4E2LA

Crystal structure of the periplasmic domain of mutant fepe lps o-antigen chain length regulator protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
262
structure length
240
Chain Sequence
WTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLDLHRAIVALSEKMKAVDDSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Closely Related O-antigen Lipopolysaccharide (LPS) Chain Length Regulators.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Ferric enterobactin (Enterochelin) transport
total genus 73
structure length 240
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4e2lA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 4e2lA01
1DLBA 3CYOA 3WFVA 5CN0A 2LP7A 1Y66A 1MG1A 4FJCC 1Y4MA 3CP1A 4N21A 4E2CA 1ENVA 4FIPC 1MOFA 1K34A 3H01A 1QCEA 3B8NA 3P30A 3B8MA 5CMUA 1K33A 5H9CA 3B8PA 2M7WA 3MHHC 3B8OA 3M99B 5HFMA 4JGSA 1SZTA 3B77A 1F23A 2EZOA 2X7RB 3GWOA 2EZPA 1JPXA 5KA6A 3MHSC 4ZM5A 5HFLA 1DF5A 3K9AA 4JPRA 1I5YA 5KA5A 1EBOA 1QR8A 1I5XA 2OT5A 4N23A 1JQ0A 1DF4A 4FK5C 4E2LA 1QR9A 4E2HA 1QBZA 4ZM1A 4G2KA 2EBOA 2MK3A 2P6JA 4E29A 4JF3A
chains in the Genus database with same CATH superfamily
3BA8A 3JD4A 2Q73A 5LA6B 1ZL8A 3AK1A 2W0FC 3ICXA 3BRCA 1XOUA 2VQFB 3L74H 3JARA 4DYLA 1Q6UA 2DYRC 3D8CA 3CRCA 2KKWA 2XUMA 2Q6AA 4I0XB 5LXTA 3NXSA 4DV3O 4GKJO 3H1HH 2R9IA 1WPBA 3QO5A 2K1EA 1WB8A 4LFAB 4XBFA 3WU2Z 4YIOA 1FKAO 1DGSA 2GV9A 4UXNA 1D2DA 2EZOA 3E89A 3L9DA 4DR3B 4O2AB 1LUWA 3OMAB 4R7CA 4R8CA 2HFEC 3OUFA 3OMIB 5K1XA 5LGNA 4GLXA 4O4IA 4AHCA 2M6YA 1L0NH 5JWPA 1I7FA 4UV8A 5KUKA 3HKCA 1XMOO 1FYJA 5CB4A 2IH3C 1I0HA 1AROP 5FLXN 2Q0AA 4PELA 1QQCA 5BMVB 1H8EG 1WLEA 2WLKA 1YHQV 2UUAO 1ZL8B 3ZMTA 1WB7A 1QBZA 3TGUH 2Q9LA 1PM9A 3RT3C 2FMLA 4GZRB 3CCRV 1JCHA 4I5SA 1VQ9V 5CBFA 4EFEA 1NBMG 2BE3A 3W7SA 2GDSA 3B8OA 2XAJA 4JGSA 4GT1A 4X66B 2QWPB 4YJ3A 3MAQA 1HP8A 2C2AA 4UCTA 5JH7A 4DW0A 2YI9A 2CK3G 1NT2B 3WFVA 1BMFG 5KMGB 1FXKA 4GKKB 4RO2A 4FFBA 1OCRB 4JI7O 4DR6B 5IJ0A 2GSMB 1NR7A 4LCUC 4I9WA 1MZEA 3K9AA 3FB5C 4UB6Z 3QNEA 2VQEO 2JEUA 1XQ8A 4A5UB 3ETDA 2OWOA 2Q7EA 3UM7A 1WP8A 3CCUV 1N34O 2OTJV 2OTLV 4MW3A 1NJIW 1SA0A 3ZRWA 4LFAO 4B7KA 4X8AA 2R72A 3ABMB 1COWG 3D36A 4X1IA 3ABKB 3KG2A 4MVSA 4LFBB 3BHPA 1XNQO 2PTMA 3OTFA 1XDCA 1XHZA 3QG5A 4P30A 3FB6C 3JALA 1XILA 3RYFA 5FPOA 2CH7B 5KLVH 1GN6A 2BOCC 4O4IB 4NXMB 4KHPO 1IBKO 4RWUA 2DW4A 1R3JC 4TV8A 1KB9F 1GN3A 1FFXA 2UUCB 4JPRA 3CC2V 3J7AU 4JI3O 1SQGA 4WFEA 1VP7A 4G2KA 2NR5A 4GKJB 4LF7B 3OTOO 2QGNA 5L3BA 1Y4MA 2UU9B 4LR3A 1N0JA 3HKDA 1H2MA 1CP9A 1QU7A 4O2BB 4XDLA 2F4VB 4X1KA 1XNQB 4WCEV 3JAWB 3J81N 4ZM1A 3BA9A 1Q5OA 3QO7A 4PA3A 1SQPH 2JGDA 4NXMO 2YS8A 2EIJC 1JR9A 3THOA 1KQSU 1J5EO 1T5EA 5LP6A 4B3SB 3FFQA 1RP3B 4BIOA 4UVBA 1URFA 4O4HB 2KB1A 2WLIB 3BCCH 5BY1A 3W7UA 1JFFB 4LWSB 2LJ2A 3B4SA 4O4JA 2XAFA 5GONB 1S0VA 3JATB 3RYHA 4DR3O 2JJ1G 4JI0B 4NXNB 3ML0A 3E2EA 4QE9A 2H3OA 5JH7B 3FB7C 4HNAA 3CE2A 3WB0A 4WBNA 4J7JA 4NB5A 4OX9B 1AP5A 4L8JA 2EULA 2EIKC 3RYCB 2ZIMA 2FL4A 2P06A 2XAGA 4EFBA 3CSXA 2H8PC 2X6CA 3X2QB 3CPWU 2F66C 4FLVA 1F4NA 5AG2A 1SF9A 3CB2A 1B04A 5LMUB 1Q90D 4B3SO 4H0LB 4MVUA 1AR4A 1ORQC 5LMNO 5H6RA 2YI8A 4F4LA 1AVMA 4LH7A 2AGAA 4TQDA 4X66O 4DV4O 3FB8C 1UJWB 3I5DA 3RVZA 4LWSA 2JVDA 3AG2B 1XL6A 4Z1MG 3E22A 1OCOC 1R1BA 3E8FA 4JTCB 1OZ0A 2CGOA 2JS5A 2VRZA 1HNZB 1YTFB 2EILC 4LBEC 2P22C 1CPYA 4GX5A 3T1YB 2ZR3A 1N33O 3JAMN 3TK1A 4LF6O 1VF6C 1YIJV 1BL8A 1YCIA 4OXSA 3AG1B 1K7DA 3ZHSA 2Z0AA 1PD3A 3H1LH 2UXCB 1IBMB 1D5AA 2QTOA 2EBOA 2W6JG 1WPXA 2QEXV 3K0GA 1F7YA 2Y69B 1K5SA 2P67A 3VOUA 4JYYA 1SA0B 3H1IH 4N21A 3ZRWB 3HKDB 1N36B 1VF7A 4JV5O 2JDIG 4RAIA 5IJ9B 5KA6A 1JPXA 1M56C 1R73A 3LNMB 2CGNA 4NVPA 4XDKA 5CA1B 2EILB 4O4LB 1QLNA 3EFFK 1ZWIC 3W7XA 1XMQO 3OT7A 1EM1A 2OIEA 2ARHA 4QE7A 1QCEA 1PV0A 2LGQA 2Y48A 5B1NA 5IYZA 1P7BA 1YDXA 4LF4O 2QWNB 1N8RW 3OUSA 4DO2A 1B6QA 1AI5A 1VQLV 4J10A 1QLEB 1TAEA 4F6RB 4PI0A 3CMEV 3NR7A 4KFMA 2WA4A 5EK0A 3ZS8C 4AQYB 4G28B 2FTKA 2EINB 1AR5A 5H5NA 4GX1A 4FIPC 1JMKC 3LSUA 2BTQA 4PDRA 4WFFA 4U7NA 2F1MA 4MTOA 3K57A 1ZLZA 5BMVA 4B3TO 2JGUA 5CA0A 1RFYA 1BE3H 5LBQA 4EB6A 2MK3A 4QPKA 1FAFA 4JAUA 4JF3A 1KUQA 4FZ1A 1EZVH 3CS5A 5CA3A 4I55A 3EHBB 4I4TB 3IC7A 4KHPB 3D3IA 3VQWA 1AILA 5LMUO 2BSKB 1FXVA 1K5QA 2HVJC 2A7WA 3ZEDA 1EN5A 2EINC 3ZMSA 2VQFO 5LL6Y 1VF5B 3AEIA 4TWKA 4FM2A 2NNUA 1Y76A 4DR2B 1SS3A 3CCEV 1FJGO 5J2UB 1BHBA 5B1AC 3KCYA 4PV1B 4ABMA 3TETA 5B1BB 4CS2A 4OX9O 1YEWA 3EXAA 2F23A 2YXYA 2ZDIA 2FB5A 4O2BA 1XMQB 4YJ2B 3RYCA 1JJ2U 4F6RA 2ETNA 5LGTA 3FD9A 2X6BA 5CBGA 2HLDG 2Q68A 2YIDA 4UCVA 4LF8B 5IYZB 1MABG 1YJ9V 1NH2B 2IJKA 1KYOF 4Z1VA 5TISZ 2OYQA 1BSMA 4I4TA 2ZE6A 3M8AA 4NTWA 4AQYO 3ZHUA 3CCQV 2HEPA 1PNMA 4LF9O 3CYOA 1EN4A 1MMMA 1YVWA 1PNKA 3CHXA 3IFXA 2F43G 2QM7A 4JI2B 4DR1O 1S76D 1NQTA 4UCRA 4GX0A 3EVKA 3GVMA 1JX9A 3K5MA 5ITZB 3RYFB 2QWQB 3RYIA 2F4VO 4DR4B 5H2FZ 2Q7GA 4WF9V 3APQA 1SQXH 2E74B 3CP1A 1H8HG 2QWRB 3OR6C 5L3CA 2KG7B 5LA6A 1W2BU 3AG3B 4J7KA 3B8MA 1BT8A 3RYIB 3U0ZA 5JCOA 2XAQA 2B1IA 1M1KW 4FMTA 1Q81W 3CEIA 5KA5A 2AHZA 3K03A 2HHHB 1WJZA 3K5LA 1PP9H 5LYJB 2Q8VA 1SQQH 3BY6A 3VQYA 3OGCC 4LF9B 1VQ5V 2JEXA 1YF2A 3JD0A 3FKSG 5E1AC 1SKVA 4LFBO 3STZC 3K08A 4U7OA 5CMUA 1Q86W 4DUZO 3F7YC 2ZKOA 3JASB 4DR4O 2JIZG 2YIBD 4E2LA 3JCUZ 2XOKG 2EIJB 1HDJA 2RNBA 4MVQA 2XAHA 1P7GA 5D5QA 1V54C 2N05A 4JAVA 2ZT9B 1RPRA 3T4DA 4GKKO 1AI4A 4N23A 4UV9A 1G4YB 4BIZA 4JI7B 5J2UA 4B3RB 2YIAA 