4E26A

Braf in complex with an organic inhibitor 7898734
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
270
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Identification of a Novel Family of BRAF(V600E) Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 76
structure length 270
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e26A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e26A01
4AE9A 3UOHA 1U54A 2BROA 2VWIA 4TWNA 4AW5A 4AZWA 4KB8A 4RJ4A 4QD6A 4RX9A 4TN6A 1WBSA 3ZS5A 1EH4A 2ACXA 3LIJA 3Q4CA 4C02A 4IB3A 4QP6A 2VWVA 3K3JA 5ANEA 4G9RA 5AP2A 5G6VA 2FUMA 2FSLX 3ID6C 1J91A 4FK3A 2RG6A 4IHPA 2CKEA 3NZ0A 4X3FB 3HL7A 2B54A 2W9FB 3DKFA 3T3UA 2WOUA 3VRZA 3C4ZA 4FSZA 4RFZA 2WPAA 3MVLA 4XOYA 1Q61A 2XNPA 3GCPA 1YI6A 3DB6A 2HXLA 2PE0A 5IPJA 1QPCA 5L6OA 1A9UA 3PXYA 2ZB0A 4E8AA 4Z7HA 2PMNX 5IA5A 4FT5A 4RQKA 3ZO4A 1L3RE 2QKRA 3UYTA 1H25A 4U3YA 3MVHA 4ZLYA 4I5HA 4PF4A 3BHUA 4XG7A 3IECA 3POOA 4MWHA 2OKRA 2ZVAA 4CV8A 2QO9A 2DYLA 4IZ7A 3KN6A 2BDWA 2X2MA 4O1PA 4RIOA 5B7VA 5D1JA 3TTIA 3JYAA 4RWIA 3Q60A 5HCZA 1CM8A 3ODYX 3ZU7A 1XH8A 5FXRA 5J1WA 3GU6A 3G5DA 4F9CA 3VBYA 4BHNA 1URWA 1F0QA 3O7LD 3CQWA 2OFVA 3VBWA 3HMNA 3NIEA 5M53A 3ZTXA 5AX9A 5M09A 5LCJA 4FICA 3BGQA 4U8ZA 2C3LA 2RFNA 5AA9A 4XG6A 3D5WA 4FV0A 3A4PA 3DAKA 3W2QA 4N57A 2V5QA 4JX7A 4KKHA 3VS0A 2XA4A 4FG8A 2UV2A 1KV1A 4BYJA 3KMWA 4BZNA 2QOFA 2VTOA 5HIDA 3UG2A 4DFXE 4R78A 2YJRA 2IO6A 5A4TA 3FPQA 2RL5A 5ACKA 4AZFA 4IDVA 4AT4A 4JI9A 2CN8A 4KAOA 5M4CA 3G0EA 5JSMA 5ACBC 4BTKA 4C4GA 3UOLA 3DDPA 4OT6A 4BCPA 4YLKA 2UW6A 4I5MA 4WBBB 2PVLA 2CNQA 3MVJA 2XJ2A 3AC1A 3I81A 1P2AA 3VULA 3F2RA 5K3YA 3WZJA 2OF4A 3ANQA 4HZRA 4TW9A 3ZXZA 1H0VA 5LOHA 4D58A 5CSPA 5AAGA 4XNEA 2EXEA 2O2UA 1IASA 3C9WA 4O0RA 5D7AA 1PXKA 1G8AA 1PW2A 3DTCA 1UU3A 3LFQA 4HYIA 3WE4A 4FF8A 4AT5A 3WOWA 2UZDA 4KIKA 1GZ8A 3FSFA 4YO6A 1NVQA 4CRLA 4ZMEA 3TKUA 4YZ9A 5CEMA 4R7HA 4EEVA 2Q0BA 3RAIA 1L8TA 2ZDTA 1M7NA 4U9AA 1JQHA 4IQ6A 5CU6A 4USEA 2J2IB 4FKWA 4R3RA 3PXFA 3NUXA 3LVPA 4Y85A 4FUYA 4CMUA 2IWIA 1PXPA 3TJCA 4AA4A 4F0IA 2UW0A 3GC9A 3GU7A 4NFNA 4FIFA 4LL5A 3II5A 2QR8A 3EKKA 3EQRA 4XHKB 3H10A 3GU4A 1T46A 3GBZA 4FTLA 3FC1X 3ZBFA 2W96B 4QP4A 4O38A 5KBRA 5CANA 4G2FA 4K0YA 3NR9A 1GZKA 2WD1A 4RIYB 2QLUA 2PZ5A 3LPBA 3E7OA 3QD4A 4XV3A 2IW9A 5CALA 5I9XA 4GCJA 4I23A 4PDSA 3U9NA 3ODZX 5CU2A 4A9TA 5E8UA 3FMHA 5LMKC 3R30A 3VS2A 3R9DA 1J1CA 3ZFYA 5EH0A 4ASDA 2ZAZA 2HCKA 2BZKB 1E9HA 1W84A 3DZQA 3G9LX 4W4YA 3KN5A 3O23A 3G33A 5DRBA 4X2FA 2YZLA 1SYKA 4K11A 2WKMA 3CTQA 2VTLA 3TN8A 3TUDA 3KKVA 5A4QA 3HLLA 2YDJA 3ACJA 5A9UA 5DYJA 2X6DA 4NTSA 1OL7A 2J51A 2JEDA 2JDRA 3QQHA 2W17A 5FWKK 5KHWA 4EUUA 4BDHA 2ZDUA 3MYGA 3QL8A 3RCDA 1NW1A 4FYOA 4ZJVA 3MB6A 4HCTA 4CG8A 4EK8A 5HVKA 3RM7A 2YISA 4M15A 2XM9A 4RLLA 3Q96A 3W33A 3FMEA 5KMIA 1K3AA 2HELA 5ITAA 3R8VA 4Y8DA 1JKTA 3LCDA 1KE7A 3EFKA 2ZV8A 4M0YA 4OBPA 5M07A 1H24A 4IAIA 5DH3A 3QX2A 4F0GA 3OBJA 3E64A 2OIBA 3OROA 4E4LA 2HIWA 3V5QA 1M7QA 4LYNA 3OOGA 3NIZA 3E5AA 3EOCA 4IVBA 4ZTQA 4BL1A 1YHVA 3KU2A 2XNGA 4EKLA 3NVMB 2OO8X 4FV8A 4U44A 4XH6A 4O0YA 2HWOA 3AQVA 3EKNA 4WD5A 2X2LA 2XIRA 5TT7A 4L46A 3ZXTA 3DJ5A 1IA9A 2R3KA 5CAOA 4IX4A 4NZWB 3KXXA 2R3FA 3COIA 3PIXA 3IW8A 3R04A 4GL9A 3GOPA 4IZ5A 3RINA 3TL8A 1LEWA 2P33A 3S2PA 3TV4A 5K9IA 3MIAA 1Q8UA 3KXZA 3R7IA 4IADA 4ENXA 1XWSA 2H9VA 3MJ2A 4K18A 4DA5A 2VWUA 4X0MA 4I24A 4OAUC 3ULIA 4EOSA 5D41A 2GS7A 4XYFA 1SZMA 5LQFA 5BUIA 5BUJA 2PL0A 3A7HA 3BQRA 3PSCA 4EUTA 3UQFA 5GNKA 3UP7A 1ATPE 1WVWA 4C58A 4GK2A 2RIOA 3O7LB 4TYJA 3TNHA 2YEXA 2QR7A 2UZLA 4K2RA 3TTJA 4MEDA 4X6RA 3OTUA 3NNXA 5HU9A 4D2TA 5AP3A 3FPMA 3Q52A 5CTPA 4AA5A 4JBPA 4ZLZA 3EQHA 4AZVA 4MKCA 3R8LA 2OH0E 5CEIA 3ZBXA 3GCQA 1G5SA 5CT7A 4RVKA 3UPZA 3NSZA 4XG8A 2PUUA 4BIDA 3GEQA 4YJTA 4DBNA 4TPTA 1MUOA 5DI1A 5KMNA 2VRXA 5LMBA 3R8UA 4QYGA 4IACA 4QYYA 4GSBA 2JDSA 2CGUA 4KNBA 3O71A 4MQ1A 4WT6A 2ETRA 5IA0A 1OM1A 4YPSA 2XNNA 4UWCA 4FUXA 4CEGA 5DT4A 3TZ9A 5JKGA 3AOXA 3O96A 4RIYA 4DFYA 2PU8A 2R7BA 1OGUA 2F2CB 4G9CA 3VS4A 1AQ1A 2QNJA 4DEIA 3ORKA 1OL1A 2JKOA 4K77A 3HVCA 4D55A 4DGMA 1KOBA 2UZTA 5HGIA 5E1EA 4YNOA 4EK3A 5ETFA 2UZNA 5KMMA 4QMZA 3FSKA 1TQIA 2YWPA 4FSYA 4TL0A 3WYXA 3R8MA 4II5A 4O86A 3F3WA 3IGOA 4FV1A 3TCPA 3VS3A 2PK9A 2WEIA 4QQ5A 4XS2A 4GV1A 2WMUA 2QHMA 4BCNA 2PE1A 2UUEA 2W05A 3GP0A 3PY0A 3FZSA 4C36A 5EYCA 4JBOA 3EIDA 4DFNA 1R0EA 5AADA 2RG5A 2PPQA 2VTJA 3NW7A 4XP2A 3TKIA 4CMOA 4DT8A 4MXAA 3ZMMA 2C5YA 5EYMA 3IOPA 2ITYA 2JFLA 1SMHA 2OK1A 4AW1A 4DCAA 2YITA 4RX5A 2OF2A 4GU6A 4C61A 3VBXA 4AN9A 4CFVA 4HGTA 5CNOA 4D1XA 4FV7A 4APPA 2E9NA 2VWYA 4FZDB 4FEWA 3W2CA 1KWPA 2JKMA 4L52A 4RG0A 3EQFA 3LCTA 4U5JA 2OWBA 4U41A 5BMSA 4HYUA 4NT4A 1UA2A 2W99B 5JFWA 1OPKA 3BZ3A 3MWUA 1NXKA 5FBNC 4M84A 5CEOA 4UMTA 2YM6A 5L3AA 4NM7A 5DMZA 4FTTA 1JSVA 2VU3A 1V1KA 2IW6A 3R2BA 4QTBA 4FL2A 3SKCA 3A2CA 5M4IA 3KF7A 4R7BA 4R6VA 3ZM4A 3BRBA 3QZHA 1GZNA 4FTCA 4WNOA 2VTMA 2O3PA 4DEHA 4I93A 5BYYA 4FG9A 4G3EA 5GIPE 2ZV9A 4PNKA 4G6LA 4E26A 2QURA 1YXVA 1PXNA 4HPTE 4O7WA 5IQBA 4JL9A 4KBCA 3LQ3A 5IQHA 3VN9A 4AAAA 4D5HA 5CYIA 3S1HA 3SHEA 1XH7A 