4E2LA

Crystal structure of the periplasmic domain of mutant fepe lps o-antigen chain length regulator protein
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
262
structure length
240
Chain Sequence
WTSAAVVTPPEPVQWQELEKTFTKLRVLDLDIKIDRTEAFNLFIKKFQSVSLLEEYLRSSPYVMDQLDLHRAIVALSEKMKAVDDSLYTSWTLSFTAPTSEEAQTVLSGYIDYISALVVKESIENVRNKLEIKTQFEKEKLAQDRIKMKNQLDANIQRLNYSLDIANAAGIKKPVDPDFSISLGADGIERKLEIEKAVTDVAELNGELRNRQYLVEQLTKANINDVNFTPFKYQLSPSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferric enterobactin (Enterochelin) transport
publication title Structural Characterization of Closely Related O-antigen Lipopolysaccharide (LPS) Chain Length Regulators.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 73
structure length 240
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature
pdb deposition date 2012-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4e2lA02
3.30.1890.10 Alpha Beta 2-Layer Sandwich Bacterial polysaccharide co-polymerase-like FepE-like 4e2lA01
1Y4MA 1DF5A 4ZM1A 2EZOA 1JQ0A 3MHHC 1SZTA 3GWOA 4FJCC 4E2HA 4JF3A 1QR8A 2X7RB 3B8OA 3P30A 5CMUA 4JGSA 5KA5A 5HFMA 1MOFA 3B8PA 3H01A 1K33A 3WFVA 2EBOA 4ZM5A 1I5XA 4N21A 1Y66A 3K9AA 1K34A 1JPXA 1QBZA 4FIPC 3M99B 5CN0A 5KA6A 1QR9A 1ENVA 1EBOA 4E2CA 1DF4A 3B8NA 2OT5A 3B8MA 1I5YA 2EZPA 4JPRA 4E29A 3B77A 4E2LA 1DLBA 3MHSC 3CP1A 4FK5C 2LP7A 2M7WA 2MK3A 3CYOA 5HFLA 1F23A 5H9CA 4N23A 1MG1A 4G2KA 1QCEA 2P6JA
chains in the Genus database with same CATH superfamily
3BPZA 2NLJC 1VQLV 2UXBB 1RPRA 4AHCA 4QNHB 2ARHA 3ETQA 1FXKB 2DYSC 4RAIA 5EBWC 4XDKA 1SZXA 4TV8B 5TISZ 2UXNA 1Q86W 4YJ2A 3JD3A 4LP8A 2LFSA 3ZRVA 1XNQO 3Q4HB 3CC2V 3H1KH 4NXMB 1VQ4V 3OR6C 1PNLA 3BHPA 3ABUA 4EFBA 1DK1A 1EN6A 3CCUV 2P90A 3AG4B 4KHPO 4FIPC 1OCZC 2UUAO 2GTSA 1J5EO 1T5EA 2B5UA 3K04A 3L73H 3UO3A 2QR4A 1QLEB 4R7CA 1ZWIC 1QCEA 2P6JA 3PN1A 4JTDB 1VIBA 1YITV 3ZHQA 5GW7A 1K7DA 1RSOB 3CXHF 1SRYA 4JI2B 4B7KA 3ZMTA 1B3QA 4X65O 4O2BB 2E76B 2WA4A 3E86A 1BCCH 1H2KA 4B3MB 1FD9A 1W59A 1YVWA 2MK3A 1DGSA 2GHYA 2LO1A 4RQFA 2YIBD 2DJVA 1WA8B 1YJNV 3C3SA 3GB7C 5B1OA 1GRJA 2WLHA 1QR8A 5KHJA 3B8OA 5FNVA 1JOYA 2JJ2G 2WLIB 3FYEB 3D3QA 4K0KB 3SPIA 3B8NA 2UXDO 2WLLB 5JH7A 1Y76A 1M4UA 4CC5A 1M56B 5GONA 3UKMA 2ZR3A 4ZI7B 2LGQA 3JAWB 4DUYB 1X59A 2YEVA 4O4LB 4JI0B 1SQPH 2RCVA 1XHZA 5KMGB 4OXSA 4DR2B 2EINB 4X66B 4QIWF 1V54B 4WBNA 3S3WA 3I55V 4WFGA 1XMQO 5JVDA 3CE2A 1D5AA 1KQSU 2GUZB 2E5LB 2DYRB 2ZXWC 3ZHSA 3C3TA 4EEQA 1LUWA 4KP4A 1DF5A 3GWOA 2XAJA 2R9AA 1TUEB 2HLDG 5A9GA 1ORQC 4F4LA 1GTOA 1ZLZA 4UCVA 3CRRA 4ZHQA 1FFXA 3L75H 1WLEA 4W4KA 2R9IA 2PUSA 4GX0A 4J7ZA 2XAFA 3OGCC 4G2KA 4NB5A 3MHHC 3CWBH 4P9OA 3UT5A 4UV8A 4J9YB 4O4JA 1NTKH 1AI6A 3SYOA 3KZIZ 3OD4A 3QO8A 2K9PA 1QBZA 4MTXA 2JK5C 2QWRB 3RT3C 1VARA 5KUMA 3CP1A 4U7OA 3QG5A 4EB6B 2ZQMA 2Q7GA 2UU9O 2CK3G 