3KCXA 2WA3A 3LUTB 3JSLA 4DR5B 5B3SC 4FLZA 4JI8O 4K0KO 1S5LZ 2EX3A 2ZE5A 3LSQA 3E22B 2BSKA 1M90W 1Z5VA 2QA4V 5GONA 1NTKH 2GTSA 4DV5B 1H38A 4FM0A 2P5OA 3F5WC 4O2AA 1FXKC 4HBNA 4O4HA 3A8TA 5KHGA 3TCUA 1U96A 4JI1B 1IDSA 3SR2C 1TVKA 3ZIAG 4DW1A 5KAIZ 4PD4F 4JYBA 2UXDO 1BHAA 3MDSA 3CCSV 2FKXA 5IDJA 3BVOA 2GUZB 3L71H 3ZRVA 1IBMO 1QHTA 3LSSA 4LC1A 1V55B 3APOA 4B3RO 1K92A 3SPCA 5L3FA 5C8YB 4RUFA 4JI3B 3VQVA 3WB1A 4LH6A 1VARA 3JSNA 2DQ3A 3E8HA 2PZSA 4BW9A 1WA8B 2N74A 3HKBA 1XHXA 5IYBO 2RDCA 1AB3A 3HKCB 2YEVB 2P4VA 4C7UA 4BW5A 4B3TB 1H2KA 4JYAO 1R6TA 2LW7A 1A32A 2AW9A 3G4SV 1S3JA 3ZN1A 3SPIA 3UCSC 1BQ0A 5EIBD 5KHKA 4X9QA 5A2QN 5JQGB 3ZX6A 3C3TA 1SZTA 1XMOB 1FS0G 2F93B 5E79Z 4DV6O 3U11A 4W4LA 5JCOC 2A3QA 1N4CA 4B3MB 4X1YA 2AHYA 2CTPA 3JALB 2JGDB 4JZGA 3ZMVA 1MA1A 3SJQC 4CZZA 1Q7YW 3AK3A 4ZOLA 2L35A 4JAAA 4J9YB 4FLYA 5C8YA 3RFRA 1SQVH 2YUAA 3CCJV 1W59A 4MVZA 4DUYB 1H2NA 5B1BC 2NN4A 1Z5WA 3AG1C 1N0NA 2DYSC 4JYCA 1GK9A 4PA4A 4X62B 2DYRB 1RM1B 4X89A 4JYAB 4IT5A 3UT5A 3KKYA 1O9HA 1RSOA 4B08A 4JI5B 3BAAA 4X65B 2QKAA 4H44B 4PA7A 5LGUA 2QSAA 1GAXA 1MZFA 1SC5B 2ZE7A 3SPGA 4DRXB 1XI1A 2R70A 2E3CA 4FK5C 2A06H 4E29A 2UUBB 3ZRXA 1R3LC 4YJ3B 3P3PA 5LMNB 2QJ1A 1MSDA 3JAKA 3P30A 3CCMV 1GRJA 2CUGA 3M99B 1NTMH 1HR0B 3S3XA 4LFCB 3SYAA 3TJTA 3ABLB 4LNUB 1YITV 3D3QA 2DE0X 1OCOB 4LF5B 1W0KG 3ABMC 3T4ZA 1K73W 4X88A 3DC5A 1GKFA 2WLNA 4DV2O 1Q6IA 1U97A 3DC6A 5CB4B 1KC8W 5IJ0B 1YJWV 4DR6O 2WLLA 2IW5A 4AILC 3L72H 4DR2O 2RCVA 1V9PA 3OM3B 1S5HC 2OIGA 2UUCO 1NVPB 2Y0PA 3RN4A 4K0KB 3HPLC 3E8BA 4DRXA 3J80N 3OEEG 4K8XA 4TV9A 1KP3A 3IGAC 2NLJC 3D36C 4ICGA 3PN1A 1P84F 2DQ0A 3ABLC 1W0JG 2ODMA 3ASNC 1KP2A 2G38A 2E76B 2PF4E 3T1HO 4X20B 3OD4A 2BOBC 3BFRA 4LF8O 2QTSA 1PNLA 4MT8A 2ZXWC 2A79B 1ROPA 1YZBA 4CH3A 1BS3A 1GH6A 3ZN0A 4RQEA 4DV1O 1KD1W 3Q4HA 4YJ2A 2EIMB 5B66Z 2Z5UA 2P7TC 5LHHA 3ZRSA 4HYOA 1PKXA 1OJHA 1JA8A 1TUEB 1M57C 4U3JB 5EIBC 3JD3A 2UXCO 1TUBA 3FX7A 1HNXB 3N2KB 3S3WA 3SYCA 5IWAO 2XNDG 5J2TA 5FL7G 1HNZO 2F95B 2O57A 4X64B 4MVRA 2OT5A 1Y74B 1XREA 2B5UA 1QVGU 1S72V 5B1AB 3SPJA 3UO2A 2WLLB 2ZNIA 1LUVA 2FYUH 4JI1O 3B8NA 3GWKC 4RQFA 4KP4A 1HW7A 1K4CC 1M57B 2HR3A 1O9GA 1M5IA 2Q4PA 1NTZH 2IBZH 1DTOA 4PHZA 3Q4HB 1CXZB 3SYPA 4ZHQB 4JI2O 2BTOA 1AJNA 3PJSK 1KBHA 2KSDA 5KHHA 1GO3F 4LF7O 5DEDA 5IE9A 2D3OW 4K35A 4XDJA 1K34A 4FLXA 1I94B 1LR1A 1RM1C 2E5LO 2HKOA 1FJGB 1M4UA 2EJ7A 4WFAV 2HP8A 3AG3C 3ZHVA 1H2GA 1ZUQA 4B7EA 3OW2U 3K59A 1JQ0A 4FM1A 2ATKC 3B09A 3LDCA 4PJ0Z 5CN0A 1R3IC 5KHIA 5LOVB 2DWEC 1H2LA 3H01A 1AR1B 1SRYA 1LNQA 3CRAA 4PA6A 3ZMZA 3MHHC 4O4LA 2UXBB 3JD1A 4TSFG 1Q43A 4J80A 5JVDA 4YHHO 1OCCC 2ZXWB 1FXHA 2QWOB 1Q3EA 1NU1H 4BIUA 1HWYA 4I9QA 3OE7G 3A2FA 3HB3B 5J9PC 4P9OA 5LHIA 3WG7C 3AG4C 3AG2C 1VQOV 4KL1A 4BAYA 3SJCC 3A0BZ 2DJVA 5HFMA 4D7TA 3K58A 2GHYA 3ETQA 2Y4UA 4IIJB 3L75H 1KKDA 3UKMA 4CS3A 3JAKB 1QR9A 2YXHA 4GX2A 2KQXA 3ZMUA 1MG1A 4IGGA 1ENVA 1VMGA 1SETA 2RQ6A 5KX5A 4DV7B 1CEZA 4D6TH 4I50A 4FZ0A 2ZINA 4IL6Z 2EIMC 1IBLB 2A9HA 1RSOB 2JRIA 2R9AA 3O65A 1R6NA 5KHJA 1HNXO 5IT9N 2HHHO 1OHHG 2EJRA 2PYJA 1MOFA 1N32B 1THZA 1ZX3A 4Q6GA 4FFKA 3ZHQA 3VQXA 3B8PA 1J95A 2W0XA 3ZCCA 4P9PA 2LO1A 5L3EA 3DGEA 2ZQMA 1IURA 3E8GA 3U10A 1PL4A 5A9GA 3DTUB 1KU9A 2ADQB 4FLWA 1KMIZ 5LHGA 4PA9A 4LF5O 3F7VC 3HR0A 4DV0O 2ILMA 1MSWD 4ASUG 1PL0A 5ITZA 3K3WA 4HZ3A 1HNWB 5FNVA 4DV7O 1XNRB 3MD0A 3ZHTA 4HNAB 2ZCEA 5JVDB 3JCZA 4QNHB 4TV9B 2B9ZA 4IHJB 4F6EA 4FFBB 1SERA 3IJ4A 2QM4A 3F5TA 2UUBO 2AXTZ 1AI6A 3R65A 4CC5A 4OPAA 2ZR2A 3CJHA 1AJQA 1QVFU 2LW1A 4H33A 5H9CA 2IM9A 5H6QA 4DR7O 2OCCC 3FYEB 2IJHA 1F23A 4J11A 1V55C 2Q0OC 3SYOA 1JJOA 2ZM6B 5BR8B 3ASNB 3OEHG 3CC4V 4U3FH 2BCCH 1DLBA 5EZYA 1JOYA 1N33B 3RW0A 3G71V 1YI2V 3QF7A 4DV2B 4ZI7A 1K4DC 2GUZA 1L8DA 4IYHA 1VQ4V 1K8AW 2CTWA 2QM8A 2XTAA 3RWRD 3B2EE 4NKGB 1VQNV 1Y76B 1OV9A 1TVKB 2Q5ZA 2AZ2A 1IZ3A 3I56V 1B3QA 5EC2C 1SESA 1WAZA 2ADPA 1FPOA 4OGQB 2Q7HA 4O4JB 1GN2A 3AG4B 3K5OA 1FFXB 2EIKB 1K3EA 3N2GB 2ZDIC 3OMNB 2RN9A 1M56B 3OGIB 4FPPA 1YXBA 1GM9A 2DOSA 2LFSA 2DWDC 4PDMA 4LP8A 3BEHA 1VF6A 4TT3G 4J7ZA 4E4EA 5BXZA 4AI8A 3LDDA 5JJJB 1YTFD 4JI5O 2BTQB 2PY5A 2XT9A 1Y67A 4BR6A 1NVPD 4NTXA 3JAWA 1ZSPA 4YXWG 1M9NA 2CAZC 3K0DA 2JJ2G 1H2SB 4MVOA 5D5PA 3CCLV 4RUEA 1QLEC 2UUAB 4PDLA 2CE4A 5JJEB 4LFCO 3ETEA 3P32A 2VS0A 1SQFA 2RJZA 4JI6B 5KAFZ 2UXDB 2LP7A 4BWAA 4ZIBA 5KMGA 5L3DA 4TUYB 2QKSA 1YSCA 1I08A 1UFIA 1WNSA 1ZAUA 4X62O 1GN4A 3G6BA 2HVKC 1BCCH 1XNRO 2CTRA 5DN6G 3K9SA 4MS2A 2XASA 2KG7A 4CH6A 1GM7A 2CTQA 4JI4O 4UUJC 2WSSG 5GTHZ 4X1IB 1PPJH 4K3AA 1XUQA 3SGIA 3CWBH 2X7RB 1Q82W 4JTAB 2K9PA 1B06A 1DF5A 1QR8A 4K8ZA 1HR0O 4WBNB 2GTAA 4ZBMA 2QR4A 2RMKB 4OPHA 2WLHA 2YC0A 2Y69C 3E83A 3ABTA 2Q67A 4X65O 4DV1B 5LOVA 4UFZA 4UVAA 3DXRB 3STLC 5J2TB 5LP6B 1IBLO 2XHBA 5CA0B 5FNVB 1N34B 4W4KA 2VWJA 1EFRG 4GYCB 4FVMA 4EEQA 4DR5O 5EC1C 2ITCC 4X64O 4ZI7B 3SPHA 3JARB 4DXWA 5BZBA 4FLUA 5EZYB 1G8MA 4ZOLB 4NR1A 5FPRA 1IVSA 1P49A 2YSUB 4R6ZA 3JASA 5EBMC 3UQ8A 1JVMA 1K33A 2IJJA 4JZ2A 5EBLC 2MW2B 4DV0B 5IY5C 4CH5A 1GMGA 4J41A 3ZJZA 2WLIA 5F2VO 4I55B 3OAAG 3K06A 2V4DA 2P6JA 5JQGA 1S77D 1NKDA 2YDEA 4DV4B 4MSWC 2IU3A 5CA1A 4H37A 1NH2D 2UU9O 2AZ0A 1V54B 4EB6B 3CXHF 2WAMA 4QPJA 4Q20A 2IH1C 1NZ6A 2WPDG 5IJ9A 3RVYA 4J42A 2CH7A 2CDYA 3GWOA 2ZE8A 5LXTB 3IAYA 2E5LB 2YEVA 3AG7A 4L87A 1K97A 5GW7A 4JI6O 4MW8A 1FD9A 2V1DA 4GCZA 2E75B 3HKBB 1WA8A 1TGOA 3O9OA 4J9ZB 4GUNA 5GTIZ 3RBZA 1KECA 4UVCA 3JYCA 1J5EB 