2YDIA 4XG9A 3BE9A 2XEZA 3DKCA 3DQXA 3EN5A 4F1MA 1HCLA 2YAAA 3B8QA 4IFGA 3KXHA 4IDTA 3QD2B 4X21A 3BLQA 4MYGA 2B9HA 1YXSA 4JQEA 1X8BA 4I1ZA 3AT3A 1QPJA 2JBOA 2XCHA 4AQCA 5IDPA 3GENA 2CMWA 2C6LA 1DAWA 3Q5ZA 2QVSE 3S00A 2BZHB 1PKDA 3F3UA 3ZEPA 4AGCA 1ZYSA 4FZFB 5IISA 3PZEA 3KRLA 2CGVA 3GFEA 2UW9A 4PDPA 4XJ0A 3TZMA 1ZMVA 1H08A 3LM0A 2G15A 3LLTA 3R63A 2VNYA 4IC8A 5D10A 5J5SA 2VN9A 4N6ZA 5BVDA 1YXTA 3GCVA 2QONA 3D14A 4YJPA 3UZRA 3LFDA 3QTQA 2IVTA 3BQCA 4FTMA 4P2KA 3AT2A 3UO5A 3QGWA 3VW6A 1U5RA 2WXVA 3LQ5A 2QD9A 3EHAA 4WG5A 3AG9A 4AZTA 2W4JA 3ZLWA 4MF0A 2C5XA 1XH5A 3O8UA 2X4ZA 4L6QA 2PYWA 2FA2A 2QOCA 4GH2A 3ALOA 4YHTA 2GNLA 3JS2A 4BBMA 3EZVA 4IB1A 4BGQA 2W1ZA 3KULB 4XX9A 4QYEA 1Q4LA 3P5KA 1YWNA 3P7AA 3HMOA 3FZOA 2J0LA 2VD5A 3JUHA 1CSNA 3KEXA 5DEWA 1V0BA 2R3OA 1ZZ2A 2ITZA 5AV3A 5E7RA 4FIIA 3RNIA 1ZYLA 4P5ZA 3ERKA 2EB3A 2NRYA 3NYXA 4G5JA 3ULZA 4EBWA 3UIMA 4OBQA 5AP0A 3DS6A 3S4QA 4GFOA 3PXRA 3TNIA 3QZGA 1JWHA 4Y95A 5DE2A 4F9WA 1H4LA 1MRYA 3RTPA 2P0CA 3UZTA 3WZDA 4BWKA 4IB5A 3O8PA 3P1AA 2HZNA 5ANOA 1M52A 5JQ8A 3GQIA 2ZMDA 3H0ZA 4YJOA 3BHVA 5A6OA 2WQEA 4D2RA 2C6IA 2QHNA 3WF6A 2X9EA 4BDDA 3CBLA 2XUUA 3R71A 3ZUTA 4AE6A 4ZY5A 4R8QA 4FNYA 2REIA 3A62A 2C3IB 2C6OA 5DR2A 3O51A 5IMXA 5K0XA 3QRTA 4GT3A 4A9YA 3QQJA 5EDQA 5BVNA 3FQHA 3QA8A 4X6QC 2WB8A 4GFMA 4YZDA 4CLIA 5LVNA 4BZOA 2Q83A 4RFYA 5CVFA 2CSNA 4G3GA 5IDNA 3BYOA 2OJ9A 4LG4A 5GZ9A 3IQ7A 1BL7A 2XZSA 4FL1A 2GCDA 2C0OA 3D5XA 3Q4ZA 4FSTA 4FEQA 4J8MA 1KSWA 4AU8A 2P2IA 3EZRA 3DK3A 3ZRMA 3I6WA 3PTGA 3RVGA 4DHFA 3VW8A 4DT9A 5EM6A 5F4NA 5HICA 5KHXA 4D2VA 4EOIA 3UIXA 1O6KA 4LI5A 4O6EA 4DFBA 4BCQA 1ZWSA 4O7LA 5L8KA 3LFCA 3Q4UA 5AJQA 4EL9A 3TXOA 4BIBA 3LCSA 2YFXA 1U59A 1WBOA 3DDQA 2BILB 3KCKA 4FKTA 4FIHA 4FOBA 1OIUA 4F70A 4Q9ZA 1BKXA 3MA6A 3DJ7A 4L7SA 1TKIA 2YJSA 4CFXA 1ZZLA 4C7TA 3R0TA 4Q9SA 3V3VA 2CKPA 4E4MA 5IA3A 3VC4A 3K54A 3GGFA 2C4GA 3E8NA 3ITZA 4WHZA 4FV4A 5I9UA 4GUBA 1LP4A 1TQMA 2GNJA 3PG1A 3DK7A 3QWJA 3SRVB 2JKKA 4KIOA 2FSOX 3I7BA 2KTYA 4JAJA 4CFFA 3OOMA 3ORMA 4QTAA 4LUDA 1MRVA 1OL2A 3DLSA 2WO6A 2BVAA 2XVDA 4AN3A 4CZTA 4ERKA 5FM3A 5HIBA 5M44A 1W7HA 3ORLA 4UB7A 1J7IA 5AR8A 1Q99A 4ACHA 1HOWA 4F7LA 4IWPA 4QT1A 4E73A 4RIXB 5ETCA 2IVUA 3IDCA 2ERZE 4R3CA 2W0JA 3KRXA 4FZ6A 5HLPA 4F6UA 3RGFA 1CTPE 4YJNA 4S31A 4BKZA 4GW8A 3GOKA 4CYIA 2CPKE 4FG7A 2QOBA 5CSVA 4BF2A 1UVRA 4BCMA 2VWXA 4XBUA 3Q9XA 5DT0A 3FL5A 3LW0A 5IKWA 5EW8A 3HA6A 3CQUA 4YTFA 3EB0A 5E8XA 3QRUA 5HD7A 3PYYA 3OCTA 2O65A 1Q3DA 1FOTA 3E88A 5A14A 1XJDA 2W7XA 3EN6A 4K8AA 5TKDA 3C4WA 3KK9A 4ANOA 3KULA 3PIZA 3UVQA 4OTRA 2BTSA 5AIRA 4AF3A 4ZS0A 3AC5A 4MHAA 3WIGA 2C1BA 4W4VA 5JN2A 2WFYA 4CCBA 5CAPA 5F94A 3NUNA 4DH3A 3KRJA 4QMXA 4WOVA 1UV5A 1SVHA 3OFMA 3VJNA 3RZFA 4FTUA 3E93A 4G5PA 2R3JA 4C38A 4CVAA 5IEYA 5M51A 1FVVA 2GHGA 3FQEA 4FIJA 4YO4A 4O7SA 2OFUA 4IAAA 1B38A 2F57A 1Y6AA 3D94A 3UC4A 4GVAA 1PXJA 3M1SA 4H39A 3DBCA 4BN1A 5K4JA 3CEKA 3PUPA 3ZEWA 4LM5A 2V7OA 4WBOA 2E9VA 3QYWA 1YI3A 3VVHA 1H27A 2X6EA 2XK9A 4FV5A 5KMJA 1ZOGA 3E8EA 4PL3A 2VWWA 2C6KA 3KQ7A 3QAME 4M69B 4YP8A 4DGOA 5AUVA 3OT8A 1PY5A 3P86A 1A48A 4UALA 2W1DA 5DG5A 2KULA 2XK7A 1JBPE 3RHXA 3COKA 3BEGA 4EC9A 2W9ZB 4A06A 4R5SA 4H3PA 4IB0A 4O7TA 3GCUA 3K2LA 1WZYA 2W06A 4FNZA 4FSMA 3FZTA 3CCNA 4JNWA 4ZSJA 4EJNA 5A4LA 2ITPA 3UJGA 2RFSA 3LFAA 2XKCA 3NEWA 5EW3A 3A8XA 4E4NA 2VZ6A 2PWLA 3NUPA 3ORXA 4FTRA 2BAKA 2OXXA 2WQBA 5FRIA 4FSQA 5H3QA 4RJ7A 2PVMA 2YWVA 4PL4A 4MD8E 3L9NA 3BBTB 2XF0A 2OJJA 4CFNA 2IZTA 5H8GA 5F95A 3G2FA 3R02A 3RJCA 4AW2A 4BCIA 5CAUA 5K4IA 4AT3A 4ZLOA 3RCJA 2XS0A 5AX3A 3D7ZA 4N6YA 4D2PA 1TVOA 4D4VA 2UZVA 3ACKA 4F7SA 1J7LA 3OCBA 3RKBA 4EOMA 3RPOA 4DFZE 4U6RA 5GZ8A 3CY2A 4RJ8A 1VZOA 2R3HA 3F9NA 5M4FA 2CNUA 3GU5A 2VO0A 5C8MA 3MA3A 3OXZA 5JK3A 2BRNA 2W1GA 3SRVA 4LQMA 1RDQE 4QP1A 5AFVA 3FV8A 3MFTA 4WO5A 2J90A 5A46A 2ZOQA 4FKGA 4DFUA 2QODA 4RT7A 1H07A 4EJ7A 4I6QA 3CQEA 4OTQA 5LMKA 4KIKB 2GS6A 4FODA 4PL5A 4C4FA 1ZYCA 4JG7A 4MAOA 5D11A 2IZUA 5E8ZA 2Y6MA 4RIXA 4DEGA 5A3XA 1MQ4A 1YKRA 1W83A 1UU9A 3U51A 3OF0A 5JT2A 3FMNA 4ANMA 2BRBA 2F9GA 3FI8A 2ZM3A 2A4LA 2QC6A 3AC8A 5HNGA 2B9IA 3QTUA 4TWPA 2Z7SA 4IW0A 4OR5A 4FTJA 4IVDA 4BR3A 3DAEA 4F09A 1BYGA 1ZYDA 5EQEA 1MQBA 4O7RA 1LUFA 2YM7A 1GOLA 1TQPA 3KB7A 3KXNA 2C30A 3UIUA 3VUGA 2VNWA 4FOCA 1R3CA 4QOXA 3O17A 3L9LA 4E6DA 3K5UA 1VJYA 4DGGA 3VUIA 2A2AA 2GHLA 4YC6A 3VBTA 1V0PA 5EQPA 5DLSA 4HGLA 3FHIA 4O27B 5EM5A 4K33A 4CMTA 2J5EA 3QYZA 5H8EA 3VWAA 5FGKA 3UBDA 2GNFA 2BKKA 4L00A 4RJ5A 5HOAA 2R0IA 1H8FA 3TKHA 3Q6UA 2Y4PA 5C26A 5HI2A 1AGWA 3N4TA 2NRUA 1PYEA 1JAMA 2UW5A 2HAKA 4FKSA 4XRJA 3M11A 4IIRA 4IWDA 4YHFA 4JR7A 1YOJA 3QKLA 5HESA 3OXTA 4UMRA 2OXDA 2VV9A 3V6RA 1REJA 3ZH8A 4DAWA 5IQIA 3SA0A 1R39A 2VTRA 3ETAA 1YDTE 1PMVA 1WBWA 5CXHA 3NUSA 2UVYA 4O0UA 4M69A 2CCHA 3OMVA 2HZ4A 2F49A 5AR3A 5FEDA 1OBDA 4YHJA 2B4SB 5E92A 5HBEA 3R7VA 3TV6A 4QMMA 4W9XA 5C9CA 3FI4A 3F2AA 4PMTA 3TWJA 2J50A 5HE3A 4QPAA 3RP9A 4FR4A 2QOKA 1WVXA 2YCRA 3PZHA 4OAVB 4YURA 4NTTA 1XHAA 2CGWA 2EB2A 3NCZA 4LOPA 1XH4A 4ZXTA 5LVMA 2H8HA 3BLRA 1E1VA 5CASA 2PSQA 4N70A 3LXLA 3PRIA 2QU6A 4ANLA 