4E2LA

Crystal structure of the periplasmic domain of mutant fepe lps o-antigen chain length regulator protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
262
structure length
240
Chain Sequence
WTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLDLHRAIVALSEKMKAVDDSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Closely Related O-antigen Lipopolysaccharide (LPS) Chain Length Regulators.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Ferric enterobactin (Enterochelin) transport
total genus 73
structure length 240
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4e2lA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 4e2lA01
3B8MA 3CP1A 1DLBA 1DF5A 5HFLA 5CMUA 3MHSC 4E2LA 4E2HA 1QBZA 2LP7A 2EZOA 1EBOA 4FIPC 4JPRA 2X7RB 4N21A 5KA5A 3B8NA 1I5XA 3WFVA 3B8OA 4E29A 2MK3A 1QCEA 3K9AA 1JPXA 1SZTA 2OT5A 1I5YA 4FJCC 3CYOA 1MOFA 1F23A 1JQ0A 4JGSA 2EBOA 3M99B 3B8PA 3H01A 1Y4MA 3GWOA 4ZM5A 1QR9A 3B77A 4FK5C 4JF3A 5HFMA 2P6JA 4N23A 1MG1A 3MHHC 1QR8A 4ZM1A 4G2KA 1K34A 3P30A 1Y66A 4E2CA 2EZPA 1ENVA 1DF4A 5CN0A 1K33A 2M7WA 5H9CA 5KA6A
chains in the Genus database with same CATH superfamily
1KP3A 5LGTA 5KMGB 4X1KB 3JD0A 1VQ9V 4LC1A 3IGAC 1FD9A 4PA3A 4AI8A 4X66B 3CS5A 2AZ2A 2JRIA 2R9IA 2VWKA 1QR9A 3E8FA 1MNGA 3AG1C 1SS3A 4X64B 3CCVV 1EZVH 4TWKA 2XOKG 1DF4A 1IBMB 2YIDA 1D5AA 1PL4A 1G4YB 1SQVH 1I94B 4BIZA 2IW5A 4LF4B 4JI4B 3CJHA 1S77D 4G27B 4E29A 4I0XB 4FLUA 3OAAG 2UUCO 1KKDA 1ZWIC 2GBOA 4FLTA 4NTXA 2Q4PA 1HR0O 1VIBA 1TUBB 2GUZA 3A0RA 2G38A 3A0BZ 4DV6B 4E2CA 4P30A 4DUZB 4WFEA 3EVKA 4H33A 1GN2A 3OUSA 4GYCB 1Q6UA 1KU9A 2Q69A 4MVRA 3RYIA 2L35A 5CBFA 3AG3B 3JYCA 1QQCA 1R3IC 4RQEA 1H2SB 2ZXWC 3K3WA 4YY3B 3ZN1A 3ZRVA 4LH6A 3N2KA 3QNEA 5GONA 2HHHO 4F6EA 2YXHA 4FZ0A 2K1EA 3QO7A 1SQXH 5JVDB 1NT2B 2JDIG 2FTKA 4ABMA 3FYEB 1E1QG 1VQ7V 2VQEO 1F4MA 1I08A 2YIAA 3UM7A 1AROP 3VQWA 2HFEC 1V55C 1AR4A 1VQLV 3J80N 4QPKA 1W2BU 4MVQA 2D2CB 4OX9O 1DTOA 1DGSA 1QLEB 4DW0A 1JOYA 2ITDC 4UVBA 2B1IA 3L9DA 4D7SA 1QLNA 1ZUQA 1WB7A 5J2TA 4FLVA 3RYIB 3THOA 4PHZA 2BOCC 4JASA 5FLXN 4NXNO 1NTZH 3O65A 2LJ2A 3LNNA 4BAYA 5CA0A 1M56C 4XDKA 1HNXB 1BL8A 2IBZH 3W7TA 1YSCA 2B5UA 5KAIZ 1IURA 3WU2Z 1YZBA 2GUZB 3OMNB 2ZE8A 2EBOA 1Q6IA 2WPDG 3CB2A 4MTFA 1YITV 4FM0A 4JI7B 1K34A 4R50A 4X88A 4H13B 3W7WA 2QTOA 2MW2B 2E5LO 3AG2C 1XEQA 5LHHA 2UU9B 2ETNA 4KHPB 4EEQA 3IAYA 4MSWC 3L71H 3AK1A 3AG1B 5LA6A 1OCCB 2DWEC 3X2QC 3UKMA 2YDEA 1S76D 3TETA 3KZIZ 3W7XA 4BWAA 2IH1C 3OTFA 4UCTA 3CCQV 5H9CA 1NQTA 1AP6A 4MTGA 4YHHB 2PTMA 4UVCA 4XDJA 4DR1B 4X20B 2JK5C 4FMTA 1SRYA 4MTXA 1Z5VA 2EIKB 4ZI7B 2IM9A 4RUFA 1I0HA 1V54B 1XQ8A 1WP7A 2RCVA 3GVMA 5JCOC 3JSLA 4DR5B 4HYOA 2EINC 2ATKC 3F7VC 3G67A 3ABUA 4DXWA 4GLXA 1WPBA 4ICGA 1L0LH 3BFRA 2Q9LA 4JYCA 1GM7A 2YSUB 2Y69C 4O4JB 3FAVB 3CCJV 2HVKC 2EX3A 3H9VA 1XMOB 1NI8A 2JEUA 4NTWA 4YJ3B 1N36B 5AG2A 2EIKC 2UXDO 5EC1C 1NH2D 1Q8IA 5CMUA 4DRXB 3BPZA 2AW9A 3F7YC 3RVYA 4X65B 1MSWD 1XHZA 2ODMA 3OW2U 3OM3B 5KX5A 3L73H 3JAKB 3ZX6A 4LWSB 3JARA 2F95B 2DE0X 1MA1A 4MVOA 1SQFA 4L87A 4XBFA 2KSDA 2YUAA 1EBOA 4JI5O 3M7MX 3ZMTA 1LUVA 5IJ9B 4JI2O 4WFBV 2OWOA 3ABLC 1N34B 3SPCA 4IIJA 2HR3A 3HR0A 5C8YB 5L3GA 1MZEA 3DC6A 4WBNA 4IYHA 4GKKB 3JALB 2HEPA 3N2GB 4O4LB 5IY5B 4LFAB 3HKBA 2PYJA 2HHHB 3F5WC 1DK1A 4I4TA 5FPRA 2UUBB 4B3MB 2WWWA 3T1YO 1YVWA 1SQQH 4PDVA 2EIMB 2YEVA 4UFZA 4QE9A 2M6YA 3I56V 1BHAA 3Q4HB 1EN5A 2P5OA 4O2AA 5LXTB 2EJ7A 2PUSA 3ETGA 2X6CA 4R6ZA 5LHGA 1AILA 4N21A 1FFXB 3ASOC 2WA3A 4TQDA 2PI4A 2V7QG 5B3SC 3BY6A 4H44B 4FK5C 4DUZO 1B04A 1SQPH 2A9HA 3BEHA 4NR1A 2UUAB 3KG2A 3FD9A 3CRRA 3JD1A 3A0HZ 3EFFK 2F23A 4X64O 5KUMA 3JARB 4LFBO 1OHHG 2JGUA 2NNUA 5EZYA 2F66C 2CH7A 4UCVA 2LGQA 3JASB 3LUTB 3K0GA 1L0NH 3OMAB 1GM8A 4JYBA 4L8JA 3ETEA 4A5UB 4PD4F 4FPPA 1RSOB 1IBLB 4K0KO 4LF5O 1FAFA 3D3QA 1N0NA 1AI4A 2HKOA 2OCHA 1HNWO 4JI1O 4JTDB 2Y48A 1I5YA 4DUYB 3UCSC 3MHHC 3RYFB 1HNZO 4DR4B 3SJQC 4IT5A 3CCEV 3UT5A 4J7KA 4I4TB 3CSXA 1M57B 3GWKC 1Q43A 3APQA 4GX0A 4PA7A 2DQ0A 5IYZB 4JAAA 3KCXA 1MOFA 3C90A 3CWBH 4IGGA 1FFTB 4DV7O 4MW8A 1PNMA 3L72H 3J7AU 1SF9A 2Q0OC 1QVFU 4B3SB 3WFVA 3BAAA 4OPHA 1MSDA 3DXRB 1YEWA 1AI5A 3KKYA 5H6QA 4W4LA 2FKXA 3M99B 3GB7C 4TV9B 2IH3C 3RBZA 4D7TA 3ZMZA 3JCZA 4LF7B 2LFSA 3AG4C 3VBBA 1H38A 4LFCB 3TCUA 1K33A 2W0FC 4NKGB 5ITZB 4BW5A 1N32O 1UJWB 5L3BA 1VEWA 4JI3O 5B1BB 3ABTA 3JASA 1AR5A 4O4IB 1PL0A 4ZM5A 3GWOA 5JJNB 4MVZA 4X62O 4N23A 1N8RW 4WCEV 1ENVA 3H1JH 3SYAA 3SDLA 4RO2A 1TGOA 2UXDB 1GN3A 4EKWA 5GW7A 3LSUA 4I55B 4KFMA 4YY3O 1EN4A 3FFQA 2AHZA 5GTHZ 4JI6B 1KD1W 2JJ2G 1Q3EA 2PF4E 3CCSV 3JAWA 1JX9A 2ZR2A 3SGIA 1K5QA 1WA8A 1JR9A 1XILA 4B3MO 3H1HH 3K0DA 3SYOA 2ZE7A 1PPJH 1P7BA 4LCUC 3OFNG 1Y76B 3K9AA 4J9ZB 5LXTA 4J9YB 4X1YB 1ZL8A 1BMFG 5EBMC 1K8AW 4FM1A 5IWAB 4LF9B 2XAJA 1SZXA 3APOA 4YIOA 4HBNA 2P90A 4JPRA 3CRAA 4LF5B 1QCEA 3JAWB 1MMMA 4RWUA 3J81N 1SETA 2CTQA 3VOUA 2XUMA 4GKKO 4DR5O 1R6NA 3ABLB 4UV8A 3RYCB 2LQTA 3BA9A 1RFYA 4E4EA 4MT8A 3MD0A 2P67A 4UCRA 4MS2A 4QPJA 3W7UA 4JI5B 2NR5A 2IJIA 2QKAA 2QWRB 3BCCH 1WPXA 3ASNC 3B8NA 4DR7B 2JIZG 3RYHA 1QVGU 3ZHTA 4UV9A 4XDLA 4OPAA 5CB4A 2VQFB 1PP9H 1U96A 3CC2V 2WLLA 1IBKO 2CTRA 3N27A 3E89A 1GKFA 4RQFA 1E79G 4U3FH 1W59A 1AJPA 3K5LA 2ZD9A 3OD4A 1WB8A 5LOVB 2HP8A 4NXMO 2HJDA 3ZMVA 2WLJA 4IL6Z 4J80A 3ASOB 5DM6V 1H2LA 2E75B 1RP3B 4DK0A 3CMAV 1HP8A 2BOBC 1S5JA 1KKCA 3WB0A 1AI6A 2JGDA 3K04A 3K5OA 3JD4A 2E76B 2LP7A 