5IY5B 2X6AA 3WG7B 2DN9A 3W7TA 2R9RB 4ZM5A 1EBOA 1I5XA 2Y4TA 3OTOB 4X20A 3TXSA 4TQFA 3ZHRA 2HJFC 3G67A 1WP7A 1N36O 4Z2WA 1MNGA 1GM8A 4DV3B 1Y66A 3KZIZ 3FYIB 1YJNV 4JI8B 2N04A 4P2ZA 1L1FA 4DR1B 1D5NA 4TV8B 4PI2A 5KX5B 5IYDO 4CH4A 2X0LA 3T2MA 1I94O 2ZM6O 1VQ7V 3SYQA 1Q6HA 4NYKA 4E2HA 1NI8A 1S5JA 2WLJA 1VQKV 1XEQA 3HKEA 3QVNA 2HJDA 2LFRA 3UT5B 3ASOC 3N27A 3L73H 1ZTEA 4NTYA 4TOIA 4LF4B 3ABKC 1E1RG 1DK1A 3R66A 3TXQA 3SJBC 2W6IG 1XBLA 2PYLA 5B5EZ 2WWWA 2UXNA 5HFLA 5KUMA 3H1KH 4R50A 3I55V 2UXBO 1VEWA 3K5NA 5DECA 1R3KC 1F4MA 3CRQA 2H94A 3SJAC 3CD6V 2YIBA 2QDOA 2OCCB 3QO8A 2YXLA 2DYSB 1BZKA 4I7ZB 3DXRA 2JS3A 2Y0IA 1G1XB 1X59A 3ZBHA 3GB7C 3N2GA 4QIWF 1VQMV 5BR8O 3DSQA 2P90A 4MVMA 2LQTA 1JFFA 4DK0A 2YICA 4ZKIA 3W7WA 1Y74A 2IJIA 2QKCA 3VBBA 2GBOA 1Q8IA 3UO3A 1HNWO 1EN6A 4UCSA 3CRRA 4CBCA 3L70H 4I0XA 4DV6B 1US6A 4U3JA 3A0HZ 3E86A 4UB8Z 4YHHB 1FFTB 1G6UA 5EYPB 5L3GA 2LGWA 5DM6V 2UXXA 2ZD9A 3SDLA 2OCHA 3C90A 2P4KA 2Z3YA 3ASOB 1N32O 1KKCA 5IWAB 4MTGA 4DR7B 1AP6A 4MTFA 1RPOA 4TUYA 2ZNJA 3RYHB 1TA8A 3ETGA 3AK2A 1R6KA 4UCOA 2D2CB 4FJCC 1P4RA 4CS4A 4PDVA 3BABA 5K1PA 4YIPA 3CC7V 5B3SB 3IC9A 3CX5F 3T1CA 4WFHA 3JD2A 3A0RA 4QGPA 4H13B 3RGBA 4KUMA 4IYIA 1TUBB 2JK5C 5C93A 1Z2GA 4WFBV 4E2CA 4IIJA 1SQBH 4YY3O 2DMXA 4DUZB 4X1KB 3K04A 3LDEA 3B77A 3LNNA 4QJFB 1NS1A 5EBWC 4LNUA 1I5YA 3CMAV 1GTOA 5EYPA 1OCZC 2ZIOA 4KXRA 2V7QG 3WB2A 4WFGA 3CXCU 1BQZA 1BGYH 2WLMA 4D7SA 3C3SA 2B1GA 2Q69A 3T1YO 2M7WA 2ITDC 1IXMA 3OFNG 2EZPA 4I50B 3X2QC 1FXKB 3E35A 3G6EV 4DK1A 3OR7C 3P3NA 2VWKA 2PUSA 1F51A 1QNMA 2A0LA 3FAVB 4JV5B 3QTCA 3BPZA 3H9VA 4CC6A 2VQEB 2PGGA 1OCRC 5JJNB 1AJPA 1VQ6V 1OCCB 1M93A 1X4TA 1VQPV 3MHSC 3T1HB 1VQ8V 4G27B 1DF4A 4DUYO 3K79A 4ZHQA 1UPGA 2QE7G 1NR1A 5CBHA 2HG5C 1IXBA 1E1QG 2PI5A 4MTXA 4EKWA 2L6LA 1XL4A 1IBKB 3G80A 3HKEB 4LF6B 4X1YB 5LP6C 4B3MO 3JATA 3CJHB 3FAVA 1VIBA 3B40A 1L0LH 1IX9A 1OCZB 4YY3B 4JI0O 4NXNO 3ABUA 4IHJA 1Y6XA 3CCVV 2PI4A 4JI4B 1AI7A 2IU0A 4DV5O 5B1OA 1SZXA 3M7MX 1E79G 4UCUA 3N2KA 4JASA 1EZJA 1WN7A 5LYJA 4JTDB 3H1JH 5IYCO 4HAMA 1K9MW 4FLTA 3CRMA
chains in the Genus database with same CATH topology
2A79B 1ROPA 3ZN0A 4RQEA 3JD4A 5CA3A 2WLHA 1KD1W 2Y69C 3E83A 3EHBB 3IC7A 3ABTA 2EIMB 2Q67A 2W0FC 3D3IA 2Z5UA 2P7TC 5LHHA 1FXVA 1K5QA 2HVJC 4UVAA 3ZRSA 4HYOA 1PKXA 1TUEB 1M57C 2EINC 2DYRC 3STLC 3ZMSA 3AEIA 3JD3A 4TWKA 2Q6AA 2NNUA 3NXSA 3CCEV 2R9IA 3QO5A 1EFRG 2K1EA 1BHBA 5B1AC 4XBFA 3SYCA 5EC1C 3TETA 2ITCC 2XNDG 5FL7G 4UXNA 5B1BB 3SPHA 2EZOA 3E89A 4DXWA 5BZBA 4MVRA 3OMAB 4R7CA 2OT5A 4R8CA 2HFEC 3OUFA 2ZDIA 1G8MA 3OMIB 5LGNA 2B5UA 1JJ2U 1QVGU 1S72V 5B1AB 5LGTA 3SPJA 2X6BA 5CBGA 4UV8A 2WLLB 5KUKA 2HLDG 2Q68A 2YSUB 4R6ZA 5EBMC 2IH3C 3B8NA 1JVMA 4RQFA 1K33A 1MABG 2IJJA 1AROP 4KP4A 1YJ9V 1K4CC 1M57B 2HR3A 4PELA 1NH2B 2IJKA 1DTOA 5EBLC 5IY5C 1H8EG 1GMGA 1WLEA 2WLKA 1YHQV 3ZJZA 3ZMTA 1QBZA 2WLIA 3SYPA 3CCQV 3OAAG 3K06A 2P6JA 1AJNA 3PJSK 1PNMA 1S77D 1NKDA 3CYOA 1GO3F 3CCRV 1JCHA 2IU3A 4MSWC 4H37A 4I5SA 1PNKA 1NH2D 1VQ9V 1V54B 2F43G 2QM7A 3IFXA 5CBFA 4XDJA 2D3OW 1K34A 1S76D 1NQTA 2WAMA 1NBMG 4Q20A 2IH1C 4QPJA 1RM1C 2WPDG 4GX0A 1JX9A 2HKOA 3RVYA 3W7SA 3B8OA 2XAJA 4JGSA 4GT1A 4WFAV 3GWOA 3AG3C 2YEVA 1H2GA 2C2AA 3OW2U 4L87A 1JQ0A 1K97A 5GW7A 4WF9V 4MW8A 2ATKC 2V1DA 4GCZA 2CK3G 3LDCA 3WFVA 5CN0A 1R3IC 1BMFG 4J9ZB 1FXKA 3CP1A 1H8HG 2DWEC 3OR6C 3H01A 1KECA 3RBZA 5L3CA 1W2BU 3AG3B 4UVCA 3JYCA 4RO2A 1SRYA 1LNQA 3B8MA 5IY5B 2X6AA 4PA6A 3ZMZA 3MHHC 3WG7B 1OCRB 2XAQA 3JD1A 3W7TA 2GSMB 4TSFG 2B1IA 1NR7A 2R9RB 4FMTA 4LCUC 4I9WA 1Q81W 1M1KW 4ZM5A 3K9AA 5KA5A 3FB5C 1EBOA 1OCCC 2AHZA 1I5XA 2ZXWB 3K03A 1FXHA 3QNEA 2HJFC 4BIUA 1HWYA 2JEUA 3BY6A 3OE7G 3ETDA 3HB3B 5J9PC 3UM7A 1GM8A 3CCUV 3OGCC 1VQ5V 2OTJV 2OTLV 4MW3A 4P9OA 1Y66A 3ZRWA 1NJIW 5LHIA 3FYIB 3WG7C 2JEXA 1YJNV 3JD0A 3FKSG 4P2ZA 5E1AC 1L1FA 4X8AA 3AG4C 3AG2C 3STZC 1VQOV 3ABMB 3K08A 4U7OA 4BAYA 5CMUA 1Q86W 1COWG 3D36A 5HFMA 5IYDO 3ABKB 2X0LA 2GHYA 3F7YC 3T2MA 3KG2A 4MVSA 1KKDA 1VQ7V 3SYQA 3UKMA 2JIZG 4E2LA 4E2HA 1QR9A 4P30A 2XOKG 3FB6C 4GX2A 2WLJA 1VQKV 2EIJB 2BOCC 2LFRA 3ZMUA 1MG1A 3ASOC 1ENVA 3ABKC 4MVQA 1E1RG 1SETA 2XAHA 2DW4A 2W6IG 1CEZA 1V54C 1R3JC 4JAVA 2WWWA 1RPRA 3T4DA 2UXNA 2EIMC 5HFLA 5KUMA 4JPRA 3CC2V 1AI4A 4R50A 4N23A 4UV9A 3I55V 1G4YB 4BIZA 4WFEA 2A9HA 4G2KA 1R3KC 1F4MA 1R6NA 3LUTB 2H94A 1OHHG 3CD6V 2EJRA 5L3BA 1Y4MA 2OCCB 3QO8A 1MOFA 2DYSB 1THZA 5B3SC 3GB7C 4QIWF 3B8PA 3LSQA 1J95A 1CP9A 3ZCCA 1VQMV 4P9PA 1M90W 5L3EA 2P90A 4MVMA 2QA4V 3DGEA 2ZQMA 4XDLA 4ZKIA 3W7WA 1H38A 3E8GA 2IJIA 4WCEV 3F5WC 4ZM1A 1FXKC 3DTUB 3VBBA 3TCUA 3QO7A 4PA3A 3ZIAG 5LHGA 4PA9A 3F7VC 2EIJC 4JYBA 1MSWD 1BHAA 4ASUG 1PL0A 3K3WA 4HZ3A 1KQSU 4CBCA 3CCSV 5IDJA 3MD0A 3JCZA 4QNHB 3ZRVA 3E86A 4UVBA 3LSSA 1FFTB 1V55B 4LC1A 5L3GA 1SERA 1K92A 3SPCA 5L3FA 2KB1A 2WLIB 4RUFA 1AI6A 3R65A 5DM6V 3W7UA 2UXXA 2ZD9A 2XAFA 1S0VA 2ZR2A 1AJQA 2DQ3A 1QVFU 3E8HA 4H33A 2Z3YA 5H9CA 2JJ1G 5H6QA 3ASOB 2OCCC 3FYEB 3ML0A 3E2EA 2IJHA 1F23A 1V55C 4QE9A 5IYBO 3SYOA 3FB7C 4MTGA 2YEVB 4MTFA 1RPOA 4BW5A 3ASNB 3OEHG 3CC4V 2EIKC 3ETGA 1DLBA 1R6KA 1JOYA 2XAGA 3RW0A 4FJCC 1P4RA 3G4SV 2H8PC 1S3JA 3G71V 2X6CA 3ZN1A 3SPIA 1YI2V 3X2QB 3CPWU 4PDVA 1F4NA 3CC7V 1K4DC 1SZTA 5B3SB 3T1CA 1FS0G 1K8AW 1VQ4V 2QM8A 4WFHA 3JD2A 3A0RA 4MVUA 4KUMA 1VQNV 1ORQC 2AHYA 2JK5C 5H6RA 3ZMVA 5C93A 1AR1B 3SJQC 4F4LA 4WFBV 5EC2C 3I56V 4E2CA 4CZZA 1SESA 1Q7YW 3FB8C 1UJWB 3K04A 3LDEA 