1UNGA 4S33A 4A9SA 5C8NA 1Z5MA 2OW3A 3OEFX 4QYFA 4Z55A 5J7HA 4ANNA 4W9WA 4CKIA 4OTPA 4XBRA 2WELA 4BCOA 4FK6A 4V04A 2RSVA 4YZNA 4RWLA 3UC3A 2JDVA 2XM8A 4CT2A 1PYXA 5IZFA 3MTFA 1B6CB 3PWDA 1FGIA 4NIFA 2ZYBA 1UNLA 3L1SA 4M12A 5LVLA 5HVYA 4J97A 3TZ7A 3N4VA 5KUPA 3OWPA 4UMUA 4ZMFA 2B52A 4FKLA 2AC3A 5CEQA 5CLPA 4I21A 3Q9YA 4G17A 4FEUA 5KMOA 3EMGA 2BDFA 2WQNA 5F9EA 1XH6A 5L6PA 4NKSA 5CT0A 4BDKA 4HJOA 1YI4A 3R01A 4LGHA 3D5UA 4V01A 4CFUA 2FGIA 3AGMA 4H1JA 3TI1A 4BTMA 4DE4A 3BX5A 1YQJA 4U80A 4ZY6A 1P4FA 3IW7A 3VHEA 3VUKA 4NYEA 5DA3A 4UWBA 3PA4A 4LGGA 4MWIA 1K9AA 4YSMA 3R7UA 3ZC6A 4UX9A 3OCGA 5B0XA 4ZP5A 4WNPA 3AGLA 3EH9A 4NCTC 4NK9A 3HGKA 4QMSA 4UWYA 4ZSAA 5IH5A 4EOQA 4F64A 3JY0A 4Y5QA 5HZNA 3OUKA 4NM0A 4FKQA 2EWAA 4RZWA 3UNZA 4NW6A 1ZLTA 1ZRZA 2W1CA 4MF1A 3R7OA 4LOOA 4AOJA 4C62A 5M4UA 3CXWA 4DN5A 4TT7A 1PXIA 5IA4A 1FMKA 5ANIA 3ZONA 3PJ2A 4F1TA 4RVMA 3LE6A 3WF5A 2ITWA 3P0MA 3PWYA 4MBJA 4RBLA 2ITTA 4MXYA 5EDRA 4MCVA 3VS6A 2HW6A 2YN8A 3RNYA 3EQPA 3PVUA 5EHLA 2QG7A 2XK3A 4XG4A 5C27A 1WCCA 3F2NA 4JDIA 4NEUA 4DITA 5CAVA 3NAYA 4XG3A 5D9HA 3VHKA 1KE8A 2E9PA 3NMUF 3A99A 2ITVA 4EH9A 3AMYA 4NFMA 4KABA 3OC1A 3P78A 5CU4A 3HMPA 2J5FA 4C3PA 1UKHA 3B2WA 3RPYA 1O6LA 5EHOA 3HUCA 4OTGA 2WMSA 1JPAA 1JKLA 3Q04A 2Y9QA 4FTKA 1M2QA 4ZSLA 4IWQA 4ANSA 4BHZA 4EH3A 4IFCA 2VTQA 3UE4A 4Z16A 3S95A 5BNJA 2CDZA 4QP7A 2UZOA 3HRFA 3NAXA 1IA8A 3PFQA 4H3BA 4XRLA 2XRWA 5BVKA 4HVDA 3LFNA 1SVEA 3W16A 4BTJA 4RVLA 3L8VA 3MSSA 4UEUA 2WU6A 3BKBA 3WF7A 4J96A 5IA1A 5J9LA 3F82A 2VX3A 3V6SA 1PHKA 4JG6A 3ORZA 4XLVA 2IVSA 1CKIA 3EQGA 3LFSA 2WTCA 4GG5A 3FI2A 4KSPA 4F99A 4AUAA 3QA0A 5CXZA 4A7CA 3HRBA 5AR7A 2YLEA 3DXNA 3OW3A 5HBJA 3SG9A 3FKLA 5FEEA 4AFEA 2BTRA 3D2IA 3ZDUA 4QMYA 2GU8A 2X7FA 3V5WA 5I9VA 5JFSA 1Q62A 2QO2A 1NT2A 1KOAA 4S34A 3BGPA 3C4XA 3SXSA 5F20A 2CKOA 3IGGA 3VJOA 1GIHA 3CSVA 4WRSA 3L8XA 3ZFMA 5H9BA 2VO3A 5CAQA 1FBNA 3KFAA 3QXPA 4TNDA 4NM5A 4FA2A 3OY1A 2AUHA 3F3TA 1DAYA 4QNAA 3UMWA 4EHZA 2BUJA 4HVGA 3CR0A 4Y72A 3DBEA 3V8WA 2A0CX 3F66A 4PX6A 4TYHB 3QKMA 3CTJA 4XV1A 1Q3WA 3D0EA 3T8OA 4F63A 2ESMA 4A9UA 2IVVA 3QWKA 2C68A 3BYMA 2HZ0A 4E7WA 3FL4A 4GUEA 3VRYA 4PDYA 4OGRA 3DB8A 2F7ZE 2B7AA 4Q2AA 4RWKA 4RZVA 3TZ8A 5FTGA 4IM2A 4UYAA 2SRCA 5FQDC 5E8TA 5EKNA 1NY3A 3Q5IA 3MESA 4Y83A 5DBXA 2Z02A 4DCEA 1GAGA 2XP2A 5HO6A 4DEAA 3KGAA 3EFJA 4O0SA 4UXQA 2C6DA 4QPMA 3UIBA 4KD1A 4BBEA 2FB8A 4EOKA 4O91A 1W98A 3AD5A 2XYUA 4BDJA 1Q24A 5IH6A 3UTOA 4MNFA 5CF5A 2GPHA 4DINA 1SNUA 4NL0A 3HV3A 4EH6A 4KKGA 4MNEB 3F7ZA 5H2UA 5HTBA 4LV8A 4XOZA 3O0GA 4C0TA 3Q2JA 4UYNA 4FBXA 5DR6A 2DUVA 2BKZA 3RI1A 4EZ7A 2QLQA 1XH9A 1OPJA 2ZMCA 4QQCA 4RX8A 4GKIA 2C0IA 4EBVA 4QRCA 5BPYA 3C1XA 2V62A 3BIZA 2W4KA 4IVCA 4DGNA 1URCA 3WZKA 3DFCB 2RGPA 2PY3A 3POZA 4BCKA 2XMYA 2WTJA 3TJDA 4ASEA 4D9TA 4L7FA 5M06A 4O96A 3G0FA 3U6JA 4J8NA 4UBAA 1JKKA 3GUBA 3FWQA 4Q5HA 4KINA 1UU8A 1JSTA 4XEYA 3SLSA 4I0RA 5L2IA 1ZOEA 4FYNA 5CQUA 4IBMA 3DBQA 3OXIA 4M67A 2HENA 1Q8YA 4PTEA 2WMWA 3IONA 4QO9A 3U9CA 4FGRA 1WBPA 2BIYA 4MQ2A 4PNIA 3RAWA 3JVSA 4GMYA 3RHKA 4DEBA 5HG8A 4BYIA 4BZDA 4C59A 2JFMA 3FY0A 3PPJA 2VX1A 3ET7A 3OWKA 2WMXA 4W8DA 3ZSIA 3SGCA 1PXLA 2GTMA 1YWVA 4C34A 3COMA 3DZOA 1LEZA 1ZARA 4GKHA 2VTPA 5B2MA 3A7JA 3HX4A 1KUTA 2B9JA 3QTZA 5FEQA 3V51A 3WILA 2R2PA 2WHBA 3LXKA 4ZTSA 4BCJA 5L2TA 2WMRA 3R1QA 3QCYA 1Y8GA 2YDKA 2WTVA 5T6KA 4ZTMA 4CFMA 4L45A 3RPSA 3TV7A 4ZS4A 3S3IA 4FKOA 5CVHA 2YIYA 4LUEA 5KMLA 1DI9A 3PXQA 3IS5A 4FVPA 5EI6A 2OJIA 1YOLA 3QZIA 2GNHA 2WIPA 3DXPA 4C3RA 2BHHA 4B8LA 2WMVA 2GNIA 4ACMA 3LFFA 1FMOE 3NVKI 5IQCA 3UVRA 3QD3A 3TDVA 2YM4A 5JMSA 2WTKC 2WQOA 2CNVA 5F1ZA 2AYPA 2R3NA 4NH1A 4TRLA 2QOHA 4ZJJA 3ATSA 5JQ5A 2GQGA 3MN3A 4U81A 3FLSA 1PXOA 2XIKA 2IW8A 3F88A 5I9ZA 3PLAE 2JDTA 2OSCA 3TM0A 2B0QA 2J0IA 5E8YA 4JDJA 5LCKA 3CIKA 5IG1A 3QHRA 2Y0AA 2NO3A 5M55A 3SV0A 3UYSA 4MK0A 3R21A 4TYHA 4AGDA 2QCSA 3HV7A 4GYIA 5HKMA 4CQGA 3BELA 4AWIA 3VNTA 1I09A 4BCFA 3A4OX 4BDIA 4EKKA 5HCXA 4EOJA 2A27A 5KX8A 3QXOA 4BVUA 4IC7A 3EJ1A 3A60A 4ARKA 4ASXA 3P08A 4IANA 2OICA 4GFGA 3S0OA 3FEGA 2Z7QA 1R78A 4RVTA 5E8VA 1H01A 1BI8A 2BMCA 2UZBA 3BV3A 3IKAA 4IAKA 4RMZA 2XIYA 4O84A 2CHLA 1GY3A 4FZAB 3PDTA 4X7QA 1ZYJA 3TACA 4BWXA 4FKIA 2QI8A 4PPAA 2XNMA 4MNEA 1OIYA 1R0PA 2OI4X 3AC4A 4ALUA 2PVJA 5L6WL 2IG7A 4CZUA 2W5HA 2WAJA 2Y8OA 3VUMA 5FXQA 1OIQA 2PZYA 3V8SA 2PULA 4ZZNA 3D5VA 1YDRE 2R3GA 4LV5A 5GZAA 3LLAA 1BL6A 4APCA 4QMNA 1FVRA 4QMUA 5FLFA 2ITQA 3C51A 4J53A 4YC8A 2WIHA 1OL5A 3FC2A 5CI6A 4E5WA 2X39A 1STCE 1ZXEA 2GS2A 3V5LA 2WEVA 4BIEA 3C7QA 3W32A 3ZO1A 4C37A 3DAJA 4YR8A 4YBKA 3R00A 2Y4IC 3PVBA 4EK5A 4IAZA 4M8TA 2WQMA 2JBPA 5JGAA 3Q3BA 2GSFA 4B9DA 3MH1A 1KE6A 3WF8A 5HX6A 5I5ZA 3UQGA 4YMJA 1WAKA 4M13A 3KXMA 4FV2A 1XBAA 3LM5A 2WMQA 3JXWA 2XNOA 3TIYA 5LARA 3QBNA 5FXSA 4JG8A 4D1ZA 1ZY5A 4IX5A 3BU3A 3OVVA 4YJUA 3H3CA 5J95A 2OXYA 4YTCA 4CLJA 1XBBA 3CGFA 4EZ3A 3HEGA 4HW7A 1SVGA 3C0IA 4WSYA 4C35A 4NWMA 4L44A 3A8WA 4CD0A 3W1FA 2J9MA 4FTNA 4PTCA 2XNBA 4F08A 3EL7A 2BFXA 3PXKA 2PMLX 3NYNA 4O7NA 3NW5A 2JLDA 4O7VA 1DS5A 4E93A 3OW4A 3EQCA 4GRBA 5T3QA 4X3JA 4ALVA 5J8IA 2YIXA 