4K0KB 5IYBO 2D3OW 1BT8A 4K8XA 1JMKC 3QF7A 3STLC 4EB6A 1KQSU 4U3JA 5IYCO 4J7JA 3HKCA 2JJ1G 1L8DA 4OX9B 2YC0A 3BHPA 4LF6B 5L3CA 4YJ2A 1Q5OA 3CC7V 1Y74B 2BSKA 2Q7EA 2BTOA 2LFRA 4X8AA 1KBHA 1F4NA 4QJFB 4B3SO 4DV0O 2V4DA 1MZFA 4TQFA 4G28B 5LP6B 1HR0B 3QTCA 4OXSA 4Q20A 2QGNA 4UVAA 1FXVA 1TVKB 3RGBA 4JTAB 2W6IG 3P32A 4TOIA 3FAVA 1EM1A 1J95A 3RFRA 4DV5O 4GT1A 2VS0A 1EN6A 2WLKA 1HNXO 3SJCC 2X6BA 1NH2B 1XNRO 4BR6A 1BE3H 4QNHB 1YXBA 3ABMC 2YXYA 4BW9A 2ZINA 4P9OA 1AP5A 1HNZB 4CS4A 2A7WA 3LDDA 4LWSA 2OCCB 5KHKA 1S5HC 4ZOLB 1N33B 5A9GA 2ADPA 4ASUG 1JA8A 3AK2A 3H1LH 4I5SA 2QEXV 3LSQA 5EC2C 1R73A 2LO1A 4JI3B 4TV8B 3DC5A 4WFHA 1YTFD 2EILC 3E8HA 1WAZA 4YIPA 4NTYA 2GHYA 4JF3A 1A32A 3MAQA 3RVZA 5B5EZ 1CXZB 4YJ3A 2QSAA 3RWRD 2RMKB 3N2KB 4JI1B 3E8GA 4DW1A 4CH4A 4I9QA 3K08A 2LGWA 4JGSA 5D5PA 4PDMA 3ZCCA 1T5EA 2XTAA 1VP7A 3B77A 3ZIAG 4ZI7A 4AILC 4LP8A 1S3JA 5LMNO 4GZRB 2JS5A 3CC4V 1VMGA 3ZHRA 3CCMV 1FJGO 3SPIA 4QGPA 2CTWA 2CDYA 4LNUA 1EZJA 3TXQA 4F6RA 3HKDB 1SA0A 4DR6B 4TUYA 3HPLC 5LP6C 4CH3A 4JI7O 2YIBA 1KC8W 5LA6B 1PKXA 2DOSA 4DV7B 2Q73A 4DV2B 4LR3A 2YXLA 2GSMB 4FLYA 3H1KH 4J41A 1RM1C 1I5XA 3ZHQA 4KP4A 3QG5A 2B1GA 3OT7A 3PN1A 4TSFG 1CP9A 3EHBB 2ZE5A 1TUEB 4U7OA 3WB1A 3OE7G 2ZR3A 3BRCA 3NR7A 4LF7O 5B3SB 2WLHA 3DXRA 4HNAB 3BABA 1VQNV 1Z2GA 1D5NA 1XL4A 3ZMUA 3B8OA 4DR4O 2QM4A 2B9ZA 2Q8VA 4FFKA 1Y67A 1KUQA 2WA4A 3CCUV 2QDOA 2ZDIA 1XNQO 3ZRWA 2N05A 5JVDA 1QR8A 3ZS8C 1KYOF 3ZBHA 1VF6C 1R1BA 1YI2V 1K97A 4EB6B 4U3JB 2DJVA 4JAVA 3CHXA 2QWQB 2DYRB 4GCZA 5J2UA 4MVSA 2OT5A 3CXCU 1ROPA 3B4SA 3E86A 1FS0G 1BCCH 5B1AB 5KAFZ 5IYZA 5C8YA 5GTIZ 1FXKA 3CD6V 3X2QB 3ABKC 1VQ5V 2RJZA 1X59A 3SPHA 3ZHVA 1HW7A 3CPWU 1RSOA 2IU3A 3S3XA 2QWOB 4UB6Z 4PJ0Z 2DQ3A 2XAGA 5KHJA 3HKEB 3SYCA 3K79A 4PA4A 2VRZA 2EZPA 4LFAO 1YCIA 3I5DA 4CS3A 1Q90D 4GUNA 2QTSA 3WG7B 2CUGA 1US6A 3SYPA 5EZYB 1OZ0A 1M4UA 3AG4B 1V9PA 1H8EG 1OCOB 1NR1A 3E8BA 3JAKA 1NR7A 1VARA 4DV3O 5B1AC 1DF5A 4I50B 1R3KC 3L74H 4JYAB 2UXXA 1NJIW 3JSNA 1THZA 1W0KG 1JFFB 4X1IB 5J2TB 1GO3F 4KXRA 5E79Z 4LF6O 2WLMA 4EFBA 4F6RB 3HB3B 3M8AA 2DW4A 5L3DA 4CZZA 5LMUB 5LGUA 4X9QA 4O2BB 1XMOO 4IHJA 3C3SA 1Y6XA 1R6KA 5JQGB 5KLVH 2F4VB 5GONB 1LR1A 2R9RB 3SJAC 1JJOA 1M5IA 4NXMB 3FB8C 3OUFA 1M57C 3T1YB 2LW7A 1XOUA 3L75H 3IC9A 2Q0AA 2GV9A 1SERA 2UXNA 1J5EB 2P4VA 2QWPB 2CH7B 1N0JA 4X1KA 4JI4O 2WLIB 5KMGA 2QM8A 1PNLA 4B3TB 2IJJA 5IY5C 2UU9O 5JH7A 4YJ2B 5H6RA 2N74A 4JI8O 4PI0A 2OIGA 3O9OA 2FB5A 2KG7B 3NXSA 3ZN0A 1XL6A 4DUYO 1VQOV 3JD3A 4X1IA 3VQVA 4DR3O 5H5NA 4J11A 2OYQA 5CA0B 5EK0A 1FFXA 2F4VO 2Q7GA 2AGAA 4DRXA 5LL6Y 3G6EV 4P2ZA 1FXKC 2OCCC 1M1KW 1S0VA 2A79B 1B06A 5KX5B 2UXCB 1Y4MA 5EIBC 1GH6A 2ZNJA 2Y4UA 3T4ZA 2Y0PA 1WN7A 3CJHB 4Z1MG 3JATB 2Q68A 3K9SA 1IBKB 1GK9A 1YHQV 1PNKA 1QBZA 1FPOA 1VF5B 3AG3C 4UCSA 4JI6O 2NN4A 4ZHQB 4WF9V 4O4JA 2P22C 3W7SA 4DK1A 2ZNIA 5KUKA 2JEXA 1N4CA 2RNBA 4GKJB 3JALA 4DR3B 2CGOA 2EINB 5BMVA 2V1DA 4PDRA 2DYSC 2O57A 1YTFB 4J10A 2BCCH 3DTUB 1K5SA 1H2MA 4KL1A 2ADQB 1ORQC 3MHSC 1BZKA 1VQMV 1H8HG 3FKSG 4DR6O 1OV9A 1WNSA 4PA9A 4ZKIA 3F5TA 1PD3A 4ZOLA 1ZAUA 4B3TO 1IDSA 4F4LA 1TUBA 1MG1A 3TXSA 4FFBA 4GX2A 1Y66A 4GX1A 1QLEC 2XNDG 4J42A 4AHCA 4LH7A 4X66O 4HNAA 2ZKOA 2XAFA 4B7EA 1R6TA 2X6AA 3G6BA 3ZRWB 2DYRC 1JQ0A 1P49A 3OTOO 2QJ1A 4ZHQA 1AB3A 1GRJA 5HFMA 5LMUO 1BS3A 2E5LB 1TVKA 1GMGA 1GN4A 5K1PA 4JV5B 2ARHA 4O4HA 2ZIMA 1YF2A 5K1XA 3RYHB 1URFA 5EBLC 5BXZA 1NZ6A 4H0LB 5JJJB 2EZOA 1N32B 3CRCA 4JI2B 5E1AC 3T1HB 4LF8O 3E83A 2QWNB 2ZXWB 2Y0IA 2OTLV 5LYJB 5CB4B 2Q5ZA 4DV1O 1UPGA 3ZHSA 1SQGA 1HWYA 3JAMN 2N04A 3B09A 1Q82W 5B1BC 3T2MA 1B3QA 1IBMO 4JTCB 5EYPB 1XBLA 1NBMG 3BA8A 3U10A 5C93A 2UUCB 1KECA 2DYSB 3D36C 2EULA 1HDJA 4LFCO 2AHYA 4YHHO 2VQFO 2KG7A 1NTKH 4LF9O 5J2UB 2W6JG 4ZBMA 5TISZ 1TAEA 1OJHA 2YI9A 4ZIBA 1SKVA 1G8MA 1IXBA 1AVMA 3L70H 1K4DC 2L6LA 3K5NA 2E74B 2Q67A 2YEVB 2WSSG 5BY1A 2KB1A 4X1YA 4WBNB 3UO3A 4DV5B 5FNVA 5EYPA 1GAXA 2PZSA 4JYAO 3OTOB 5LBQA 3HKBB 2EIMC 4CH6A 4BIOA 3CCLV 4I50A 4JZ2A 5LMNB 5IT9N 4JV5O 3WB2A 3LDCA 1IXMA 2PYLA 2HVJC 3KCYA 3H01A 4UUJC 1H2NA 3G71V 1YJ9V 1K4CC 5IJ9A 4O4IA 1FYJA 4NVPA 3CX5F 4LFBB 2C2AA 1AJNA 1G1XB 1BSMA 4GX5A 3G4SV 1E1RG 1ZSPA 5LHIA 5ITZA 1CEZA 2A3QA 1N33O 1Q81W 1ZTEA 4DR2B 3Q4HA 1H2GA 4ZM1A 5BZBA 3OR7C 4QIWF 2P4KA 5JH7B 1JJ2U 2IJKA 3R65A 1NVPB 4NXNB 2WLIA 2KQXA 2Q6AA 2WLNA 2Z0AA 1K92A 3A2FA 1NU1H 1VQ4V 3K59A 1J5EO 5B66Z 1X4TA 3ICXA 4JYYA 2P6JA 3FB7C 1OCRC 1ZLZA 1S5LZ 1SA0B 2Z5UA 5L3FA 5JWPA 2ZCEA 4R8CA 4UCUA 4P9PA 4B7KA 1AJQA 1R3LC 1O9HA 5HFLA 4B3RO 3DSQA 4E2LA 4NB5A 3FYIB 1P84F 1XREA 3AG2B 1SZTA 5IJ0A 3AK3A 4X65O 2YI8A 2EIJB 5FL7G 1H2KA 1PV0A 4MW3A 3SPJA 2KKWA 1ZL8B 2GTSA 3B40A 4LNUB 4CH5A 3UQ8A 3CMEV 4GKJO 3K58A 1LUWA 3ZRXA 4QE7A 5KHIA 3D3IA 1JCHA 1FKAO 3T1CA 3K03A 4FLXA 4CBCA 4DV2O 2X0LA 3ZEDA 3IC7A 4JI8B 2R9AA 4O4HB 3CYOA 1KP2A 3ABKB 2H8PC 3E35A 2K9PA 4TV8A 2YIBD 3ZHUA 1QU7A 1RM1B 5CN0A 3I55V 2M7WA 3CP1A 2UXBO 2YICA 2XHBA 1XUQA 2MK3A 4FLZA 2XAHA 3ZRSA 4DV1B 1RPOA 4W4KA 1Z5WA 5H2FZ 5A2QN 2Q7HA 3P3PA 3VQYA 4BIUA 3VQXA 2ZQMA 5LYJA 3S3WA 4TUYB 2GDSA 4IYIA 1GTOA 1DLBA 5FPOA 1XMQO 2ZIOA 1IZ3A 1P4RA 4NYKA 5CBGA 2JGDB 1I7FA 1OCOC 2HLDG 1EFRG 1KB9F 2RQ6A 1S72V 3WG7C 1R3JC 4JZGA 3RYFA 3IJ4A 3HKDA 3K5MA 3CXHF 1F7YA 2BTQB 1YIJV 3EXAA 3CCRV 1NKDA 1XMQB 3E2EA 2XT9A 3D36A 5JQGA 2H94A 2LW1A 4WFAV 2FMLA 4WFFA 4TV9A 5IWAO 2QKCA 1BHBA 1GM9A 3SPGA 4FJCC 4WFGA 2FL4A 1V54C 3OEHG 1D2DA 3P3NA 3FB6C 3B2EE 