4E2KA

The structure of the s. aureus dnag rna polymerase domain
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
321
structure length
319
Chain Sequence
SNADDLQMIEMHELIQEFYYYALTKTVEGEQALTYLQERGFTDALIKERGIGFAPDSSHFCHDFLQKKGYDIELAYEAGLLSRNEENFSYYDRFRNRIMFPLKNAQGRIVGYSGRTYTGQEPKYLNSPETPIFQKRKLLYNLDKARKSIRKLDEIVLLEGFMDVIKSDTAGLKNVVATMGTQLSDEHITFIRKLTSNITLMFDGDFAGSEATLKTGQHLLQQGLNVFVIQLPMDPDEYIGKYGNDAFTTFVKNDKKSFAHYKVSILKDEIAHNDLSYERYLKELSHDISLMKSSILQQKAINDVAPFFNVSPEQLANEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA primase
publication title Binding Mechanism of Metal-NTP Substrates and Stringent-Response Alarmones to Bacterial DnaG-Type Primases.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 116
structure length 319
sequence length 321
ec nomenclature ec 2.7.7.-:
pdb deposition date 2012-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08275 Toprim_N DNA primase catalytic core, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.20 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 4e2kA03
3.40.1360.10 Alpha Beta 3-Layer(aba) Sandwich Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 Dna Topoisomerase Vi A Subunit; Chain: A, domain 2 4e2kA02
3.90.980.10 Alpha Beta Alpha-Beta Complex DNA primase DNAg catalytic core, N-terminal domain DNA primase, catalytic core, N-terminal domain 4e2kA01
1DD9A 2ZBKA 1VDDA 3VDPA 4EDVA 5GUJA 3VDUA 1D3YA 4EE1A 1T6T1 4O6PB 4EDKA 4EDGA 4JCVA 1DDEA 4O6OA 4E2KA 4EDTA 1EQNA 2V1CA 3B39A 3VE5A 2AU3A 4EDRA 2Q2EA
chains in the Genus database with same CATH superfamily
1DD9A 2ZBKA 2FCJA 1VDDA 3VDPA 4EDVA 3CU7A 5GUJA 3VDUA 2KK2A 1D3YA 4EE1A 2KC6A 2NSWA 1T6T1 4O6PB 4EDKA 4EDGA 4JCVA 2Q2EA 3KXRA 1DDEA 3KLSA 4O6OA 2I5RA 4E2KA 4EDTA 2JMSA 1EQNA 2NSVA 2LMKA 2V1CA 3B39A 2ERLA 2B39A 3VE5A 2AU3A 4EDRA 1ERCA
chains in the Genus database with same CATH topology
1DD9A 2ZBKA 1VDDA 3VDPA 4EDVA 3CU7A 5GUJA 3VDUA 2KK2A 1D3YA 4EE1A 2KC6A 2NSWA 1T6T1 4O6PB 4EDKA 4EDGA 4JCVA 2Q2EA 3KXRA 1DDEA 3KLSA 4O6OA 4E2KA 4EDTA 2JMSA 1EQNA 2NSVA 2LMKA 2V1CA 3B39A 2ERLA 2B39A 3VE5A 2AU3A 4EDRA 1ERCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DD9 A;  2ZBK A;  1VDD A;  3VDP A;  4EDV A;  5GUJ A;  3VDU A;  1D3Y A;  4EE1 A;  1T6T 1;  4O6P B;  4EDK A;  4EDG A;  4JCV A;  1DDE A;  4O6O A;  4E2K A;  4EDT A;  1EQN A;  2V1C A;  3B39 A;  3VE5 A;  2AU3 A;  4EDR A;  2Q2E A; 
#chains in the Genus database with same CATH topology
 1DD9 A;  2ZBK A;  2FCJ A;  1VDD A;  3VDP A;  4EDV A;  3CU7 A;  5GUJ A;  3VDU A;  2KK2 A;  1D3Y A;  4EE1 A;  2KC6 A;  2NSW A;  1T6T 1;  4O6P B;  4EDK A;  4EDG A;  4JCV A;  2Q2E A;  3KXR A;  1DDE A;  3KLS A;  4O6O A;  2I5R A;  4E2K A;  4EDT A;  2JMS A;  1EQN A;  2NSV A;  2LMK A;  2V1C A;  3B39 A;  2ERL A;  2B39 A;  3VE5 A;  2AU3 A;  4EDR A;  1ERC A; 
#chains in the Genus database with same CATH homology
 1DD9 A;  2ZBK A;  1VDD A;  3VDP A;  4EDV A;  3CU7 A;  5GUJ A;  3VDU A;  2KK2 A;  1D3Y A;  4EE1 A;  2KC6 A;  2NSW A;  1T6T 1;  4O6P B;  4EDK A;  4EDG A;  4JCV A;  2Q2E A;  3KXR A;  1DDE A;  3KLS A;  4O6O A;  4E2K A;  4EDT A;  2JMS A;  1EQN A;  2NSV A;  2LMK A;  2V1C A;  3B39 A;  2ERL A;  2B39 A;  3VE5 A;  2AU3 A;  4EDR A;  1ERC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...