1NH2B 5E1AC 1E79G 4D6TH 4D7SA 5HFMA 1HDJA 1Y67A 1HNXO 2OTJV 1PKXA 4X64O 1AJNA 4HBNA 1TAEA 4CZZA 4J10A 5GTHZ 4I9WA 1YIJV 2DOSA 1KP3A 3H9VA 1SQVH 1AJQA 4I4TA 1KBHA 1Q82W 1GO3F 2EIJC 1MG1A 4DR4B 5JQGA 2C2AA 4GYCB 4TV9A 5DECA 2VQEB 1L0NH 2FKXA 3N2KA 2B1IA 2FB5A 3A8TA 2PF4E 4BR6A 1S0VA 4XDJA 1OCRB 2GDSA 4TSFG 4DUZB 2BOCC 5H9CA 2RNBA 1M1KW 4IGGA 1R6TA 1JQ0A 4PDRA 3X2QB 3M8AA 3HPLC 2Y4UA 1KC8W 3JD0A 3B09A 2UUBO 1W2BU 2HKOA 5LMUO 2E74B 4PDMA 3K5NA 4FLXA 2R72A 2ZE6A 4DV5O 2UUCO 3BEHA 4LR3A 5A2QN 4YJ2B 2M6YA 1R6KA 1Q5OA 4B3SO 5BZBA 3G4SV 3P30A 1FXHA 2EBOA 1FXKC 1PV0A 4F6EA 1BHAA 3K5LA 2V7QG 2ZCEA 4DV2O 1N8RW 4K8ZA 3K0GA 1R6NA 2Y69B 2QJ1A 5B1AB 1AVMA 4J7KA 1LNQA 3WU2Z 1HNZO 4UCRA 1OHHG 2YC0A 2AZ2A 3K5OA 1NR7A 1VQNV 3SR2C 4I9QA 2IH1C 1KUQA 1VQ8V 3OMNB 4NTYA 1KD1W 3JAKA 5L3BA 2ZE8A 3T1HO 1VQ6V 3AG4C 3UCSC 4KHPB 2KB1A 1VEWA 3I5DA 2UUAB 3B8MA 1J5EB 4E29A 4LH6A 3CSXA 1O9GA 3IFXA 5J2TA 1NBMG 4FLZA 1Q6HA 1QLEC 1SF9A 1XUQA 2EILB 1M5IA 5IDJA 1FXKA 3ETEA 3LDDA 2ZT9B 4LBEC 3B4SA 1B04A 4PA6A 1O9HA 4B7EA 3O9OA 1OCZB 3LSQA 3SJCC 1XMOB 4NXNB 4U3FH 3DSQA 1ZUQA 3K03A 2JIZG 2H3OA 4J80A 1PP9H 1D2DA 3CRQA 5HFLA 4Z1MG 1Y76B 4N23A 2B9ZA 2JGUA 3HB3B 5GONB 4AQYO 4QPJA 3WB2A 4JF3A 4TQDA 3AG1C 1AI4A 2YEVB 5KX5A 3CPWU 5CA1A 3ETGA 4N21A 1AI5A 1Q7YW 1COWG 4LWSA 2ZDIC 3L71H 5C8YA 2UXDB 4WBNB 4OPHA 3BFRA 4DV3O 3ABKB 3LNMB 5JVDB 2PTMA 1FKAO 1YDXA 4EKWA 4DV6O 4LF5O 4ZM1A 4LFBB 1EN4A 1OCCC 3RBZA 1GH6A 1K33A 4NVPA 1JJOA 1NS1A 1AROP 2CGOA 1P4RA 2JVDA 4JAAA 4LF8O 3ZBHA 4RWUA 2DYRC 1YZBA 5EBMC 1XBLA 4U3JB 4YHHO 4DR5O 1I08A 4FLUA 4CH3A 5CBFA 2WLIA 3UT5B 1CEZA 2DWDC 2F1MA 2ZDIA 3JCUZ 4O4JB 2QGNA 5FPRA 2IJJA 4HZ3A 1JCHA 1GN3A 4LF4B 4DO2A 1WAZA 4ZI7A 2KG7A 2QKCA 3JAWA 3TCUA 1XEQA 1NTZH 3SPCA 3H1LH 3KCYA 4MVSA 3R66A 1PPJH 5IJ0B 5KMGA 3OMAB 4LFCO 1SS3A 3OMIB 4J7JA 4PI0A 2P7TC 3TXQA 1JA8A 3UO2A 4FFBA 3JD2A 3P3NA 1EN5A 4YJ3B 1VQMV 1ZX3A 4FLWA 4JI1B 4O4IA 3E35A 2WA3A 2UU9B 4LF6O 2W0FC 5CA3A 1TVKB 3MD0A 5JQGB 1S76D 5B1NA 2Q0AA 3SYQA 1VF7A 2DE0X 3A0HZ 4TV9B 1M9NA 4PA7A 2DQ3A 3N2KB 1HNXB 4X64B 4JI4O 1Q6UA 5IWAO 3HKDB 3D3IA 1WB8A 1JX9A 3JASB 2MW2B 3OGIB 3APOA 4UB8Z 3AG3B 1KKDA 4TOIA 1LR1A 2Q68A 4OPAA 1UFIA 5KHKA 1YI2V 4F6RA 2ZM6B 2A3QA 4NR1A 4MVQA 4JI7O 1IXMA 1OCRC 2WLMA 4Q20A 3OAAG 2JS5A 3BABA 4GX2A 2EIJB 2X6BA 4X62O 3X2QC 3ABLC 3P3PA 2AGAA 5GTIZ 4LF7B 3B8PA 2HP8A 4CH5A 1AR1B 1GMGA 1I7FA 2UUBB 2P5OA 5LMUB 3QO7A 1GKFA 4DV5B 2Q67A 2UUCB 5EC2C 4FLYA 4PA4A 1L8DA 1KB9F 4BWAA 3JD4A 4DK0A 2W6IG 2X6CA 4DV4O 3DXRB 5L3DA 4ASUG 2YXHA 3CCLV 3ML0A 4DV2B 2Y69C 1F4NA 2XUMA 5BR8O 5B1AC 3FAVB 4YY3B 2Q7EA 4H0LB 2P06A 5LMNO 1HR0O 4MSWC 3SDLA 5J2TB 2NN4A 5BY1A 1GN6A 2BCCH 3L9DA 2Q4PA 2KSDA 3GVMA 3SYCA 5CN0A 4PJ0Z 5LYJA 3T1HB 4GKJO 4ZKIA 1V9PA 1BGYH 3CC4V 4LF9O 1KU9A 3D8CA 1F4MA 1SC5B 1XNRO 4QJFB 3FB8C 4CS2A 1K8AW 5K1XA 2IH3C 4I55B 5LP6C 