3B77A 3RVZA 4QJFB 3AG4B 4J9YB 3AG2B 1XL6A 5EBWC 4Z1MG 2EIKB 1OCOC 3CCJV 1I5YA 1K3EA 4MVZA 3CMAV 2ZDIC 3E8FA 1GTOA 1OZ0A 3OMNB 4JTCB 5B1BC 1OCZC 1M56B 3AG1C 2V7QG 1YTFB 2EILC 4LBEC 2DYSC 4JYCA 4FPPA 1GK9A 1GM9A 4PA4A 2DYRB 1RM1B 4WFGA 4X89A 2LFSA 1CPYA 4GX5A 2WLMA 2DWDC 3CXCU 2ZR3A 4PDMA 4LP8A 3BEHA 3TK1A 4TT3G 2B1GA 2Q69A 2M7WA 4PA7A 1YIJV 2ITDC 5LGUA 3LDDA 1IXMA 1BL8A 3OFNG 2EZPA 1YTFD 3X2QC 1FXKB 3E35A 4OXSA 3AG1B 3G6EV 1K7DA 3SPGA 1NVPD 4FK5C 1PD3A 2JJ2G 1M9NA 4YXWG 3K0DA 3OR7C 4MVOA 2QTOA 2EBOA 2W6JG 1WPXA 3CCLV 2QEXV 4RUEA 1F51A 4E29A 3K0GA 2A0LA 2Y69B 1K5SA 1QLEC 2P67A 3VOUA 4PDLA 3ZRXA 4N21A 3ZRWB 1R3LC 1OCRC 3ETEA 2JDIG 4RAIA 3P30A 3CCMV 1AJPA 1VQ6V 1OCCB 3M99B 3P32A 5KA6A 1JPXA 1M56C 1R73A 3LNMB 1VQPV 4XDKA 3MHSC 2EILB 3SYAA 1VQ8V 3ABLB 4G27B 1DF4A 1QLNA 3K79A 3EFFK 1YITV 1ZWIC 2QE7G 1OCOB 1NR1A 3W7XA 1W0KG 5CBHA 2LP7A 3ABMC 3T4ZA 2HG5C 5L3DA 1E1QG 1YSCA 2QKSA 2PI5A 1K73W 4X88A 4QE7A 1QCEA 4MTXA 2Y48A 5B1NA 4EKWA 1XL4A 1P7BA 1GKFA 2HVKC 2WLNA 1KC8W 5DN6G 1N8RW 1YJWV 3OUSA 2WLLA 4MS2A 4DO2A 1B6QA 1AI5A 2IW5A 1VQLV 2XASA 1QLEB 3CMEV 3OM3B 4KFMA 1S5HC 5EK0A 4G28B 1NVPB 1GM7A 2FTKA 2EINB 4UUJC 2WSSG 3HPLC 1OCZB 3E8BA 4GX1A 3ABUA 4FIPC 3OEEG 3CCVV 2PI4A 1KP3A 3IGAC 2NLJC 4PDRA 4WFFA 1AI7A 4U7NA 2IU0A 5B1OA 4MTOA 3ABLC 2DQ0A 2X7RB 1W0JG 1Q82W 1E79G 3ASNC 1KP2A 4JTAB 4JASA 1DF5A 1EZJA 1QR8A 4JTDB 5IYCO 4HAMA 5LBQA 2BOBC 2MK3A 4QPKA 4ZBMA 1K9MW 4JAUA 1PNLA 4JF3A 4MT8A 2ZXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DLB A;  3CYO A;  3WFV A;  5CN0 A;  2LP7 A;  1Y66 A;  1MG1 A;  4FJC C;  1Y4M A;  3CP1 A;  4N21 A;  4E2C A;  1ENV A;  4FIP C;  1MOF A;  1K34 A;  3H01 A;  1QCE A;  3B8N A;  3P30 A;  3B8M A;  5CMU A;  1K33 A;  5H9C A;  3B8P A;  2M7W A;  3MHH C;  3B8O A;  3M99 B;  5HFM A;  4JGS A;  1SZT A;  3B77 A;  1F23 A;  2EZO A;  2X7R B;  3GWO A;  2EZP A;  1JPX A;  5KA6 A;  3MHS C;  4ZM5 A;  5HFL A;  1DF5 A;  3K9A A;  4JPR A;  1I5Y A;  5KA5 A;  1EBO A;  1QR8 A;  1I5X A;  2OT5 A;  4N23 A;  1JQ0 A;  1DF4 A;  4FK5 C;  4E2L A;  1QR9 A;  4E2H A;  1QBZ A;  4ZM1 A;  4G2K A;  2EBO A;  2MK3 A;  2P6J A;  4E29 A;  4JF3 A; 
#chains in the Genus database with same CATH topology
 3BA8 A;  3JD4 A;  2Q73 A;  5LA6 B;  1ZL8 A;  3AK1 A;  2W0F C;  3ICX A;  3BRC A;  1XOU A;  2VQF B;  3L74 H;  3JAR A;  4DYL A;  1Q6U A;  2DYR C;  3D8C A;  3CRC A;  2KKW A;  2XUM A;  2Q6A A;  4I0X B;  5LXT A;  3NXS A;  4DV3 O;  4GKJ O;  3H1H H;  2R9I A;  1WPB A;  3QO5 A;  2K1E A;  1WB8 A;  4LFA B;  4XBF A;  3WU2 Z;  4YIO A;  1FKA O;  1DGS A;  2GV9 A;  4UXN A;  1D2D A;  2EZO A;  3E89 A;  3L9D A;  4DR3 B;  4O2A B;  1LUW A;  3OMA B;  4R7C A;  4R8C A;  2HFE C;  3OUF A;  3OMI B;  5K1X A;  5LGN A;  4GLX A;  4O4I A;  4AHC A;  2M6Y A;  1L0N H;  5JWP A;  1I7F A;  4UV8 A;  5KUK A;  3HKC A;  1XMO O;  1FYJ A;  5CB4 A;  2IH3 C;  1I0H A;  1ARO P;  5FLX N;  2Q0A A;  4PEL A;  1QQC A;  5BMV B;  1H8E G;  1WLE A;  2WLK A;  1YHQ V;  2UUA O;  1ZL8 B;  3ZMT A;  1WB7 A;  1QBZ A;  3TGU H;  2Q9L A;  1PM9 A;  3RT3 C;  2FML A;  4GZR B;  3CCR V;  1JCH A;  4I5S A;  1VQ9 V;  5CBF A;  4EFE A;  1NBM G;  2BE3 A;  3W7S A;  2GDS A;  3B8O A;  2XAJ A;  4JGS A;  4GT1 A;  4X66 B;  2QWP B;  4YJ3 A;  3MAQ A;  1HP8 A;  2C2A A;  4UCT A;  5JH7 A;  4DW0 A;  2YI9 A;  2CK3 G;  1NT2 B;  3WFV A;  1BMF G;  5KMG B;  1FXK A;  4GKK B;  4RO2 A;  4FFB A;  1OCR B;  4JI7 O;  4DR6 B;  5IJ0 A;  2GSM B;  1NR7 A;  4LCU C;  4I9W A;  1MZE A;  3K9A A;  3FB5 C;  4UB6 Z;  3QNE A;  2VQE O;  2JEU A;  1XQ8 A;  4A5U B;  3ETD A;  2OWO A;  2Q7E A;  3UM7 A;  1WP8 A;  3CCU V;  1N34 O;  2OTJ V;  2OTL V;  4MW3 A;  1NJI W;  1SA0 A;  3ZRW A;  4LFA O;  4B7K A;  4X8A A;  2R72 A;  3ABM B;  1COW G;  3D36 A;  4X1I A;  3ABK B;  3KG2 A;  4MVS A;  4LFB B;  3BHP A;  1XNQ O;  2PTM A;  3OTF A;  1XDC A;  1XHZ A;  3QG5 A;  4P30 A;  3FB6 C;  3JAL A;  1XIL A;  3RYF A;  5FPO A;  2CH7 B;  5KLV H;  1GN6 A;  2BOC C;  4O4I B;  4NXM B;  4KHP O;  1IBK O;  4RWU A;  2DW4 A;  1R3J C;  4TV8 A;  1KB9 F;  1GN3 A;  1FFX A;  2UUC B;  4JPR A;  3CC2 V;  3J7A U;  4JI3 O;  1SQG A;  4WFE A;  1VP7 A;  4G2K A;  2NR5 A;  4GKJ B;  4LF7 B;  3OTO O;  2QGN A;  5L3B A;  1Y4M A;  2UU9 B;  4LR3 A;  1N0J A;  3HKD A;  1H2M A;  1CP9 A;  1QU7 A;  4O2B B;  4XDL A;  2F4V B;  4X1K A;  1XNQ B;  4WCE V;  3JAW B;  3J81 N;  4ZM1 A;  3BA9 A;  1Q5O A;  3QO7 A;  4PA3 A;  1SQP H;  2JGD A;  4NXM O;  2YS8 A;  2EIJ C;  1JR9 A;  3THO A;  1KQS U;  1J5E O;  1T5E A;  5LP6 A;  4B3S B;  3FFQ A;  1RP3 B;  4BIO A;  4UVB A;  1URF A;  4O4H B;  2KB1 A;  2WLI B;  3BCC H;  5BY1 A;  3W7U A;  1JFF B;  4LWS B;  2LJ2 A;  3B4S A;  4O4J A;  2XAF A;  5GON B;  1S0V A;  3JAT B;  3RYH A;  4DR3 O;  2JJ1 G;  4JI0 B;  4NXN B;  3ML0 A;  3E2E A;  4QE9 A;  2H3O A;  5JH7 B;  3FB7 C;  4HNA A;  3CE2 A;  3WB0 A;  4WBN A;  4J7J A;  4NB5 A;  4OX9 B;  1AP5 A;  4L8J A;  2EUL A;  2EIK C;  3RYC B;  2ZIM A;  2FL4 A;  2P06 A;  2XAG A;  4EFB A;  3CSX A;  2H8P C;  2X6C A;  3X2Q B;  3CPW U;  2F66 C;  4FLV A;  1F4N A;  5AG2 A;  1SF9 A;  3CB2 A;  1B04 A;  5LMU B;  1Q90 D;  4B3S O;  4H0L B;  4MVU A;  1AR4 A;  1ORQ C;  5LMN O;  5H6R A;  2YI8 A;  4F4L A;  1AVM A;  4LH7 A;  2AGA A;  4TQD A;  4X66 O;  4DV4 O;  3FB8 C;  1UJW B;  3I5D A;  3RVZ A;  4LWS A;  2JVD A;  3AG2 B;  1XL6 A;  4Z1M G;  3E22 A;  1OCO C;  1R1B A;  3E8F A;  4JTC B;  1OZ0 