5KHGA 1LNQA 5DECA 2OIEA 4CS2A 1YDXA 1COWG 5EIBD 1O9GA 1JPXA 1N34O 5KHHA 4H37A 5BMVB 3SYQA 3E22B 1VQPV 1BGYH 3ML0A 1JFFA 3RYCA 5LOVA 2NLJC 2PY5A 1WJZA 2EILB 4E2HA 5BR8B 4MVMA 3U11A 2F1MA 2ILMA 5DN6G 4AQYB 2CGNA 1NS1A 1SC5B 4YXWG 5F2VO 2RN9A 3A8TA 3AEIA 4O2AB 3IFXA 4G2KA 4I0XA 3HKEA 1N36O 2DN9A 2R70A 1K73W 1OCZC 4J7ZA 3ASNB 4HAMA 5IYDO 1L1FA 5LP6A 3OEEG 2P06A 1FJGB 2ZM6B 4OGQB 1UFIA 4EFEA 1XHXA 3H1IH 3ZMSA 3CRMA 1WP8A 4K35A 4DV4B 3E22A 1AI7A 4KHPO 2CK3G 4C7UA 2EIJC 4B08A 3K06A 3R66A 3B8MA 3SR2C 2XAQA 1YJWV 3ETDA 2UXBB 1XI1A 1SQBH 4AQYO 4CC6A 1Q86W 4PI2A 1VF6A 4R7CA 2IU0A 3UT5B 3HKCB 2PGGA 5IJ0B 4DR2O 4PELA 4JI0O 4RUEA 2HG5C 4DV6O 1ZX3A 5BR8O 4FM2A 1XDCA 2ZT9B 1F51A 1K9MW 5FNVB 2DWDC 3JATA 4PA6A 5DEDA 2JS3A 3PJSK 4O4LA 3OMIB 2BE3A 3QVNA 2UXCO 4DV0B 4JI0B 5EBWC 1IVSA 2Z3YA 2ITCC 3DGEA 3JCUZ 1HNWB 2BTQA 2UUAO 5CBHA 3N2GA 1KMIZ 5B1OA 2WLLB 4DV4O 4KUMA 1M90W 4I9WA 3G80A 1FXKB 3LNMB 1TA8A 5J9PC 2AZ0A 5IE9A 2ZE6A 3P30A 1W0JG 1GN6A 4FLWA 3QO8A 4MTOA 3CEIA 4K8ZA 1Q7YW 3TJTA 3LDEA 1IBLO 4FIPC 2QR4A 1NVPD 3T4DA 2QA4V 2RDCA 4LBEC 1VQ6V 1F23A 3AG7A 3SJBC 2QE7G 2FYUH 3RN4A 1IX9A 5L3EA 1OCCC 2PI5A 1Q6HA 2IJHA 4DO2A 2HJFC 3LSSA 4U7NA 2YS8A 4RAIA 2XASA 3RW0A 1BQZA 1V55B 5JJEB 4I7ZB 4O2BA 1JVMA 3OGCC 1OCZB 2EJRA 4TT3G 5CA1B 1Y76A 3D8CA 4X20A 1XNRB 2DMXA 4D6TH 4B3RB 3STZC 4DYLA 4I55A 1G6UA 1M93A 3CRQA 3ZJZA 2AXTZ 2R72A 2Y69B 4X89A 1M56B 4X62B 4DR1O 2F93B 3TK1A 4CC5A 4JAUA 5D5QA 4PV1B 1BQ0A 3OR6C 3JD2A 4K3AA 1WLEA 2CTPA 1U97A 3U0ZA 5JCOA 5KA6A 3ABMB 4FVMA 1VQ8V 4DR7O 5LGNA 1NTMH 3RT3C 3FX7A 3TGUH 1SESA 1VF7A 5CA3A 1OCRB 4Z2WA 3CE2A 1YJNV 4UB8Z 1M9NA 5B1NA 3MDSA 2QKSA 2JVDA 1P7GA 2VQEB 1VQKV 2QM7A 4HZ3A 5IDJA 3QO5A 1XNQB 3FB5C 4Q6GA 2X7RB 5KA5A 4IHJB 2H3OA 1PM9A 2GTAA 3B8PA 1K7DA 2UUBO 2E3CA 4UCOA 2CE4A 3K57A 1MABG 2W0XA 1CPYA 2Y4TA 3ETQA 4UXNA 4IIJB 3C3TA 1AR1B 4Z1VA 2OTJV 2VWJA 2CAZC 4MVUA 1QHTA 1I94O 4FZ1A 4LF4O 1Y74A 2BSKB 2ZDIC 4FFBB 1WA8B 1FXHA 1QNMA 4PDLA 3BVOA 3T1HO 4LF8B 3UO2A 5CA1A 1RPRA 1B6QA 2ZM6O 2A0LA 3OGIB 2A06H 2WAMA 1K3EA 4DV3B 2F43G 2P7TC
chains in the Genus database with same CATH topology
3ZRXA 1KP3A 4QE7A 5LGTA 3D3IA 3SPHA 1JCHA 3T1CA 3K03A 1QVFU 3JD0A 3CPWU 3WFVA 4LC1A 1VQ9V 3IGAC 4CBCA 2X0LA 2IU3A 1AI5A 5H6QA 3IC7A 4PA3A 2DQ3A 3CYOA 2XAGA 3M99B 1KP2A 2R9IA 3ABKB 2H8PC 3E35A 1QR9A 3E8FA 3GB7C 2IH3C 3RBZA 3SYCA 3K79A 3AG1C 4PA4A 3ZMZA 3CCVV 4TWKA 2XOKG 3JCZA 2LFSA 3AG4C 2EZPA 3VBBA 1DF4A 1RM1B 1H38A 5CN0A 3I55V 3TCUA 1K33A 2M7WA 2W0FC 3CP1A 4BW5A 1G4YB 1UJWB 4BIZA 2IW5A 1S77D 5L3BA 4G27B 4E29A 3OAAG 3WG7B 5B1BB 1KKDA 2MK3A 1ZWIC 3SYPA 3ABTA 2XAHA 3ZRSA 1RPOA 1OZ0A 3AG4B 1PL0A 1H8EG 3GWOA 4ZM5A 4MVZA 1OCOB 4BIUA 2ZQMA 4N23A 1NR1A 3A0RA 1N8RW 4WCEV 3E8BA 1NR7A 4E2CA 4P30A 1ENVA 1GTOA 5B1AC 4WFEA 4H33A 1DF5A 1DLBA 3OUSA 3SYAA 1R3KC 2UXXA 4RO2A 4EKWA 1NJIW 5GW7A 1P4RA 1THZA 5CBGA 4KFMA 1W0KG 2Q69A 1OCOC 2HLDG 4MVRA 5CBFA 2AHZA 1GO3F 1KD1W 1EFRG 2JJ2G 1S72V 3AG3B 3JYCA 3WG7C 1R3JC 2WLMA 1R3IC 4RQEA 3CCSV 3HB3B 2ZXWC 3K3WA 2DW4A 1JX9A 2ZR2A 3ZN1A 1K5QA 5L3DA 4CZZA 1YIJV 3ZRVA 5LGUA 3K0DA 3QNEA 3SYOA 1R6KA 3CCRV 1NKDA 3E2EA 1P7BA 4LCUC 3D36A 2R9RB 3OFNG 2H94A 4WFAV 4WFFA 3K9AA 3FB8C 3OUFA 4J9ZB 2K1EA 1M57C 4J9YB 3QO7A 1BHBA 1GM9A 3SPGA 2JDIG 2FTKA 4FJCC 4WFGA 1BMFG 3FYEB 1E1QG 1VQ7V 1V54C 1SERA 2UXNA 1F4MA 3OEHG 3FB6C 5EBMC 3UM7A 1AROP 1K8AW 2HFEC 2WLIB 1V55C 2XAJA 2QM8A 1PNLA 1LNQA 1VQLV 2IJJA 4QPKA 1W2BU 5IY5C 1COWG 2P90A 4MVQA 1DTOA 4JPRA 5H6RA 1QLEB 1JOYA 2ITDC 1QCEA 1JPXA 4UVBA 2B1IA 3NXSA 4H37A 1SETA 3VOUA 3ZN0A 1XL6A 3SYQA 1QLNA 1VQOV 1VQPV 3JD3A 1R6NA 3ABLB 4UV8A 3ML0A 4MT8A 2BOCC 3MD0A 2P67A 4JASA 4MS2A 4QPJA 3W7UA 2NLJC 5EK0A 4BAYA 2EILB 1M56C 4E2HA 4XDKA 4MVMA 2IJIA 1BL8A 3W7TA 1WPXA 3ASNC 1YSCA 2B5UA 3B8NA 2JIZG 5DN6G 3G6EV 4P2ZA 1FXKC 1QVGU 4UV9A 4XDLA 4YXWG 2OCCC 1M1KW 3OMNB 1S0VA 2A79B 2EBOA 2WLLA 3CC2V 3AEIA 1Y4MA 3E89A 2WPDG 1GKFA 3IFXA 4MTFA 1YITV 4RQFA 1E79G 4G2KA 1K34A 4R50A 3T4ZA 4X88A 1K73W 1OCZC 3W7WA 2QTOA 3ASNB 4HAMA 4Z1MG 1AJPA 2Q68A 3AG2C 1GK9A 5IYDO 1YHQV 2ZD9A 1L1FA 5LHHA 1PNKA 3OEEG 1QBZA 3AG3C 3ZMVA 4MSWC 4WF9V 2WLJA 3AG1B 3W7SA 1OCCB 2DWEC 5KUKA 3X2QC 3UKMA 1S76D 3TETA 2JEXA 3ASOB 5DM6V 3W7XA 3ZMSA 3CMAV 2IH1C 1AI7A 2CK3G 2BOBC 3CCQV 2EINB 2V1DA 2EIJC 4PDRA 2DYSC 3K06A 1YTFB 3DTUB 5H9CA 1AI6A 1K5SA 3B8MA 1NQTA 4MTGA 1ORQC 2XAQA 3MHSC 3K04A 1VQMV 1H8HG 1YJWV 3JD4A 2LP7A 4UVCA 5IYBO 2D3OW 3CMEV 3ETDA 3FKSG 4XDJA 3STLC 1KQSU 2JK5C 4FMTA 4PA9A 4ZKIA 1SRYA 5IYCO 1Q86W 4MTXA 4R7CA 2IU0A 1PD3A 2JJ1G 2EIKB 4PELA 4F4LA 1MG1A 4RUFA 4RUEA 2HG5C 4GX2A 1Y66A 5L3CA 4GX1A 3CC7V 1QLEC 2LFRA 1V54B 4X8AA 1F51A 1F4NA 4QJFB 2XNDG 1K9MW 4HYOA 2EINC 2ATKC 2DWDC 4G28B 3F7VC 3ABUA 2XAFA 4PA6A 2X6AA 4DXWA 3PJSK 4OXSA 4Q20A 4UVAA 3ZRWB 2DYRC 4JYCA 1GM7A 1JQ0A 3OMIB 2YSUB 1FXVA 2Y69C 4JTAB 3CCJV 5HFMA 2HVKC 2W6IG 3P32A 1GMGA 1J95A 5EBWC 2JEUA 2Z3YA 4GT1A 2EIKC 2ITCC 3DGEA 2WLKA 5EC1C 1NH2D 5EBLC 5CMUA 2X6BA 2EZOA 3F7YC 3RVYA 5CBHA 1NH2B 1MSWD 4QNHB 3ABMC 5E1AC 3E83A 5B1OA 3OW2U 2ZXWB 2OTLV 2WLLB 3OM3B 4P9OA 4KUMA 1M90W 4I9WA 1FXKB 3LDDA 3LNMB 5J9PC 2OCCB 1S5HC 1HWYA 3P30A 1W0JG 3QO8A 4MTOA 4MVOA 1Q82W 4L87A 5B1BC 4ASUG 4XBFA 1Q7YW 3T2MA 3LDEA 4I5SA 1EBOA 4FIPC 3ZMTA 4JTCB 2QEXV 3LSQA 4WFBV 5EC2C 3ABLC 1NVPD 1R73A 3SPCA 3T4DA 1NBMG 2QA4V 2HR3A 4LBEC 5L3GA 1VQ6V 5C93A 1F23A 1KECA 2QE7G 2DYSB 2AHYA 4WFHA 1YTFD 2EILC 