2EILC 1L0LH 1NKDA 4JI8B 3RVZA 4XBFA 1AR5A 3L74H 2JJ1G 3W7XA 4DV0O 1R3KC 1RM1B 5KX5B 4JI3O 1K3EA 5CA1B 4MTGA 3AK3A 4LWSB 2HHHO 2VRZA 3OUFA 2Y4TA 5C8YB 3T4ZA 1Q90D 1IBKB 2ADQB 2PI5A 2JRIA 4AQYB 1W0KG 1SQQH 4P2ZA 5LBQA 3NXSA 3K0DA 4CBCA 2D3OW 4MVRA 3WFVA 2E3CA 2Z3YA 1YJ9V 2FMLA 2FL4A 2QWNB 5J2UA 1Z5VA 2AZ0A 3FX7A 2ZNJA 4MW3A 1YEWA 4IYIA 4MVZA 4E4EA 5LP6A 2X0LA 3RYHB 3ABKC 4UCTA 3K9SA 4LF5B 3AG1B 5L3FA 2F23A 3LNNA 3WG7C 2X6AA 4B08A 4GT1A 1JPXA 2F4VO 2ZINA 4ABMA 5LL6Y 1QU7A 3R65A 2EIMC 2OCCB 4LF8B 1XREA 3CRCA 4TQFA 1YXBA 3EHBB 2KG7B 1OCCB 1NI8A 1E1RG 1K92A 3TETA 4OX9B 2IU3A 1BMFG 3RWRD 2HVKC 2XTAA 3ABTA 2N05A 4FZ1A 2YIDA 4BW5A 2OIEA 2RN9A 1K97A 5JJJB 1H8HG 2VQFO 4E2CA 1DF4A 1TUBA 4CS3A 4FFBB 4CH6A 2RQ6A 1JJ2U 4DV7O 2YXLA 4FFKA 4O4IB 5DN6G 2W6JG 2BSKB 3PJSK 2RDCA 4P9PA 2GV9A 1FXVA 2ZE7A 4H44B 3STZC 4LFCB 3OW2U 1G6UA 5IYZB 2L6LA 2OWOA 5F2VO 3AG7A 3NR7A 5L3GA 2W0XA 2ZD9A 1MSDA 1DLBA 2H8PC 4U3JA 3L70H 4TT3G 4UCUA 5LHGA 4LF6B 3WB0A 3CCJV 1ROPA 2YDEA 3RVYA 3CEIA 3E89A 4U7NA 2WLJA 3FKSG 1H8EG 4DV1O 1PL0A 4JI4B 4F6RB 5IWAB 1BQ0A 2O57A 1N33O 5JJNB 1THZA 5ITZA 1NJIW 4CH4A 5IJ0A 3OTOO 3OFNG 1SESA 3AG3C 2JEXA 3A2FA 1Q81W 1NVPB 5EYPB 3E8BA 3DC6A 3JSNA 4UVBA 1GN4A 4YJ3A 2QSAA 2XAQA 4KXRA 4LFAO 1V55C 1CP9A 3CCQV 5BXZA 1ENVA 2CTPA 2YICA 3B40A 2WLKA 1TVKA 4X62B 4JYYA 2Z0AA 1SZTA 2QM7A 5KUKA 3I56V 4QGPA 3K59A 1R3LC 4I0XA 4X1KA 4JYBA 1N36O 3CMAV 4QE7A 2V4DA 3HKDA 4DYLA 4G27B 1I94B 3OEEG 4B3RO 3JASA 5FL7G 3ABLB 1P7GA 1RPOA 2EIKB 4X89A 3F7YC 3HKCA 3JCZA 1WN7A 4O2AB 1H38A 4JI6O 1G8MA 4DV4B 2ODMA 1UJWB 3E22A 3ZN1A 2WLNA 5LYJB 4DR3O 2R70A 5BR8B 3G80A 2ITDC 1WPBA 4J42A 2EZOA 5LMNB 1HR0B 3VQYA 1AILA 1VQ5V 1BL8A 2DN9A 4Z1VA 5CA0A 1BT8A 1PM9A 5JCOA 3SJQC 1NH2D 4UCSA 2QKAA 3BVOA 4GKJB 3JATA 4ZBMA 2WSSG 2CTQA 2DMXA 4LF9B 2IW5A 1XNRB 2CAZC 1FFTB 3LSUA 1IXBA 3QVNA 1XNQB 3BRCA 3VBBA 2X7RB 4BIUA 3DXRA 3IC9A 1B06A 5B1BB 1UPGA 1RM1C 3ZRSA 5KAIZ 4JI3B 3T1YO 2QTOA 4DR1O 5J2UB 2F43G 3EFFK 3FAVA 2YUAA 2HHHB 5EC1C 1I94O 2ZIMA 2IM9A 5LP6B 1YJWV 2ATKC 3VQXA 3D36C 4RO2A 2RMKB 2YIBA 3EVKA 1PD3A 2P4VA 1BSMA 1Q3EA 3RYFA 3M99B 4X65B 3O65A 1S3JA 1BHBA 2DW4A 4X1YA 4I55A 4R50A 1BQZA 1R3JC 5IYDO 4JASA 4I5SA 5JJEB 5B3SC 2LW1A 5EK0A 5J9PC 2XT9A 3RFRA 3ZMUA 1TA8A 1MNGA 2F4VB 2EULA 2D2CB 1F51A 3G6BA 1K4CC 1TUBB 2OCCC 4TUYA 4I50A 2HR3A 3D36A 4ICGA 5LGTA 1H2NA 4R8CA 1N34O 5IY5B 1IVSA 4XDLA 1SQBH 3FYIB 1NT2B 2LFRA 3CXCU 1YHQV 4JI2O 4UXNA 3WG7B 1KYOF 3DTUB 5DEDA 4JI5O 3AK2A 4FZ0A 2VQFB 4B3MO 2EIMB 4JPRA 5C93A 3RYHA 1XMQB 1CXZB 3ASOB 2BTQA 3AG2B 4EFEA 3W7TA 4DV7B 3VOUA 1RFYA 1FS0G 1J95A 3JYCA 3ZHTA 2LQTA 2XAHA 3QF7A 2Q69A 1S5HC 3CRAA 5B5EZ 3UM7A 4IT5A 1YTFB 2LP7A 3P32A 1Q8IA 4NYKA 1ZAUA 1FPOA 3OM3B 1SKVA 1S5LZ 3J7AU 4IIJA 4JI0O 5IE9A 5ITZB 3ZX6A 3CCMV 2WAMA 1HP8A 4PDVA 1Q43A 4HAMA 3DGEA 5L3EA 1BZKA 4X8AA 1VMGA 4IL6Z 