTQA 2XK6A 2XNMA 5BVEA 2X6DA 5FBOA 3PRFA 4KRDA 2C5OA 4CTBA 3A4PA 3CS9A 2VUWA 3HMPA 2XMYA 3RCDA 3RINA 4GU9A 4BDIA 5EYCA 4G16A 4GEOA 5M51A 2FSOX 2WMBA 3QHWA 4FV8A 4E1ZA 3TNPC 3DAEA 2XBAA 3OBJA 2R3KA 3UTOA 4M97A 4E6CA 1KV2A 2CNQA 1YW2A 4PMMA 4QP7A 3G2FA 3QTXA 3H9OA 5F4NA 4YJPA 2RG5A 2WOUA 3ZEWA 2CSNA 5HORA 1Y57A 3WE4A 3GUBA 3N4UA 2XBJA 4FV1A 2XH5A 5FP6A 3QF9A 4QP1A 2P2HA 3V04A 3QTIA 4I4EA 4ZTMA 4KABA 4CRSA 1Q8ZA 5E8YA 4I1ZA 5E8XA 1FMKA 4J95A 5AUUA 2QOHA 4X3FC 5HTBA 5KZ0A 3LCKA 2HAKA 4CV9A 3PY1A 3ZCLA 3K3JA 2GNHA 4J1RA 3QKKA 3H3CA 2IO6A 2UV2A 4E93A 5CASA 1SNUA 4USDA 3ORIA 5I5ZA 2LGCA 4ZOGA 2G2FA 2YDIA 4PY1A 2HZIA 5CZIA 5T3QA 1REJA 4EOOA 3S3IA 4UV0A 5TO8A 4JR3A 1PF8A 3KVXA 1CM8A 2WHBA 4IAKA 5F94A 1B6CB 4EHZA 5AP7A 3FL5A 4JI9A 3QTUA 3VBTA 3NUXA 5LWNA 1U5RA 2YZLA 3W32A 2C3KA 4EH9A 3ID6C 4OTQA 3DBFA 4NK9A 2BZKB 4ZSEA 1LPUA 3SXFA 3ZSGA 2R3RA 3VULA 1ZYLA 2ZM4A 4IIRA 4XV9A 3FZPA 3NW6A 1LUFA 4LOQA 3KK8A 2H8HA 5ANGA 2R7IA 4FTLA 4ZLYA 4USFA 3H30A 4UBAA 4EI4A 2ESMA 5EQPA 1XH6A 2OG8A 4DEHA 5CF4A 3BYUA 4RJ8A 2KTYA 4F65A 5M4CA 5HLNA 4PX6A 4L46A 4BI1A 2PZPA 3EHAA 4B0GA 3R9NA 4GYIA 3LJ1A 2OIQA 4NKSA 1OBGA 3FBVA 3MH2A 3S1HA 4EQMA 2BZHB 4K8AA 1YI3A 2BZJA 2ACXA 4ALUA 4IDTA 4XG2A 3K54A 2ZDTA 4U42A 2HWPA 2JBOA 3FV8A 3OW3A 4TWNA 5GZ9A 3E3BX 4BCOA 3G15A 3TWJA 2QCSA 3LFBA 4B8MA 3MWUA 1V1KA 5IQGA 3F6XA 3VS7A 3Q4ZA 2HYYA 3TZMA 4D1SA 4J53A 5DT4A 4I93A 2PVLA 3LXPA 4FV2A 3HVCA 3GCSA 4CCBA 1KWPA 5LWMA 4O7TA 4G1WA 3PVUA 5DR6A 4IWOA 3VRZA 2VGPA 4MBJA 3ULZA 4YZDA 4H58A 3W33A 3R8MA 5FUTA 4GFMA 3VS5A 4CFWA 2OFUA 3CKWA 3F2NA 1UWJA 1JOWB 4I6BA 3HX4A 4IEBA 4Y46A 3OCGA 2WAJA 3EQHA 3KMWA 1REKA 4O0RA 3ZU7A 4R3PA 3C5UA 3O2MA 4V0GA 3RBWA 3RHXA 4YZ9A 3R28A 2J0LA 3R9RA 4L8MA 3BYVA 3GGFA 3NMUF 5IZFA 3N4VA 3WF9A 3LQ8A 1FQ1B 3LFEA 3CJFA 2W1CA 5IQHA 3DKCA 2NP8A 4MHAA 5KMIA 5GHVA 2ZM1A 5JKGA 1H4LA 2OXXA 3ORTA 4FOCA 4XV2A 5I3OA 3HAMA 3D2IA 1GAGA 2YWPA 1UVRA 2YZAA 3VIDA 3N4TA 4X2KA 2UVYA 3QGWA 1ZMWA 5CQWA 5HE0A 2UZUE 4RA5A 2WMVA 3VHKA 2GNGA 4R7BA 2A1AB 3HP5A 1ZWSA 2UZOA 3RM6A 3CTQA 3RWQA 4NW5A 1UNLA 4CMOA 3ANRA 4M3QA 3S95A 5HU3A 3HRBA 4E5BA 1ZOGA 2V22A 3NCGA 3KXNA 2UW4A 1PRYA 5J7HA 3SXRA 5I4NA 3FKLA 2UUEA 4AGUA 4OAVB 3W2RA 4DBXA 4QT1A 3V51A 3H0YA 5K0KA 4K0YA 4TL0A 3KN5A 1O6YA 2QOOA 3QQFA 1KUTA 3P86A 5ANOA 4E6DA 5L8JA 3NUPA 2UW3A 4A7CA 3A4OX 2EUFB 4Q2AA 5AMNA 2CKOA 2E9NA 2GNJA 5ETCA 4ALWA 4ZY4A 3SG9A 4NM5A 1UU9A 3MV5A 1JKKA 3MW1A 3R22A 4FKUA 2Z8CA 4CZYB 4FV9A 1F0QA 1J1BA 2RIOA 5HCYA 4ZZMA 3V5QA 3WI6A 3PA3A 4RX7A 4EBWA 3E63A 4B8LA 4EUTA 4EOPA 3V6SA 1M2PA 1UA2A 2PY3A 2W1IA 3CEKA 2R2PA 4I20A 4FNWA 1QPDA 3T3VA 4RWLA 3HV6A 3ZXZA 3FUPA 4TY1A 5BVKA 3RPYA 4FZDB 2ITNA 4FT3A 1Y8YA 3F3ZA 2VZ6A 4NKAA 1XH4A 3OWJA 5DMZA 3QYZA 4HJOA 4D4SA 1Q97A 4UALA 4F9AA 5B2LA 5K5XA 2VV9A 2AUHA 4FZ7A 2J90A 3WARA 5C03A 2W1FA 3OG7A 4KSPA 4JX7A 3RVGA 4FL3A 2ITUA 3G6GA 3OC1A 5EH0A 1OL7A 2VO7A 3ODZX 5M4UA 2YM5A 4BGHA 2JIUA 3VN9A 4K18A 4C35A 1GOLA 2UZNA 4BTFA 1I44A 3P7BA 4HYSA 4ACMA 2YM6A 2GHGA 2PVHA 3RZFA 1ZYSA 2DWBA 4FSWA 4PTGA 3TV4A 2QKRA 3NRMA 3QX2A 4Y5HA 5I9VA 3OMVA 4YJTA 1WCCA 3KRWA 4DFNA 1XR1A 4TZRA 5DT0A 5E8WA 2ITWA 5CU4A 5BYYA 4J98A 4YR8A 4V0GB 3EN4A 2C6KA 2GSFA 2W1GA 4O7SA 4I6QA 3AMAA 3G33A 3QLFA 2F2UA 3SRVB 4CEGA 5AADA 1JNKA 1L8TA 4RPVA 4N6YA 5E92A 4FZAB 4O0TA 4PP7A 3FPMA 3RI1A 4NCTC 3W8QA 4C2WA 4CFXA 2B0QA 4CG9A 4DGLC 4JDJA 3NR9A 3WYXA 2EVAA 4YC6A 3SOAA 4XP0A 3OT8A 3CR0A 2CKEA 3NIEA 4B7TA 2FUMA 1M17A 2C47A 2R3QA 3CC6A 4K9YA 4C61A 3P23A 2B52A 4FI1A 4I5MA 3FLZA 2XK7A 1TQPA 4RJ7A 1GY3A 4ZTLA 4FL1A 4IAAA 1SVHA 3D5XA 4IJ9A 3FMNA 3AT3A 4BIBA 2VX0A 1F5QA 3GU8A 4Y85A 2CCIA 4GIHA 4S32A 4AACA 3PIZA 4ZTRA 5IU2A 5E1EA 2YCQA 4QYYA 4O7VA 4BDDA 3JPVA 3U4WA 2AYPA 4F0GA 1NVQA 3FZSA 5E8ZA 1MP8A 4DFUA 2OJJA 3PXFA 2CGWA 4BDFA 4RIOA 4MD7E 