3E8HA 5IY5B 2W6JG 5L3EA 1OCCC 2GHYA 2PI5A 2IJHA 4DO2A 4ZBMA 2HJFC 4JF3A 3F5WC 3LSSA 4U7NA 4RAIA 3RVZA 2XASA 3RW0A 2WWWA 1V55B 1G8MA 3E8GA 1JVMA 4PDVA 1K4DC 2EIMB 2YEVA 3K08A 3OGCC 4JGSA 1OCZB 4PDMA 4QE9A 2EJRA 2Q67A 2YEVB 3ZCCA 3I56V 2WSSG 1BHAA 3B77A 4TT3G 3ZIAG 2KB1A 4LP8A 1S3JA 3CC4V 3CCMV 3STZC 3SPIA 3ETGA 2X6CA 5LBQA 4R6ZA 5LHGA 2EIMC 3CCLV 3ZJZA 4N21A 1EZJA 2Y69B 4X89A 3ASOC 1M56B 3LDCA 2PI4A 2V7QG 1IXMA 3TK1A 3HPLC 2HVJC 5B3SC 3H01A 4UUJC 3BY6A 4JAUA 4FK5C 3G71V 1YJ9V 1K4CC 1KC8W 3OR6C 1PKXA 3JD2A 1WLEA 2A9HA 2C2AA 3BEHA 1AJNA 5KA6A 3KG2A 3ABMB 1VQ8V 3JD1A 2GSMB 5LGNA 4GX5A 3EFFK 3G4SV 1E1RG 1RM1C 1SESA 5LHIA 1I5XA 1CEZA 5CA3A 4KP4A 2B1GA 1Q81W 4TSFG 1CP9A 3EHBB 5KUMA 1OCRB 1TUEB 4U7OA 1OHHG 3OE7G 2NNUA 2ZR3A 1YJNV 3LUTB 3K0GA 1H2GA 4ZM1A 1M9NA 3OMAB 5B1NA 5BZBA 1GM8A 4JYBA 3ETEA 3OR7C 5B3SB 2QKSA 4QIWF 2WLHA 1VQKV 1JJ2U 4FPPA 2QM7A 4HZ3A 2IJKA 3QO5A 5IDJA 3FB5C 1VQNV 3R65A 1AI4A 1NVPB 2HKOA 2WLIA 1XL4A 5KA5A 2X7RB 2Q6AA 2WLNA 3ZMUA 3B8OA 1K92A 4JTDB 2Y48A 1I5YA 1VQ4V 3CCUV 3B8PA 2ZDIA 1K7DA 3ZRWA 2P6JA 3FB7C 1OCRC 1QR8A 3MHHC 3SJQC 1MABG 3CCEV 2Z5UA 5L3FA 1CPYA 4R8CA 1YI2V 4UXNA 1K97A 4P9PA 1AJQA 1AR1B 2OTJV 1R3LC 5HFLA 1M57B 4MVUA 4JAVA 4E2LA 2DYRB 2ZDIC 3FYIB 4GX0A 4PA7A 2DQ0A 1FXHA 4PDLA 4GCZA 3AG2B 4MVSA 1SZTA 2OT5A 3CXCU 1ROPA 3E86A 1FS0G 1MOFA 2EIJB 5FL7G 5B1AB 4MW3A 3SPJA 1RPRA 1B6QA 1FXKA 2A0LA 3CD6V 2WAMA 1FFTB 4MW8A 3X2QB 1K3EA 3ABKC 1VQ5V 2F43G 1PNMA 2P7TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B8M A;  3CP1 A;  1DLB A;  1DF5 A;  5HFL A;  5CMU A;  3MHS C;  4E2L A;  4E2H A;  1QBZ A;  2LP7 A;  2EZO A;  1EBO A;  4FIP C;  4JPR A;  2X7R B;  4N21 A;  5KA5 A;  3B8N A;  1I5X A;  3WFV A;  3B8O A;  4E29 A;  2MK3 A;  1QCE A;  3K9A A;  1JPX A;  1SZT A;  2OT5 A;  1I5Y A;  4FJC C;  3CYO A;  1MOF A;  1F23 A;  1JQ0 A;  4JGS A;  2EBO A;  3M99 B;  3B8P A;  3H01 A;  1Y4M A;  3GWO A;  4ZM5 A;  1QR9 A;  3B77 A;  4FK5 C;  4JF3 A;  5HFM A;  2P6J A;  4N23 A;  1MG1 A;  3MHH C;  1QR8 A;  4ZM1 A;  4G2K A;  1K34 A;  3P30 A;  1Y66 A;  4E2C A;  2EZP A;  1ENV A;  1DF4 A;  5CN0 A;  1K33 A;  2M7W A;  5H9C A;  5KA6 A; 
#chains in the Genus database with same CATH topology
 1KP3 A;  5LGT A;  5KMG B;  4X1K B;  3JD0 A;  1VQ9 V;  4LC1 A;  3IGA C;  1FD9 A;  4PA3 A;  4AI8 A;  4X66 B;  3CS5 A;  2AZ2 A;  2JRI A;  2R9I A;  2VWK A;  1QR9 A;  3E8F A;  1MNG A;  3AG1 C;  1SS3 A;  4X64 B;  3CCV V;  1EZV H;  4TWK A;  2XOK G;  1DF4 A;  1IBM B;  2YID A;  1D5A A;  1PL4 A;  1G4Y B;  1SQV H;  1I94 B;  4BIZ A;  2IW5 A;  4LF4 B;  4JI4 B;  3CJH A;  1S77 D;  4G27 B;  4E29 A;  4I0X B;  4FLU A;  3OAA G;  2UUC O;  1KKD A;  1ZWI C;  2GBO A;  4FLT A;  4NTX A;  2Q4P A;  1HR0 O;  1VIB A;  1TUB B;  2GUZ A;  3A0R A;  2G38 A;  3A0B Z;  4DV6 B;  4E2C A;  4P30 A;  4DUZ B;  4WFE A;  3EVK A;  4H33 A;  1GN2 A;  3OUS A;  4GYC B;  1Q6U A;  1KU9 A;  2Q69 A;  4MVR A;  3RYI A;  2L35 A;  5CBF A;  3AG3 B;  3JYC A;  1QQC A;  1R3I C;  4RQE A;  1H2S B;  2ZXW C;  3K3W A;  4YY3 B;  3ZN1 A;  3ZRV A;  4LH6 A;  3N2K A;  3QNE A;  5GON A;  2HHH O;  4F6E A;  2YXH A;  4FZ0 A;  2K1E A;  3QO7 A;  1SQX H;  5JVD B;  1NT2 B;  2JDI G;  2FTK A;  4ABM A;  3FYE B;  1E1Q G;  1VQ7 V;  2VQE O;  1F4M A;  1I08 A;  2YIA A;  3UM7 A;  1ARO P;  3VQW A;  2HFE C;  1V55 C;  1AR4 A;  1VQL V;  3J80 N;  4QPK A;  1W2B U;  4MVQ A;  2D2C B;  4OX9 O;  1DTO A;  1DGS A;  1QLE B;  4DW0 A;  1JOY A;  2ITD C;  4UVB A;  2B1I A;  3L9D A;  4D7S A;  1QLN A;  1ZUQ A;  1WB7 A;  5J2T A;  4FLV A;  3RYI B;  3THO A;  4PHZ A;  2BOC C;  4JAS A;  5FLX N;  4NXN O;  1NTZ H;  3O65 A;  2LJ2 A;  3LNN A;  4BAY A;  5CA0 A;  1M56 C;  4XDK A;  1HNX B;  1BL8 A;  2IBZ H;  3W7T A;  1YSC A;  2B5U A;  5KAI Z;  1IUR A;  3WU2 Z;  1YZB A;  2GUZ B;  3OMN B;  2ZE8 A;  2EBO A;  1Q6I A;  2WPD G;  3CB2 A;  4MTF A;  1YIT V;  4FM0 A;  4JI7 B;  1K34 A;  4R50 A;  4X88 A;  4H13 B;  3W7W A;  2QTO A;  2MW2 B;  2E5L O;  3AG2 C;  1XEQ A;  5LHH A;  2UU9 B;  2ETN A;  4KHP B;  4EEQ A;  3IAY A;  4MSW C;  3L71 H;  3AK1 A;  3AG1 B;  5LA6 A;  1OCC B;  2DWE C;  3X2Q C;  3UKM A;  2YDE A;  1S76 D;  3TET A;  3KZI Z;  3W7X A;  4BWA A;  2IH1 C;  3OTF A;  4UCT A;  3CCQ V;  5H9C A;  1NQT A;  1AP6 A;  4MTG A;  4YHH B;  2PTM A;  4UVC A;  4XDJ A;  4DR1 B;  4X20 B;  2JK5 C;  4FMT A;  1SRY A;  4MTX A;  1Z5V A;  2EIK B;  4ZI7 B;  2IM9 A;  4RUF A;  1I0H A;  1V54 B;  1XQ8 A;  1WP7 A;  2RCV A;  3GVM A;  5JCO C;  3JSL A;  4DR5 B;  4HYO A;  2EIN C;  2ATK C;  3F7V C;  3G67 A;  3ABU A;  4DXW A;  4GLX A;  1WPB A;  4ICG A;  1L0L H;  3BFR A;  2Q9L A;  4JYC A;  1GM7 A;  2YSU B;  2Y69 C;  4O4J B;  3FAV B;  3CCJ V;  2HVK C;  2EX3 A;  3H9V A;  1XMO B;  1NI8 A;  2JEU A;  4NTW A;  4YJ3 B;  1N36 B;  5AG2 A;  2EIK C;  2UXD O;  5EC1 C;  1NH2 D;  1Q8I A;  5CMU A;  4DRX B;  3BPZ A;  2AW9 A;  3F7Y C;  3RVY A;  4X65 B;  1MSW D;  1XHZ A;  2ODM A;  3OW2 U;  3OM3 B;  5KX5 A;  3L73 H;  3JAK B;  3ZX6 A;  4LWS B;  3JAR A;  2F95 B;  2DE0 X;  1MA1 A;  4MVO A;  1SQF A;  4L87 A;  4XBF A;  2KSD A;  2YUA A;  1EBO A;  4JI5 O;  3M7M X;  3ZMT A;  1LUV A;  5IJ9 B;  4JI2 O;  4WFB V;  2OWO A;  3ABL C;  1N34 B;  3SPC A;  4IIJ A;  2HR3 A;  3HR0 A;  5C8Y B;  5L3G A;  1MZE A;  3DC6 A;  4WBN A;  4IYH A;  4GKK B;  3JAL B;  2HEP A;  3N2G B;  4O4L B;  5IY5 B;  4LFA B;  3HKB A;  2PYJ A;  2HHH B;  3F5W C;  1DK1 A;  4I4T