4DV1B 5CBGA 1I5YA 4CC6A 1YF2A 2V1DA 2NNUA 1N33B 4BIZA 2QWQB 3F5WC 4J11A 2BSKA 4PELA 4JTCB 3OTOB 1EZVH 4JTAB 1JVMA 2G38A 5IYZA 1K5SA 2ETNA 3SPJA 3WB1A 1I0HA 4ZIBA 4I0XB 4X1KB 2YXYA 3K5MA 4PDLA 2YS8A 4FK5C 2FTKA 1XL6A 3IC7A 4GZRB 1N0NA 5E79Z 1OJHA 1IDSA 4FM0A 2KQXA 4JGSA 5FLXN 2VWKA 3H1IH 3H01A 3L72H 4RUEA 3HKCB 2VWJA 2QM8A 3ZHRA 3K9AA 4PV1B 1NR1A 1N36B 3EXAA 1KKCA 2OT5A 3K06A 3FB7C 2QE7G 1V55B 1QVGU 5IJ9A 3E22B 1H2SB 4IHJA 1Y4MA 3SYAA 4B3RB 2E75B 2UXCO 1S5JA 1SQGA 3E2EA 5IYBO 5H6RA 2ZIOA 2EIKC 4FM1A 1YTFD 5EYPA 5LOVB 3S3XA 2CUGA 4JI6B 1ZL8B 5CA0B 2WWWA 4WF9V 2HEPA 3ASNC 3STLC 4DR3B 4J9ZB 3JATB 4ZOLA 2VQEO 3JALB 1MOFA 1WJZA 5EZYA 2EX3A 2QDOA 4B3SB 3CCEV 1H2MA 1MABG 4UVCA 4Z2WA 2IJIA 1VP7A 1ZTEA 3CCSV 2EZPA 3TJTA 1FJGO 3IGAC 2XOKG 3SGIA 1HW7A 1SQFA 3CX5F 4UUJC 1HNZB 3W7WA 1XDCA 1BS3A 4O2AA 4LC1A 3ABMC 5KLVH 1VQ7V 3QTCA 4NKGB 5JWPA 3A0BZ 4GKKO 1IX9A 5B1BC 3G6EV 1GM8A 1KMIZ 1QVFU 4AI8A 1EBOA 4UFZA 4X20A 3RYFB 4DR1B 4WFHA 1U97A 3ZMVA 2P67A 4X1YB 1PL4A 4WFAV 2N04A 4Q6GA 1P49A 1XQ8A 3LDEA 1N0JA 5FPOA 2LJ2A 1K4DC 2VS0A 2GBOA 1NU1H 3KG2A 3C90A 3RYCA 3OTFA 4K3AA 2CDYA 1AP5A 4P30A 2M7WA 2RJZA 5L3CA 1X4TA 4TUYB 4I50B 4BAYA 4KFMA 1M93A 1EM1A 4DRXA 5B66Z 1MA1A 4G28B 4B3TO 4DK1A 1EZJA 1OV9A 4RQEA 1IURA 3RYIB 1SA0B 3SPHA 2Y0IA 4C7UA 1HWYA 1P84F 1NZ6A 1S77D 3CC7V 1XILA 3AEIA 3H1HH 4DV3B 3BA9A 1N34B 1LUVA 1R1BA 2BTQB 5IY5C 5B3SB 4DV6B 1GK9A 1D5NA 4CS4A 2XASA 3QO5A 4FLVA 4HYOA 1XMOO 4NXNO 4MTFA 4LNUA 4H13B 4JI5B 3LDCA 3E8FA 2Q5ZA 4UCOA 3HKBA 4JZ2A 4KL1A 3OT7A 2CTWA 5H6QA 4MTOA 3H1JH 3K3WA 3ASOC 3AG2C 1MSWD 4IIJB 4YHHB 4DR5B 2A7WA 5EBLC 3BY6A 4JV5O 4OGQB 3B2EE 2HJDA 5KA6A 2JS3A 4YXWG 2PYJA 3A0RA 4NTWA 3IAYA 4JYAO 4LFBO 2QM4A 5KHGA 2A06H 2ZE5A 1VQ9V 5IT9N 1MZFA 3K79A 2HJFC 2QEXV 5LXTA 3CJHA 3K58A 4FVMA 1TGOA 1K9MW 2Q73A 3RW0A 4DR7O 4YIOA 5LGUA 4X9QA 3OUSA 2DQ0A 3ICXA 1Z2GA 3ZHUA 3ZRXA 1U96A 1N32O 1R3IC 3TGUH 2Q0OC 1FYJA 2NR5A 3N2GA 5CBHA 3M7MX 4LF4O 2WPDG 3LSSA 2AW9A 3B77A 1AR4A 4MVUA 3T4DA 3E83A 3SJBC 1XOUA 5CMUA 5IJ9B 5EIBC 3UQ8A 4DR6O 3JARB 3ZEDA 4IHJB 3J80N 5LA6B 4D7TA 1WB7A 1BE3H 2AHZA 4BIOA 4BW9A 4H33A 4JI1O 4DW0A 2Q7HA 2ADPA 2Z5UA 5BMVB 5KHIA 4JI7B 4X1IA 3ZRWA 3GWKC 2UXCB 4ZOLB 4WCEV 2QWOB 2JGDA 3CS5A 1XI1A 5KA5A 3CHXA 4K35A 4YIPA 3W7SA 5EZYB 2CGNA 5JCOC 1HNWO 5LHHA 1WP7A 4E2LA 2QWPB 4QE9A 1M57B 3E8HA 3QNEA 2OTLV 1OCOB 4GUNA 5LGNA 1JFFB 4E2HA 2IBZH 5H5NA 1AP6A 3F7VC 5AG2A 1M90W 1IBMO 2ILMA 1L1FA 2CH7A 3AK1A 2OCHA 2ZR2A 2ZM6O 4GLXA 2JEUA 3ZMSA 3SYPA 1F7YA 4LCUC 1VF6C 3ZN0A 1H2LA 3ASNB 3CYOA 1FJGB 4QPKA 4X20B 2IJHA 1SETA 1PNMA 4FJCC 4LF7O 4NTXA 2R9RB 3T1CA 2F95B 5LOVA 1IBLO 2YI8A 4GCZA 1ZL8A 3MAQA 4HNAA 1VQKV 1Y66A 5CB4A 1K34A 1P7BA 2P22C 1US6A 3TXSA 2Q9LA 4GKKB 2HFEC 3RYCB 4PD4F 1CPYA 2F93B 3APQA 1VF5B 1WP8A 3MDSA 4W4LA 1NVPD 2PZSA 3JALA 3CCRV 4PA3A 3JSLA 3ABMB 4DRXB 1QHTA 