5L8KA 4PL4A 4RJ4A 4YO6A 2X7GA 3EZVA 3SVVA 4QOXA 3I79A 3VO3A 2WEIA 4USEA 3Q5ZA 3T8OA 3HMOA 1WVWA 4BIDA 4Z9LA 4NTTA 2PPQA 2R3GA 2Y6MA 4LG4A 4MXAA 2BALA 3WIGA 1CKJA 3VUDA 1CKIA 4ANSA 3PJ3A 3LPBA 2WMXA 3F88A 3IGOA 4YGAA 5EQYA 3KKVA 1PW2A 3FY0A 1YKRA 3QQKA 2EXMA 4E4NA 3FQSA 3MVHA 2BDJA 4PDSA 1ZZ2A 4JAJA 1OUYA 1QCFA 5JZJA 3CKXA 4RSSA 3QRTA 5A4EA 3GVUA 3AGMA 2V7AA 2VWWA 1W8CA 3DOGA 3JUHA 2JC6A 3UIUA 4BIEA 4OT6A 4RWJA 4X3JA 4ANNA 3PLAE 3UBDA 4BC6A 3BU5A 4IVDA 3OUKA 5HCZA 5JGBA 4WNOA 1XQZA 4RC4A 4TYEA 2W0JA 4CLIA 3TZ7A 1JKLA 3BHVA 2RG6A 3PIXA 3EB0A 4B4LA 3BBWA 5G1XA 4ZTHA 3CY2A 4L42A 3ZRLA 2WEVA 3W55A 4G2FA 2IW6A 2UZDA 2ZB1A 1HCKA 2QODA 3EQGA 4PDYA 3UG2A 2CJMA 3G0EA 4PDPA 2J5FA 4EOLA 2CCHA 4ALVA 3PXRA 3CGFA 3NUSA 4U44A 5EW9A 4LUEA 1OB3A 3CJGA 3PJ1A 3QD4A 4ZTNA 2OJGA 4BWXA 2PUNA 2BMCA 3BHHA 3FMKA 4O96A 2PU8A 4NH1A 3ENHA 4I0RA 2IVTA 3OWKA 4DITA 3HECA 4WRSA 5DR9A 4EWQA 2JDSA 5KKRC 2VO0A 4O7ZA 3NLBA 3R30A 3UDBA 4FKSA 4IM2A 4L52A 3TNIA 4YBJA 1YRPA 3DDPA 4FIEA 3TIYA 3HV5A 5CAVA 3KRXA 4F6SA 3DBDA 3MSSA 2JEDA 2X2MA 4E8AA 4BZOA 2J0KA 3FI2A 2R3OA 4PTEA 2GS7A 5BUJA 3HUBA 4FX3A 2R7BA 2XIXA 5J87A 2FSTX 2OF4A 4JQ7A 5HHWA 2YIXA 4GK3A 2A0CX 3OFMA 4E3CA 5EDQA 2IG7A 2IWIA 4ZTQA 1Q3WA 4ITHA 4QMTA 4EQCA 2PUIA 2B4SB 1OL5A 1E1VA 4YJUA 3CQUA 4CT2A 2I1MA 3IPHA 4HVGA 4UYAA 5DA3A 5I0BA 3UZTA 4DEIA 3KEXA 3P7AA 4DYMA 4ZLOA 1YWRA 3DTCA 3IOPA 2ZVAA 4FVQA 5BYZA 2XB7A 5J9LA 2XKEA 2FYSA 3LFQA 3Q2MA 5HE1A 2YDJA 1W84A 4AN9A 4O81A 1Q62A 1XO2B 4KIPA 4F9WA 3OUNB 4OTDA 4W4XA 4XBRA 5FTQA 3DKFA 5KUPA 4H05A 2VX1A 4QMMA 4BFMA 3E87A 4DA5A 2XA4A 3AOXA 4FIFA 4V04A 2ITZA 1V0OA 3MFRA 2W1EA 3E3PA 3KXMA 4JNWA 2BPMA 2HW6A 3OWLA 2GU8A 1DM2A 5JMSA 3IQ7A 1SMHA 4LUDA 4M69A 4X2GA 3FAAA 4D55A 2YLFA 3QXOA 2VTJA 3ZLYA 3KRRA 5DPVA 2BHEA 3NSZA 3DXPA 3B2WA 3D94A 5D41A 5AR2A 5F95A 3OWPA 5LVNA 1JAMA 4AOTA 1H1SA 2J0JA 3LCDA 3QKMA 4O7WA 4AGWA 3SC1A 2A19B 3QUEA 1H0VA 4K2RA 4O21A 3KXZA 4QYGA 4RVMA 5A3XA 5GJGA 4A06A 4G31A 1MRUA 1BL7A 2JFMA 4O7NA 4YJQA 4JXFA 4D0WA 2BRHA 2ONLA 2BTSA 1XH9A 3UP2A 4K33A 5F20A 5ICPA 4CGAA 4RFYA 3C50A 3U6JA 4ARKA 3F5GA 1SVGA 2Y6OA 5EYMA 3Q52A 4BCIA 2PMOX 4DT8A 1XH5A 2X8IA 2XEZA 2JDVA 4GVJA 1NY3A 2ZDUA 4CFVA 2FVDA 4R3RA 3VBQA 4YO4A 4WG3A 4F6WA 3FLSA 3LHJA 4U40A 5IUHA 4IXPA 3ZFYA 4BWKA 4TYIA 1IRKA 4BL1A 4L7SA 4R1YA 4FIJA 1M2RA 4AWIA 3RPRA 3D5UA 4IC7A 3VS4A 4BCMA 4WT6A 5HTIA 2HOGA 4ZZOA 1A9UA 4Y8DA 2IW9A 5BX0A 2XM9A 4L45A 4FC0A 3W2SA 2P4IA 5CXHA 3DK7A 3UVQA 3DBQA 4ANQA 2QR8A 3EN6A 1IEPA 1LEZA 3KMMA 5E9EA 3ORMA 4MXXA 3NW7A 4TKSA 5CSWA 3MGYA 4C4EA 5KBQA 5M07A 3O96A 3POOA 4OR5A 5HG7A 3ZDUA 2C5VA 4F09A 5DEYA 4W9XA 4ENYA 4H1MA 3Q2JA 4JJRA 4KA3A 4Y95A 3OF0A 2RFEA 4AW1A 3FMJA 2PZRA 3QTZA 1K9AA 1YHWA 4Q5EA 5FM3A 5GIOE 5AAFA 2GS2A 4MD8E 2Z7SA 2FSMX 4AGCA 4YHFA 3NAXA 5FWKK 4BCHA 4F6UA 4ZAUA 5IH4A 4LV5A 4OTGA 4W4WA 1YOLA 3LM5A 5AV0A 4CTCA 4DEGA 1GIHA 1P4OA 2OIBA 4U43A 3QD0A 4BCFA 4FNZA 4L01A 2QU6A 2VTLA 1LEWA 4GH2A 4ZSLA 5EOLA 5HI2A 3OROA 2QOIA 4ITJA 4C62A 3O71A 1VYZA 2B54A 1I09A 3E7VA 5HU9A 2C6TA 3Q60A 5JGAA 4PV0A 1ZARA 5JK3A 5LVMA 3R73A 2E9OA 4FF8A 4FKOA 3HP2A 3DBCA 2FH9A 4XH6A 3RMFA 4WD5A 3R8UA 3FMLA 3M2WA 3GFEA 4OTPA 2IJMA 4ZJJA 4G34A 3D83A 4HGLA 4M69B 4RA4A 1ZOHA 3V8WA 4F7NA 3PG3A 4F7JA 5BVNA 5ITAA 1YQJA 1H27A 4TT7A 2OZAA 2VTAA 4HCUA 1WBPA 1GNGA 3FI8A 4O0YA 4DTBA 5FEEA 3K5VA 4P4CA 3TTIA 4IJPA 2EB3A 4ZSAA 5T68A 5KBRA 3W2QA 4XHKB 5IQDA 4MXYA 4BWPA 3LJ0A 2NRUA 4EUUA 5AA8A 4MWHA 2XIZA 4QMZA 4AG8A 5IUGA 3GOKA 4I92A 4UZDA 2VD5A 1PJKA 4JG8A 4D4VA 5M09A 5IF1A 1S9JA 2E9PA 3L9MA 3EQIA 1R3CA 1ZYCA 4I41A 4MXZA 4UMPA 5EM8A 2Z02A 2P55A 3JVSA 4WNKA 3TDVA 4XV1A 3NUYA 4FV5A 4RFMA 4FTAA 3OCBA 4IQ6A 1ZRZA 4CKIA 2WQOA 1MRVA 2VWVA 4FKWA 5HVYA 5D11A 2YACA 5E90A 2ETMA 2Y8OA 5LXMA 2R3PA 3HRFA 1Y91A 4M8TA 3FWQA 2O65A 3E8NA 