A;  2CGO A;  2JS5 A;  2VRZ A;  1HNZ B;  1YTF B;  2EIL C;  4LBE C;  2P22 C;  1CPY A;  4GX5 A;  3T1Y B;  2ZR3 A;  1N33 O;  3JAM N;  3TK1 A;  4LF6 O;  1VF6 C;  1YIJ V;  1BL8 A;  1YCI A;  4OXS A;  3AG1 B;  1K7D A;  3ZHS A;  2Z0A A;  1PD3 A;  3H1L H;  2UXC B;  1IBM B;  1D5A A;  2QTO A;  2EBO A;  2W6J G;  1WPX A;  2QEX V;  3K0G A;  1F7Y A;  2Y69 B;  1K5S A;  2P67 A;  3VOU A;  4JYY A;  1SA0 B;  3H1I H;  4N21 A;  3ZRW B;  3HKD B;  1N36 B;  1VF7 A;  4JV5 O;  2JDI G;  4RAI A;  5IJ9 B;  5KA6 A;  1JPX A;  1M56 C;  1R73 A;  3LNM B;  2CGN A;  4NVP A;  4XDK A;  5CA1 B;  2EIL B;  4O4L B;  1QLN A;  3EFF K;  1ZWI C;  3W7X A;  1XMQ O;  3OT7 A;  1EM1 A;  2OIE A;  2ARH A;  4QE7 A;  1QCE A;  1PV0 A;  2LGQ A;  2Y48 A;  5B1N A;  5IYZ A;  1P7B A;  1YDX A;  4LF4 O;  2QWN B;  1N8R W;  3OUS A;  4DO2 A;  1B6Q A;  1AI5 A;  1VQL V;  4J10 A;  1QLE B;  1TAE A;  4F6R B;  4PI0 A;  3CME V;  3NR7 A;  4KFM A;  2WA4 A;  5EK0 A;  3ZS8 C;  4AQY B;  4G28 B;  2FTK A;  2EIN B;  1AR5 A;  5H5N A;  4GX1 A;  4FIP C;  1JMK C;  3LSU A;  2BTQ A;  4PDR A;  4WFF A;  4U7N A;  2F1M A;  4MTO A;  3K57 A;  1ZLZ A;  5BMV A;  4B3T O;  2JGU A;  5CA0 A;  1RFY A;  1BE3 H;  5LBQ A;  4EB6 A;  2MK3 A;  4QPK A;  1FAF A;  4JAU A;  4JF3 A;  1KUQ A;  4FZ1 A;  1EZV H;  3CS5 A;  5CA3 A;  4I55 A;  3EHB B;  4I4T B;  3IC7 A;  4KHP B;  3D3I A;  3VQW A;  1AIL A;  5LMU O;  2BSK B;  1FXV A;  1K5Q A;  2HVJ C;  2A7W A;  3ZED A;  1EN5 A;  2EIN C;  3ZMS A;  2VQF O;  5LL6 Y;  1VF5 B;  3AEI A;  4TWK A;  4FM2 A;  2NNU A;  1Y76 A;  4DR2 B;  1SS3 A;  3CCE V;  1FJG O;  5J2U B;  1BHB A;  5B1A C;  3KCY A;  4PV1 B;  4ABM A;  3TET A;  5B1B B;  4CS2 A;  4OX9 O;  1YEW A;  3EXA A;  2F23 A;  2YXY A;  2ZDI A;  2FB5 A;  4O2B A;  1XMQ B;  4YJ2 B;  3RYC A;  1JJ2 U;  4F6R A;  2ETN A;  5LGT A;  3FD9 A;  2X6B A;  5CBG A;  2HLD G;  2Q68 A;  2YID A;  4UCV A;  4LF8 B;  5IYZ B;  1MAB G;  1YJ9 V;  1NH2 B;  2IJK A;  1KYO F;  4Z1V A;  5TIS Z;  2OYQ A;  1BSM A;  4I4T A;  2ZE6 A;  3M8A A;  4NTW A;  4AQY O;  3ZHU A;  3CCQ V;  2HEP A;  1PNM A;  4LF9 O;  3CYO A;  1EN4 A;  1MMM A;  1YVW A;  1PNK A;  3CHX A;  3IFX A;  2F43 G;  2QM7 A;  4JI2 B;  4DR1 O;  1S76 D;  1NQT A;  4UCR A;  4GX0 A;  3EVK A;  3GVM A;  1JX9 A;  3K5M A;  5ITZ B;  3RYF B;  2QWQ B;  3RYI A;  2F4V O;  4DR4 B;  5H2F Z;  2Q7G A;  4WF9 V;  3APQ A;  1SQX H;  2E74 B;  3CP1 A;  1H8H G;  2QWR B;  3OR6 C;  5L3C A;  2KG7 B;  5LA6 A;  1W2B U;  3AG3 B;  4J7K A;  3B8M A;  1BT8 A;  3RYI B;  3U0Z A;  5JCO A;  2XAQ A;  2B1I A;  1M1K W;  4FMT A;  1Q81 W;  3CEI A;  5KA5 A;  2AHZ A;  3K03 A;  2HHH B;  1WJZ A;  3K5L A;  1PP9 H;  5LYJ B;  2Q8V A;  1SQQ H;  3BY6 A;  3VQY A;  3OGC C;  4LF9 B;  1VQ5 V;  2JEX A;  1YF2 A;  3JD0 A;  3FKS G;  5E1A C;  1SKV A;  4LFB O;  3STZ C;  3K08 A;  4U7O A;  5CMU A;  1Q86 W;  4DUZ O;  3F7Y C;  2ZKO A;  3JAS B;  4DR4 O;  2JIZ G;  2YIB D;  4E2L A;  3JCU Z;  2XOK G;  2EIJ B;  1HDJ A;  2RNB A;  4MVQ A;  2XAH A;  1P7G A;  5D5Q A;  1V54 C;  2N05 A;  4JAV A;  2ZT9 B;  1RPR A;  3T4D A;  4GKK O;  1AI4 A;  4N23 A;  4UV9 A;  1G4Y B;  4BIZ A;  4JI7 B;  5J2U A;  4B3R B;  2YIA A;  3KCX A;  2WA3 A;  3LUT B;  3JSL A;  4DR5 B;  5B3S C;  4FLZ A;  4JI8 O;  4K0K O;  1S5L Z;  2EX3 A;  2ZE5 A;  3LSQ A;  3E22 B;  2BSK A;  1M90 W;  1Z5V A;  2QA4 V;  5GON A;  1NTK H;  2GTS A;  4DV5 B;  1H38 A;  4FM0 A;  2P5O A;  3F5W C;  4O2A A;  1FXK C;  4HBN A;  4O4H A;  3A8T A;  5KHG A;  3TCU A;  1U96 A;  4JI1 B;  1IDS A;  3SR2 C;  1TVK A;  3ZIA G;  4DW1 A;  5KAI Z;  4PD4 F;  4JYB A;  2UXD O;  1BHA A;  3MDS A;  3CCS V;  2FKX A;  5IDJ A;  3BVO A;  2GUZ B;  3L71 H;  3ZRV A;  1IBM O;  1QHT A;  3LSS A;  4LC1 A;  1V55 B;  3APO A;  4B3R O;  1K92 A;  3SPC A;  5L3F A;  5C8Y B;  4RUF A;  4JI3 B;  3VQV A;  3WB1 A;  4LH6 A;  1VAR A;  3JSN A;  2DQ3 A;  3E8H A;  2PZS A;  4BW9 A;  1WA8 B;  2N74 A;  3HKB A;  1XHX A;  5IYB O;  2RDC A;  1AB3 A;  3HKC B;  2YEV B;  2P4V A;  4C7U A;  4BW5 A;  4B3T B;  1H2K A;  4JYA O;  1R6T A;  2LW7 A;  1A32 A;  2AW9 A;  3G4S V;  1S3J A;  3ZN1 A;  3SPI A;  3UCS C;  1BQ0 A;  5EIB D;  5KHK A;  4X9Q A;  5A2Q N;  5JQG B;  3ZX6 A;  3C3T A;  1SZT A;  1XMO B;  1FS0 G;  2F93 B;  5E79 Z;  4DV6 O;  3U11 A;  4W4L A;  5JCO C;  2A3Q A;  1N4C A;  4B3M B;  4X1Y A;  2AHY A;  2CTP A;  3JAL B;  2JGD B;  4JZG A;  3ZMV A;  1MA1 A;  3SJQ C;  4CZZ A;  1Q7Y W;  3AK3 A;  4ZOL A;  2L35 A;  4JAA A;  4J9Y B;  4FLY A;  5C8Y A;  3RFR A;  1SQV H;  2YUA A;  3CCJ V;  1W59 A;  4MVZ A;  4DUY B;  1H2N A;  5B1B C;  2NN4 A;  1Z5W A;  3AG1 C;  1N0N A;  2DYS C;  4JYC A;  1GK9 A;  4PA4 A;  4X62 B;  2DYR B;  1RM1 B;  4X89 A;  4JYA B;  4IT5 A;  3UT5 A;  3KKY A;  1O9H A;  1RSO A;  4B08 A;  4JI5 B;  3BAA A;  4X65 B;  2QKA A;  4H44 B;  4PA7 A;  5LGU A;  2QSA A;  1GAX A;  1MZF A;  1SC5 B;  2ZE7 A;  3SPG A;  4DRX B;  1XI1 A;  2R70 A;  2E3C A;  4FK5 C;  2A06 H;  4E29 A;  2UUB B;  3ZRX A;  1R3L C;  4YJ3 B;  3P3P A;  5LMN B;  2QJ1 A;  1MSD A;  3JAK A;  3P30 A;  3CCM V;  1GRJ A;  2CUG A;  3M99 B;  1NTM H;  1HR0 B;  3S3X A;  4LFC B;  3SYA A;  3TJT A;  3ABL B;  4LNU B;  1YIT V;  3D3Q A;  2DE0 X;  1OCO B;  4LF5 B;  1W0K G;  3ABM C;  3T4Z A;  1K73 W;  4X88 A;  3DC5 A;  1GKF A;  2WLN A;  4DV2 O;  1Q6I A;  1U97 A;  3DC6 A;  5CB4 B;  1KC8 W;  5IJ0 B;  1YJW V;  4DR6 O;  2WLL A;  2IW5 A;  4AIL C;  3L72 H;  4DR2 O;  2RCV A;  1V9P A;  