A;  5FPR A;  2UUB B;  4B3M B;  2WWW A;  3T1Y O;  1YVW A;  1SQQ H;  4PDV A;  2EIM B;  2YEV A;  4UFZ A;  4QE9 A;  2M6Y A;  3I56 V;  1BHA A;  3Q4H B;  1EN5 A;  2P5O A;  4O2A A;  5LXT B;  2EJ7 A;  2PUS A;  3ETG A;  2X6C A;  4R6Z A;  5LHG A;  1AIL A;  4N21 A;  1FFX B;  3ASO C;  2WA3 A;  4TQD A;  2PI4 A;  2V7Q G;  5B3S C;  3BY6 A;  4H44 B;  4FK5 C;  4DUZ O;  1B04 A;  1SQP H;  2A9H A;  3BEH A;  4NR1 A;  2UUA B;  3KG2 A;  3FD9 A;  3CRR A;  3JD1 A;  3A0H Z;  3EFF K;  2F23 A;  4X64 O;  5KUM A;  3JAR B;  4LFB O;  1OHH G;  2JGU A;  2NNU A;  5EZY A;  2F66 C;  2CH7 A;  4UCV A;  2LGQ A;  3JAS B;  3LUT B;  3K0G A;  1L0N H;  3OMA B;  1GM8 A;  4JYB A;  4L8J A;  3ETE A;  4A5U B;  4PD4 F;  4FPP A;  1RSO B;  1IBL B;  4K0K O;  4LF5 O;  1FAF A;  3D3Q A;  1N0N A;  1AI4 A;  2HKO A;  2OCH A;  1HNW O;  4JI1 O;  4JTD B;  2Y48 A;  1I5Y A;  4DUY B;  3UCS C;  3MHH C;  3RYF B;  1HNZ O;  4DR4 B;  3SJQ C;  4IT5 A;  3CCE V;  3UT5 A;  4J7K A;  4I4T B;  3CSX A;  1M57 B;  3GWK C;  1Q43 A;  3APQ A;  4GX0 A;  4PA7 A;  2DQ0 A;  5IYZ B;  4JAA A;  3KCX A;  1MOF A;  3C90 A;  3CWB H;  4IGG A;  1FFT B;  4DV7 O;  4MW8 A;  1PNM A;  3L72 H;  3J7A U;  1SF9 A;  2Q0O C;  1QVF U;  4B3S B;  3WFV A;  3BAA A;  4OPH A;  1MSD A;  3DXR B;  1YEW A;  1AI5 A;  3KKY A;  5H6Q A;  4W4L A;  2FKX A;  3M99 B;  3GB7 C;  4TV9 B;  2IH3 C;  3RBZ A;  4D7T A;  3ZMZ A;  3JCZ A;  4LF7 B;  2LFS A;  3AG4 C;  3VBB A;  1H38 A;  4LFC B;  3TCU A;  1K33 A;  2W0F C;  4NKG B;  5ITZ B;  4BW5 A;  1N32 O;  1UJW B;  5L3B A;  1VEW A;  4JI3 O;  5B1B B;  3ABT A;  3JAS A;  1AR5 A;  4O4I B;  1PL0 A;  4ZM5 A;  3GWO A;  5JJN B;  4MVZ A;  4X62 O;  4N23 A;  1N8R W;  4WCE V;  1ENV A;  3H1J H;  3SYA A;  3SDL A;  4RO2 A;  1TGO A;  2UXD B;  1GN3 A;  4EKW A;  5GW7 A;  3LSU A;  4I55 B;  4KFM A;  4YY3 O;  1EN4 A;  3FFQ A;  2AHZ A;  5GTH Z;  4JI6 B;  1KD1 W;  2JJ2 G;  1Q3E A;  2PF4 E;  3CCS V;  3JAW A;  1JX9 A;  2ZR2 A;  3SGI A;  1K5Q A;  1WA8 A;  1JR9 A;  1XIL A;  4B3M O;  3H1H H;  3K0D A;  3SYO A;  2ZE7 A;  1PPJ H;  1P7B A;  4LCU C;  3OFN G;  1Y76 B;  3K9A A;  4J9Z B;  5LXT A;  4J9Y B;  4X1Y B;  1ZL8 A;  1BMF G;  5EBM C;  1K8A W;  4FM1 A;  5IWA B;  4LF9 B;  2XAJ A;  1SZX A;  3APO A;  4YIO A;  4HBN A;  2P90 A;  4JPR A;  3CRA A;  4LF5 B;  1QCE A;  3JAW B;  1MMM A;  4RWU A;  3J81 N;  1SET A;  2CTQ A;  3VOU A;  2XUM A;  4GKK O;  4DR5 O;  1R6N A;  3ABL B;  4UV8 A;  3RYC B;  2LQT A;  3BA9 A;  1RFY A;  4E4E A;  4MT8 A;  3MD0 A;  2P67 A;  4UCR A;  4MS2 A;  4QPJ A;  3W7U A;  4JI5 B;  2NR5 A;  2IJI A;  2QKA A;  2QWR B;  3BCC H;  1WPX A;  3ASN C;  3B8N A;  4DR7 B;  2JIZ G;  3RYH A;  1QVG U;  3ZHT A;  4UV9 A;  4XDL A;  4OPA A;  5CB4 A;  2VQF B;  1PP9 H;  1U96 A;  3CC2 V;  2WLL A;  1IBK O;  2CTR A;  3N27 A;  3E89 A;  1GKF A;  4RQF A;  1E79 G;  4U3F H;  1W59 A;  1AJP A;  3K5L A;  2ZD9 A;  3OD4 A;  1WB8 A;  5LOV B;  2HP8 A;  4NXM O;  2HJD A;  3ZMV A;  2WLJ A;  4IL6 Z;  4J80 A;  3ASO B;  5DM6 V;  1H2L A;  2E75 B;  1RP3 B;  4DK0 A;  3CMA V;  1HP8 A;  2BOB C;  1S5J A;  1KKC A;  3WB0 A;  1AI6 A;  2JGD A;  3K04 A;  3K5O A;  3JD4 A;  2E76 B;  2LP7 A;  4K0K B;  5IYB O;  2D3O W;  1BT8 A;  4K8X A;  1JMK C;  3QF7 A;  3STL C;  4EB6 A;  1KQS U;  4U3J A;  5IYC O;  4J7J A;  3HKC A;  2JJ1 G;  1L8D A;  4OX9 B;  2YC0 A;  3BHP A;  4LF6 B;  5L3C A;  4YJ2 A;  1Q5O A;  3CC7 V;  1Y74 B;  2BSK A;  2Q7E A;  2BTO A;  2LFR A;  4X8A A;  1KBH A;  1F4N A;  4QJF B;  4B3S O;  4DV0 O;  2V4D A;  1MZF A;  4TQF A;  4G28 B;  5LP6 B;  1HR0 B;  3QTC A;  4OXS A;  4Q20 A;  2QGN A;  4UVA A;  1FXV A;  1TVK B;  3RGB A;  4JTA B;  2W6I G;  3P32 A;  4TOI A;  3FAV A;  1EM1 A;  1J95 A;  3RFR A;  4DV5 O;  4GT1 A;  2VS0 A;  1EN6 A;  2WLK A;  1HNX O;  3SJC C;  2X6B A;  1NH2 B;  1XNR O;  4BR6 A;  1BE3 H;  4QNH B;  1YXB A;  3ABM C;  2YXY A;  4BW9 A;  2ZIN A;  4P9O A;  1AP5 A;  1HNZ B;  4CS4 A;  2A7W A;  3LDD A;  4LWS A;  2OCC B;  5KHK A;  1S5H C;  4ZOL B;  1N33 B;  5A9G A;  2ADP A;  4ASU G;  1JA8 A;  3AK2 A;  3H1L H;  4I5S A;  2QEX V;  3LSQ A;  5EC2 C;  1R73 A;  2LO1 A;  4JI3 B;  4TV8 B;  3DC5 A;  4WFH A;  1YTF D;  2EIL C;  3E8H A;  1WAZ A;  4YIP A;  4NTY A;  2GHY A;  4JF3 A;  1A32 A;  3MAQ A;  3RVZ A;  5B5E Z;  1CXZ B;  4YJ3 A;  2QSA A;  3RWR D;  2RMK B;  3N2K B;  4JI1 B;  3E8G A;  4DW1 A;  4CH4 A;  4I9Q A;  3K08 A;  2LGW A;  4JGS A;  5D5P A;  4PDM A;  3ZCC A;  1T5E A;  2XTA A;  1VP7 A;  3B77 A;  3ZIA G;  4ZI7 A;  4AIL C;  4LP8 A;  1S3J A;  5LMN O;  4GZR B;  2JS5 A;  3CC4 V;  1VMG A;  3ZHR A;  3CCM V;  1FJG O;  3SPI A;  4QGP A;  2CTW A;  2CDY A;  4LNU A;  1EZJ A;  3TXQ A;  4F6R A;  3HKD B;  1SA0 A;  4DR6 B;  4TUY A;  3HPL C;  5LP6 C;  4CH3 A;  4JI7 O;  2YIB A;  1KC8 W;  5LA6 B;  1PKX A;  2DOS A;  4DV7 B;  2Q73 A;  4DV2 B;  4LR3 A;  2YXL A;  2GSM B;  4FLY A;  3H1K H;  4J41 A;  1RM1 C;  1I5X A;  3ZHQ A;  4KP4 A;  3QG5 A;  2B1G A;  3OT7 A;  3PN1 A;  4TSF G;  1CP9 A;  3EHB B;  2ZE5 A;  1TUE B;  4U7O A;  3WB1 A;  3OE7 G;  2ZR3 A;  3BRC A;  3NR7 A;  4LF7 O;  5B3S B;  2WLH A;  3DXR A;  4HNA B;  3BAB A;  1VQN V;  1Z2G A;  1D5N A;  1XL4 A;  3ZMU A;  3B8O A;  4DR4 O;  2QM4 A;  2B9Z A;  2Q8V A;  4FFK A;  1Y67 A;  1KUQ A;  2WA4 A;  3CCU V;  2QDO A;  2ZDI A;  1XNQ O;  3ZRW A;  2N05 A;  5JVD A;  1QR8 A;  3ZS8 C;  1KYO F;  3ZBH A;  1VF6 C;  1R1B A;  1YI2 V;  1K97 A;  4EB6 B;  4U3J B;  2DJV A;  