1NVRA 4RX5A 3ZO1A 2J50A 3PPKA 3ZM9A 3CTJA 5HO6A 3GOPA 3E93A 4Y73A 5HG9A 2JFLA 1NW1A 2QVSE 5JT2A 5L4QA 4OLIA 2QO7A 1BI8A 3BQRA 5IKWA 5A4LA 4DTAA 2W5HA 4QRCA 1ND4A 3R71A 1H00A 3LFAA 4CSVA 2OK1A 2Z7LA 3NGAA 2RFNA 3MS9A 1P5EA 2G15A 2W4KA 5AR3A 5JFVA 3O51A 3MY0A 1DS5A 5C4LA 2C4GA 4FSYA 4E7WA 4NJDA 1WVYA 2I0HA 3AXWA 3FHIA 1OI9A 3C7QA 3FZ1A 3HGKA 5LARA 4JG6A 1ZMUA 4D28A 3P0MA 3A7IA 3AC5A 3HEGA 3QD2B 5A9UA 3R04A 4FTTA 3DB6A 4JQEA 3W10A 4KD1A 2ZM3A 3LQ3A 1GZKA 3BELA 3DNDA 4Z7HA 4FTIA 4PNKA 5E4HA 3D2KA 2XUUA 4MF0A 4KINA 4IWPA 5FP5A 4XG9A 3CLYA 4GG5A 3UVRA 4D5HA 1SM2A 4F0IA 3PUPA 2F9GA 3MH3A 1O9UA 3NCZA 4KIKA 1DAYA 1Q61A 4QQCA 4RWKA 4WG5A 4YC8A 5AIKA 4HCTA 3C4CA 2QU5A 4KBCA 2ZB0A 4BB4A 2SRCA 2WB8A 3IDCA 2JKMA 5KMMA 4APCA 4L3LA 1PMUA 2F49A 3AQVA 3OCSA 3UP7A 4ZSJA 3BX5A 2QG5A 4MYGA 4ENXA 1CKPA 3BE2A 4O38A 2CNUA 2GTNA 3SW4A 4I4FA 2C6EA 3MJ1A 4GW8A 5EDPA 5J95A 4FTRA 2OZAB 1G8SA 4MH7A 1IG1A 4NM0A 1FPUA 3VS6A 4CMUA 4EHGA 3O0GA 1FBNA 4U3YA 1URWA 3HV3A 4GCJA 4TTHB 4FNXA 5LCKA 3RWPA 4AE9A 2WFYA 3E64A 2R3NA 5CVGA 4ZS4A 3EKKA 2BRMA 5H8BA 3EN7A 1H26A 3ZEPA 3B8RA 3FL4A 2ZV7A 3TZ8A 3KXHA 4C59A 4G3GA 4EZ7A 3E92A 2GCDA 5FDPA 2PVRA 3V8TA 5KMJA 2YN8A 3EYHA 3R83A 5AAGA 1Q3DA 4IVCA 2WTJA 3EN9A 5HD4A 3WZJA 4Z16A 4DGGA 4FE2A 4H36A 5K4IA 3FC1X 3NEWA 4O86A 1V0PA 3AGLA 3R8LA 4OBOA 2UZLA 2EWAA 4D2WA 2WMUA 5IQFA 1ZOEA 2C69A 5AUVA 2C5NA 3DAKA 3ATTA 2GQSA 2C0TA 3TTJA 2J0MB 5CNNA 2R64A 4JQ8A 4P5ZA 3QA0A 4H3QA 5HZNA 4KAOA 5LQFA 4FKGA 4MKCA 3RK7A 3UQGA 2W9FB 2W17A 4YURA 4G5JA 4EORA 3ETAA 4DEBA 2Z60A 4HCVA 1APME 5GNKA 1J7UA 3AC2A 1EH4A 4GYGA 5EG3A 4HGSA 5KMNA 3G9NA 5I9WA 4AA0A 4ANMA 1XBAA 4DFZE 3DDQA 4G3FA 4FR4A 4MNEA 4WA9A 5FTGA 5CVFA 5CSHA 5ETIA 5A46A 3DQWA 5JSMA 2GMXA 5CF6A 4KBKA 3FYKX 2B55A 2ZV9A 2BDFA 4PNIA 3TG1A 3ZBXA 2DQ7X 4QPSA 4EHVA 3P79A 3RPVA 3BV3A 4BRXA 3CQEA 1SZMA 4AT4A 3PZHA 3QC9A 5DNRA 3AMYA 5HO8A 4BBFA 3DZQA 3R02A 2QKWB 2W96B 4I0TA 4U81A 2YJRA 3MJ2A 3R1YA 4QNYA 3Q9XA 1MQBA 1OUKA 3NVKI 4KIKB 5LMKA 1OZ1A 1JQHA 2VX3A 4HW7A 3PFQA 5DYJA 3A8WA 3OW4A 4I23A 3HV7A 4QQ5A 3UPZA 3C4FA 2C3IB 3DT1A 3GP0A 3Q9WA 4HYIA 2XNPA 2Q83A 1YWVA 4KS7A 5DGZA 2BIYA 4YTFA 4ZY5A 4YTIA 3OP5A 1U59A 2ETKA 5KHXA 2OXDA 3D0EA 3ZONA 4FEUA 4GUEA 3RHKA 2OIDA 2R5TA 3PXQA 4BYIA 1BYGA 5GZAA 5EI2A 1S9IA 5FDXA 4BICA 3KK9A 2YERA 3NUNA 3ZO2A 3TDWA 3C4EA 3OEZA 5IISA 4JL9A 4IAIA 4FEXA 4BCNA 3QQUA 2VAGA 3VS2A 5ANJA 2Q0BA 3GENA 4F99A 2OICA 2XJ0A 1OKWA 4OAUC 3R00A 4QTAA 3HKOA 4G3DA 3A60A 3U87A 4FBXA 5HOAA 2YIWA 1GZ8A 4EK8A 4L68A 4O0VA 5AIRA 3PPJA 3GFWA 4TPTA 3HMMA 4QQJA 3ZO4A 3A8XA 3HA6A 3KY2A 5JH6A 4BHZA 4RMZA 4QMYA 3W2OA 3NW5A 5I3RA 2C0OA 2PUPA 4FEWA 3FSKA 4X7QA 4U79A 2YM3A 5JN2A 5KHWA 2YM8A 2QG7A 3RAWA 2DYLA 4JIKA 4F0FA 4EHEA 3KF7A 4AZWA 3IW8A 3L8XA 4E5WA 4NL0A 3LW0A 5CF8A 1Q8YA 3DTWA 5HVKA 5ETAA 4WBBB 4M68A 4M67A 2CLXA 1VJYA 2GHLA 5DEWA 2PZYA 1OKVA 2RFDA 5AUXA 4C4IA 4DHFA 2OJ9A 4J8MA 1OMWA 5DVRA 1QPJA 2YITA 3HZTA 4QNAA 3LAUA 3BGPA 5C01A 2B1PA 2I40A 2O64A 4AP7A 2PHKA 2W05A 3MY1A 4RZVA 2LAVA 4EH2A 4BKZA 2PE2A 4MNEB 3VUGA 4JS8A 4FSQA 3AD6A 5AX3A 3FLNC 4ACCA 4L9IA 4CFMA 1RE8A 3WIKA 4GSBA 3DBEA 3VW6A 4XRJA 5E8VA 3W2PA 5D9HA 5HESA 2CGUA 3F5UA 3T9IA 5BQ0A 2VWUA 2F57A 5CX9A 2HWOA 4UMQA 2O5KA 3DKGA 3FY2A 4XOZA 2Y9QA 4F1TA 3M1SA 3LLTA 3EFJA 4FKRA 1YDTE 4L43A 2PL0A 2PZIA 4H3BA 4R5YA 4DEDA 3BU6A 2WKMA 3EN5A 2J6MA 4YZMA 3COIA 4C4FA 4WOVA 5CY3A 2BDWA 2JBPA 3LE6A 2GS6A 4EZ5A 4RIXA 5ANKA 3ZLSA 4FGRA 3R21A 4FNYA 5TT7A 4K77A 5H2UA 3TJCA 2F7XE 2X1NA 4BCJA 1YHSA 5L3AA 5AAEA 2JITA 2XNEA 3GC7A 3MB6A 1DI9A 4FIHA 2BRBA 4MTAA 3IW4A 4QMUA 5JZNA 1YWNA 3MTFA 3RK5A 1VYWA 3DJ5A 2GDOA 4O0UA 5JFSA 4RRVA 3KXXA 5TF9A 5KE0A 1DAWA 2ETRA 3Q9YA 4I5PA 2WMSA 4IANA 1O6LA 1WBVA 4PMTA 4YJOA 4AW0A 5IH6A 4QTCA 4Q9ZA 5BVDA 2Y4IB 4IZAA 3E8EA 3PJ8A 2YWVA 