5EI8A 5TE0A 1H1SA 3ZFXA 5EDPA 5CSXA 3QU0A 5C03A 2QOIA 4HYSA 5I4NA 2W1EA 4ZTHA 3FLZA 2JAVA 3BV2A 3FYJX 2OZOA 4ENYA 4L67A 5AAFA 2PUNA 3E92A 3GC0A 4BDEA 5JFVA 4FKVA 4QTEA 4JIAA 4WUAA 1JKSA 5EKOA 1IG1A 4FSRA 3O50A 3R7YA 3OCSA 2FSMX 2UZWE 2B53A 2JITA 1YVJA 2VWZA 2Y7JA 2PVRA 5AP5A 4YZCA 2VWBA 3T3VA 2YIWA 3VS1A 2VTIA 3HZTA 3U55A 3KRWA 4MD9E 2OJFE 2BALA 1OBGA 2YIRA 4YZBA 5HG5A 2HYYA 1DM2A 4JBQA 2GNGA 4FKPA 3E87A 4BICA 4ANBA 3ZDIA 4HVIA 2RFEA 5LWNA 3GQLA 2XJ0A 5E1SA 3R9HA 5HTIA 5J79A 4KBAA 1MP8A 3DQWA 4YJSA 3L9MA 5HG7A 3DKGA 5FM2A 3UPXA 3KK8A 3U4UA 1E1XA 1CDKA 2E9UA 3MDYA 3T9IA 1VR2A 1G8SA 2R4BA 4RWJA 3AMAA 4ZSEA 3GFWA 3V5TA 4KRDA 4WG3A 1Y8YA 2VGOA 4FV6A 4D4SA 3UOKA 2EVAA 3GI3A 3HMMA 3HV4A 3QGYA 4NJ3A 4F4PA 5IMEA 2YCFA 3LOKA 3HAMA 5IQGA 4USFA 1Z57A 4IAFA 4USDA 5HE1A 2ZJWA 3NLBA 3PSDA 4TWCA 5CWZA 3FLNC 1RJBA 2P3GX 3TG1A 2PVHA 4DGLC 3EN4A 4CYJA 1VEBA 3Q9WA 3HDNA 1JNKA 1PKGA 3H9RA 4G31A 4U43A 5KE0A 4LOQA 5I0BA 2OZAB 3QTIA 4XUFA 1HCKA 3MV5A 1W8CA 3FLQA 5IEXA 5FDXA 3CP9A 2I0VA 3FMDA 5IA2A 3NCGA 3ZO2A 3OS3A 3QTXA 1IRKA 1OB3A 3P9JA 3PJ8A 4BDAA 1W82A 3VBVA 1JVPP 4DG2E 3W8LA 2R9SA 3QALE 3R9OA 1H0WA 4OTHA 3WIKA 4AOIA 3BU6A 2HWPA 4E3CA 3ELJA 5C01A 4D4RA 4F7JA 3M2WA 5JH6A 4LRKA 3LHJA 1W0XC 5BUEA 4FTQA 4V05A 3ZYAA 2G01A 4ITHA 4AS0A 2LAVA 4O83A 3A7FA 3L8PA 3IW4A 3ROCA 3F5UA 5B2KA 5BVEA 5LVPA 3VF9A 3QHWA 4D0XA 5J9YA 4FGBA 5JFXA 4L42A 4IZAA 3IW5A 4CNHA 3FAAA 1QMZA 3GCSA 3ROYA 2X9FA 2I6LA 3RAKA 4TY1A 2HXQA 4FEXA 4TXCA 2WTWA 4J7BA 1Y91A 1JLUE 5AUYA 4I4FA 4FSUA 4Z9LA 2HY0A 4PTGA 4HNFA 3ZRKA 2HW7A 2WTDA 4TKSA 3CKXA 3MS9A 2RFDA 5M57A 2OGVA 1U5QA 4P90A 3ZCLA 3JR1A 3OY3A 3EFWA 4EQMA 4U45A 4WNMA 4EZ5A 4NKAA 1JOWB 3CJFA 2X7OA 4KRCA 4G34A 3D9VA 3FMJA 3LZBA 4PP7A 1F5QA 3RZBA 2GDOA 3UMXA 3R83A 3DBDA 3PJ1A 2XIXA 4LL0A 3LFBA 2W1HA 4IXPA 4ERWA 2J0MB 3PVWA 4F9YA 4ONAA 4GIHA 3PPZA 5L8LA 4QP9A 3F5XA 1APME 1XO2B 5AUXA 3THBA 4BI1A 5HX8A 4D1SA 3COHA 3PIYA 3TUBA 5CZIA 3UGCA 2XNEA 3CD3A 4RA5A 4FC0A 4JQ7A 3OZ6A 5JEBA 5EM8A 3I4BA 5KNJA 1FQ1B 5KO1A 3DNEA 3H0YA 5EI2A 2C69A 5LVOA 4X2NA 3MTLA 2EUFB 2G9XA 2YM8A 3AT4A 2DWBA 5DT3A 2XBAA 4P7EA 3MFSA 1RQQA 5C4LA 3MY1A 2QOOA 4O0WA 3PLSA 4MD7E 4E20A 3H9FA 4WG4A 4FT0A 5EQYA 5DVRA 4S32A 4NCTA 4R3PA 4J52A 1OUYA 2A19B 4DBXA 3PPKA 4YLJA 4BB4A 3RM6A 1M2RA 5AUWA 4HGEA 4DEDA 5GINE 3G6GA 3NGAA 1UNHA 1REKA 4PPCA 5ETAA 5I3OA 3UZPA 5CF4A 1PRYA 2I0YA 1PXMA 3VQUA 3DJ6A 2R3PA 3GC8A 1CKJA 4NIFB 4BBFA 4KKEA 4J98A 5GJGA 4G3CA 3ORIA 3FZ1A 2PUPA 4M14A 4NW5A 4O2ZA 3I7CA 4KA3A 1U46A 4PMSA 4ZK5A 2X4FA 4WSQA 4RC2A 4IVAA 3EYGA 1I44A 2YLFA 4MBLA 2ZM1A 4M97A 3IPHA 3MFUA 3DTWA 4HNIA 2BCJA 4EK6A 3F5PA 1VYZA 3QC4A 3ZZEA 2VTNA 1H1RA 3QQUA 3ZHPC 1J7UA 3BYUA 2OZAA 1NVRA 2X8DA 4A4XA 4V0GB 5HTCA 4I92A 2W1FA 2CJMA 4FSWA 4UMQA 4MH7A 3WZUA 3NUYA 2B1PA 3ZZWA 4F9AA 3ZSGA 4Y46A 4JS8A 5T68A 4DLJA 3ZUUA 4HCVA 5DEYA 3DOGA 1CKPA 4EONA 4M0ZA 3SAYA 5TR6A 3D7TB 1YDSE 3PA5A 4UY9A 3E8CA 4KBKA 2ONLC 2G2FA 2C5VA 3MFRA 3I1AA 3FQSA 2VTSA 4I20A 2J0JA 4EH2A 3EYHA 3RAHA 2WU7A 4LFIA 4W8EA 4HZSA 2R3MA 4PPBA 2O63A 2WTKB 4ZAUA 1OUKA 2H6DA 5FTQA 2R0UA 3ZSHA 4FNWA 4OTIA 3KL8A 3CTHA 3ZC5A 2XBJA 4XP3A 3FMLA 2LGCA 2EU9A 2P4IA 2X0GA 3I6UA 4JRVA 4IX3A 3CY3A 1BUHA 3E62A 1BX6A 1ZAOA 1A06A 3Q6WA 1PMNA 3AMBA 4D5KA 2C1AA 3Q53A 5L2QA 4EHGA 3I60A 2GFCA 2PVYA 3QZFA 3BHTA 4JQ8A 4U7ZA 3G15A 1PF8A 2XRUA 1ERKA 3V01A 3RK9A 2YHVA 4G6OA 5A4EA 4TYIA 4MTAA 5CS6A 1QPEA 3EWHA 4L43A 3LKMA 5E4HA 3QRIA 3OWJA 5DR9A 5TF9A 3HECA 2XJ1A 2G1TA 3QQKA 3FHRA 4RX7A 3FXXA 3OG7A 2X81A 3CPBA 2F2UA 4FMQA 3LFEA 4O0XA 4RIWA 4RLKA 3RPVA 4RQVA 4D2WA 2XKDA 3DKOA 2P2HA 4J1RA 5EOLA 4FT3A 3KC3A 4RPVA 5BX0A 2XKEA 2VGPA 4I6HA 3QRKA 4XCUA 2PVFA 5IF1A 4CRSA 4D0WA 3GC7A 4O0VA 2C3KA 1Q5KA 2QOQA 2YA9A 4M7IA 3F7WA 4X2KA 5CSHA 4DEEA 5BVFA 1P14A 3DT1A 4CZYB 4ALWA 3MW1A 3GVUA 3JPVA 4FSNA 4LMUA 5CENA 4OT5A 3TUCA 3FKOA 4FX3A 5HHWA 2PVNA 3C13A 2QKWB 3JY9A 1B39A 3NNWA 2J0KA 4O1OA 4AOTA 4ZY4A 1Q8ZA 3LXNA 4MXOA 1OKWA 5L2WA 3KY2A 4OTDA 3RMFA 1FGKA 2FSTX 5HD4A 2Y4IB 3QQGA 2V55A 3EL8A 3REPA 1M14A 4EH8A 2RF9A 3EQBA 3BPRA 3FBVA 4I6BA 4A4OA 4C4HA 4PP9A 3QTRA 5HG9A 4HVSA 2VX0A 4S30A 5GIOE 5DN3A 4OBOA 4ZZOA 4Z3VA 3QUDA 1O9UA 4J71A 4BKYA 4WUNA 3N51A 4IJPA 2OIDA 2CGXA 3C0GA 3UP2A 4O7ZA 2B9FA 3F6XA 3C4CA 5I3RA 1OECA 3K3IA 4V0GA 3AD4A 1T45A 4PMMA 4U40A 2CLQA 3DBFA 2XCKA 4YJVA 5K5XA 1XBCA 5AUUA 4RSSA 2C6MA 2OJGA 4GG7A 4OTWA 4JAIA 4UZHA 1OZ1A 5FP5A 3UODA 2C5NA 5AP6A 4CSVA 2ERKA 4A07A 4RFMA 4WIHA 2J7TA 4E6CA 3RK7A 2JIVA 5KKRC 3HP2A 4BI0A 5D7VA 3G90X 3N4UA 5LXMA 2XEYA 2BDJA 5E9EA 3R1NA 3UOJA 4ZTLA 3D7TA 2ITXA 4CT1A 4NSTA 1BI7A 3LJ0A 4BDFA 3RPRA 4AACA 1CMKE 1Q97A 4CFWA 3QD0A 3TEIA 5CF8A 4F6SA 4ZTRA 5KMKA 5JRQA 2FYSA 1Q8WA 2WGJA 3PJCA 4QP8A 4G3DA 4FTOA 2Z2WA 3H30A 5FUTA 3KVXA 2W5BA 2X2KA 4YNEA 2CCIA 3R1SA 2Z8CA 2QOLA 4AGWA 4YUQA 1YXXA 4OLIA 4AG8A 4DH5A 3HA8A 2WMBA 3RALA 3O8TA 4F9BA 5G1XA 2G2IA 3SXRA 1RE8A 4Y5HA 3TNWA 3OWLA 5DOSA 3A61A 3SQQA 4BWPA 2QO7A 4C2VA 2R3QA 3D15A 3W2PA 2H34A 2YM5A 1SNXA 4WA9A 3R8PA 4Z7GA 2FH9A 4OTFA 4PQNA 3ALNA 3PA3A 5DNRA 4DH1A 4E5BA 3U54A 3K5VA 