2EJ7A 4GX5A 4X88A 4DV0B 1VF6A 4JAUA 4PA9A 5H2FZ 3FB5C 3JAMN 3T2MA 1GN2A 1Y74A 4YY3O 2YSUB 1NTMH 2UXBO 1GM9A 2XAGA 2QTSA 2IJKA 2GSMB 1A32A 1W0JG 1XL4A 1WNSA 2UXXA 4O4HA 3ZS8C 2DYSB 2ZKOA 4B3TB 2A79B 4MVMA 4L8JA 1IZ3A 1QNMA 4LNUB 2B1GA 1JMKC 4MS2A 2LW7A 3ZJZA 4MT8A 3HKEA 1RP3B 3HKBB 3KKYA 4NXMO 3BCCH 4JI8O 5DM6V 4J41A 5D5QA 2QKSA 4A5UB 3ZMZA 5FNVB 1JR9A 1URFA 4TV8A 3HR0A 3E8GA 3U11A 5JH7B 5KHHA 1IBKO 1H2GA 2YIAA 1KECA 3LUTB 3Q4HA 2JDIG 2ZNIA 1EFRG 3CB2A 1YSCA 3G67A 4JYCA 1AI7A 2YI9A 5LXTB 1I5XA 3CJHB 3W7UA 4JV5B 3RYIA 1SA0A 2OIGA 1QLNA 2EJRA 3ZCCA 2QA4V 1QQCA 4UB6Z 3MHSC 4JYAB 2KKWA 1M56C 2HVJC 3SPGA 1RSOA 5IYCO 4LH7A 1NQTA 3OEHG 2BOBC 4O2BA 3G71V 3K57A 2F66C 2BTOA 1PNKA 2EINC 4K0KO 3N2GB 2AXTZ 4DR7B 3DC5A 1V54C 1S72V 3N27A 4IYHA 4ZHQB 1WA8A 1FFXB 2Y48A 1F23A 4FMTA 1OZ0A 3CRMA 4PI2A 3TK1A 4DUYO 4OX9O 1N32B 2FYUH 4FLTA 1SQXH 3BA8A 2GTAA 1R73A 4DR2O 1VQOV 2Y0PA 4X66O 3U0ZA 2WLLA 3JD1A 1N4CA 2E5LO 2ZXWB 1AJPA 3VQWA 2P4KA 3KCXA 2LGWA 2XHBA 2Q6AA 4O4LA 4TWKA 4X1IB 3CMEV 3ZRWB 2DWEC 4DR6B 1VQPV 4GX1A 2CTRA 3F5TA 3CCVV 2JGDB 4R6ZA 1B6QA 3RN4A 3OR7C 2PY5A 3OE7G 3K08A 1E1QG 2Q8VA 2GUZA 4LFAB 4I4TB 2K1EA 1G1XB 4DW1A 5KAFZ 1MMMA 3BAAA 2H94A 1ZSPA 3CD6V 4ZM5A 4WFFA 2CH7B 4K8XA 1MZEA 4WFBV 4JAVA 1K73W 2A0LA 1HNWB 3ETDA 1K5QA 1YCIA 4I7ZB 1Y6XA 1M57C 3JARA 3FB6C 1OCOC 1Q6IA 2PI4A 5LA6A 5LHIA 3ZIAG 3ZHVA 1IBMB 3IJ4A 3J81N 2CE4A 4HNAB 5CB4B 4L87A 2PGGA 5BMVA 4DXWA 1G4YB 4EB6A 3THOA 4UV9A 4UVAA 4DR4O 4KUMA 2ITCC 1XHXA 3U10A 1Z5WA 1IBLB 1GAXA 4PHZA 4FM2A 4AILC 2XNDG 3SJAC 4DUZO 4MVOA 2PYLA 4FPPA 2OYQA 2AHYA 1Y74B 2HG5C 3VQVA 1FAFA 1JFFA 5K1PA 4WFEA 1GM7A 1WPXA 2IU0A 1KP2A 4O4HB 5D5PA 3FD9A 1DTOA 3RGBA 4H37A 5EIBD 2BE3A 2L35A 3JAKB 1QR9A 4MW8A 1AB3A 4JZGA 1SERA 3T1YB 2A9HA 3FFQA 4RUFA 2N74A 3HKEB
chains in the Genus database with same CATH topology
3SPCA 2NLJC 1VQLV 3ZRXA 1RPRA 4QNHB 1R3IC 3VBBA 4MVSA 2X7RB 4BIUA 3OMAB 3OMIB 1FXKB 2DYSC 4RAIA 5EBWC 5B1BB 5CBHA 2P7TC 1RM1C 4XDKA 3ZRSA 2WPDG 3LSSA 2QTOA 3JD2A 2F43G 2UXNA 3EFFK 3B77A 1Q86W 4MVUA 3T4DA 3E83A 3JD3A 5EC1C 1VQMV 4LP8A 2LFSA 3ZRVA 5CMUA 3E35A 3CC2V 1YJWV 2ATKC 2W0FC 5CA3A 3MD0A 1VQ4V 1S76D 3OR6C 5B1NA 1PNLA 4RO2A 3SYQA 3ABUA 1M9NA 4PA7A 2DQ3A 1PD3A 3CCUV 2P90A 3AG4B 4FIPC 1OCZC 2AHZA 3M99B 1S3JA 2B5UA 4H33A 1BHBA 3K04A 2Z5UA 1QLEB 2DW4A 4R7CA 1ZWIC 3D3IA 4R50A 1R3JC 1QCEA 3ZRWA 2P6JA 1JX9A 4JTDB 1YITV 5IYDO 4JASA 4I5SA 5GW7A 4WCEV 1K7DA 5B3SC 3AG3B 1KKDA 5KA5A 2Q68A 5EK0A 1SRYA 3W7SA 3ZMTA 1YI2V 5J9PC 3ZMUA 3E86A 1F51A 4MVQA 5LHHA 1IXMA 1OCRC 4E2LA 1K4CC 2WLMA 2OCCC 4Q20A 3OAAG 2MK3A 4QE9A 2HR3A 1M57B 2EIJB 2X6BA 3E8HA 3QNEA 3D36A 2GHYA 4GX2A 5LGTA 4R8CA 4RQFA 2OTLV 5IY5B 1OCOB 4XDLA 1YJNV 3FYIB 3GB7C 5B1OA 3X2QC 5LGNA 2LFRA 2WLHA 3ABLC 3CXCU 4E2HA 1YHQV 1QR8A 3B8OA 3F7VC 1JOYA 1M90W 3B8PA 4UXNA 3WG7B 1L1FA 3DTUB 1AR1B 