3PPZA 1Q8TA 2BRNA 4J99A 3QRKA 4X0MA 2YJSA 4KRCA 1ZZLA 4OTHA 2J2IB 3QZHA 4EH6A 2J51A 4IX5A 3GBZA 5AP2A 3UC4A 5J5SA 1CSNA 3DXNA 5BUIA 4PPAA 1VEBA 2WTDA 1Y6AA 2WTCA 4CV8A 3NWWA 3DJ6A 4G9RA 3NX8A 3Q32A 4UEUA 1LR4A 2X7FA 5HBHA 4IWDA 1YOJA 5HG5A 2R3FA 2X8DA 1KOBA 2YA9A 2JAMA 2OKRA 5J1WA 3JY0A 2R0IA 4FSNA 5G6VA 2XKCA 3ZC5A 5IG1A 1UWHA 4UZHA 1PKGA 4FODA 4CYJA 3RPSA 4CLJA 4YPDA 4RGJA 2C5XA 4KSQA 5IDPA 4GU6A 3ELJA 3E62A 4QMSA 2A27A 4H3PA 4DLIA 4KWPA 4FUXA 4WO5A 4N6ZA 3A7GA 4TN6A 3FXZA 4EC8A 2YABA 1G3NA 1GIIA 2OJIA 2IZUA 3BV2A 5H3QA 2B53A 2EXEA 4YNOA 2BROA 5CTPA 3AT2A 5HNIX 4RLKA 3JS2A 2Y4PA 3DA6A 3R2BA 4L7FA 5CNOA 4I5HA 4ASEA 5ETFA 3WBLA 4CCUA 4X2FA 2C30A 2BKZA 5CANA 4XG7A 4YSJA 5GINE 2W1ZA 1L3RE 3ORXA 2R3IA 3PJCA 4O1PA 4S30A 3MIYA 4UMUA 3SG8A 4HGEA 4ACDA 4C3FA 5B7VA 4JBVA 3HMNA 3L9LA 4UXLA 4C58A 3OY3A 4C34A 2G9XA 3HMIA 2PMNX 4A9SA 1QL6A 3UIXA 1F3MC 1WFCA 3D7TA 3F5XA 1XJDA 3JXWA 4FK3A 4TYHA 4W9WA 3UMXA 3QCQA 1H1QA 5I9UA 2WTVA 2ZOQA 4BDKA 4C38A 3GB2A 4APPA 1BUHA 4RIXB 4C4GA 4ERKA 5LJJA 3PXKA 5DR2A 2UZTA 4R6VA 3KXGA 4RVKA 4BI0A 5H8GA 4DE4A 4D4RA 5A14A 2RGPA 3VJNA 4B6LA 3C0IA 3VVHA 3R2YA 4O7YA 4I22A 3VBWA 3EKNA 3NNWA 5HICA 3KCKA 4EH7A 1J7IA 2XJ1A 3PZEA 3SOCA 3IK3A 2JDTA 3OD6X 1STCE 5M4IA 4AF3A 2XRWA 3QRIA 1XH7A 2CDZA 4XLIA 3ORPA 4GJ3A 5AP5A 5HBJA 3UQCA 2WMTA 3F7WA 5DOSA 1B38A 4JRVA 1J91A 3IECA 4OW8A 5GJDA 4BCKA 4BBEA 2GQRA 3IW6A 4DINA 4EYJA 2R3LA 3PIYA 3S0OA 4HGTA 3F69A 3VUMA 3ACKA 3OBGA 5CENA 5IEXA 1WBTA 4QYEA 5CAPA 4AE6A 4QMOA 5K9IA 3OOMA 3MBLA 4R77A 1H8FA 4O7LA 2RF9A 3CQWA 4U9AA 3WE8A 4O2PA 3IS5A 5DI1A 4Z7GA 5GZ8A 5FGKA 2XEYA 4P7EA 2UZVA 4RVLA 3D4QA 2XJ2A 4YBKA 2VNYA 3DK3A 4CZTA 5HNGA 3O8UA 5HQ0A 2XKFA 5GJFA 4BY9E 5EHYA 2O8YA 4YLKA 5AV1A 4CRLA 4ZSGA 5K0XA 3UNKA 4PMPA 3NVMB 5DE2A 3ZDIA 2X4ZA 4EOJA 4AAAA 1U54A 2I0YA 5D10A 1JPAA 4AA5A 4IZ5A 3KRJA 1KE9A 5FXQA 5DRBA 2IW8A 3NNUA 3LMGA 4E6QA 4U41A 3H9FA 2J4ZA 2OI4X 4CQEA 3FI4A 5A4CA 3EWHA 4FSUA 2WMQA 1Q99A 1YXXA 3LJ2A 3O23A 4J8NA 5AR4A 5HNBA 3BQCA 3O50A 1H08A 4FKQA 4QTDA 3W16A 4UYNA 3SKCA 5I9XA 2X6EA 2VO3A 3FHRA 4GVAA 5EDRA 4YJNA 3TKIA 1SVEA 4QP2A 3PVBA 3WF5A 3GCVA 5IA1A 2IZRA 3QGYA 4LM5A 4EH8A 2DS1A 3GXLA 1PHKA 3I60A 3ORZA 4IFGA 5AWMA 3UPXA 3WYYA 4EKLA 4LGDA 4PDOA 2YFXA 3LFCA 5HX6A 2BRGA 1IASA 3DPKA 4GT4A 3R1SA 4FIIA 3UNZA 3ZBFA 2FSLX 3HYHA 1CTPE 3PVWA 3D7TB 4KIQA 4MCVA 2YIRA 4TYHB 5CF5A 3R7VA 1ZY4A 2QONA 4GFGA 3HNGA 5AP4A 4HPUE 3U9NA 3C1XA 3KMUA 3PA5A 4DFBA 3LFNA 1YI6A 4ANOA 4II5A 3FQHA 3BIZA 3PSBA 3LIJA 4MAOA 2GFSA 3PXZA 3G5DA 2YCSA 3M11A 4YTHA 3RALA 4FEQA 3GQIA 1G5SA 4E5AX 3LFFA 4JVGA 2ITTA 3OHTA 4MQ2A 4CFUA 2VNWA 4YLJA 5M08A 1T45A 2IZTA 4FICA 5D12A 3TV6A 5LVOA 3VUTA 4JBQA 3ZS5A 3O8PA 3ZXTA 4GV1A 2RFSA 3II5A 2QHMA 2X4FA 5HLWA 2VTRA 3NPCA 1JLUE 3BEGA 3A7JA 3I0QA 5CVHA 3HA8A 5BMSA 4JDIA 5CAUA 3F7ZA 3R6XA 3W1FA 5BUEA 3CD8A 3KN6A 3QRJA 4ACGA 5KMKA 4E26A 4LYNA 3ERKA 4JIAA 3P9JA 5JFXA 4PWNA 4NYEA 4FTUA 4FYNA 3ZHPC 3WZEA 4IAYA 2JAVA 4X2NA 2NRYA 3Q9ZA 3RAKA 4F7LA 4O6EA 4AA4A 1R0EA 5HE2A 2QLQA 3VQUA 4AGDA 1FINA 3L9PA 2HY0A 3R1NA 4J96A 5L2IA 2XCHA 4W8EA 3DK6A 3VNTA 1WAKA 4HNFA 2O0UA 2Z7QA 5FG8A 1NA7A 2CLQA 5EI6A 2I6LA 3ZSIA 4OTFA 4YTCA 3D9VA 3PG1A 4M7IA 3K3IA 1ZMVA 4AX8A 4RC2A 4XP3A 4DG2E 1PXJA 3FE3A 4MWIA 4IMYA 4BGQA 4D2RA 1UKIA 1A06A 1CMKE 4D4YA 5JEBA 2JDOA 2YCRA 4IZYA 4BDEA 4IX3A 5FBNC 3QQLA 1H01A 1IA8A 2C0IA 2VGOA 4H1JA 4WUNA 3BPRA 4ZP5A 4CYIA 3ZRKA 5EYKA 4R7HA 4XCUA 4FG7A 5JRQA 1OM1A 1PXIA 1PMEA 5EKOA 1M2QA 3QA8A 5DIAA 4HZSA 5K5NA 2VRXA 4AU8A 5EM7A 4EWHA 4DG3E 1MQ4A 4FTQA 1RDQE 3DY7A 4IVBA 4FVRA 4EEVA 2WMRA 5C8NA 5D7VA 3Q4TA 5DRDA 3G51A 4C3PA 2G01A 1H07A 3CXWA 2VTIA 2YM7A 3PTGA 4I5CA 4O22A 3C4XA 2BZIB 3QCSA 3PSDA 2EB2A 3LMIA 3MVLA 3PLSA 4W4YA 4J7BA 4ZJIA 1LP4A 3PY3A 1YOMA 3DXQA 3R8ZA 4HPTE 1FVRA 4IAZA 5HD7A 