4HCUA 1ZMWA 4UN0C 3ANRA 4AP7A 5EG3A 2NNWB 4AN2A 2X1NA 3LXPA 3EQDA 4X3FA 4O82A 3KREA 4XMOA 2CKQA 4I22A 3FY2A 3ORPA 4FVQA 4FTAA 5DPVA 4BI2A 4CXAA 2UW3A 1FINA 2H96A 2UZEA 4R7IA 4A4LA 3FKNA 3FXZA 3VF8A 3R9RA 2XIZA 5DRDA 2XK4A 5CU0A 1Z9XA 5ETIA 3IDPA 4YZMA 3HV5A 3ORNA 4FTIA 4RJ3A 5DHJA 3E3BX 3FZPA 4LRJA 1Q8TA 4XP0A 2OLCA 1ND4A 2ZV7A 5JGBA 4AZEA 3P4KA 3ZLYA 5LJJA 5AR2A 1Y57A 3LAUA 3GB2A 4FNXA 4GT4A 5D12A 5BVWA 4EOLA 4L3PA 4R77A 5FG8A 3BLHA 2UW8A 1H1QA 3RWPA 4FKRA 4TWOA 2XB7A 3H9OA 4Y73A 3IK3A 2PMOX 4ZIMA 4DC2A 1G3NA 5HIEA 3PXZA 3I79A 3LCKA 4I5CA 5CZHA 5CQWA 5EYKA 3W18A 1H00A 4ACDA 3P7BA 4H3QA 3Q4TA 3HRCA 4NU1A 4C8BA 5AV0A 5AV4A 3TNQB 5BYZA 4YU2A 4KUJA 3BBWA 4JBVA 3FLWA 3NNVA 4QQJA 1XR1A 3QLFA 5FP6A 1F3MC 3WE8A 2ITUA 4F0FA 3KXGA 5AMNA 4KS7A 3KCFA 2I7QA 1OIRA 5EOBA 3KVWA 4K6ZA 4JOAA 4EOOA 4IAYA 3MY0A 4CTBA 3HDMA 3QF9A 2VTHA 1P5EA 5HE0A 5B2LA 3DU8A 5EM7A 5HEZA 3BHYA 1H28A 1NA7A 4ZOGA 4IWOA 5TOZA 3RWQA 4QQTA 4A9RA 2C47A 4JRNA 5HNBA 4D2SA 3QLGA 4YC3A 4FVRA 2YM3A 3SG8A 4QMPA 3R73A 4DTBA 4L8MA 3VS7A 5E8SA 4GJ2A 3I5NA 5J87A 5IQEA 4UV0A 3FUPA 3PSBA 4IE9A 1OKZA 1H1WA 4O2PA 4UMPA 2R7IA 3MBLA 3PG3A 5LMAA 4BCHA 2VTTA 3R1YA 5EK7A 5GJFA 4IH8A 2C6TA 4FEVA 4IX6A 3PVGA 4ZTNA 5KBQA 3H4JA 3QFVA 3BGZA 3HKOA 4JDHA 2V7AA 5AR5A 1OL6A 2VUWA 3UQCA 2BPMA 3D83A 4FIEA 3TIZA 3SW7A 5JGDA 4KIPA 3WF9A 3V8TA 5BMMA 3I0QA 3CKWA 3EN7A 3NPCA 3NYVA 4JR3A 4PY1A 3ORTA 3WBLA 5E90A 4BDCA 4BDBA 3CS9A 2BR1A 3R28A 2O0UA 4NM3A 4DF3A 3IO7A 2Z7LA 4O22A 3W2SA 5IUGA 3E7VA 2JKQA 3R22A 5IEVA 2FO0A 3BYSA 3TNPC 4EI4A 1UWHA 2BFYA 2X8EA 4ZSGA 3DGKA 4PDOA 4C33A 3MI9A 3UNJA 5L4QA 2OIQA 3T9TA 3SOCA 5AP7A 4ASZA 4JX3A 4ACCA 5CSWA 5IU2A 5AA8A 4F6WA 5AV1A 2JIIA 4P4CA 4YTHA 2JC6A 2GMXA 1WBVA 4UXLA 4FIGA 4CCUA 1KV2A 3P23A 3QCXA 4XLIA 4EORA 3CGOA 3NUUA 4GK3A 4GS6A 4QYHA 4DG0E 1YWRA 2OBJA 3E8DA 3SX9A 4H36A 1JSUA 2ITNA 4EOPA 2XK8A 3E63A 3QQFA 4EK4A 3HAVA 3F61A 3AXWA 3IOKA 2UW4A 4I3ZA 3BWFA 1QCFA 2WMAA 4BGGA 4E6AA 3LQ8A 4CKJA 4PV0A 4C2WA 4JLCA 3QTWA 4BC6A 2I0HA 4BRXA 5GHVA 4JT3A 2JDOA 2CN5A 2V0DA 3FMMA 5HVJA 5J9ZA 1S9JA 2EXCX 2W4OA 2W1IA 3I0OA 4HYHA 4MXCA 2FVDA 2BRHA 2O8YA 4AW0A 2VTAA 4X3FC 3PJ3A 3R9NA 1GIJA 5CVGA 2JAMA 1WFCA 3U4WA 2PZRA 3F3VA 5EHYA 1FPUA 3R7GA 5AWMA 3OP5A 4CGAA 4YGAA 2XKFA 3PE2A 4I94A 5HU3A 2HZIA 3MY5A 5FDPA 4MBIA 4E1ZA 4RJ6A 3CC6A 5JZJA 2OU7A 4R5YA 4YLLA 3VUHA 3MH2A 3WI6A 2O64A 4FI1A 4EHEA 4R1YA 1J3HA 2ETKA 3VQHA 5C1QB 5HORA 2XYNA 4O7YA 4U42A 1IAJA 3QQLA 1XKKA 5CI7A 2BZIB 4U3ZA 4C4IA 5I9YA 5FTOA 4KIQA 3CE3A 2UW7A 2WNTA 3E3PA 1QL6A 5J7BA 1V0OA 5KZIA 5IUIA 2JIUA 3W2OA 4MVFA 4I41A 2WZJA 4FV9A 4M66A 3W2RA 1YHSA 3QUPA 3DNDA 3FXWA 4K9YA 1DI8A 3UO4A 4AX8A 4GYGA 2F7XE 3Q2MA 2AC5A 2WTIA 4KS8A 5TO8A 3W55A 4PUZA 2IJMA 3SD0A 4U97A 2IN6A 3G9NA 4I4EA 3NDMA 1O6YA 3QCQA 4BCGA 5IUHA 4XV9A 2OH4A 2R3RA 3MIYA 3EFLA 4N4SA 5M56A 3WZEA 1U4DA 3U8WA 4J99A 3F3ZA 5I9WA 5J5TA 3KF4A 4TNBA 3HNGA 3UNKA 4L68A 5KCVA 2J6MA 4HGSA 4GVJA 3MJ1A 2R3LA 4GK4A 1OKVA 2XH5A 3HP5A 3QX4A 4GT5A 4MX9A 5H8BA 4B7TA 5CEPA 5HNIX 5LWMA 5EFQA 2GTNA 4JDKA 4QMTA 4B4LA 3CD8A 3QKKA 1ZMUA 3C50A 3NNUA 3NX8A 1BLXA 3SXFA 4L01A 3NYOA 3FZRA 4TYGA 3BE2A 4BKJA 4B99A 2UVZA 1GJOA 3RBWA 4FV3A 2QU5A 4DTKA 3DY7A 4W4WA 4EHVA 2GHMA 5BYLA 3LMHA 4JVGA 3VUTA 5AP1A 4DH7A 2CLXA 3VIDA 4QMQA 4FT9A 5L8JA 3C5IA 4S2ZA 5AUZA 2PZIA 1GNGA 3LMGA 3F69A 4OUCA 4ZEGA 5A54A 5AM7A 2UVXA 2ZB1A 1PMUA 5HE2A 5HLNA 4I0SA 1FVTA 3ZLSA 1LPUA 3Q32A 4M68A 2BAQA 4QNYA 2PMIA 4IM0A 4QPSA 3VS5A 3ZLXA 3LJ2A 3CJGA 3IG7A 3MPAA 3DXQA 1KE5A 3NW6A 3ZUVA 3C4EA 5IQFA 2BRMA 3PP0A 4ZZMA 4BFMA 2QQ7A 3AD6A 4X2JA 3P79A 1UWJA 4AA0A 3P7CA 3D2KA 3CLYA 5DGZA 5HCYA 5HO8A 4RC4A 3OHTA 4WNKA 1IAHA 4G1WA 4NUSA 2O5KA 3MPMA 2WMTA 4LMNA 3MB7A 4Q5EA 1RW8A 4B6LA 4F65A 2C6EA 2I1MA 5HO7A 1SM2A 3FE3A 3QTSA 2C3JA 3D4QA 4FKJA 4FT7A 5FBOA 5ANGA 4MXZA 5AR4A 4RC3A 5KKRB 3BWJA 4QMWA 4ORKA 5EW9A 4CTCA 4FZ7A 4UZDA 2IZSA 1KE9A 4QTDA 3ENMA 5K0KA 4AZSA 2ITOA 1UU7A 3R6XA 5AUTA 3AC3A 4C3FA 2ONLA 2YCQA 3G51A 1UKIA 4ID7A 4E6QA 5IQAA 5EYDA 4FL3A 2Z60A 4XV2A 5DIAA 3ZRLA 2I0EA 4U0IA 5FD2A 3U87A 4E4XA 2HOGA 2PUIA 1YW2A 4BY9E 3Q9ZA 3LMIA 1R1WA 2Z7RA 1WVYA 2BIKB 2QG5A 4D9UA 2PTKA 4YJQA 2HY81 4L9IA 2C0TA 3ZOSA 4L3JA 2YIQA 2PHKA 2P55A 4JIKA 4PRJA 5AAEA 4BGHA 3W10A 4ITJA 2YACA 4YTIA 4W4XA 3OT3A 3OTVA 5M08A 2RKUA 3MPTA 3AC2A 4D4YA 4EWQA 1QPDA 3DV3A 1ZY4A 3SC1A 5AEPA 4GJ3A 3PE1A 3U6IA 2ZM4A 3GNIB 4I5PA 5HQ0A 3EN9A 5BVOA 3M42A 4FKUA 3LCOA 4AXAA 1S9IA 2G2HA 3LJ1A 4ITIA 1LR4A 3RK5A 5C4KA 5CEKA 2GFSA 2C5OA 3IW6A 3N9XA 2IZRA 3SDJA 4O21A 3VBQA 4HPUE 4G3FA 1GIIA 3DCVA 1Q41A 1OPLA 3I5ZA 5IH4A 1OITA 3BHHA 1PJKA 4J95A 2BZJA 5JRSA 2ZV2A 3FJQE 5AM6A 3PY1A 2E9OA 3QC9A 5E8WA 3OBGA 5ANJA 5A4CA 3BYVA 3WARA 2A1AB 5C8KA 3BEAA 3R2YA 4C57A 4I0TA 5CF6A 3ENHA 4LRMA 4YJRA 2YCSA 4EYMA 4EH7A 4DG3E 1U54B 1VYWA 1PMEA 2BHEA 2V22A 5GJDA 4E5AX 3GT8A 4G16A 2GQSA 5CY3A 3NRMA 2X7GA 3L9PA 4C4EA 2B55A 2R3IA 5DFPA 2E2BA 3PRFA 3FMKA 1OMWA 5DWRA 5E91A 4EWHA 4KSQA 4WRGA 1MRUA 3BI6A 2VO7A 3MH3A 5AV2A 4FE2A 4QTCA 2Q0NA 3L8SA 3JVRA 4U79A 4F1OA 3B8RA 5J1VA 4MXXA 1Y6BA 3O2MA 