4JAV A;  3CHX A;  2QWQ B;  2DYR B;  4GCZ A;  5J2U A;  4MVS A;  2OT5 A;  3CXC U;  1ROP A;  3B4S A;  3E86 A;  1FS0 G;  1BCC H;  5B1A B;  5KAF Z;  5IYZ A;  5C8Y A;  5GTI Z;  1FXK A;  3CD6 V;  3X2Q B;  3ABK C;  1VQ5 V;  2RJZ A;  1X59 A;  3SPH A;  3ZHV A;  1HW7 A;  3CPW U;  1RSO A;  2IU3 A;  3S3X A;  2QWO B;  4UB6 Z;  4PJ0 Z;  2DQ3 A;  2XAG A;  5KHJ A;  3HKE B;  3SYC A;  3K79 A;  4PA4 A;  2VRZ A;  2EZP A;  4LFA O;  1YCI A;  3I5D A;  4CS3 A;  1Q90 D;  4GUN A;  2QTS A;  3WG7 B;  2CUG A;  1US6 A;  3SYP A;  5EZY B;  1OZ0 A;  1M4U A;  3AG4 B;  1V9P A;  1H8E G;  1OCO B;  1NR1 A;  3E8B A;  3JAK A;  1NR7 A;  1VAR A;  4DV3 O;  5B1A C;  1DF5 A;  4I50 B;  1R3K C;  3L74 H;  4JYA B;  2UXX A;  1NJI W;  3JSN A;  1THZ A;  1W0K G;  1JFF B;  4X1I B;  5J2T B;  1GO3 F;  4KXR A;  5E79 Z;  4LF6 O;  2WLM A;  4EFB A;  4F6R B;  3HB3 B;  3M8A A;  2DW4 A;  5L3D A;  4CZZ A;  5LMU B;  5LGU A;  4X9Q A;  4O2B B;  1XMO O;  4IHJ A;  3C3S A;  1Y6X A;  1R6K A;  5JQG B;  5KLV H;  2F4V B;  5GON B;  1LR1 A;  2R9R B;  3SJA C;  1JJO A;  1M5I A;  4NXM B;  3FB8 C;  3OUF A;  1M57 C;  3T1Y B;  2LW7 A;  1XOU A;  3L75 H;  3IC9 A;  2Q0A A;  2GV9 A;  1SER A;  2UXN A;  1J5E B;  2P4V A;  2QWP B;  2CH7 B;  1N0J A;  4X1K A;  4JI4 O;  2WLI B;  5KMG A;  2QM8 A;  1PNL A;  4B3T B;  2IJJ A;  5IY5 C;  2UU9 O;  5JH7 A;  4YJ2 B;  5H6R A;  2N74 A;  4JI8 O;  4PI0 A;  2OIG A;  3O9O A;  2FB5 A;  2KG7 B;  3NXS A;  3ZN0 A;  1XL6 A;  4DUY O;  1VQO V;  3JD3 A;  4X1I A;  3VQV A;  4DR3 O;  5H5N A;  4J11 A;  2OYQ A;  5CA0 B;  5EK0 A;  1FFX A;  2F4V O;  2Q7G A;  2AGA A;  4DRX A;  5LL6 Y;  3G6E V;  4P2Z A;  1FXK C;  2OCC C;  1M1K W;  1S0V A;  2A79 B;  1B06 A;  5KX5 B;  2UXC B;  1Y4M A;  5EIB C;  1GH6 A;  2ZNJ A;  2Y4U A;  3T4Z A;  2Y0P A;  1WN7 A;  3CJH B;  4Z1M G;  3JAT B;  2Q68 A;  3K9S A;  1IBK B;  1GK9 A;  1YHQ V;  1PNK A;  1QBZ A;  1FPO A;  1VF5 B;  3AG3 C;  4UCS A;  4JI6 O;  2NN4 A;  4ZHQ B;  4WF9 V;  4O4J A;  2P22 C;  3W7S A;  4DK1 A;  2ZNI A;  5KUK A;  2JEX A;  1N4C A;  2RNB A;  4GKJ B;  3JAL A;  4DR3 B;  2CGO A;  2EIN B;  5BMV A;  2V1D A;  4PDR A;  2DYS C;  2O57 A;  1YTF B;  4J10 A;  2BCC H;  3DTU B;  1K5S A;  1H2M A;  4KL1 A;  2ADQ B;  1ORQ C;  3MHS C;  1BZK A;  1VQM V;  1H8H G;  3FKS G;  4DR6 O;  1OV9 A;  1WNS A;  4PA9 A;  4ZKI A;  3F5T A;  1PD3 A;  4ZOL A;  1ZAU A;  4B3T O;  1IDS A;  4F4L A;  1TUB A;  1MG1 A;  3TXS A;  4FFB A;  4GX2 A;  1Y66 A;  4GX1 A;  1QLE C;  2XND G;  4J42 A;  4AHC A;  4LH7 A;  4X66 O;  4HNA A;  2ZKO A;  2XAF A;  4B7E A;  1R6T A;  2X6A A;  3G6B A;  3ZRW B;  2DYR C;  1JQ0 A;  1P49 A;  3OTO O;  2QJ1 A;  4ZHQ A;  1AB3 A;  1GRJ A;  5HFM A;  5LMU O;  1BS3 A;  2E5L B;  1TVK A;  1GMG A;  1GN4 A;  5K1P A;  4JV5 B;  2ARH A;  4O4H A;  2ZIM A;  1YF2 A;  5K1X A;  3RYH B;  1URF A;  5EBL C;  5BXZ A;  1NZ6 A;  4H0L B;  5JJJ B;  2EZO A;  1N32 B;  3CRC A;  4JI2 B;  5E1A C;  3T1H B;  4LF8 O;  3E83 A;  2QWN B;  2ZXW B;  2Y0I A;  2OTL V;  5LYJ B;  5CB4 B;  2Q5Z A;  4DV1 O;  1UPG A;  3ZHS A;  1SQG A;  1HWY A;  3JAM N;  2N04 A;  3B09 A;  1Q82 W;  5B1B C;  3T2M A;  1B3Q A;  1IBM O;  4JTC B;  5EYP B;  1XBL A;  1NBM G;  3BA8 A;  3U10 A;  5C93 A;  2UUC B;  1KEC A;  2DYS B;  3D36 C;  2EUL A;  1HDJ A;  4LFC O;  2AHY A;  4YHH O;  2VQF O;  2KG7 A;  1NTK H;  4LF9 O;  5J2U B;  2W6J G;  4ZBM A;  5TIS Z;  1TAE A;  1OJH A;  2YI9 A;  4ZIB A;  1SKV A;  1G8M A;  1IXB A;  1AVM A;  3L70 H;  1K4D C;  2L6L A;  3K5N A;  2E74 B;  2Q67 A;  2YEV B;  2WSS G;  5BY1 A;  2KB1 A;  4X1Y A;  4WBN B;  3UO3 A;  4DV5 B;  5FNV A;  5EYP A;  1GAX A;  2PZS A;  4JYA O;  3OTO B;  5LBQ A;  3HKB B;  2EIM C;  4CH6 A;  4BIO A;  3CCL V;  4I50 A;  4JZ2 A;  5LMN B;  5IT9 N;  4JV5 O;  3WB2 A;  3LDC A;  1IXM A;  2PYL A;  2HVJ C;  3KCY A;  3H01 A;  4UUJ C;  1H2N A;  3G71 V;  1YJ9 V;  1K4C C;  5IJ9 A;  4O4I A;  1FYJ A;  4NVP A;  3CX5 F;  4LFB B;  2C2A A;  1AJN A;  1G1X B;  1BSM A;  4GX5 A;  3G4S V;  1E1R G;  1ZSP A;  5LHI A;  5ITZ A;  1CEZ A;  2A3Q A;  1N33 O;  1Q81 W;  1ZTE A;  4DR2 B;  3Q4H A;  1H2G A;  4ZM1 A;  5BZB A;  3OR7 C;  4QIW F;  2P4K A;  5JH7 B;  1JJ2 U;  2IJK A;  3R65 A;  1NVP B;  4NXN B;  2WLI A;  2KQX A;  2Q6A A;  2WLN A;  2Z0A A;  1K92 A;  3A2F A;  1NU1 H;  1VQ4 V;  3K59 A;  1J5E O;  5B66 Z;  1X4T A;  3ICX A;  4JYY A;  2P6J A;  3FB7 C;  1OCR C;  1ZLZ A;  1S5L Z;  1SA0 B;  2Z5U A;  5L3F A;  5JWP A;  2ZCE A;  4R8C A;  4UCU A;  4P9P A;  4B7K A;  1AJQ A;  1R3L C;  1O9H A;  5HFL A;  4B3R O;  3DSQ A;  4E2L A;  4NB5 A;  3FYI B;  1P84 F;  1XRE A;  3AG2 B;  1SZT A;  5IJ0 A;  3AK3 A;  4X65 O;  2YI8 A;  2EIJ B;  5FL7 G;  1H2K A;  1PV0 A;  4MW3 A;  3SPJ A;  2KKW A;  1ZL8 B;  2GTS A;  3B40 A;  4LNU B;  4CH5 A;  3UQ8 A;  3CME V;  4GKJ O;  3K58 A;  1LUW A;  3ZRX A;  4QE7 A;  5KHI A;  3D3I A;  1JCH A;  1FKA O;  3T1C A;  3K03 A;  4FLX A;  4CBC A;  4DV2 O;  2X0L A;  3ZED A;  3IC7 A;  4JI8 B;  2R9A A;  4O4H B;  3CYO A;  1KP2 A;  3ABK B;  2H8P C;  3E35 A;  2K9P A;  4TV8 A;  2YIB D;  3ZHU A;  1QU7 A;  1RM1 B;  5CN0 A;  3I55 V;  2M7W A;  3CP1 A;  2UXB O;  2YIC A;  2XHB A;  1XUQ A;  2MK3 A;  4FLZ A;  2XAH A;  3ZRS A;  4DV1 B;  1RPO A;  4W4K A;  1Z5W A;  5H2F Z;  5A2Q N;  2Q7H A;  3P3P A;  3VQY A;  4BIU A;  3VQX A;  2ZQM A;  5LYJ A;  3S3W A;  4TUY B;  2GDS A;  4IYI A;  1GTO A;  1DLB A;  5FPO A;  1XMQ O;  2ZIO A;  1IZ3 A;  1P4R A;  4NYK