4BGGA 1ATPE 4U8ZA 4YUQA 1W83A 1E9HA 1JVPP 3BE9A 3LXKA 4RX9A 3R7UA 4QP6A 4P2KA 4EOMA 2GNIA 4RC3A 3MFUA 3HV4A 3OXTA 4BF2A 3D7ZA 4FIGA 4IDVA 3KQ7A 4YJVA 4LOOA 3TN8A 4ASDA 5CAQA 1ZLTA 2HXQA 3RKBA 4HNIA 4O27B 3OOGA 4L67A 4GS6A 3N9XA 3RK9A 4R7IA 3EOCA 4KUJA 2ITQA 2QD9A 5A6NA 3Q96A 1SYKA 2QNJA 5EW3A 4DGOA 3RTPA 3UMWA 3QQGA 2PULA 4FSZA 4GT3A 4IWQA 3BGQA 3V01A 4RG0A 5DH3A 4AN3A 3R63A 1GJOA 4FSTA 5L2SA 5JGDA 3DV3A 5CSPA 3REPA 4A9TA 3T9TA 4FYOA 3TL8A 3EL8A 2ITXA 4GJ2A 2VWXA 4AT5A 5HKMA 3UO6A 4JG7A 2PE0A 4U80A 3BCEA 4DFYA 5M56A 4BDHA 3C0GA 4O84A 4QMWA 5DG5A 2UW5A 1K2PA 4WHZA 5AX9A 3U55A 4EC9A 2HELA 3CIKA 3GCQA 2BTRA 5AUTA 2QOQA 4ITIA 4TYGA 3QTWA 5DHJA 4LOPA 3ROYA 3V5TA 2DUVA 2UW8A 3Q4UA 5ANIA 1IR3A 2WXVA 5IEVA 3AD5A 3UZRA 2UW0A 3FZTA 3MH1A 5B2MA 5JFWA 2R9SA 4KBAA 4U3ZA 1YHVA 5EI8A 5AUZA 5HIDA 4XEYA 4D5KA 4F63A 3UQFA 3QUDA 2ZYBA 4LFIA 3FEGA 4D2SA 2W06A 3V5PA 2XP2A 3NYOA 2WTWA 4Y72A 1QPEA 2BAKA 4FKVA 5EYDA 3MY5A 3ALOA 5FEDA 5FXSA 2XS0A 3KGAA 4WIHA 2WQMA 5LMAA 4CG8A 4OUCA 2WMWA 3KRLA 3R1QA 4EOQA 1UKHA 1OKYA 2PMIA 3VRYA 4QMPA 5E7RA 3QU0A 4KS8A 3MA3A 3TCPA 2G2HA 4F4PA 4YHJA 3COHA 3QZGA 3HDNA 4ACHA 2P33A 3ZYAA 4YMJA 2FO0A 4BDAA 1HOWA 1TQIA 4MQ1A 5EM5A 1J7LA 3TXOA 5CT0A 3VBYA 3L8PA 4EKKA 4TW9A 3UE4A 1WVXA 2QOFA 3LKMA 3NS9A 3QLGA 1OBDA 2OBJA 4FTCA 2UVZA 3IO7A 4D9TA 2VN9A 3IG7A 3VUKA 2H6DA 3PVGA 4P90A 3WF7A 4L3JA 1Q8UA
chains in the Genus database with same CATH superfamily
1U5QA 3FSFA 3FZRA 3MYGA 1H25A 3OVVA 2BAJA 3NYVA 2CGXA 3EIDA 4DGNA 3ZRMA 3QXPA 4G6OA 5HIBA 4BTKA 4XG8A 4EH3A 4C4HA 3U6HA 3EQCA 3QQHA 5AV2A 2QOCA 2XK4A 2WZJA 2JLDA 4JX3A 4IZ7A 4R8QA 4BYJA 4IFCA 5KX8A 3Q53A 2WQEA 2BAQA 3AKJA 5CWZA 2NO3A 4EYMA 3FLYA 2XIRA 4UXQA 3MI9A 1YVJA 4IB1A 4CNHA 1Z9XA 1OPJA 4GFOA 4FKIA 4F9CA 5I9ZA 3GCPA 5J7BA 5BPYA 4OTRA 2CNVA 2OH0E 3OS3A 2JGZA 5AM7A 4ASZA 4U45A 4O82A 1H1WA 4S33A 3UDTA 2J5EA 5LCJA 3F2RA 1H28A 1XBCA 3ATSA 2ERKA 2V7OA 1AD5A 1KSWA 1WBOA 1NT2A 3AMBA 1K3AA 1FGIA 3LQ5A 5JQ8A 4Y83A 1TVOA 4V01A 5L6OA 2OF2A 1Q41A 3EYGA 5CQUA 3VWAA 1JWHA 2W1HA 3H0ZA 3UGCA 4OT5A 4PL3A 3QALE 3C4ZA 3QHRA 4O1OA 4GK2A 3AC8A 2J7TA 2O63A 5AR7A 2HZ0A 1P14A 1W2CA 2CN8A 3FKNA 3WF8A 4A4LA 5IDNA 5D7AA 3VS3A 2IPXA 4QP9A 2GTMA 3DZOA 3GU5A 3M42A 3JYAA 4O0SA 2C5YA 4AS0A 2F4JA 4ID7A 2XYNA 3W8LA 3UIBA 5CLPA 2FGIA 4A9UA 4GKIA 5IA2A 3PXYA 3ZOSA 2HZNA 3PWDA 4Q9SA 3VUIA 4Z3VA 3QCXA 4ERWA 5BNJA 3GQLA 4WUAA 1PXNA 3DLSA 4BHNA 2P2IA 2X7OA 3W18A 4BJJB 4HYHA 2OFVA 1WBNA 3KULA 3ALNA 4LRJA 3ZUTA 4CMTA 3RAIA 4AFEA 1OVEA 3BRBA 3UC3A 2R3JA 4LGGA 4RIWA 3R7YA 2W5BA 1UU7A 5M57A 3KREA 2YEXA 4L3PA 5A54A 4U6RA 3SXSA 3ZFXA 2I7QA 4XLVA 4LL5A 4WSQA 3EFKA 4YC3A 5EHOA 3TUDA 1JSVA 1ST4A 3FZOA 5KKRB 3DS6A 4W8DA 2JIIA 3G6HA 1T46A 1A48A 4D2TA 3JR1A 5BMMA 1XBBA 2OJFE 3DGKA 2PK9A 3QYWA 3KB7A 4JBOA 5DFPA 5AFVA 1PMVA 5CSVA 3VS1A 4U0IA 4UY9A 4AZSA 3GC0A 3DFAA 2XNNA 4EK4A 3MPAA 3U51A 4DEEA 4AW2A 4ORKA 4MXCA 3AC4A 1JSUA 3QWJA 4EJNA 5KMLA 2HZ4A 1WZYA 2XYUA 4FT7A 2C1AA 4F9YA 4XS2A 2HIWA 3QUPA 4UMTA 4J71A 4FG9A 4N4SA 4BBMA 2RSVA 1FVVA 3C13A 3DQXA 3BI6A 3C51A 3A62A 3H9RA 3OT3A 3TUCA 4I3ZA 2Z7RA 3E5AA 2GPHA 3SQQA 4GL9A 2CPKE 2XRUA 1Q5KA 3F2AA 4D1ZA 4GT5A 4S34A 4DGMA 4LDTA 3IW7A 4DF3A 3PJ2A 5J8IA 4DCAA 2JD5A 3KA0A 5L8LA 3ZUUA 2B9HA 2XARA 3ORKA 5EOBA 4QMQA 3UG1A 3UDSA 2ZV2A 4M0ZA 3IKAA 1VZOA 4RX8A 4R5SA 3BLQA 4PL5A 4R1VA 2FB8A 4C57A 4G17A 1NVSA 4NFNA 3BYMA 4CFFA 3HDMA 2W9ZB 4QTBA 4PPBA 3D14A 5BVFA 3PY0A 2C1BA 4AXCA 3I7CA 4PTCA 4CFNA 5CALA 3ZH8A 1QMZA 5JRSA 1KE7A 4MX9A 2EXCX 1H1PA 5B2KA 5IQAA 1VR2A 5J79A 2W4OA 3HUCA 4FV3A 4FZFB 1OGUA 3ENMA 4AOIA 4EH5A 2GFCA 5CAOA 2RL5A 5C4KA 4A4OA 4IM3A 3TNHA 1FGKA 1TKIA 3BKBA 5BVWA 3WILA 4BKJA 2W4JA 4BKYA 3V6RA 3HL7A 4RLLA 4ZIMA 2PVJA 2W7XA 2PZ5A 4RIYA 4FKLA 4PQNA 3BLHA 2F2CB 2XF0A 2E9VA 3NZ0A 3QTRA 4KKEA 