3F5GA 2R5TA 4X2GA 1M17A 1YXUA 3DFAA 3HV6A 4QMLA 5CNNA 3UO6A 2OG8A 3KRRA 4RGJA 4IMYA 4D28A 4IZYA 3QUEA 2YERA 4M3QA 1OKYA 3W8QA 3TDWA 4KWPA 4RIWB 4CV9A 4I6FA 1AD5A 2PE2A 4EQUA 4EQCA 3FDNA 3V5PA 3VAPA 3OEZA 4ZJIA 3OD6X 3R8ZA 5HLWA 3WYYA 2NPQA 3QCSA 5AP4A 4QP2A 4H05A 5JZNA 3MH0A 3ZM9A 4TZRA 1OVEA 4QP3A 4YPDA 3VUDA 4BTFA 3NWWA 3EQIA 4H1MA 4EYJA 4AFJA 2F7EE 4IEBA 4P5QA 1IEPA 2JGZA 2GQRA 1WMKA 1XQZA 3FYKX 5CU3A 4DTAA 2YABA 4O6LA 3BCEA 4LGDA 3G6HA 3NS9A 2ETMA 4BDGA 3IDBA 3KMMA 5A6NA 4HVHA 3B2TA 4R1VA 4DH8A 4JXFA 3DLZA 4IM3A 4RRVA 3ATTA 3HYHA 4YSJA 2X8IA 3DPKA 3ZO3A 2XK6A 2VAGA 4ACGA 4WKQA 3C5UA 3UDBA 2JD5A 2WOTA 4GU9A 4CQEA 3NUAA 5IQDA 4K1BA 5ANKA 1P4OA 4JJRA 5ICPA 2IPXA 3VO3A 3KMUA 4O81A 2EXMA 4F7NA 3C0HA 2YAKA 4G6NA 2J4ZA 2F4JA 4NJDA 1H1PA 1WBTA 1IR3A 4GIIA 3FLYA 4RA4A 4TTHB 4EH4A 3U6HA 4CG9A 3HUBA 1YHWA 3C4FA 3FI3A 1J1BA 3TT0A 3DK6A 5BQ0A 3BU5A 4QMVA 4ANQA 2UZUE 3QRJA 4DYMA 2DQ7X 3GU8A 1BMKA 2YZAA 3A7GA 2HK5A 4PMPA 3MGYA 1K2PA 3SW4A 2PVKA 2VO6A 4EH5A 4L53A 1NVSA 4C4JA 4CKRA 3SVVA 4DLIA 3MVMA 4GEOA 4XG2A 5ANDA 5AIKA 4DFLA 2W5AA 1OI9A 4YBJA 5KZ0A 5K5NA 3GXLA 2NP8A 3UVPA 3A7IA 1YOMA 1GZOA 4PWNA 2I40A 1M2PA 2DS1A 5HBHA 3UG1A 2Y6OA 4TYEA 4EC8A 4H58A 3V04A 4O0TA 3R7EA 4B8MA 4B0GA 3PY3A 4IJ9A 2PZPA 2BRGA 2BAJA 3HMIA 3OUNB 3PP1A 1WBNA 1ZOHA 1YRPA 4L3LA 4HOKA 2R64A 5CX9A 3DA6A 3SOAA 4OW8A 3CPCA 4QMOA 3V5JA 1H26A 3KA0A 4AGUA 4N0SA 5L2SA
chains in the Genus database with same CATH superfamily
4AE9A 3UOHA 1U54A 2BROA 2VWIA 4TWNA 4AW5A 4AZWA 3O5AA 4KB8A 4RJ4A 4QD6A 4RX9A 4TN6A 1WBSA 2XAOA 3ZS5A 1EH4A 2ACXA 3LIJA 3Q4CA 4C02A 4IB3A 4QP6A 2VWVA 3K3JA 5ANEA 4G9RA 5AP2A 5G6VA 2FUMA 2FSLX 3ID6C 1J91A 4FK3A 2RG6A 4IHPA 2CKEA 3NZ0A 4X3FB 3HL7A 2B54A 2W9FB 3DKFA 3T3UA 2WOUA 3VRZA 3C4ZA 4FSZA 4RFZA 2WPAA 3MVLA 4XOYA 1Q61A 2XNPA 3GCPA 1YI6A 3DB6A 2HXLA 2PE0A 5IPJA 1QPCA 5L6OA 1A9UA 3PXYA 2ZB0A 4E8AA 4Z7HA 2PMNX 5IA5A 4FT5A 4RQKA 3ZO4A 1L3RE 2QKRA 3UYTA 1H25A 4U3YA 3MVHA 4ZLYA 4I5HA 4PF4A 3BHUA 4XG7A 4AQKA 3IECA 3POOA 3W0RA 4MWHA 2OKRA 2ZVAA 4CV8A 2QO9A 2DYLA 4IZ7A 3KN6A 2BDWA 2X2MA 4O1PA 4RIOA 5B7VA 5D1JA 3TTIA 3JYAA 4RWIA 3Q60A 5HCZA 1CM8A 3ODYX 3ZU7A 1XH8A 5FXRA 5J1WA 4DDGA 3GU6A 3G5DA 4F9CA 3VBYA 4BHNA 1URWA 1F0QA 3O7LD 3CQWA 2OFVA 3VBWA 3HMNA 4JMQA 3NIEA 5M53A 3ZTXA 5AX9A 5M09A 5LCJA 4FICA 2IEWA 3BGQA 4U8ZA 2C3LA 2RFNA 5AA9A 4XG6A 3D5WA 4FV0A 3A4PA 3DAKA 3W2QA 4N57A 2V5QA 4JX7A 4KKHA 3VS0A 2XA4A 4FG8A 2UV2A 1KV1A 4BYJA 3KMWA 4BZNA 2QOFA 2VTOA 5HIDA 3UG2A 4DFXE 4R78A 2YJRA 2IO6A 5A4TA 3FPQA 2RL5A 5ACKA 4AZFA 4IDVA 4AT4A 4JI9A 2CN8A 4KAOA 5M4CA 3G0EA 5JSMA 5ACBC 4BTKA 4C4GA 3UOLA 3DDPA 4OT6A 4BCPA 4YLKA 2UW6A 4I5MA 4WBBB 2PVLA 2CNQA 3MVJA 2XJ2A 3AC1A 3I81A 1P2AA 3VULA 1W2FA 3F2RA 5K3YA 3WZJA 2OF4A 3ANQA 4HZRA 4TW9A 3ZXZA 1H0VA 5LOHA 4D58A 5CSPA 5AAGA 4XNEA 2EXEA 2O2UA 1IASA 3C9WA 4O0RA 5D7AA 1PXKA 1G8AA 4DHJA 1PW2A 3DTCA 1UU3A 3LFQA 4HYIA 3WE4A 4FF8A 4AT5A 3WOWA 2UZDA 4KIKA 1GZ8A 3FSFA 4YO6A 1NVQA 4CRLA 4ZMEA 3TKUA 4YZ9A 5CEMA 4R7HA 4EEVA 2Q0BA 3RAIA 1L8TA 2ZDTA 1M7NA 4U9AA 1JQHA 4IQ6A 5CU6A 4USEA 2J2IB 4FKWA 4R3RA 3PXFA 3NUXA 3LVPA 4Y85A 4FUYA 4CMUA 2IWIA 1PXPA 3TJCA 4AA4A 4F0IA 2UW0A 4MUQA 3GC9A 3GU7A 4NFNA 4FIFA 4LL5A 3II5A 2QR8A 3EKKA 3EQRA 4XHKB 3H10A 2ZFYA 3GU4A 1T46A 3GBZA 4FTLA 3FC1X 3ZBFA 2W96B 4QP4A 4O38A 5KBRA 5CANA 4G2FA 4K0YA 3NR9A 1GZKA 2WD1A 4RIYB 2QLUA 2PZ5A 3LPBA 3E7OA 3QD4A 4XV3A 2IW9A 5CALA 5I9XA 4GCJA 4I23A 4PDSA 3U9NA 3ODZX 5CU2A 4A9TA 5E8UA 3FMHA 5LMKC 3R30A 3VS2A 3R9DA 1J1CA 3ZFYA 5EH0A 4ASDA 2ZAZA 2HCKA 2BZKB 1E9HA 1W84A 3DZQA 3G9LX 4W4YA 3KN5A 3O23A 3G33A 5DRBA 4X2FA 2YZLA 1SYKA 4K11A 2WKMA 3CTQA 2VTLA 3TN8A 3TUDA 3KKVA 5A4QA 3HLLA 2YDJA 3ACJA 5A9UA 5DYJA 2X6DA 4NTSA 1OL7A 2J51A 2JEDA 2JDRA 3QQHA 2W17A 5FWKK 5KHWA 4EUUA 4BDHA 2ZDUA 3MYGA 3QL8A 3RCDA 1NW1A 4FYOA 4ZJVA 3MB6A 4HCTA 4CG8A 4EK8A 5HVKA 3RM7A 2YISA 4M15A 2XM9A 4RLLA 3Q96A 3W33A 3FMEA 5KMIA 1K3AA 2HELA 5ITAA 3R8VA 4Y8DA 1JKTA 3LCDA 1KE7A 3EFKA 2ZV8A 4M0YA 4OBPA 5M07A 1H24A 4IAIA 5DH3A 3QX2A 4F0GA 3OBJA 3E64A 2OIBA 3OROA 4E4LA 1ST4A 2HIWA 3V5QA 1M7QA 3KIOC 4LYNA 3OOGA 3NIZA 3E5AA 3EOCA 4IVBA 4ZTQA 4BL1A 1YHVA 3KU2A 2XNGA 4EKLA 3NVMB 2OO8X 4FV8A 4U44A 4XH6A 4O0YA 2HWOA 3AQVA 3EKNA 4WD5A 2X2LA 2XIRA 5TT7A 4L46A 3ZXTA 3DJ5A 1IA9A 2R3KA 5CAOA 4IX4A 4NZWB 3KXXA 2R3FA 3COIA 3PIXA 3IW8A 3R04A 4GL9A 3GOPA 4IZ5A 3RINA 3TL8A 1LEWA 2P33A 3S2PA 3TV4A 5K9IA 3MIAA 1Q8UA 3KXZA 3R7IA 4IADA 4ENXA 1XWSA 2H9VA 3MJ2A 4K18A 4DA5A 2VWUA 4X0MA 4I24A 4OAUC 3ULIA 4EOSA 5D41A 2GS7A 4XYFA 1SZMA 5LQFA 5BUIA 5BUJA 2PL0A 3A7HA 3BQRA 3PSCA 4EUTA 3UQFA 5GNKA 3UP7A 1ATPE 1WVWA 4C58A 4GK2A 2RIOA 3O7LB 4TYJA 3TNHA 2YEXA 2QR7A 2UZLA 4K2RA 3TTJA 4MEDA 4X6RA 3OTUA 3NNXA 5HU9A 4D2TA 5AP3A 3FPMA 3Q52A 5CTPA 4AA5A 4JBPA 4ZLZA 3EQHA 4AZVA 4MKCA 3R8LA 2OH0E 5CEIA 3ZBXA 3GCQA 1G5SA 3P5JC 5CT7A 4RVKA 4I6LA 3UPZA 3NSZA 4XG8A 2PUUA 4BIDA 3GEQA 4YJTA 4DBNA 4TPTA 1MUOA 5DI1A 5KMNA 2VRXA 5LMBA 3R8UA 4QYGA 4IACA 4QYYA 4GSBA 2JDSA 2CGUA 4KNBA 3O71A 4MQ1A 4WT6A 2ETRA 5IA0A 1OM1A 4YPSA 2XNNA 4UWCA 4FUXA 4CEGA 5DT4A 