2JJ2G 1GMGA 2WLIB 2ZR2A 2JEUA 3FYEB 3QO7A 3ZMSA 1GKFA 3SYPA 3SPIA 3B8NA 4LCUC 2EIMB 2WLLB 4JPRA 3ZN0A 2Q67A 3ASNB 5C93A 3CYOA 4QPKA 5EC2C 1M56B 4PA4A 3UKMA 2ZR3A 3ASOB 3AG2B 2IJHA 3W7TA 1SETA 1PNMA 2YEVA 4FJCC 3JD4A 3VOUA 1FS0G 1J95A 2R9RB 3T1CA 3JYCA 4GCZA 2W6IG 4OXSA 2X6CA 1VQKV 5L3DA 2EINB 2XAHA 1Y66A 4ASUG 2Q69A 4QIWF 1K34A 1P7BA 3CCLV 1S5HC 2HFEC 3ML0A 1V54B 3I55V 4WFGA 3UM7A 1CPYA 2Y69C 1KQSU 1F4NA 1YTFB 2DYRB 2LP7A 2ZXWC 5B1AC 3P32A 3OM3B 1NVPD 4KP4A 4MSWC 1DF5A 3CCRV 4PA3A 3GWOA 2XAJA 1TUEB 3CCMV 2WAMA 3ABMB 2HLDG 4PDVA 4HAMA 3DGEA 4GX5A 4X88A 1ORQC 4F4LA 4X8AA 1GTOA 5L3EA 4JAUA 4PA9A 3SYCA 5CN0A 3FB5C 5CBGA 1I5YA 3T2MA 4ZKIA 1WLEA 2YSUB 3CC4V 2V1DA 2R9IA 1F4MA 4GX0A 4QJFB 3FB8C 2NNUA 2XAFA 3OGCC 4BIZA 4G2KA 1K8AW 3F5WC 2IH3C 1GM9A 3MHHC 2XAGA 4P9OA 2IJKA 2EILC 2GSMB 1NKDA 1W0JG 1XL4A 2UXXA 4UV8A 4J9YB 4PELA 3RVZA 4JTCB 4XBFA 2DYSB 2JJ1G 3W7XA 1AI6A 4JTAB 3SYOA 1JVMA 1R3KC 1RM1B 1K5SA 3SPJA 3QO8A 1QBZA 2A79B 1K3EA 4MVMA 4MTXA 2JK5C 4MTGA 2B1GA 4MS2A 4PDLA 3ZJZA 4MT8A 3OUFA 5KUMA 4FK5C 3CP1A 4U7OA 2FTKA 3T4ZA 2ZQMA 1XL6A 2CK3G 3IC7A 1NH2B 2PI5A 5E1AC 5DM6V 1E79G 2QKSA 1W0KG 4P2ZA 5LBQA 4JGSA 3NXSA 5HFMA 3H01A 3K0DA 3ZMZA 4CBCA 2D3OW 4RUEA 2OTJV 1PKXA 4MVRA 1AJNA 3WFVA 2Z3YA 1YJ9V 2QM8A 3K9AA 1NR1A 4CZZA 4I9WA 1YIJV 2OT5A 4MW3A 1KP3A 3K06A 3E8GA 3FB7C 2QE7G 1AJQA 1V55B 4MVZA 1QVGU 1H2GA 1KECA 3LUTB 1Q82W 1GO3F 2JDIG 2X0LA 2EIJC 1MG1A 3ABKC 1Y4MA 3SYAA 2C2AA 3E2EA 1EFRG 3AG1B 5L3FA 1YSCA 5H6RA 5IYBO 2B1IA 4JYCA 2EIKC 1AI7A 1YTFD 3WG7C 2X6AA 1I5XA 4GT1A 3W7UA 1JPXA 1QLNA 2EJRA 2WWWA 3ZCCA 1S0VA 4XDJA 1OCRB 2QA4V 3R65A 2EIMC 2OCCB 4TSFG 3MHSC 4WF9V 2BOCC 3ASNC 3STLC 4J9ZB 5H9CA 1M56C 3EHBB 1M1KW 2HVJC 3SPGA 4PDRA 1JQ0A 3X2QB 5IYCO 1OCCB 1E1RG 1K92A 3HPLC 3TETA 1NQTA 2IU3A 1BMFG 3OEHG 1KC8W 1MOFA 2BOBC 2HVKC 3ABTA 3JD0A 3CCEV 3G71V 4BW5A 1K97A 1MABG 4UVCA 1W2BU 2HKOA 2IJIA 2EINC 1H8HG 1PNKA 4PDMA 4E2CA 1DF4A 1V54C 3CCSV 2EZPA 1S72V 3IGAC 2XOKG 3BEHA 2Y48A 1F23A 4FMTA 1OZ0A 1JJ2U 3TK1A 4UUJC 5DN6G 3W7WA 1R6KA 5BZBA 3G4SV 2W6JG 3P30A 1R73A 3PJSK 3ABMC 4LC1A 4P9PA 1FXHA 1VQ7V 3STZC 1FXVA 1VQOV 2EBOA 1FXKC 3OW2U 2WLLA 1BHAA 2V7QG 5B1BC 3G6EV 1GM8A 1QVFU 1N8RW 1EBOA 3K0GA 5L3GA 1R6NA 2Y69B 3JD1A 2ZXWB 1AJPA 5B1AB 1LNQA 2ZD9A 1DLBA 2H8PC 4WFHA 3ZMVA 1OHHG 2Q6AA 2P67A 4TT3G 4TWKA 1NR7A 3CMEV 4WFAV 5LHGA 1VQNV 3ZRWB 2DWEC 1VQPV 3CCJV 2IH1C 1ROPA 4GX1A 1VQ8V 3LDEA 3CCVV 3RVYA 3OMNB 4R6ZA 1B6QA 1KD1W 1K4DC 3E89A 4U7NA 5L3BA 2WLJA 3FKSG 1H8EG 3KG2A 3OR7C 3OE7G 1PL0A 3K08A 1E1QG 1VQ6V 3AG4C 2KB1A 3B8MA 4P30A 4E29A 2M7WA 3IFXA 1NBMG 2K1EA 5L3CA 1QLEC 1THZA 2EILB 1NJIW 4BAYA 2H94A 4KFMA 3OFNG 5IDJA 1FXKA 3ETEA 3LDDA 1SESA 3AG3C 3CD6V 4LBEC 4G28B 2JEXA 4PA6A 1Q81W 1NVPB 1EZJA 4ZM5A 4WFFA 3E8BA 4RQEA 1OCZB 3LSQA 4UVBA 4WFBV 4JAVA 3SPHA 2XAQA 1K73W 2A0LA 3K03A 2JIZG 1HWYA 