3OM3 B;  1S5H C;  2OIG A;  2UUC O;  1NVP B;  2Y0P A;  3RN4 A;  4K0K B;  3HPL C;  3E8B A;  4DRX A;  3J80 N;  3OEE G;  4K8X A;  4TV9 A;  1KP3 A;  3IGA C;  2NLJ C;  3D36 C;  4ICG A;  3PN1 A;  1P84 F;  2DQ0 A;  3ABL C;  1W0J G;  2ODM A;  3ASN C;  1KP2 A;  2G38 A;  2E76 B;  2PF4 E;  3T1H O;  4X20 B;  3OD4 A;  2BOB C;  3BFR A;  4LF8 O;  2QTS A;  1PNL A;  4MT8 A;  2ZXW C;  2A79 B;  1ROP A;  1YZB A;  4CH3 A;  1BS3 A;  1GH6 A;  3ZN0 A;  4RQE A;  4DV1 O;  1KD1 W;  3Q4H A;  4YJ2 A;  2EIM B;  5B66 Z;  2Z5U A;  2P7T C;  5LHH A;  3ZRS A;  4HYO A;  1PKX A;  1OJH A;  1JA8 A;  1TUE B;  1M57 C;  4U3J B;  5EIB C;  3JD3 A;  2UXC O;  1TUB A;  3FX7 A;  1HNX B;  3N2K B;  3S3W A;  3SYC A;  5IWA O;  2XND G;  5J2T A;  5FL7 G;  1HNZ O;  2F95 B;  2O57 A;  4X64 B;  4MVR A;  2OT5 A;  1Y74 B;  1XRE A;  2B5U A;  1QVG U;  1S72 V;  5B1A B;  3SPJ A;  3UO2 A;  2WLL B;  2ZNI A;  1LUV A;  2FYU H;  4JI1 O;  3B8N A;  3GWK C;  4RQF A;  4KP4 A;  1HW7 A;  1K4C C;  1M57 B;  2HR3 A;  1O9G A;  1M5I A;  2Q4P A;  1NTZ H;  2IBZ H;  1DTO A;  4PHZ A;  3Q4H B;  1CXZ B;  3SYP A;  4ZHQ B;  4JI2 O;  2BTO A;  1AJN A;  3PJS K;  1KBH A;  2KSD A;  5KHH A;  1GO3 F;  4LF7 O;  5DED A;  5IE9 A;  2D3O W;  4K35 A;  4XDJ A;  1K34 A;  4FLX A;  1I94 B;  1LR1 A;  1RM1 C;  2E5L O;  2HKO A;  1FJG B;  1M4U A;  2EJ7 A;  4WFA V;  2HP8 A;  3AG3 C;  3ZHV A;  1H2G A;  1ZUQ A;  4B7E A;  3OW2 U;  3K59 A;  1JQ0 A;  4FM1 A;  2ATK C;  3B09 A;  3LDC A;  4PJ0 Z;  5CN0 A;  1R3I C;  5KHI A;  5LOV B;  2DWE C;  1H2L A;  3H01 A;  1AR1 B;  1SRY A;  1LNQ A;  3CRA A;  4PA6 A;  3ZMZ A;  3MHH C;  4O4L A;  2UXB B;  3JD1 A;  4TSF G;  1Q43 A;  4J80 A;  5JVD A;  4YHH O;  1OCC C;  2ZXW B;  1FXH A;  2QWO B;  1Q3E A;  1NU1 H;  4BIU A;  1HWY A;  4I9Q A;  3OE7 G;  3A2F A;  3HB3 B;  5J9P C;  4P9O A;  5LHI A;  3WG7 C;  3AG4 C;  3AG2 C;  1VQO V;  4KL1 A;  4BAY A;  3SJC C;  3A0B Z;  2DJV A;  5HFM A;  4D7T A;  3K58 A;  2GHY A;  3ETQ A;  2Y4U A;  4IIJ B;  3L75 H;  1KKD A;  3UKM A;  4CS3 A;  3JAK B;  1QR9 A;  2YXH A;  4GX2 A;  2KQX A;  3ZMU A;  1MG1 A;  4IGG A;  1ENV A;  1VMG A;  1SET A;  2RQ6 A;  5KX5 A;  4DV7 B;  1CEZ A;  4D6T H;  4I50 A;  4FZ0 A;  2ZIN A;  4IL6 Z;  2EIM C;  1IBL B;  2A9H A;  1RSO B;  2JRI A;  2R9A A;  3O65 A;  1R6N A;  5KHJ A;  1HNX O;  5IT9 N;  2HHH O;  1OHH G;  2EJR A;  2PYJ A;  1MOF A;  1N32 B;  1THZ A;  1ZX3 A;  4Q6G A;  4FFK A;  3ZHQ A;  3VQX A;  3B8P A;  1J95 A;  2W0X A;  3ZCC A;  4P9P A;  2LO1 A;  5L3E A;  3DGE A;  2ZQM A;  1IUR A;  3E8G A;  3U10 A;  1PL4 A;  5A9G A;  3DTU B;  1KU9 A;  2ADQ B;  4FLW A;  1KMI Z;  5LHG A;  4PA9 A;  4LF5 O;  3F7V C;  3HR0 A;  4DV0 O;  2ILM A;  1MSW D;  4ASU G;  1PL0 A;  5ITZ A;  3K3W A;  4HZ3 A;  1HNW B;  5FNV A;  4DV7 O;  1XNR B;  3MD0 A;  3ZHT A;  4HNA B;  2ZCE A;  5JVD B;  3JCZ A;  4QNH B;  4TV9 B;  2B9Z A;  4IHJ B;  4F6E A;  4FFB B;  1SER A;  3IJ4 A;  2QM4 A;  3F5T A;  2UUB O;  2AXT Z;  1AI6 A;  3R65 A;  4CC5 A;  4OPA A;  2ZR2 A;  3CJH A;  1AJQ A;  1QVF U;  2LW1 A;  4H33 A;  5H9C A;  2IM9 A;  5H6Q A;  4DR7 O;  2OCC C;  3FYE B;  2IJH A;  1F23 A;  4J11 A;  1V55 C;  2Q0O C;  3SYO A;  1JJO A;  2ZM6 B;  5BR8 B;  3ASN B;  3OEH G;  3CC4 V;  4U3F H;  2BCC H;  1DLB A;  5EZY A;  1JOY A;  1N33 B;  3RW0 A;  3G71 V;  1YI2 V;  3QF7 A;  4DV2 B;  4ZI7 A;  1K4D C;  2GUZ A;  1L8D A;  4IYH A;  1VQ4 V;  1K8A W;  2CTW A;  2QM8 A;  2XTA A;  3RWR D;  3B2E E;  4NKG B;  1VQN V;  1Y76 B;  1OV9 A;  1TVK B;  2Q5Z A;  2AZ2 A;  1IZ3 A;  3I56 V;  1B3Q A;  5EC2 C;  1SES A;  1WAZ A;  2ADP A;  1FPO A;  4OGQ B;  2Q7H A;  4O4J B;  1GN2 A;  3AG4 B;  3K5O A;  1FFX B;  2EIK B;  1K3E A;  3N2G B;  2ZDI C;  3OMN B;  2RN9 A;  1M56 B;  3OGI B;  4FPP A;  1YXB A;  1GM9 A;  2DOS A;  2LFS A;  2DWD C;  4PDM A;  4LP8 A;  3BEH A;  1VF6 A;  4TT3 G;  4J7Z A;  4E4E A;  5BXZ A;  4AI8 A;  3LDD A;  5JJJ B;  1YTF D;  4JI5 O;  2BTQ B;  2PY5 A;  2XT9 A;  1Y67 A;  4BR6 A;  1NVP D;  4NTX A;  3JAW A;  1ZSP A;  4YXW G;  1M9N A;  2CAZ C;  3K0D A;  2JJ2 G;  1H2S B;  4MVO A;  5D5P A;  3CCL V;  4RUE A;  1QLE C;  2UUA B;  4PDL A;  2CE4 A;  5JJE B;  4LFC O;  3ETE A;  3P32 A;  2VS0 A;  1SQF A;  2RJZ A;  4JI6 B;  5KAF Z;  2UXD B;  2LP7 A;  4BWA A;  4ZIB A;  5KMG A;  5L3D A;  4TUY B;  2QKS A;  1YSC A;  1I08 A;  1UFI A;  1WNS A;  1ZAU A;  4X62 O;  1GN4 A;  3G6B A;  2HVK C;  1BCC H;  1XNR O;  2CTR A;  5DN6 G;  3K9S A;  4MS2 A;  2XAS A;  2KG7 A;  4CH6 A;  1GM7 A;  2CTQ A;  4JI4 O;  4UUJ C;  2WSS G;  5GTH Z;  4X1I B;  1PPJ H;  4K3A A;  1XUQ A;  3SGI A;  3CWB H;  2X7R B;  1Q82 W;  4JTA B;  2K9P A;  1B06 A;  1DF5 A;  1QR8 A;  4K8Z A;  1HR0 O;  4WBN B;  2GTA A;  4ZBM A;  2QR4 A;  2RMK B;  4OPH A;  2WLH A;  2YC0 A;  2Y69 C;  3E83 A;  3ABT A;  2Q67 A;  4X65 O;  4DV1 B;  5LOV A;  4UFZ A;  4UVA A;  3DXR B;  3STL C;  5J2T B;  5LP6 B;  1IBL O;  2XHB A;  5CA0 B;  5FNV B;  1N34 B;  4W4K A;  2VWJ A;  1EFR G;  4GYC B;  4FVM A;  4EEQ A;  4DR5 O;  5EC1 C;  2ITC C;  4X64 O;  4ZI7 B;  3SPH A;  3JAR B;  4DXW A;  5BZB A;  4FLU A;  5EZY B;  1G8M A;  4ZOL B;  4NR1 A;  5FPR A;  1IVS A;  1P49 A;  2YSU B;  4R6Z A;  3JAS A;  5EBM C;  3UQ8 A;  1JVM A;  1K33 A;  2IJJ A;  4JZ2 A;  5EBL C;  2MW2 B;  4DV0 B;  5IY5 C;  4CH5 A;  1GMG A;  4J41 A;  3ZJZ A;  2WLI A;  5F2V O;  4I55 B;  3OAA G;  3K06 A;  2V4D A;  2P6J A;  5JQG A;  1S77 D;  1NKD A;  2YDE A;  4DV4 B;  4MSW