3TZ9A 5JKGA 3AOXA 3O96A 4RIYA 4DFYA 2PU8A 2R7BA 1OGUA 2F2CB 4G9CA 3VS4A 1AQ1A 2QNJA 4DEIA 3ORKA 1OL1A 2JKOA 4K77A 3HVCA 4D55A 4DGMA 1KOBA 2UZTA 5HGIA 5E1EA 4YNOA 4EK3A 5ETFA 2UZNA 5KMMA 4QMZA 3FSKA 4DHIB 1TQIA 2YWPA 4FSYA 4TL0A 3WYXA 3R8MA 4II5A 4O86A 3F3WA 3IGOA 4FV1A 4O4FA 3TCPA 3VS3A 2PK9A 2WEIA 4QQ5A 4XS2A 4GV1A 2WMUA 2QHMA 4BCNA 2PE1A 2UUEA 2W05A 4F78A 3GP0A 3PY0A 3FZSA 4C36A 5EYCA 4JBOA 3EIDA 4DFNA 1R0EA 5AADA 2RG5A 2PPQA 2VTJA 3NW7A 4XP2A 3TKIA 4CMOA 4DT8A 4MXAA 3ZMMA 2C5YA 5EYMA 3IOPA 2ITYA 2JFLA 1SMHA 2OK1A 4AW1A 4DCAA 2YITA 4RX5A 2OF2A 4GU6A 4C61A 3VBXA 4AN9A 4CFVA 4HGTA 5CNOA 4D1XA 4FV7A 4APPA 2E9NA 2VWYA 3TYKA 4FZDB 4FEWA 3W2CA 1KWPA 2JKMA 4L52A 4RG0A 3EQFA 3LCTA 4U5JA 2OWBA 4U41A 5BMSA 4HYUA 4NT4A 1UA2A 2W99B 5JFWA 1OPKA 3BZ3A 3MWUA 1NXKA 5FBNC 4M84A 5CEOA 4UMTA 2YM6A 5L3AA 4NM7A 4AXFA 5DMZA 4FTTA 1JSVA 2VU3A 1V1KA 2IW6A 3R2BA 4QTBA 4FL2A 3SKCA 3A2CA 5M4IA 3KF7A 4R7BA 4R6VA 3ZM4A 3BRBA 3QZHA 1GZNA 4FTCA 4WNOA 2VTMA 2O3PA 4DEHA 4I93A 5BYYA 4FG9A 4G3EA 5GIPE 2ZV9A 4PNKA 4G6LA 4E26A 2QURA 1YXVA 1PXNA 4HPTE 4O7WA 5IQBA 4JL9A 4KBCA 3LQ3A 5IQHA 3VN9A 4AAAA 4D5HA 5CYIA 3S1HA 3SHEA 1XH7A 2YDIA 4XG9A 3BE9A 2XEZA 3DKCA 3DQXA 3EN5A 4F1MA 1HCLA 2YAAA 3B8QA 4IFGA 3KXHA 4IDTA 3QD2B 4X21A 3BLQA 4MYGA 2B9HA 1YXSA 4JQEA 1X8BA 4I1ZA 3AT3A 1QPJA 2JBOA 2XCHA 4AQCA 5IDPA 3GENA 2CMWA 2C6LA 1DAWA 3Q5ZA 2QVSE 3S00A 2BZHB 1PKDA 3F3UA 3ZEPA 4AGCA 1ZYSA 4FZFB 5IISA 3PZEA 3KRLA 2CGVA 3GFEA 2UW9A 4PDPA 4XJ0A 3TZMA 1ZMVA 1H08A 3LM0A 2G15A 3LLTA 3R63A 2VNYA 4IC8A 5D10A 5J5SA 2VN9A 4N6ZA 5BVDA 1YXTA 3GCVA 2QONA 3D14A 4YJPA 3UZRA 3LFDA 3QTQA 2IVTA 3BQCA 4FTMA 4P2KA 3AT2A 3UO5A 3QGWA 3VW6A 1U5RA 2WXVA 3LQ5A 2QD9A 3EHAA 4WG5A 3AG9A 4AZTA 2W4JA 3ZLWA 4MF0A 2C5XA 1XH5A 3O8UA 2X4ZA 4L6QA 2PYWA 2FA2A 2QOCA 4GH2A 3ALOA 4YHTA 2GNLA 3JS2A 4BBMA 3EZVA 4IB1A 4BGQA 2W1ZA 3KULB 4XX9A 4QYEA 1Q4LA 3P5KA 1YWNA 3P7AA 3HMOA 3FZOA 2J0LA 2VD5A 3JUHA 1CSNA 3KEXA 5DEWA 1V0BA 2R3OA 1ZZ2A 2ITZA 5AV3A 5E7RA 4FIIA 3RNIA 1ZYLA 4P5ZA 3ERKA 2EB3A 2NRYA 3NYXA 4G5JA 3ULZA 4EBWA 3UIMA 4OBQA 5AP0A 3DS6A 3S4QA 4GFOA 3PXRA 3TNIA 3QZGA 1JWHA 4Y95A 5DE2A 4F9WA 1H4LA 1MRYA 3RTPA 2P0CA 3UZTA 3WZDA 4BWKA 4IB5A 3O8PA 3P1AA 2HZNA 5ANOA 1M52A 5JQ8A 3GQIA 2ZMDA 3H0ZA 4YJOA 3BHVA 5A6OA 2WQEA 4D2RA 2C6IA 2QHNA 3WF6A 2X9EA 4BDDA 3CBLA 2XUUA 3R71A 3ZUTA 4AE6A 4ZY5A 4R8QA 4FNYA 2REIA 3A62A 2C3IB 2C6OA 5DR2A 3O51A 5IMXA 5K0XA 3QRTA 4GT3A 4A9YA 3QQJA 5EDQA 5BVNA 3FQHA 3QA8A 4X6QC 2WB8A 4GFMA 4YZDA 4CLIA 5LVNA 4BZOA 2Q83A 4RFYA 5CVFA 2CSNA 4G3GA 5IDNA 3BYOA 2OJ9A 4LG4A 5GZ9A 3IQ7A 1BL7A 2XZSA 4FL1A 2GCDA 2C0OA 3D5XA 3Q4ZA 4FSTA 4FEQA 4J8MA 1KSWA 4AU8A 2P2IA 3EZRA 3DK3A 3ZRMA 3I6WA 3PTGA 3RVGA 4DHFA 3VW8A 4DT9A 5EM6A 5F4NA 5HICA 5KHXA 4D2VA 4EOIA 3UIXA 1O6KA 4LI5A 4O6EA 1ST0A 4BCQA 1ZWSA 4O7LA 5L8KA 3LFCA 3Q4UA 5AJQA 4EL9A 4DFBA 3TXOA 4BIBA 3LCSA 2YFXA 1U59A 1WBOA 3DDQA 2BILB 3KCKA 4FKTA 4FIHA 4FOBA 1OIUA 4F70A 4Q9ZA 1BKXA 2AEGA 3MA6A 3DJ7A 4L7SA 1TKIA 2YJSA 4CFXA 1ZZLA 4C7TA 3R0TA 4Q9SA 3V3VA 2CKPA 4E4MA 5IA3A 3VC4A 3K54A 3GGFA 2C4GA 3E8NA 3ITZA 4WHZA 4FV4A 5I9UA 4GUBA 1LP4A 1TQMA 2GNJA 3PG1A 3DK7A 3QWJA 3SRVB 2JKKA 4KIOA 2FSOX 3I7BA 2KTYA 4JAJA 4CFFA 3OOMA 3ORMA 4QTAA 4LUDA 1MRVA 1OL2A 3DLSA 2WO6A 2BVAA 2XVDA 4AN3A 4CZTA 4ERKA 5FM3A 1OGYA 5HIBA 5M44A 1W7HA 3ORLA 4UB7A 1J7IA 5AR8A 1Q99A 4ACHA 1HOWA 4F7LA 4IWPA 4QT1A 4E73A 4RIXB 5ETCA 2IVUA 3IDCA 2ERZE 4R3CA 2W0JA 3KRXA 4FZ6A 5HLPA 4F6UA 3RGFA 1CTPE 4YJNA 4S31A 4BKZA 4GW8A 3GOKA 4CYIA 2CPKE 4FG7A 2QOBA 5CSVA 4BF2A 1UVRA 4BCMA 2VWXA 4XBUA 3Q9XA 5DT0A 3FL5A 3LW0A 5IKWA 5EW8A 3HA6A 3CQUA 4YTFA 3EB0A 5E8XA 3QRUA 5HD7A 3PYYA 3OCTA 2O65A 1Q3DA 1FOTA 3E88A 5A14A 1XJDA 2W7XA 3EN6A 4K8AA 5TKDA 3C4WA 3KK9A 4ANOA 3KULA 3PIZA 3UVQA 4OTRA 2BTSA 5AIRA 4AF3A 4ZS0A 3AC5A 4MHAA 3WIGA 2C1BA 4W4VA 5JN2A 2WFYA 4CCBA 5CAPA 5F94A 3NUNA 4DH3A 3KRJA 4QMXA 4WOVA 1UV5A 1SVHA 3OFMA 3VJNA 3RZFA 4FTUA 3E93A 4G5PA 2R3JA 4C38A 4CVAA 5IEYA 5M51A 1FVVA 2GHGA 3FQEA 4FIJA 4YO4A 4O7SA 2OFUA 4IAAA 1B38A 2F57A 1Y6AA 3D94A 3UC4A 4GVAA 1PXJA 3M1SA 4H39A 3DBCA 4BN1A 5K4JA 3CEKA 3PUPA 3ZEWA 4LM5A 2V7OA 4WBOA 2E9VA 3QYWA 1YI3A 3VVHA 1H27A 2X6EA 2XK9A 4FV5A 5KMJA 1ZOGA 2IF8A 3E8EA 4PL3A 2VWWA 2C6KA 3KQ7A 3QAME 4M69B 4YP8A 4DGOA 5AUVA 3OT8A 1PY5A 3P86A 1A48A 4UALA 2W1DA 5DG5A 2KULA 2XK7A 1JBPE 3RHXA 3COKA 3BEGA 4EC9A 2W9ZB 4A06A 4R5SA 4H3PA 4IB0A 4O7TA 3GCUA 3K2LA 1WZYA 2W06A 4FNZA 4FSMA 3FZTA 3CCNA 4JNWA 4ZSJA 4EJNA 5A4LA 2ITPA 3UJGA 2RFSA 3LFAA 2XKCA 3NEWA 5EW3A 3A8XA 4E4NA 2VZ6A 2PWLA 3NUPA 3ORXA 4FTRA 2BAKA 2OXXA 2WQBA 5FRIA 4FSQA 5H3QA 4RJ7A 2PVMA 2YWVA 4PL4A 4MD8E 3L9NA 3BBTB 2XF0A 2OJJA 4CFNA 2IZTA 5H8GA 5F95A 3G2FA 3R02A 3RJCA 4AW2A 4BCIA 5CAUA 5K4IA 4AT3A 4ZLOA 3RCJA 2XS0A 5AX3A 3D7ZA 4N6YA 4D2PA 1TVOA 4D4VA 2UZVA 3ACKA 4F7SA 1J7LA 3OCBA 3RKBA 4EOMA 3RPOA 4DFZE 4U6RA 5GZ8A 3CY2A 4RJ8A 1VZOA 2R3HA 3F9NA 5M4FA 2CNUA 3GU5A 2VO0A 5C8MA 3MA3A 3OXZA 5JK3A 2BRNA 2W1GA 3SRVA 4LQMA 1RDQE 4QP1A 5AFVA 3FV8A 3MFTA 4WO5A 2J90A 5A46A 2ZOQA 4FKGA 4DFUA 2QODA 4RT7A 1H07A 4EJ7A 4I6QA 3CQEA 