3ETDA 1S77D 1V55C 1K5QA 5HFLA 4Z1MG 3CC7V 1CP9A 3CCQV 3AEIA 4N23A 1ENVA 1M57C 2WLKA 3HB3B 1SZTA 2QM7A 5KUKA 4QPJA 3I56V 3FB6C 5IY5C 5B3SB 1OCOC 2PI4A 1GK9A 4JF3A 5LHIA 2XASA 3AG1C 1AI4A 2YEVB 3QO5A 1R3LC 3ZIAG 3CPWU 3ETGA 4HYOA 4N21A 4JYBA 1AI5A 1Q7YW 1COWG 4MTFA 3CMAV 2ZDIC 4QE7A 3LDCA 4L87A 3E8FA 4DXWA 1G4YB 4UV9A 3ABKB 4UVAA 3LNMB 4G27B 3OEEG 5H6QA 4MTOA 4EKWA 4ZM1A 3K3WA 3ASOC 4KUMA 3AG2C 2ITCC 1OCCC 3ABLB 5FL7G 1MSWD 1RPOA 3RBZA 2EIKB 4X89A 3F7YC 5EBLC 3BY6A 3JCZA 1K33A 1H38A 2XNDG 1G8MA 1AROP 5KA6A 1P4RA 1UJWB 3ZN1A 4YXWG 3A0RA 4MVOA 2WLNA 4FPPA 2AHYA 2DYRC 2HG5C 2ITDC 5EBMC 1VQ9V 2EZOA 3K79A 4WFEA 1GM7A 1VQ5V 1BL8A 2HJFC 2QEXV 1WPXA 5CBFA 2IU0A 2WLIA 1KP2A 1CEZA 2DWDC 2ZDIA 1K9MW 1DTOA 4H37A 3RW0A 2IJJA 3SJQC 4HZ3A 1JCHA 1QR9A 1NH2D 4MW8A 5LGUA 3OUSA 1SERA 2DQ0A 4DO2A 4ZBMA 2WSSG 2A9HA 4RUFA 2IW5A 3TCUA 1FFTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4M A;  1DF5 A;  4ZM1 A;  2EZO A;  1JQ0 A;  3MHH C;  1SZT A;  3GWO A;  4FJC C;  4E2H A;  4JF3 A;  1QR8 A;  2X7R B;  3B8O A;  3P30 A;  5CMU A;  4JGS A;  5KA5 A;  5HFM A;  1MOF A;  3B8P A;  3H01 A;  1K33 A;  3WFV A;  2EBO A;  4ZM5 A;  1I5X A;  4N21 A;  1Y66 A;  3K9A A;  1K34 A;  1JPX A;  1QBZ A;  4FIP C;  3M99 B;  5CN0 A;  5KA6 A;  1QR9 A;  1ENV A;  1EBO A;  4E2C A;  1DF4 A;  3B8N A;  2OT5 A;  3B8M A;  1I5Y A;  2EZP A;  4JPR A;  4E29 A;  3B77 A;  4E2L A;  1DLB A;  3MHS C;  3CP1 A;  4FK5 C;  2LP7 A;  2M7W A;  2MK3 A;  3CYO A;  5HFL A;  1F23 A;  5H9C A;  4N23 A;  1MG1 A;  4G2K A;  1QCE A;  2P6J A; 
#chains in the Genus database with same CATH topology
 3BPZ A;  2NLJ C;  1VQL V;  2UXB B;  1RPR A;  4AHC A;  4QNH B;  2ARH A;  3ETQ A;  1FXK B;  2DYS C;  4RAI A;  5EBW C;  4XDK A;  1SZX A;  4TV8 B;  5TIS Z;  2UXN A;  1Q86 W;  4YJ2 A;  3JD3 A;  4LP8 A;  2LFS A;  3ZRV A;  1XNQ O;  3Q4H B;  3CC2 V;  3H1K H;  4NXM B;  1VQ4 V;  3OR6 C;  1PNL A;  3BHP A;  3ABU A;  4EFB A;  1DK1 A;  1EN6 A;  3CCU V;  2P90 A;  3AG4 B;  4KHP O;  4FIP C;  1OCZ C;  2UUA O;  2GTS A;  1J5E O;  1T5E A;  2B5U A;  3K04 A;  3L73 H;  3UO3 A;  2QR4 A;  1QLE B;  4R7C A;  1ZWI C;  1QCE A;  2P6J A;  3PN1 A;  4JTD B;  1VIB A;  1YIT V;  3ZHQ A;  5GW7 A;  1K7D A;  1RSO B;  3CXH F;  1SRY A;  4JI2 B;  4B7K A;  3ZMT A;  1B3Q A;  4X65 O;  4O2B B;  2E76 B;  2WA4 A;  3E86 A;  1BCC H;  1H2K A;  4B3M B;  1FD9 A;  1W59 A;  1YVW A;  2MK3 A;  1DGS A;  2GHY A;  2LO1 A;  4RQF A;  2YIB D;  2DJV A;  1WA8 B;  1YJN V;  3C3S A;  3GB7 C;  5B1O A;  1GRJ A;  2WLH A;  1QR8 A;  5KHJ A;  3B8O A;  5FNV A;  1JOY A;  2JJ2 G;  2WLI B;  3FYE B;  3D3Q A;  4K0K B;  3SPI A;  3B8N A;  2UXD O;  2WLL B;  5JH7 A;  1Y76 A;  1M4U A;  4CC5 A;  1M56 B;  5GON A;  3UKM A;  2ZR3 A;  4ZI7 B;  2LGQ A;  3JAW B;  4DUY B;  1X59 A;  2YEV A;  4O4L B;  4JI0 B;  1SQP H;  2RCV A;  1XHZ A;  5KMG