4S31A 5AR5A 3V3VA 3V5WA 3KULB 4AQCA 4GMYA 2PE1A 3I6WA 5E1SA 4D0XA 4UWYA 5ACBC 3F82A 3ZO3A 3GNIB 3NNXA 2WU6A 4BTJA 4E73A 4RIWB 3EFWA 4RZWA 2IVUA 2VTOA 4L00A 3UVPA 5AP6A 3R7IA 4Q5HA 4MK0A 2VWBA 2WU7A 4BDBA 2BILB 2VTNA 4ZXTA 2A2AA 1AQ1A 4IB0A 3G90X 4BI2A 3VF8A 3VW8A 1M14A 3QD3A 3QZIA 3FJQE 3RNIA 5EW8A 2PVMA 4LL0A 2PWLA 2X8EA 3EL7A 3SRVA 4DEAA 4I0SA 2Q0NA 4FV4A 3E7OA 2ITOA 4YZNA 2XIYA 3UO5A 1X8BA 1KE5A 3IONA 2UZBA 3FI3A 2CMWA 2WQNA 4BR3A 3CTHA 3BZ3A 3IGGA 4FT9A 5EKNA 4GG7A 1Z57A 1PMNA 4M84A 3TIZA 4TRLA 3BHYA 4OTWA 3SLSA 4D2VA 4NWMA 4O0WA 3RCJA 3LXLA 2X0PA 4LRMA 5L2QA 5BVOA 4CXAA 3UJGA 3ODYX 4XG6A 1J3HA 4DLJA 1U4DA 2I0EA 2X2KA 5B0XA 3RNYA 3QWKA 4G3CA 4MBLA 3R8PA 4IX6A 2VTTA 5AP0A 4C3RA 1PXKA 4G6LA 3LFDA 3LZBA 1RJBA 4CT1A 4DG0E 5IH5A 1YDSE 3W0RA 4TXCA 3WZDA 2AC5A 2PSQA 2O3PA 3GCUA 4F64A 2XNGA 2ZMCA 5IPJA 4DH1A 4YHTA 3QCYA 4TNBA 2QO2A 2IVVA 3TEIA 4FKTA 5JQ5A 1G8KA 4F70A 3DAJA 1IAHA 1BL6A 4FGBA 1PXPA 3KC3A 3QAME 3FXWA 4RJ5A 5AA9A 1PKDA 3FLQA 2ONLC 5HO7A 3A61A 1PXOA 3MVMA 3ZZEA 4UX9A 1P2AA 4XG3A 4NU1A 3PE1A 5AR8A 4AXAA 1WBWA 3JVRA 2W5AA 3LMHA 1O6KA 4IAFA 1OIRA 4NEUA 4DFXE 5IA0A 4J97A 4NT4A 3FC2A 3F3TA 3OXIA 5IQEA 3IDPA 4O6LA 2PVFA 4E6AA 3AC3A 2F7EE 5L6WL 2JDRA 4DCEA 2JKKA 3V5JA 2REIA 4XX9A 5EM6A 4BVUA 4BCPA 2X9FA 2V62A 3THBA 4C0TA 3QQJA 4RIYB 4XNEA 4XV3A 4CVAA 3TV7A 4RQKA 3VJOA 4I6HA 4EONA 4KNBA 3EH9A 4PPCA 3WZKA 2XM8A 3CD3A 3E8CA 3I5NA 1B39A 1R1WA 1W0XC 3OY1A 3LCSA 4JAIA 4TNDA 3VHEA 4ANLA 4E4XA 5A4QA 2HXLA 4TYJA 2BR1A 2W1DA 3A7FA 4XYFA 5C1QB 3FMEA 5CU6A 3RM7A 5K3YA 5E91A 5CXZA 5HTCA 3DU8A 4C36A 5HVJA 2YHVA 4FVPA 4AUAA 2OGVA 4BDGA 3KCFA 5CSXA 4FKJA 4LQMA 5IQCA 2WD1A 1PXLA 4RJ6A 4C37A 5IA5A 1SNXA 2UZEA 4HZRA 2GQGA 4M12A 2NPQA 3TI1A 3UOLA 4M14A 3V8SA 2G2IA 5FD2A 3ULIA 5EQEA 3UZPA 3GC9A 2WOTA 4DBNA 2WTIA 4IBMA 2X9EA 4ZMEA 4X3FA 4AOJA 2FA2A 5M44A 4CKJA 5A6OA 3WZUA 5CZHA 3AD4A 4X6RA 4IM0A 3R8VA 3ROCA 3NUAA 3MDYA 2B9IA 3NAYA 1M7QA 3PDTA 3BGZA 3F9NA 4FTNA 4HYUA 3MA6A 4RT7A 2IEWA 3DB8A 5AUWA 1BMKA 4RBLA 5CI6A 5CEPA 2BCJA 3RJCA 4FA2A 1QPCA 4UWBA 1OIYA 4LMNA 4WBOA 2XALA 3MVJA 4C2VA 1M52A 4JOAA 2C3JA 3O7LB 3COKA 5ACKA 1DI8A 5HIEA 5CS6A 3I7BA 3JY9A 3BLRA 2WTKB 3B8QA 3NUUA 5FRIA 1CDKA 3ZUVA 2QOLA 2VTPA 2VWIA 5F9EA 2I0VA 2UZWE 3AG9A 3ZSHA 4Z55A 5ANDA 3TNWA 4E20A 4NZWB 4GK4A 4AZVA 2J0IA 1UV5A 1TQMA 3P78A 2AC3A 4G3EA 4OBQA 4M13A 4RJ3A 1KOAA 4RVTA 3RP9A 5AEPA 4U5JA 5L2WA 4WRGA 2ZAZA 3I5ZA 4PUZA 4YNEA 5C27A 3SX9A 4EJ7A 2IF8A 4FTJA 3VAPA 4U7ZA 2P3GX 5D1JA 5I9YA 1OL2A 1XH8A 2WIPA 3EQPA 1R39A 4FTKA 5C8KA 4QYFA 3I1AA 4AT3A 4MD9E 5IMXA 1MUOA 5AJQA 5J9ZA 2VTSA 2YLEA 4JRNA 3GU6A 4FOBA 5FTOA 2CKQA 2WIHA 3QC4A 1OITA 4G5PA 4O4DA 3R9HA 4HVHA 3L9NA 3PYYA 3ZTXA 3LM0A 1UU3A 1OPKA 3FKOA 1YXTA 3FXXA 2ITYA 4FT0A 4ZS0A 3OEFX 3I4BA 4HVIA 4M66A 2H34A 2XK3A 4JDKA 4Y5QA 5IQBA 2IVSA 4DFLA 2IN6A 3V5LA 3HAVA 3ZLXA 4QMVA 1OIQA 2XNOA 2ZMDA 1BKXA 3PWYA 3TJDA 3ITZA 3F3WA 1RQQA 3O7LD 4X21A 1YI4A 4N57A 5BYLA 2QO9A 3RAHA 3GU4A 2RKUA 3ACJA 4LMUA 4TWOA 2XVDA 2VTQA 3R7OA 1E1XA 1Z5MA 3P1AA 2EU9A 4EZ3A 2WMAA 3QX4A 2NYAA 3RPOA 5DBXA 1JBPE 3O8TA 1YDRE 2H9VA 2QI8A 4WSYA 5FXRA 2WELA 1GZOA 4W4VA 2BFYA 2O2UA 2OU7A 2PVNA 4IVAA 5HE3A 1W7HA 2X0GA 4ZJVA 4YZCA 3MB7A 4FV7A 2PVYA 4MF1A 4LI5A 4A4XA 5C26A 3SHEA 4R78A 5FM2A 4FSMA 3G0FA 5E8TA 5LVLA 4D58A 3IOKA 4DT9A 3DNEA 4JR7A 4D9UA 4IACA 3ZMMA 5EK7A 4X3FB 3MESA 4BZNA 4O7RA 3UDZA 3UOHA 4XMOA 5A4TA 3COMA 2C3LA 3R7GA 2WGJA 4QP8A 5HX8A 5L6PA 2PTKA 5IA4A 4FTOA 1P4FA 2YDKA 4E4MA 3ORNA 4B9DA 2XK9A 3UO4A 4QTEA 2B7AA 4DH8A 4UN0C 3OCTA 4O91A 3Q04A 3MPMA 5J5TA 2ITVA 5FEQA 3EZRA 4CKRA 2WNTA 4TWPA 4YSMA 5FLFA 1W82A 2QQ7A 3HLLA 4MNFA 3F61A 4RWIA 4DN5A 3KF4A 3DLZA 2OLCA 3TKUA 2C68A 4ZY6A 1M7NA 2A98A 1J1CA 4G6NA 3Q4CA 4L53A 3QKLA 5DN3A 3NDMA 3E88A 3R0TA 3UIMA 5C8MA 2A4LA 4OTIA 1H1RA 