4OTQA 5LMKA 4KIKB 2GS6A 4FODA 4PL5A 4C4FA 1ZYCA 4JG7A 4MAOA 5D11A 2IZUA 5E8ZA 2Y6MA 4RIXA 4DEGA 5A3XA 1MQ4A 1YKRA 1W83A 1UU9A 3U51A 3OF0A 5JT2A 3FMNA 4ANMA 2BRBA 2F9GA 3FI8A 2ZM3A 4LDTA 2A4LA 2QC6A 3AC8A 5HNGA 2B9IA 3QTUA 4TWPA 2Z7SA 4IW0A 4OR5A 4FTJA 4IVDA 4BR3A 3DAEA 4F09A 1BYGA 1ZYDA 5EQEA 1MQBA 4O7RA 1LUFA 2YM7A 1GOLA 1TQPA 3KB7A 3KXNA 2C30A 3UIUA 3VUGA 2VNWA 4FOCA 1R3CA 4QOXA 3O17A 3L9LA 4E6DA 3K5UA 1VJYA 4DGGA 3VUIA 2A2AA 2GHLA 4YC6A 3VBTA 1V0PA 5EQPA 1VLRA 5DLSA 4HGLA 3FHIA 4O27B 5EM5A 4K33A 4CMTA 2J5EA 3QYZA 5H8EA 3VWAA 5FGKA 3UBDA 2GNFA 2BKKA 4L00A 4RJ5A 5HOAA 2R0IA 1H8FA 3TKHA 3Q6UA 2Y4PA 5C26A 5HI2A 1AGWA 3N4TA 2NRUA 1PYEA 1JAMA 1W2DA 2HAKA 2UW5A 4FKSA 3M11A 4IIRA 4IWDA 4XRJA 4JR7A 1YOJA 3QKLA 4YHFA 5HESA 3OXTA 4UMRA 2OXDA 2VV9A 3V6RA 1REJA 2X0PA 3ZH8A 4DAWA 5IQIA 3SA0A 1R39A 2VTRA 3ETAA 1YDTE 1PMVA 1WBWA 5CXHA 3NUSA 2UVYA 4QEBA 4O0UA 4M69A 2CCHA 3OMVA 2HZ4A 2A98A 2F49A 5AR3A 5FEDA 1OBDA 4YHJA 2B4SB 5E92A 5HBEA 3R7VA 3TV6A 4QMMA 4W9XA 5C9CA 3FI4A 3F2AA 4PMTA 3TWJA 2J50A 5HE3A 4QPAA 3RP9A 4FR4A 2QOKA 1WVXA 2YCRA 3PZHA 4OAVB 4YURA 4NTTA 1XHAA 2CGWA 2EB2A 3NCZA 4LOPA 1XH4A 4ZXTA 5LVMA 2H8HA 3BLRA 1E1VA 5CASA 2PSQA 4N70A 3LXLA 3PRIA 2QU6A 4ANLA 1UNGA 4S33A 4A9SA 5C8NA 1Z5MA 2OW3A 3OEFX 4QYFA 4Z55A 5J7HA 4ANNA 4W9WA 4CKIA 4OTPA 4XBRA 2WELA 4BCOA 4FK6A 4V04A 2RSVA 4YZNA 4RWLA 3UC3A 2JDVA 2XM8A 4CT2A 1PYXA 5IZFA 3MTFA 1B6CB 3PWDA 1FGIA 4NIFA 2ZYBA 1UNLA 3L1SA 4M12A 5LVLA 5HVYA 4J97A 3TZ7A 3N4VA 5KUPA 3OWPA 4UMUA 4ZMFA 2B52A 4FKLA 2AC3A 5CEQA 5CLPA 4I21A 3W0PA 3Q9YA 4G17A 4FEUA 5KMOA 3EMGA 2BDFA 2WQNA 5F9EA 1XH6A 5L6PA 4NKSA 5CT0A 4BDKA 4HJOA 1YI4A 3R01A 4LGHA 3D5UA 4V01A 4CFUA 2FGIA 3AGMA 4H1JA 3TI1A 4BTMA 4DE4A 3BX5A 1YQJA 4U80A 4ZY6A 1P4FA 3IW7A 3VHEA 3VUKA 4NYEA 5DA3A 4UWBA 3PA4A 4LGGA 4MWIA 1K9AA 4YSMA 3R7UA 3ZC6A 4UX9A 3OCGA 5B0XA 4ZP5A 4WNPA 3AGLA 3EH9A 4NCTC 4NK9A 3HGKA 4QMSA 4UWYA 4ZSAA 5IH5A 3VONA 4EOQA 4F64A 3JY0A 4Y5QA 5HZNA 3OUKA 4NM0A 4FKQA 2EWAA 4RZWA 3UNZA 4NW6A 1ZLTA 1ZRZA 2W1CA 4MF1A 3R7OA 4LOOA 4AOJA 4C62A 5M4UA 3CXWA 4DN5A 4TT7A 1PXIA 5IA4A 1FMKA 5ANIA 3ZONA 3PJ2A 4F1TA 4RVMA 3LE6A 3WF5A 2ITWA 3P0MA 3PWYA 4MBJA 4RBLA 2ITTA 4MXYA 5EDRA 4MCVA 3VS6A 2HW6A 2YN8A 3RNYA 3EQPA 3PVUA 5EHLA 2QG7A 2XK3A 4XG4A 5C27A 1WCCA 3F2NA 4JDIA 4NEUA 4DITA 5CAVA 3NAYA 4XG3A 5D9HA 3VHKA 1KE8A 2E9PA 3NMUF 3A99A 2ITVA 4EH9A 3AMYA 4NFMA 4KABA 3OC1A 3P78A 5CU4A 3HMPA 2J5FA 4C3PA 1UKHA 3B2WA 3RPYA 1O6LA 5EHOA 3HUCA 4OTGA 2WMSA 1JPAA 1JKLA 3Q04A 2Y9QA 4FTKA 1M2QA 4ZSLA 4IWQA 4ANSA 4BHZA 4EH3A 4IFCA 2VTQA 3UE4A 4Z16A 3S95A 4O4CA 5BNJA 2CDZA 4QP7A 2UZOA 3HRFA 3NAXA 1IA8A 3PFQA 4H3BA 4XRLA 2XRWA 5BVKA 4HVDA 3LFNA 1SVEA 3W16A 4BTJA 4RVLA 3L8VA 3MSSA 4UEUA 2WU6A 3BKBA 3WF7A 4J96A 5IA1A 5J9LA 3F82A 2VX3A 3V6SA 1PHKA 4JG6A 3ORZA 4XLVA 2IVSA 1CKIA 3EQGA 3LFSA 2WTCA 4GG5A 3FI2A 4KSPA 4F99A 4AUAA 3QA0A 5CXZA 3AKLA 4A7CA 3HRBA 5AR7A 2YLEA 3DXNA 3OW3A 5HBJA 3SG9A 3FKLA 3NFFB 5FEEA 4AFEA 2BTRA 3D2IA 3ZDUA 4QMYA 2GU8A 2X7FA 3V5WA 5I9VA 5JFSA 1Q62A 2QO2A 1NT2A 1KOAA 4S34A 3BGPA 3C4XA 3SXSA 5F20A 2CKOA 3IGGA 3VJOA 1GIHA 3CSVA 4WRSA 3L8XA 3ZFMA 5H9BA 2VO3A 5CAQA 1FBNA 3KFAA 3QXPA 4TNDA 4NM5A 4FA2A 3OY1A 2AUHA 3F3TA 1DAYA 4QNAA 3UMWA 4EHZA 2BUJA 4HVGA 3CR0A 4Y72A 3DBEA 3V8WA 2A0CX 3F66A 4PX6A 4TYHB 3QKMA 3CTJA 4XV1A 1Q3WA 3D0EA 3T8OA 4F63A 2ESMA 4A9UA 2IVVA 3QWKA 2C68A 3BYMA 2HZ0A 4E7WA 3FL4A 4GUEA 3VRYA 4PDYA 4OGRA 3DB8A 2F7ZE 2B7AA 4Q2AA 4RWKA 4RZVA 3TZ8A 5FTGA 4IM2A 4UYAA 2SRCA 5FQDC 5E8TA 5EKNA 1NY3A 3Q5IA 3MESA 4Y83A 5DBXA 2Z02A 4DCEA 1GAGA 2XP2A 5HO6A 4DEAA 3KGAA 3EFJA 4O0SA 4UXQA 2C6DA 4QPMA 3UIBA 4KD1A 4BBEA 2FB8A 4EOKA 4O91A 1W98A 3AD5A 2XYUA 4BDJA 1Q24A 5IH6A 3UTOA 4MNFA 5CF5A 2GPHA 4DINA 1SNUA 4NL0A 3HV3A 4EH6A 4KKGA 4MNEB 3F7ZA 5H2UA 5HTBA 4LV8A 4XOZA 3O0GA 4C0TA 3Q2JA 4UYNA 4FBXA 5DR6A 2DUVA 2BKZA 3RI1A 4EZ7A 2QLQA 1XH9A 1OPJA 2ZMCA 4QQCA 4RX8A 4GKIA 2C0IA 4EBVA 4QRCA 5BPYA 3C1XA 2V62A 3BIZA 2W4KA 4IVCA 4DGNA 1URCA 3WZKA 3DFCB 2RGPA 2PY3A 3POZA 4BCKA 2XMYA 2WTJA 3TJDA 4ASEA 4D9TA 4L7FA 5M06A 4O96A 3G0FA 3U6JA 4J8NA 4UBAA 1TFFA 1JKKA 3GUBA 3FWQA 4Q5HA 4KINA 1UU8A 1JSTA 4XEYA 3SLSA 4I0RA 5L2IA 1ZOEA 4FYNA 5CQUA 4IBMA 3DBQA 3OXIA 4M67A 2HENA 1Q8YA 4PTEA 2WMWA 3IONA 4QO9A 3U9CA 4FGRA 1WBPA 2BIYA 4MQ2A 4PNIA 3RAWA 3JVSA 4GMYA 3RHKA 4DEBA 5HG8A 4BYIA 4BZDA 4C59A 2JFMA 3FY0A 3PPJA 2VX1A 3ET7A 3OWKA 2WMXA 4W8DA 3ZSIA 3SGCA 3UDZA 1PXLA 2GTMA 1YWVA 4C34A 3COMA 3DZOA 1LEZA 1ZARA 4GKHA 2VTPA 5B2MA 3A7JA 3HX4A 1KUTA 2B9JA 3QTZA 5FEQA 3V51A 3WILA 2R2PA 2WHBA 3LXKA 4ZTSA 4BCJA 5L2TA 2WMRA 3R1QA 3QCYA 1Y8GA 2YDKA 2WTVA 5T6KA 4ZTMA 4CFMA 4L45A 3RPSA 3TV7A 4ZS4A 3S3IA 4FKOA 5CVHA 2YIYA 4LUEA 5KMLA 1DI9A 3PXQA 3IS5A 4FVPA 5EI6A 2OJIA 1YOLA 3QZIA 2GNHA 2WIPA 3DXPA 4C3RA 2BHHA 4B8LA 2WMVA 2GNIA 4ACMA 3LFFA 1FMOE 3NVKI 5IQCA 3UVRA 3QD3A 3TDVA 2YM4A 5JMSA 2WTKC 2WQOA 2CNVA 5F1ZA 2AYPA 2R3NA 4NH1A 4TRLA 2QOHA 4ZJJA 3ATSA 5JQ5A 2GQGA 3MN3A 4U81A 3FLSA 1PXOA 2XIKA 2IW8A 3F88A 5I9ZA 3PLAE 2JDTA 2OSCA 3TM0A 2B0QA 2J0IA 5E8YA 4JDJA 5LCKA 3CIKA 5IG1A 3QHRA