C;  2IU3 A;  5CA1 A;  4H37 A;  1NH2 D;  2UU9 O;  2AZ0 A;  1V54 B;  4EB6 B;  3CXH F;  2WAM A;  4QPJ A;  4Q20 A;  2IH1 C;  1NZ6 A;  2WPD G;  5IJ9 A;  3RVY A;  4J42 A;  2CH7 A;  2CDY A;  3GWO A;  2ZE8 A;  5LXT B;  3IAY A;  2E5L B;  2YEV A;  3AG7 A;  4L87 A;  1K97 A;  5GW7 A;  4JI6 O;  4MW8 A;  1FD9 A;  2V1D A;  4GCZ A;  2E75 B;  3HKB B;  1WA8 A;  1TGO A;  3O9O A;  4J9Z B;  4GUN A;  5GTI Z;  3RBZ A;  1KEC A;  4UVC A;  3JYC A;  1J5E B;  5IY5 B;  2X6A A;  3WG7 B;  2DN9 A;  3W7T A;  2R9R B;  4ZM5 A;  1EBO A;  1I5X A;  2Y4T A;  3OTO B;  4X20 A;  3TXS A;  4TQF A;  3ZHR A;  2HJF C;  3G67 A;  1WP7 A;  1N36 O;  4Z2W A;  1MNG A;  1GM8 A;  4DV3 B;  1Y66 A;  3KZI Z;  3FYI B;  1YJN V;  4JI8 B;  2N04 A;  4P2Z A;  1L1F A;  4DR1 B;  1D5N A;  4TV8 B;  4PI2 A;  5KX5 B;  5IYD O;  4CH4 A;  2X0L A;  3T2M A;  1I94 O;  2ZM6 O;  1VQ7 V;  3SYQ A;  1Q6H A;  4NYK A;  4E2H A;  1NI8 A;  1S5J A;  2WLJ A;  1VQK V;  1XEQ A;  3HKE A;  3QVN A;  2HJD A;  2LFR A;  3UT5 B;  3ASO C;  3N27 A;  3L73 H;  1ZTE A;  4NTY A;  4TOI A;  4LF4 B;  3ABK C;  1E1R G;  1DK1 A;  3R66 A;  3TXQ A;  3SJB C;  2W6I G;  1XBL A;  2PYL A;  5B5E Z;  2WWW A;  2UXN A;  5HFL A;  5KUM A;  3H1K H;  4R50 A;  3I55 V;  2UXB O;  1VEW A;  3K5N A;  5DEC A;  1R3K C;  1F4M A;  3CRQ A;  2H94 A;  3SJA C;  3CD6 V;  2YIB A;  2QDO A;  2OCC B;  3QO8 A;  2YXL A;  2DYS B;  1BZK A;  4I7Z B;  3DXR A;  2JS3 A;  2Y0I A;  1G1X B;  1X59 A;  3ZBH A;  3GB7 C;  3N2G A;  4QIW F;  1VQM V;  5BR8 O;  3DSQ A;  2P90 A;  4MVM A;  2LQT A;  1JFF A;  4DK0 A;  2YIC A;  4ZKI A;  3W7W A;  1Y74 A;  2IJI A;  2QKC A;  3VBB A;  2GBO A;  1Q8I A;  3UO3 A;  1HNW O;  1EN6 A;  4UCS A;  3CRR A;  4CBC A;  3L70 H;  4I0X A;  4DV6 B;  1US6 A;  4U3J A;  3A0H Z;  3E86 A;  4UB8 Z;  4YHH B;  1FFT B;  1G6U A;  5EYP B;  5L3G A;  2LGW A;  5DM6 V;  2UXX A;  2ZD9 A;  3SDL A;  2OCH A;  3C90 A;  2P4K A;  2Z3Y A;  3ASO B;  1N32 O;  1KKC A;  5IWA B;  4MTG A;  4DR7 B;  1AP6 A;  4MTF A;  1RPO A;  4TUY A;  2ZNJ A;  3RYH B;  1TA8 A;  3ETG A;  3AK2 A;  1R6K A;  4UCO A;  2D2C B;  4FJC C;  1P4R A;  4CS4 A;  4PDV A;  3BAB A;  5K1P A;  4YIP A;  3CC7 V;  5B3S B;  3IC9 A;  3CX5 F;  3T1C A;  4WFH A;  3JD2 A;  3A0R A;  4QGP A;  4H13 B;  3RGB A;  4KUM A;  4IYI A;  1TUB B;  2JK5 C;  5C93 A;  1Z2G A;  4WFB V;  4E2C A;  4IIJ A;  1SQB H;  4YY3 O;  2DMX A;  4DUZ B;  4X1K B;  3K04 A;  3LDE A;  3B77 A;  3LNN A;  4QJF B;  1NS1 A;  5EBW C;  4LNU A;  1I5Y A;  3CMA V;  1GTO A;  5EYP A;  1OCZ C;  2ZIO A;  4KXR A;  2V7Q G;  3WB2 A;  4WFG A;  3CXC U;  1BQZ A;  1BGY H;  2WLM A;  4D7S A;  3C3S A;  2B1G A;  2Q69 A;  3T1Y O;  2M7W A;  2ITD C;  1IXM A;  3OFN G;  2EZP A;  4I50 B;  3X2Q C;  1FXK B;  3E35 A;  3G6E V;  4DK1 A;  3OR7 C;  3P3N A;  2VWK A;  2PUS A;  1F51 A;  1QNM A;  2A0L A;  3FAV B;  4JV5 B;  3QTC A;  3BPZ A;  3H9V A;  4CC6 A;  2VQE B;  2PGG A;  1OCR C;  5JJN B;  1AJP A;  1VQ6 V;  1OCC B;  1M93 A;  1X4T A;  1VQP V;  3MHS C;  3T1H B;  1VQ8 V;  4G27 B;  1DF4 A;  4DUY O;  3K79 A;  4ZHQ A;  1UPG A;  2QE7 G;  1NR1 A;  5CBH A;  2HG5 C;  1IXB A;  1E1Q G;  2PI5 A;  4MTX A;  4EKW A;  2L6L A;  1XL4 A;  1IBK B;  3G80 A;  3HKE B;  4LF6 B;  4X1Y B;  5LP6 C;  4B3M O;  3JAT A;  3CJH B;  3FAV A;  1VIB A;  3B40 A;  1L0L H;  1IX9 A;  1OCZ B;  4YY3 B;  4JI0 O;  4NXN O;  3ABU A;  4IHJ A;  1Y6X A;  3CCV V;  2PI4 A;  4JI4 B;  1AI7 A;  2IU0 A;  4DV5 O;  5B1O A;  1SZX A;  3M7M X;  1E79 G;  4UCU A;  3N2K A;  4JAS A;  1EZJ A;  1WN7 A;  5LYJ A;  4JTD B;  3H1J H;  5IYC O;  4HAM A;  1K9M W;  4FLT A;  3CRM A; 
#chains in the Genus database with same CATH homology
 2A79 B;  1ROP A;  3ZN0 A;  4RQE A;  3JD4 A;  5CA3 A;  2WLH A;  1KD1 W;  2Y69 C;  3E83 A;  3EHB B;  3IC7 A;  3ABT A;  2EIM B;  2Q67 A;  2W0F C;  3D3I A;  2Z5U A;  2P7T C;  5LHH A;  1FXV A;  1K5Q A;  2HVJ C;  4UVA A;  3ZRS A;  4HYO A;  1PKX A;  1TUE B;  1M57 C;  2EIN C;  2DYR C;  3STL C;  3ZMS A;  3AEI A;  3JD3 A;  4TWK A;  2Q6A A;  2NNU A;  3NXS A;  3CCE V;  2R9I A;  3QO5 A;  1EFR G;  2K1E A;  1BHB A;  5B1A C;  4XBF A;  3SYC A;  5EC1 C;  3TET A;  2ITC C;  2XND G;  5FL7 G;  4UXN A;  5B1B B;  3SPH A;  2EZO A;  3E89 A;  4DXW A;  5BZB A;  4MVR A;  3OMA B;  4R7C A;  2OT5 A;  4R8C A;  2HFE C;  3OUF A;  2ZDI A;  1G8M A;  3OMI B;  5LGN A;  2B5U A;  1JJ2 U;  1QVG U;  1S72 V;  5B1A B;  5LGT A;  3SPJ A;  2X6B A;  5CBG A;  4UV8 A;  2WLL B;  5KUK A;  2HLD G;  2Q68 A;  2YSU B;  4R6Z A;  5EBM C;  2IH3 C;  3B8N A;  1JVM A;  4RQF A;  1K33 A;  1MAB G;  2IJJ A;  1ARO P;  4KP4 A;  1YJ9 V;  1K4C C;  1M57 B;  2HR3 A;  4PEL A;  1NH2 B;  2IJK A;  1DTO A;  5EBL C;  5IY5 C;  1H8E G;  1GMG A;  1WLE A;  2WLK A;  1YHQ V;  3ZJZ A;  3ZMT A;  1QBZ A;  2WLI A;  3SYP A;  3CCQ V;  3OAA G;  3K06 A;  2P6J A;  1AJN A;  3PJS K;  1PNM A;  1S77 D;  1NKD A;  3CYO A;  1GO3 F;  3CCR V;  1JCH A;  2IU3 A;  4MSW C;  4H37 A;  4I5S A;  1PNK A;  1NH2 D;  1VQ9 V;  1V54 B;  2F43 G;  2QM7 A;  3IFX A;  5CBF A;  4XDJ A;  2D3O W;  1K34 A;  1S76 D;  1NQT A;  2WAM A;  1NBM G;  4Q20 A;  2IH1 C;  4QPJ A;  1RM1 C;  2WPD G;  4GX0 A;  1JX9 A;  2HKO A;  3RVY A;  3W7S A;  3B8O A;  2XAJ A;  4JGS A;  4GT1 A;  4WFA V;  3GWO A;  3AG3 C;  2YEV A;  1H2G A;  2C2A A;  3OW2 U;  4L87 A;  1JQ0 A;  1K97 A;  5GW7 A;  4WF9 V;  4MW8 A;  2ATK C;  2V1D A;  4GCZ A;  2CK3 G;  3LDC A;  3WFV A;  5CN0 A;  1R3I C;  1BMF G;  