A;  5CBG A;  2JGD B;  1I7F A;  1OCO C;  2HLD G;  1EFR G;  1KB9 F;  2RQ6 A;  1S72 V;  3WG7 C;  1R3J C;  4JZG A;  3RYF A;  3IJ4 A;  3HKD A;  3K5M A;  3CXH F;  1F7Y A;  2BTQ B;  1YIJ V;  3EXA A;  3CCR V;  1NKD A;  1XMQ B;  3E2E A;  2XT9 A;  3D36 A;  5JQG A;  2H94 A;  2LW1 A;  4WFA V;  2FML A;  4WFF A;  4TV9 A;  5IWA O;  2QKC A;  1BHB A;  1GM9 A;  3SPG A;  4FJC C;  4WFG A;  2FL4 A;  1V54 C;  3OEH G;  1D2D A;  3P3N A;  3FB6 C;  3B2E E;  5KHG A;  1LNQ A;  5DEC A;  2OIE A;  4CS2 A;  1YDX A;  1COW G;  5EIB D;  1O9G A;  1JPX A;  1N34 O;  5KHH A;  4H37 A;  5BMV B;  3SYQ A;  3E22 B;  1VQP V;  1BGY H;  3ML0 A;  1JFF A;  3RYC A;  5LOV A;  2NLJ C;  2PY5 A;  1WJZ A;  2EIL B;  4E2H A;  5BR8 B;  4MVM A;  3U11 A;  2F1M A;  2ILM A;  5DN6 G;  4AQY B;  2CGN A;  1NS1 A;  1SC5 B;  4YXW G;  5F2V O;  2RN9 A;  3A8T A;  3AEI A;  4O2A B;  3IFX A;  4G2K A;  4I0X A;  3HKE A;  1N36 O;  2DN9 A;  2R70 A;  1K73 W;  1OCZ C;  4J7Z A;  3ASN B;  4HAM A;  5IYD O;  1L1F A;  5LP6 A;  3OEE G;  2P06 A;  1FJG B;  2ZM6 B;  4OGQ B;  1UFI A;  4EFE A;  1XHX A;  3H1I H;  3ZMS A;  3CRM A;  1WP8 A;  4K35 A;  4DV4 B;  3E22 A;  1AI7 A;  4KHP O;  2CK3 G;  4C7U A;  2EIJ C;  4B08 A;  3K06 A;  3R66 A;  3B8M A;  3SR2 C;  2XAQ A;  1YJW V;  3ETD A;  2UXB B;  1XI1 A;  1SQB H;  4AQY O;  4CC6 A;  1Q86 W;  4PI2 A;  1VF6 A;  4R7C A;  2IU0 A;  3UT5 B;  3HKC B;  2PGG A;  5IJ0 B;  4DR2 O;  4PEL A;  4JI0 O;  4RUE A;  2HG5 C;  4DV6 O;  1ZX3 A;  5BR8 O;  4FM2 A;  1XDC A;  2ZT9 B;  1F51 A;  1K9M W;  5FNV B;  2DWD C;  3JAT A;  4PA6 A;  5DED A;  2JS3 A;  3PJS K;  4O4L A;  3OMI B;  2BE3 A;  3QVN A;  2UXC O;  4DV0 B;  4JI0 B;  5EBW C;  1IVS A;  2Z3Y A;  2ITC C;  3DGE A;  3JCU Z;  1HNW B;  2BTQ A;  2UUA O;  5CBH A;  3N2G A;  1KMI Z;  5B1O A;  2WLL B;  4DV4 O;  4KUM A;  1M90 W;  4I9W A;  3G80 A;  1FXK B;  3LNM B;  1TA8 A;  5J9P C;  2AZ0 A;  5IE9 A;  2ZE6 A;  3P30 A;  1W0J G;  1GN6 A;  4FLW A;  3QO8 A;  4MTO A;  3CEI A;  4K8Z A;  1Q7Y W;  3TJT A;  3LDE A;  1IBL O;  4FIP C;  2QR4 A;  1NVP D;  3T4D A;  2QA4 V;  2RDC A;  4LBE C;  1VQ6 V;  1F23 A;  3AG7 A;  3SJB C;  2QE7 G;  2FYU H;  3RN4 A;  1IX9 A;  5L3E A;  1OCC C;  2PI5 A;  1Q6H A;  2IJH A;  4DO2 A;  2HJF C;  3LSS A;  4U7N A;  2YS8 A;  4RAI A;  2XAS A;  3RW0 A;  1BQZ A;  1V55 B;  5JJE B;  4I7Z B;  4O2B A;  1JVM A;  3OGC C;  1OCZ B;  2EJR A;  4TT3 G;  5CA1 B;  1Y76 A;  3D8C A;  4X20 A;  1XNR B;  2DMX A;  4D6T H;  4B3R B;  3STZ C;  4DYL A;  4I55 A;  1G6U A;  1M93 A;  3CRQ A;  3ZJZ A;  2AXT Z;  2R72 A;  2Y69 B;  4X89 A;  1M56 B;  4X62 B;  4DR1 O;  2F93 B;  3TK1 A;  4CC5 A;  4JAU A;  5D5Q A;  4PV1 B;  1BQ0 A;  3OR6 C;  3JD2 A;  4K3A A;  1WLE A;  2CTP A;  1U97 A;  3U0Z A;  5JCO A;  5KA6 A;  3ABM B;  4FVM A;  1VQ8 V;  4DR7 O;  5LGN A;  1NTM H;  3RT3 C;  3FX7 A;  3TGU H;  1SES A;  1VF7 A;  5CA3 A;  1OCR B;  4Z2W A;  3CE2 A;  1YJN V;  4UB8 Z;  1M9N A;  5B1N A;  3MDS A;  2QKS A;  2JVD A;  1P7G A;  2VQE B;  1VQK V;  2QM7 A;  4HZ3 A;  5IDJ A;  3QO5 A;  1XNQ B;  3FB5 C;  4Q6G A;  2X7R B;  5KA5 A;  4IHJ B;  2H3O A;  1PM9 A;  2GTA A;  3B8P A;  1K7D A;  2UUB O;  2E3C A;  4UCO A;  2CE4 A;  3K57 A;  1MAB G;  2W0X A;  1CPY A;  2Y4T A;  3ETQ A;  4UXN A;  4IIJ B;  3C3T A;  1AR1 B;  4Z1V A;  2OTJ V;  2VWJ A;  2CAZ C;  4MVU A;  1QHT A;  1I94 O;  4FZ1 A;  4LF4 O;  1Y74 A;  2BSK B;  2ZDI C;  4FFB B;  1WA8 B;  1FXH A;  1QNM A;  4PDL A;  3BVO A;  3T1H O;  4LF8 B;  3UO2 A;  5CA1 A;  1RPR A;  1B6Q A;  2ZM6 O;  2A0L A;  3OGI B;  2A06 H;  2WAM A;  1K3E A;  4DV3 B;  2F43 G;  2P7T C; 
#chains in the Genus database with same CATH homology
 3ZRX A;  1KP3 A;  4QE7 A;  5LGT A;  3D3I A;  3SPH A;  1JCH A;  3T1C A;  3K03 A;  1QVF U;  3JD0 A;  3CPW U;  3WFV A;  4LC1 A;  1VQ9 V;  3IGA C;  4CBC A;  2X0L A;  2IU3 A;  1AI5 A;  5H6Q A;  3IC7 A;  4PA3 A;  2DQ3 A;  3CYO A;  2XAG A;  3M99 B;  1KP2 A;  2R9I A;  3ABK B;  2H8P C;  3E35 A;  1QR9 A;  3E8F A;  3GB7 C;  2IH3 C;  3RBZ A;  3SYC A;  3K79 A;  3AG1 C;  4PA4 A;  3ZMZ A;  3CCV V;  4TWK A;  2XOK G;  3JCZ A;  2LFS A;  3AG4 C;  2EZP A;  3VBB A;  1DF4 A;  1RM1 B;  1H38 A;  5CN0 A;  3I55 V;  3TCU A;  1K33 A;  2M7W A;  2W0F C;  3CP1 A;  4BW5 A;  1G4Y B;  1UJW B;  4BIZ A;  2IW5 A;  1S77 D;  5L3B A;  4G27 B;  4E29 A;  3OAA G;  3WG7 B;  5B1B B;  1KKD A;  2MK3 A;  1ZWI C;  3SYP A;  3ABT A;  2XAH A;  3ZRS A;  1RPO A;  1OZ0 A;  3AG4 B;  1PL0 A;  1H8E G;  3GWO A;  4ZM5 A;  4MVZ A;  1OCO B;  4BIU A;  2ZQM A;  4N23 A;  1NR1 A;  3A0R A;  1N8R W;  4WCE V;  3E8B A;  1NR7 A;  4E2C A;  4P30 A;  1ENV A;  1GTO A;  5B1A C;  4WFE A;  4H33 A;  1DF5 A;  1DLB A;  3OUS A;  3SYA A;  1R3K C;  2UXX A;  4RO2 A;  4EKW A;  1NJI W;  5GW7 A;  1P4R A;  1THZ A;  5CBG A;  4KFM A;  1W0K G;  2Q69 A;  1OCO C;  2HLD G;  4MVR A;  5CBF A;  2AHZ A;  1GO3 F;  1KD1 W;  1EFR G;  2JJ2 G;  1S72 V;  3AG3 B;  3JYC A;  3WG7 C;  1R3J C;  2WLM A;  1R3I C;  4RQE A;  3CCS V;  3HB3 B;  2ZXW C;  3K3W A;  2DW4 A;  1JX9 A;  2ZR2 A;  3ZN1 A;  1K5Q A;  5L3D A;  4CZZ A;  1YIJ V;  3ZRV A;  5LGU A;  3K0D A;  3QNE A;  3SYO A;  1R6K A;  3CCR V;  1NKD A;  3E2E A;  1P7B A;  4LCU C;  3D36 A;  2R9R B;  3OFN G;  2H94 A;  4WFA V;  4WFF A;  3K9A A;  3FB8 C;  3OUF A;  4J9Z B;  2K1E A;  1M57 C;  4J9Y B;  3QO7 A;  1BHB A;  1GM9 A;  3SPG A;  2JDI G;  2FTK A;  4FJC C;  4WFG A;  1BMF G;  3FYE B;  1E1Q G;  1VQ7 V;  