4O4EA 4A9RA 3BL7A 1OPLA 2PUUA 1UNHA 4EK5A 1U46A 4AN2A 4L6QA 5T6KA 3D5VA 2BIKB 3EQDA 3CCNA 4JDHA 5AM6A 4FV6A 5CT7A 2YIYA 4EBVA 2XK8A 3DJ7A 3Q5IA 4ONAA 4EOSA 2XKDA 2ITPA 4R3CA 4GRBA 4YP8A 5CEQA 1W2FA 1BLXA 3BHTA 1OECA 4M0YA 4B99A 1R0PA 3I0OA 1ZYDA 1FOTA 4GUBA 4O4FA 3P5KA 4WG4A 5HEZA 5L2TA 4QD6A 4LV7A 3ORLA 3F66A 4I24A 3MFSA 2OZOA 3L1SA 3EJ1A 3A99A 5TOZA 4FL2A 1U54B 3EFLA 4FSRA 3GI3A 5AV3A 5LMBA 4X2JA 2F7ZE 3OTUA 2P0CA 2VTHA 1PYXA 2UW9A 4MXOA 2YAAA 3T3UA 5IMEA 3W0OA 4DH5A 4CD0A 5HBEA 4F1MA 5ANEA 1Y8GA 4O83A 3F3UA 5CEMA 3K2LA 2PYWA 3C5IA 4EK3A 2PVKA 4I94A 5CEIA 3H10A 1Y6BA 3PSCA 3QRUA 5CU3A 1IA9A 5F1ZA 4WNPA 4XOYA 3B2TA 2VO6A 3A2CA 4FV0A 3R7EA 2X81A 3RZBA 3VBVA 4CQGA 5CEKA 2HK5A 3OXZA 3EQBA 4I21A 4DH7A 1XWSA 4NTSA 3L8SA 4F78A 3TACA 2C6OA 3KU2A 1UNGA 5CU2A 3HRCA 2YAKA 3LOKA 1Q24A 5M55A 2UW7A 3MPTA 4XG4A 4XJ0A 2ERZE 3W2CA 5KMOA 3G9LX 3EQFA 4G9CA 4QP3A 4QPAA 1PY5A 3ZC6A 3S00A 1XHAA 3KFAA 3SGCA 2R3HA 4QMXA 3FQEA 4K1BA 4HOKA 1IAJA 3ANQA 4MEDA 4KIOA 3LLAA 3QFVA 5LMKC 4YJSA 2R3MA 4F9BA 1PYEA 3KVWA 3GC8A 4FZ6A 4AW5A 2GNLA 3LXNA 1OKZA 4CZUA 2VWYA 3BU3A 4NCTA 5CYIA 3FMHA 5EHLA 4I6FA 4F7SA 4FEVA 5C9CA 4TWCA 5IA3A 4C33A 2C6IA 3O17A 4OBPA 4X6QC 4P5QA 4IHPA 4LV8A 5IEYA 4DDGA 2JKQA 3Q6UA 4J52A 4UMRA 3R01A 4FKPA 4D1XA 5M53A 4F1OA 2UW6A 2OXYA 2W99B 4EH4A 3FMMA 4IE9A 3N51A 4JT3A 4FK6A 5IQIA 4ZEGA 4DH3A 3NYNA 4OGRA 5TKDA 3PE2A 5CU0A 2WQBA 1KV1A 3P7CA 5HG8A 3AT4A 4A9YA 4AZEA 1ZAOA 4H39A 3H4JA 3POZA 3FDNA 4DTKA 3DCVA 2Y4IC 4N0SA 3Q6WA 3S2PA 3U6IA 4ZK5A 3TZ9A 2HY81 4IX4A 1JSTA 5E8UA 2XCKA 3RGFA 3TNQB 1UU8A 5DLSA 4NIFA 3VF9A 1YXUA 3CGOA 3PRIA 4WNMA 4MUQA 1XKKA 3DKOA 4C7TA 3PUFC 3A7HA 3BYSA 1YXVA 4QP4A 5IUIA 3U8WA 3MH0A 3S4QA 3VC4A 2OW3A 4AZTA 5AV4A 4ZTSA 3CE3A 4JLCA 4BTMA 4FG8A 1OIUA 2C6LA 4XUFA 2XZSA 2GHMA 5HLPA 2XIKA 4IB3A 5KO1A 5M06A 4N70A 4YJRA 3EQRA 4EOKA 4I6LA 4BZDA 3LCTA 3CPBA 4JBPA 3SD0A 5EFQA 1JKTA 2KULA 2HW7A 2YIQA 3SDJA 3E8DA 1G8AA 3UOKA 4NJ3A 4ZZNA 4C8BA 4BCGA 1W98A 2J9MA 2BVAA 4HVDA 3R9DA 4WKQA 4XP2A 2WO6A 4O2ZA 3P4KA 5K4JA 1OL6A 3TT0A 4L44A 3BYOA 5M4FA 4QO9A 2YISA 3LFSA 3AC1A 3MFTA 2NNWB 3EMGA 5TE0A 3F3VA 1URCA 2BFXA 2QR7A 1GIJA 1WBSA 2V5QA 3BBTB 3Q3BA 4BN1A 4DAWA 2Y7JA 4DDIA 4LRKA 5KCVA 4BCQA 3C9WA 1HCLA 3CBLA 3MTLA 3BEAA 3TM0A 5E8SA 2YM4A 4MVFA 3IDBA 4ZLZA 3FYJX 2CKPA 4PP9A 3MN3A 5TR6A 2Y0AA 1R78A 4IB5A 4PRJA 4QQTA 3CSVA 2E2BA 1H24A 1FVTA 2CHLA 1ZY5A 1ERKA 2X2LA 3QBNA 3MIAA 2VU3A 4KKGA 3VUHA 2ZV8A 3GEQA 3NYXA 1JKSA 2OSCA 1V0BA 4C4JA 1FMOE 1OL1A 4KKHA 5HGIA 3BHUA 3U9CA 3SA0A 3QL8A 4LGHA 1RW8A 3SAYA 4EL9A 4UB7A 2BKKA 4KB8A 4QEBA 4ZMFA 5J1VA 4MBIA 3WOWA 3UYTA 3TKHA 3LVPA 2JIVA 4QYHA 4YZBA 2E9UA 5H8EA 5AUYA 3ZLWA 2BUJA 3P08A 4IADA 4F08A 2R4BA 4IH8A 2QLUA 4S2ZA 4FUYA 3PA4A 5H9BA 4ANBA 1MRYA 2GNFA 3ZZWA 5J9YA 1Q4LA 2QURA 3KL8A 3OZ6A 4BDJA 5GIPE 3PP1A 3NIZA 4NM7A 4PMSA 3D15A 4IW0A 4NW6A 3CY3A 3GT8A 3I81A 3ZM4A 3D5WA 1AGWA 4GKHA 2XNBA 3FMDA 4XRLA 3BWJA 2X39A 3R9OA 4O0XA 2V55A 4IC8A 1H0WA 1ZYJA 2WTKC 3IW5A 4V05A 3UNJA 5AP3A 3FPQA 2JKOA 4DC2A 1W2DA 3VBXA 4NIFB 2PMLX 3ET7A 3L8VA 4YPSA 3SV0A 2BHHA 3UODA 3PP0A 1KE8A 5HCXA 2WPAA 5CI7A 3I6UA 1Q8WA 4QMNA 5AP1A 2Z2WA 1YXSA 3NNVA 4M15A 2IZSA 2R0UA 1BX6A 4UWCA 4YU2A 1KE6A 4FT5A 2UVXA 2VTMA 3FLWA 3QZFA 2B9FA 3C4WA 4FMQA 4K6ZA 2CGVA 2VWZA 2YCFA 3UOJA 3QTSA 3VS0A 2C6DA 4GIIA 4QPMA 1GZNA 2ZJWA 1BI7A 2OH4A 3F5PA 4XBUA 2HENA 4EOIA 2B9JA 4BDCA 5LVPA 5KZIA 1ZXEA 3DFCB 3U54A 4A07A 3GU7A 4RQVA 3LCOA 4NSTA 3VQHA 3ZFMA 3K5UA 4QMLA 2V0DA 3BWFA 2QOKA 5FQDC 3U4UA 4E4LA 3WF6A 3UYSA 2QOBA 5CEOA 4D2PA 3SW7A 1WMKA 3C0HA 1PXMA 3OTVA 4ASXA 5KNJA 2QC6A 2HCKA 4NUSA 4FTMA 2QHNA 4PF4A 3TUBA 4NFMA 4K11A 4AFJA 2G1TA 4RFZA 2CN5A 5DWRA 4YLLA 2OWBA 2OO8X 3CP9A 4U97A 4AZFA 4EK6A 4EQUA 2C6MA 5DT3A 4C02A 2H96A 5LOHA 4HVSA 1NXKA 3CPCA 4NM3A 3QTQA 