4J9Z B;  1FXK A;  3CP1 A;  1H8H G;  2DWE C;  3OR6 C;  3H01 A;  1KEC A;  3RBZ A;  5L3C A;  1W2B U;  3AG3 B;  4UVC A;  3JYC A;  4RO2 A;  1SRY A;  1LNQ A;  3B8M A;  5IY5 B;  2X6A A;  4PA6 A;  3ZMZ A;  3MHH C;  3WG7 B;  1OCR B;  2XAQ A;  3JD1 A;  3W7T A;  2GSM B;  4TSF G;  2B1I A;  1NR7 A;  2R9R B;  4FMT A;  4LCU C;  4I9W A;  1Q81 W;  1M1K W;  4ZM5 A;  3K9A A;  5KA5 A;  3FB5 C;  1EBO A;  1OCC C;  2AHZ A;  1I5X A;  2ZXW B;  3K03 A;  1FXH A;  3QNE A;  2HJF C;  4BIU A;  1HWY A;  2JEU A;  3BY6 A;  3OE7 G;  3ETD A;  3HB3 B;  5J9P C;  3UM7 A;  1GM8 A;  3CCU V;  3OGC C;  1VQ5 V;  2OTJ V;  2OTL V;  4MW3 A;  4P9O A;  1Y66 A;  3ZRW A;  1NJI W;  5LHI A;  3FYI B;  3WG7 C;  2JEX A;  1YJN V;  3JD0 A;  3FKS G;  4P2Z A;  5E1A C;  1L1F A;  4X8A A;  3AG4 C;  3AG2 C;  3STZ C;  1VQO V;  3ABM B;  3K08 A;  4U7O A;  4BAY A;  5CMU A;  1Q86 W;  1COW G;  3D36 A;  5HFM A;  5IYD O;  3ABK B;  2X0L A;  2GHY A;  3F7Y C;  3T2M A;  3KG2 A;  4MVS A;  1KKD A;  1VQ7 V;  3SYQ A;  3UKM A;  2JIZ G;  4E2L A;  4E2H A;  1QR9 A;  4P30 A;  2XOK G;  3FB6 C;  4GX2 A;  2WLJ A;  1VQK V;  2EIJ B;  2BOC C;  2LFR A;  3ZMU A;  1MG1 A;  3ASO C;  1ENV A;  3ABK C;  4MVQ A;  1E1R G;  1SET A;  2XAH A;  2DW4 A;  2W6I G;  1CEZ A;  1V54 C;  1R3J C;  4JAV A;  2WWW A;  1RPR A;  3T4D A;  2UXN A;  2EIM C;  5HFL A;  5KUM A;  4JPR A;  3CC2 V;  1AI4 A;  4R50 A;  4N23 A;  4UV9 A;  3I55 V;  1G4Y B;  4BIZ A;  4WFE A;  2A9H A;  4G2K A;  1R3K C;  1F4M A;  1R6N A;  3LUT B;  2H94 A;  1OHH G;  3CD6 V;  2EJR A;  5L3B A;  1Y4M A;  2OCC B;  3QO8 A;  1MOF A;  2DYS B;  1THZ A;  5B3S C;  3GB7 C;  4QIW F;  3B8P A;  3LSQ A;  1J95 A;  1CP9 A;  3ZCC A;  1VQM V;  4P9P A;  1M90 W;  5L3E A;  2P90 A;  4MVM A;  2QA4 V;  3DGE A;  2ZQM A;  4XDL A;  4ZKI A;  3W7W A;  1H38 A;  3E8G A;  2IJI A;  4WCE V;  3F5W C;  4ZM1 A;  1FXK C;  3DTU B;  3VBB A;  3TCU A;  3QO7 A;  4PA3 A;  3ZIA G;  5LHG A;  4PA9 A;  3F7V C;  2EIJ C;  4JYB A;  1MSW D;  1BHA A;  4ASU G;  1PL0 A;  3K3W A;  4HZ3 A;  1KQS U;  4CBC A;  3CCS V;  5IDJ A;  3MD0 A;  3JCZ A;  4QNH B;  3ZRV A;  3E86 A;  4UVB A;  3LSS A;  1FFT B;  1V55 B;  4LC1 A;  5L3G A;  1SER A;  1K92 A;  3SPC A;  5L3F A;  2KB1 A;  2WLI B;  4RUF A;  1AI6 A;  3R65 A;  5DM6 V;  3W7U A;  2UXX A;  2ZD9 A;  2XAF A;  1S0V A;  2ZR2 A;  1AJQ A;  2DQ3 A;  1QVF U;  3E8H A;  4H33 A;  2Z3Y A;  5H9C A;  2JJ1 G;  5H6Q A;  3ASO B;  2OCC C;  3FYE B;  3ML0 A;  3E2E A;  2IJH A;  1F23 A;  1V55 C;  4QE9 A;  5IYB O;  3SYO A;  3FB7 C;  4MTG A;  2YEV B;  4MTF A;  1RPO A;  4BW5 A;  3ASN B;  3OEH G;  3CC4 V;  2EIK C;  3ETG A;  1DLB A;  1R6K A;  1JOY A;  2XAG A;  3RW0 A;  4FJC C;  1P4R A;  3G4S V;  2H8P C;  1S3J A;  3G71 V;  2X6C A;  3ZN1 A;  3SPI A;  1YI2 V;  3X2Q B;  3CPW U;  4PDV A;  1F4N A;  3CC7 V;  1K4D C;  1SZT A;  5B3S B;  3T1C A;  1FS0 G;  1K8A W;  1VQ4 V;  2QM8 A;  4WFH A;  3JD2 A;  3A0R A;  4MVU A;  4KUM A;  1VQN V;  1ORQ C;  2AHY A;  2JK5 C;  5H6R A;  3ZMV A;  5C93 A;  1AR1 B;  3SJQ C;  4F4L A;  4WFB V;  5EC2 C;  3I56 V;  4E2C A;  4CZZ A;  1SES A;  1Q7Y W;  3FB8 C;  1UJW B;  3K04 A;  3LDE A;  3B77 A;  3RVZ A;  4QJF B;  3AG4 B;  4J9Y B;  3AG2 B;  1XL6 A;  5EBW C;  4Z1M G;  2EIK B;  1OCO C;  3CCJ V;  1I5Y A;  1K3E A;  4MVZ A;  3CMA V;  2ZDI C;  3E8F A;  1GTO A;  1OZ0 A;  3OMN B;  4JTC B;  5B1B C;  1OCZ C;  1M56 B;  3AG1 C;  2V7Q G;  1YTF B;  2EIL C;  4LBE C;  2DYS C;  4JYC A;  4FPP A;  1GK9 A;  1GM9 A;  4PA4 A;  2DYR B;  1RM1 B;  4WFG A;  4X89 A;  2LFS A;  1CPY A;  4GX5 A;  2WLM A;  2DWD C;  3CXC U;  2ZR3 A;  4PDM A;  4LP8 A;  3BEH A;  3TK1 A;  4TT3 G;  2B1G A;  2Q69 A;  2M7W A;  4PA7 A;  1YIJ V;  2ITD C;  5LGU A;  3LDD A;  1IXM A;  1BL8 A;  3OFN G;  2EZP A;  1YTF D;  3X2Q C;  1FXK B;  3E35 A;  4OXS A;  3AG1 B;  3G6E V;  1K7D A;  3SPG A;  1NVP D;  4FK5 C;  1PD3 A;  2JJ2 G;  1M9N A;  4YXW G;  3K0D A;  3OR7 C;  4MVO A;  2QTO A;  2EBO A;  2W6J G;  1WPX A;  3CCL V;  2QEX V;  4RUE A;  1F51 A;  4E29 A;  3K0G A;  2A0L A;  2Y69 B;  1K5S A;  1QLE C;  2P67 A;  3VOU A;  4PDL A;  3ZRX A;  4N21 A;  3ZRW B;  1R3L C;  1OCR C;  3ETE A;  2JDI G;  4RAI A;  3P30 A;  3CCM V;  1AJP A;  1VQ6 V;  1OCC B;  3M99 B;  3P32 A;  5KA6 A;  1JPX A;  1M56 C;  1R73 A;  3LNM B;  1VQP V;  4XDK A;  3MHS C;  2EIL B;  3SYA A;  1VQ8 V;  3ABL B;  4G27 B;  1DF4 A;  1QLN A;  3K79 A;  3EFF K;  1YIT V;  1ZWI C;  2QE7 G;  1OCO B;  1NR1 A;  3W7X A;  1W0K G;  5CBH A;  2LP7 A;  3ABM C;  3T4Z A;  2HG5 C;  5L3D A;  1E1Q G;  1YSC A;  2QKS A;  2PI5 A;  1K73 W;  4X88 A;  4QE7 A;  1QCE A;  4MTX A;  2Y48 A;  5B1N A;  4EKW A;  1XL4 A;  1P7B A;  1GKF A;  2HVK C;  2WLN A;  1KC8 W;  5DN6 G;  1N8R W;  1YJW V;  3OUS A;  2WLL A;  4MS2 A;  4DO2 A;  1B6Q A;  1AI5 A;  2IW5 A;  1VQL V;  2XAS A;  1QLE B;  3CME V;  3OM3 B;  4KFM A;  1S5H C;  5EK0 A;  4G28 B;  1NVP B;  1GM7 A;  2FTK A;  2EIN B;  4UUJ C;  2WSS G;  3HPL C;  1OCZ B;  3E8B A;  4GX1 A;  3ABU A;  4FIP C;  3OEE G;  3CCV V;  2PI4 A;  1KP3 A;  3IGA C;  2NLJ C;  4PDR A;  4WFF A;  1AI7 A;  4U7N A;  2IU0 A;  5B1O A;  4MTO A;  3ABL C;  2DQ0 A;  2X7R B;  1W0J G;  1Q82 W;  1E79 G;  3ASN C;  1KP2 A;  4JTA B;  4JAS A;  1DF5 A;  1EZJ A;  1QR8 A;  4JTD B;  5IYC O;  4HAM A;  5LBQ A;  2BOB C;  2MK3 A;  4QPK A;  4ZBM A;  1K9M W;  4JAU A;  1PNL A;  4JF3 A;  4MT8 A;  2ZXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...