1V54 C;  1SER A;  2UXN A;  1F4M A;  3OEH G;  3FB6 C;  5EBM C;  3UM7 A;  1ARO P;  1K8A W;  2HFE C;  2WLI B;  1V55 C;  2XAJ A;  2QM8 A;  1PNL A;  1LNQ A;  1VQL V;  2IJJ A;  4QPK A;  1W2B U;  5IY5 C;  1COW G;  2P90 A;  4MVQ A;  1DTO A;  4JPR A;  5H6R A;  1QLE B;  1JOY A;  2ITD C;  1QCE A;  1JPX A;  4UVB A;  2B1I A;  3NXS A;  4H37 A;  1SET A;  3VOU A;  3ZN0 A;  1XL6 A;  3SYQ A;  1QLN A;  1VQO V;  1VQP V;  3JD3 A;  1R6N A;  3ABL B;  4UV8 A;  3ML0 A;  4MT8 A;  2BOC C;  3MD0 A;  2P67 A;  4JAS A;  4MS2 A;  4QPJ A;  3W7U A;  2NLJ C;  5EK0 A;  4BAY A;  2EIL B;  1M56 C;  4E2H A;  4XDK A;  4MVM A;  2IJI A;  1BL8 A;  3W7T A;  1WPX A;  3ASN C;  1YSC A;  2B5U A;  3B8N A;  2JIZ G;  5DN6 G;  3G6E V;  4P2Z A;  1FXK C;  1QVG U;  4UV9 A;  4XDL A;  4YXW G;  2OCC C;  1M1K W;  3OMN B;  1S0V A;  2A79 B;  2EBO A;  2WLL A;  3CC2 V;  3AEI A;  1Y4M A;  3E89 A;  2WPD G;  1GKF A;  3IFX A;  4MTF A;  1YIT V;  4RQF A;  1E79 G;  4G2K A;  1K34 A;  4R50 A;  3T4Z A;  4X88 A;  1K73 W;  1OCZ C;  3W7W A;  2QTO A;  3ASN B;  4HAM A;  4Z1M G;  1AJP A;  2Q68 A;  3AG2 C;  1GK9 A;  5IYD O;  1YHQ V;  2ZD9 A;  1L1F A;  5LHH A;  1PNK A;  3OEE G;  1QBZ A;  3AG3 C;  3ZMV A;  4MSW C;  4WF9 V;  2WLJ A;  3AG1 B;  3W7S A;  1OCC B;  2DWE C;  5KUK A;  3X2Q C;  3UKM A;  1S76 D;  3TET A;  2JEX A;  3ASO B;  5DM6 V;  3W7X A;  3ZMS A;  3CMA V;  2IH1 C;  1AI7 A;  2CK3 G;  2BOB C;  3CCQ V;  2EIN B;  2V1D A;  2EIJ C;  4PDR A;  2DYS C;  3K06 A;  1YTF B;  3DTU B;  5H9C A;  1AI6 A;  1K5S A;  3B8M A;  1NQT A;  4MTG A;  1ORQ C;  2XAQ A;  3MHS C;  3K04 A;  1VQM V;  1H8H G;  1YJW V;  3JD4 A;  2LP7 A;  4UVC A;  5IYB O;  2D3O W;  3CME V;  3ETD A;  3FKS G;  4XDJ A;  3STL C;  1KQS U;  2JK5 C;  4FMT A;  4PA9 A;  4ZKI A;  1SRY A;  5IYC O;  1Q86 W;  4MTX A;  4R7C A;  2IU0 A;  1PD3 A;  2JJ1 G;  2EIK B;  4PEL A;  4F4L A;  1MG1 A;  4RUF A;  4RUE A;  2HG5 C;  4GX2 A;  1Y66 A;  5L3C A;  4GX1 A;  3CC7 V;  1QLE C;  2LFR A;  1V54 B;  4X8A A;  1F51 A;  1F4N A;  4QJF B;  2XND G;  1K9M W;  4HYO A;  2EIN C;  2ATK C;  2DWD C;  4G28 B;  3F7V C;  3ABU A;  2XAF A;  4PA6 A;  2X6A A;  4DXW A;  3PJS K;  4OXS A;  4Q20 A;  4UVA A;  3ZRW B;  2DYR C;  4JYC A;  1GM7 A;  1JQ0 A;  3OMI B;  2YSU B;  1FXV A;  2Y69 C;  4JTA B;  3CCJ V;  5HFM A;  2HVK C;  2W6I G;  3P32 A;  1GMG A;  1J95 A;  5EBW C;  2JEU A;  2Z3Y A;  4GT1 A;  2EIK C;  2ITC C;  3DGE A;  2WLK A;  5EC1 C;  1NH2 D;  5EBL C;  5CMU A;  2X6B A;  2EZO A;  3F7Y C;  3RVY A;  5CBH A;  1NH2 B;  1MSW D;  4QNH B;  3ABM C;  5E1A C;  3E83 A;  5B1O A;  3OW2 U;  2ZXW B;  2OTL V;  2WLL B;  3OM3 B;  4P9O A;  4KUM A;  1M90 W;  4I9W A;  1FXK B;  3LDD A;  3LNM B;  5J9P C;  2OCC B;  1S5H C;  1HWY A;  3P30 A;  1W0J G;  3QO8 A;  4MTO A;  4MVO A;  1Q82 W;  4L87 A;  5B1B C;  4ASU G;  4XBF A;  1Q7Y W;  3T2M A;  3LDE A;  4I5S A;  1EBO A;  4FIP C;  3ZMT A;  4JTC B;  2QEX V;  3LSQ A;  4WFB V;  5EC2 C;  3ABL C;  1NVP D;  1R73 A;  3SPC A;  3T4D A;  1NBM G;  2QA4 V;  2HR3 A;  4LBE C;  5L3G A;  1VQ6 V;  5C93 A;  1F23 A;  1KEC A;  2QE7 G;  2DYS B;  2AHY A;  4WFH A;  1YTF D;  2EIL C;  3E8H A;  5IY5 B;  2W6J G;  5L3E A;  1OCC C;  2GHY A;  2PI5 A;  2IJH A;  4DO2 A;  4ZBM A;  2HJF C;  4JF3 A;  3F5W C;  3LSS A;  4U7N A;  4RAI A;  3RVZ A;  2XAS A;  3RW0 A;  2WWW A;  1V55 B;  1G8M A;  3E8G A;  1JVM A;  4PDV A;  1K4D C;  2EIM B;  2YEV A;  3K08 A;  3OGC C;  4JGS A;  1OCZ B;  4PDM A;  4QE9 A;  2EJR A;  2Q67 A;  2YEV B;  3ZCC A;  3I56 V;  2WSS G;  1BHA A;  3B77 A;  4TT3 G;  3ZIA G;  2KB1 A;  4LP8 A;  1S3J A;  3CC4 V;  3CCM V;  3STZ C;  3SPI A;  3ETG A;  2X6C A;  5LBQ A;  4R6Z A;  5LHG A;  2EIM C;  3CCL V;  3ZJZ A;  4N21 A;  1EZJ A;  2Y69 B;  4X89 A;  3ASO C;  1M56 B;  3LDC A;  2PI4 A;  2V7Q G;  1IXM A;  3TK1 A;  3HPL C;  2HVJ C;  5B3S C;  3H01 A;  4UUJ C;  3BY6 A;  4JAU A;  4FK5 C;  3G71 V;  1YJ9 V;  1K4C C;  1KC8 W;  3OR6 C;  1PKX A;  3JD2 A;  1WLE A;  2A9H A;  2C2A A;  3BEH A;  1AJN A;  5KA6 A;  3KG2 A;  3ABM B;  1VQ8 V;  3JD1 A;  2GSM B;  5LGN A;  4GX5 A;  3EFF K;  3G4S V;  1E1R G;  1RM1 C;  1SES A;  5LHI A;  1I5X A;  1CEZ A;  5CA3 A;  4KP4 A;  2B1G A;  1Q81 W;  4TSF G;  1CP9 A;  3EHB B;  5KUM A;  1OCR B;  1TUE B;  4U7O A;  1OHH G;  3OE7 G;  2NNU A;  2ZR3 A;  1YJN V;  3LUT B;  3K0G A;  1H2G A;  4ZM1 A;  1M9N A;  3OMA B;  5B1N A;  5BZB A;  1GM8 A;  4JYB A;  3ETE A;  3OR7 C;  5B3S B;  2QKS A;  4QIW F;  2WLH A;  1VQK V;  1JJ2 U;  4FPP A;  2QM7 A;  4HZ3 A;  2IJK A;  3QO5 A;  5IDJ A;  3FB5 C;  1VQN V;  3R65 A;  1AI4 A;  1NVP B;  2HKO A;  2WLI A;  1XL4 A;  5KA5 A;  2X7R B;  2Q6A A;  2WLN A;  3ZMU A;  3B8O A;  1K92 A;  4JTD B;  2Y48 A;  1I5Y A;  1VQ4 V;  3CCU V;  3B8P A;  2ZDI A;  1K7D A;  3ZRW A;  2P6J A;  3FB7 C;  1OCR C;  1QR8 A;  3MHH C;  3SJQ C;  1MAB G;  3CCE V;  2Z5U A;  5L3F A;  1CPY A;  4R8C A;  1YI2 V;  4UXN A;  1K97 A;  4P9P A;  1AJQ A;  1AR1 B;  2OTJ V;  1R3L C;  5HFL A;  1M57 B;  4MVU A;  4JAV A;  4E2L A;  2DYR B;  2ZDI C;  3FYI B;  4GX0 A;  4PA7 A;  2DQ0 A;  1FXH A;  4PDL A;  4GCZ A;  3AG2 B;  4MVS A;  1SZT A;  2OT5 A;  3CXC U;  1ROP A;  3E86 A;  1FS0 G;  1MOF A;  2EIJ B;  5FL7 G;  5B1A B;  4MW3 A;  3SPJ A;  1RPR A;  1B6Q A;  1FXK A;  2A0L A;  3CD6 V;  2WAM A;  1FFT B;  4MW8 A;  3X2Q B;  1K3E A;  3ABK C;  1VQ5 V;  2F43 G;  1PNM A;  2P7T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...