2XK6A 2XNMA 5BVEA 2X6DA 5FBOA 3PRFA 4KRDA 2C5OA 4CTBA 3A4PA 3CS9A 2VUWA 3HMPA 2XMYA 3RCDA 3RINA 4GU9A 4BDIA 5EYCA 4G16A 4GEOA 5M51A 3W0QA 2FSOX 2WMBA 3QHWA 4FV8A 4E1ZA 3TNPC 3DAEA 2XBAA 3OBJA 2R3KA 3UTOA 4M97A 4E6CA 1KV2A 2CNQA 1YW2A 4PMMA 4QP7A 3G2FA 3QTXA 3H9OA 5F4NA 4YJPA 2RG5A 2WOUA 3ZEWA 2CSNA 5HORA 1Y57A 3WE4A 3GUBA 3N4UA 2XBJA 4FV1A 2XH5A 5FP6A 3QF9A 4QP1A 2P2HA 3V04A 3QTIA 4I4EA 4ZTMA 4KABA 4CRSA 1Q8ZA 5E8YA 4I1ZA 5E8XA 1FMKA 4J95A 5AUUA 2QOHA 4X3FC 5HTBA 5KZ0A 3LCKA 2HAKA 4CV9A 3PY1A 3ZCLA 3K3JA 2GNHA 4J1RA 3QKKA 3H3CA 2IO6A 2UV2A 4E93A 5CASA 1SNUA 4USDA 3ORIA 5I5ZA 2LGCA 4ZOGA 2G2FA 2YDIA 4PY1A 2HZIA 5CZIA 5T3QA 1REJA 4EOOA 3S3IA 4UV0A 5TO8A 4JR3A 1PF8A 3KVXA 1CM8A 2WHBA 4IAKA 5F94A 1B6CB 4EHZA 5AP7A 3FL5A 4JI9A 3QTUA 3VBTA 3NUXA 5LWNA 1U5RA 2YZLA 3W32A 2C3KA 4EH9A 3ID6C 4OTQA 3DBFA 4NK9A 2BZKB 4ZSEA 1LPUA 3NFGB 3SXFA 3ZSGA 2R3RA 3VULA 1ZYLA 2ZM4A 4IIRA 4XV9A 3FZPA 3NW6A 1LUFA 4LOQA 3KK8A 2H8HA 5ANGA 2R7IA 4FTLA 4ZLYA 4USFA 3H30A 4UBAA 4EI4A 2ESMA 5EQPA 1XH6A 2OG8A 4DEHA 5CF4A 3BYUA 4RJ8A 2KTYA 4F65A 5M4CA 5HLNA 4PX6A 4L46A 4BI1A 2PZPA 3EHAA 4B0GA 3R9NA 4GYIA 3LJ1A 2OIQA 4NKSA 1OBGA 3FBVA 3MH2A 3S1HA 4EQMA 2BZHB 4K8AA 1YI3A 2BZJA 2ACXA 4ALUA 4IDTA 4XG2A 3K54A 2ZDTA 4U42A 2HWPA 2JBOA 3FV8A 3OW3A 4TWNA 5GZ9A 3E3BX 4BCOA 3G15A 3TWJA 2QCSA 3LFBA 4B8MA 3MWUA 1V1KA 5IQGA 3F6XA 3VS7A 3Q4ZA 2HYYA 3TZMA 4D1SA 4J53A 5DT4A 4I93A 2PVLA 3LXPA 4FV2A 3HVCA 3GCSA 4CCBA 1KWPA 5LWMA 4O7TA 4G1WA 3PVUA 5DR6A 4IWOA 3VRZA 2VGPA 4MBJA 3ULZA 4YZDA 4H58A 3W33A 3R8MA 5FUTA 4GFMA 3VS5A 4CFWA 2OFUA 3CKWA 3F2NA 1UWJA 1JOWB 4I6BA 3HX4A 4IEBA 4Y46A 3OCGA 2WAJA 3EQHA 3KMWA 1REKA 4O0RA 3ZU7A 4R3PA 3C5UA 3O2MA 4V0GA 3RBWA 3RHXA 4YZ9A 3R28A 3W0MA 2J0LA 3R9RA 4L8MA 3BYVA 3GGFA 3NMUF 5IZFA 3N4VA 3WF9A 3LQ8A 1FQ1B 3LFEA 3CJFA 2W1CA 5IQHA 3DKCA 2NP8A 4MHAA 5KMIA 5GHVA 2ZM1A 5JKGA 1H4LA 2OXXA 3ORTA 4FOCA 4XV2A 5I3OA 3HAMA 3D2IA 1GAGA 2YWPA 1UVRA 2YZAA 3VIDA 3N4TA 4X2KA 2UVYA 3QGWA 1ZMWA 5CQWA 5HE0A 2UZUE 4RA5A 2WMVA 3VHKA 2GNGA 4R7BA 2A1AB 3HP5A 1ZWSA 2UZOA 3RM6A 3CTQA 3RWQA 4NW5A 1UNLA 4CMOA 3ANRA 4M3QA 3S95A 5HU3A 3HRBA 4E5BA 1ZOGA 2V22A 3NCGA 3KXNA 2UW4A 1PRYA 5J7HA 3SXRA 5I4NA 3FKLA 2UUEA 4AGUA 4OAVB 3W2RA 4DBXA 4QT1A 3V51A 3H0YA 5K0KA 4K0YA 4TL0A 3KN5A 1O6YA 2QOOA 3QQFA 1KUTA 3P86A 5ANOA 4E6DA 5L8JA 3NUPA 2UW3A 4A7CA 3A4OX 2EUFB 4Q2AA 5AMNA 2CKOA 2E9NA 2GNJA 5ETCA 4ALWA 4ZY4A 3SG9A 4NM5A 1UU9A 3MV5A 1JKKA 3MW1A 3R22A 4FKUA 2Z8CA 4CZYB 4FV9A 1F0QA 1J1BA 2RIOA 5HCYA 4ZZMA 3V5QA 3WI6A 3PA3A 4RX7A 4EBWA 3E63A 4B8LA 4EUTA 4EOPA 3V6SA 1M2PA 1UA2A 2PY3A 2W1IA 3CEKA 2R2PA 4I20A 4FNWA 1QPDA 3T3VA 4RWLA 3HV6A 4AXDA 3ZXZA 3FUPA 4TY1A 5BVKA 3RPYA 4FZDB 2ITNA 4FT3A 1Y8YA 3F3ZA 2VZ6A 4NKAA 1XH4A 3OWJA 5DMZA 3QYZA 4HJOA 4D4SA 1Q97A 4UALA 4F9AA 5B2LA 5K5XA 2VV9A 2AUHA 4FZ7A 2J90A 3WARA 5C03A 2W1FA 3OG7A 4KSPA 4JX7A 3RVGA 4FL3A 2ITUA 3G6GA 3OC1A 5EH0A 1OL7A 2VO7A 3ODZX 5M4UA 2YM5A 4BGHA 2JIUA 3VN9A 4K18A 4C35A 1GOLA 2UZNA 4BTFA 1I44A 3P7BA 4HYSA 4ACMA 2YM6A 2GHGA 2PVHA 3RZFA 1ZYSA 2DWBA 4FSWA 4PTGA 3TV4A 2QKRA 3NRMA 3QX2A 4Y5HA 5I9VA 3OMVA 4YJTA 1WCCA 3KRWA 4DFNA 1XR1A 4TZRA 3KIOC 5DT0A 5E8WA 2ITWA 5CU4A 5BYYA 4J98A 4YR8A 3ML1A 4V0GB 3EN4A 2C6KA 2GSFA 2W1GA 3PFYA 4O7SA 4I6QA 3AMAA 3TMOA 3G33A 3QLFA 2F2UA 3SRVB 4CEGA 5AADA 1JNKA 1L8TA 4RPVA 4N6YA 5E92A 4FZAB 4O0TA 4PP7A 3FPMA 3RI1A 4NCTC 3W8QA 4C2WA 4CFXA 2B0QA 4CG9A 4DGLC 4JDJA 3NR9A 3WYXA 2EVAA 4YC6A 3SOAA 4XP0A 3OT8A 3CR0A 2CKEA 3NIEA 4B7TA 2FUMA 1ST0A 1M17A 2C47A 2R3QA 3CC6A 4K9YA 4C61A 3P23A 2B52A 4FI1A 4I5MA 3FLZA 2XK7A 1TQPA 4RJ7A 1GY3A 4ZTLA 4FL1A 4IAAA 1SVHA 3D5XA 4IJ9A 3FMNA 3W0PA 3AT3A 4BIBA 2VX0A 1F5QA 3GU8A 4Y85A 2CCIA 4GIHA 4S32A 4AACA 3PIZA 4ZTRA 5IU2A 5E1EA 2YCQA 4QYYA 4O7VA 4BDDA 3JPVA 3U4WA 2AYPA 4F0GA 1NVQA 3FZSA