B;  4OXS A;  4DR2 B;  2EIN B;  4X66 B;  4QIW F;  1V54 B;  4WBN A;  3S3W A;  3I55 V;  4WFG A;  1XMQ O;  5JVD A;  3CE2 A;  1D5A A;  1KQS U;  2GUZ B;  2E5L B;  2DYR B;  2ZXW C;  3ZHS A;  3C3T A;  4EEQ A;  1LUW A;  4KP4 A;  1DF5 A;  3GWO A;  2XAJ A;  2R9A A;  1TUE B;  2HLD G;  5A9G A;  1ORQ C;  4F4L A;  1GTO A;  1ZLZ A;  4UCV A;  3CRR A;  4ZHQ A;  1FFX A;  3L75 H;  1WLE A;  4W4K A;  2R9I A;  2PUS A;  4GX0 A;  4J7Z A;  2XAF A;  3OGC C;  4G2K A;  4NB5 A;  3MHH C;  3CWB H;  4P9O A;  3UT5 A;  4UV8 A;  4J9Y B;  4O4J A;  1NTK H;  1AI6 A;  3SYO A;  3KZI Z;  3OD4 A;  3QO8 A;  2K9P A;  1QBZ A;  4MTX A;  2JK5 C;  2QWR B;  3RT3 C;  1VAR A;  5KUM A;  3CP1 A;  4U7O A;  3QG5 A;  4EB6 B;  2ZQM A;  2Q7G A;  2UU9 O;  2CK3 G;  1NH2 B;  5E1A C;  1E79 G;  4D6T H;  4D7S A;  5HFM A;  1HDJ A;  1Y67 A;  1HNX O;  2OTJ V;  1PKX A;  4X64 O;  1AJN A;  4HBN A;  1TAE A;  4CZZ A;  4J10 A;  5GTH Z;  4I9W A;  1YIJ V;  2DOS A;  1KP3 A;  3H9V A;  1SQV H;  1AJQ A;  4I4T A;  1KBH A;  1Q82 W;  1GO3 F;  2EIJ C;  1MG1 A;  4DR4 B;  5JQG A;  2C2A A;  4GYC B;  4TV9 A;  5DEC A;  2VQE B;  1L0N H;  2FKX A;  3N2K A;  2B1I A;  2FB5 A;  3A8T A;  2PF4 E;  4BR6 A;  1S0V A;  4XDJ A;  1OCR B;  2GDS A;  4TSF G;  4DUZ B;  2BOC C;  5H9C A;  2RNB A;  1M1K W;  4IGG A;  1R6T A;  1JQ0 A;  4PDR A;  3X2Q B;  3M8A A;  3HPL C;  2Y4U A;  1KC8 W;  3JD0 A;  3B09 A;  2UUB O;  1W2B U;  2HKO A;  5LMU O;  2E74 B;  4PDM A;  3K5N A;  4FLX A;  2R72 A;  2ZE6 A;  4DV5 O;  2UUC O;  3BEH A;  4LR3 A;  5A2Q N;  4YJ2 B;  2M6Y A;  1R6K A;  1Q5O A;  4B3S O;  5BZB A;  3G4S V;  3P30 A;  1FXH A;  2EBO A;  1FXK C;  1PV0 A;  4F6E A;  1BHA A;  3K5L A;  2V7Q G;  2ZCE A;  4DV2 O;  1N8R W;  4K8Z A;  3K0G A;  1R6N A;  2Y69 B;  2QJ1 A;  5B1A B;  1AVM A;  4J7K A;  1LNQ A;  3WU2 Z;  1HNZ O;  4UCR A;  1OHH G;  2YC0 A;  2AZ2 A;  3K5O A;  1NR7 A;  1VQN V;  3SR2 C;  4I9Q A;  2IH1 C;  1KUQ A;  1VQ8 V;  3OMN B;  4NTY A;  1KD1 W;  3JAK A;  5L3B A;  2ZE8 A;  3T1H O;  1VQ6 V;  3AG4 C;  3UCS C;  4KHP B;  2KB1 A;  1VEW A;  3I5D A;  2UUA B;  3B8M A;  1J5E B;  4E29 A;  4LH6 A;  3CSX A;  1O9G A;  3IFX A;  5J2T A;  1NBM G;  4FLZ A;  1Q6H A;  1QLE C;  1SF9 A;  1XUQ A;  2EIL B;  1M5I A;  5IDJ A;  1FXK A;  3ETE A;  3LDD A;  2ZT9 B;  4LBE C;  3B4S A;  1B04 A;  4PA6 A;  1O9H A;  4B7E A;  3O9O A;  1OCZ B;  3LSQ A;  3SJC C;  1XMO B;  4NXN B;  4U3F H;  3DSQ A;  1ZUQ A;  3K03 A;  2JIZ G;  2H3O A;  4J80 A;  1PP9 H;  1D2D A;  3CRQ A;  5HFL A;  4Z1M G;  1Y76 B;  4N23 A;  2B9Z A;  2JGU A;  3HB3 B;  5GON B;  4AQY O;  4QPJ A;  3WB2 A;  4JF3 A;  4TQD A;  3AG1 C;  1AI4 A;  2YEV B;  5KX5 A;  3CPW U;  5CA1 A;  3ETG A;  4N21 A;  1AI5 A;  1Q7Y W;  1COW G;  4LWS A;  2ZDI C;  3L71 H;  5C8Y A;  2UXD B;  4WBN B;  4OPH A;  3BFR A;  4DV3 O;  3ABK B;  3LNM B;  5JVD B;  2PTM A;  1FKA O;  1YDX A;  4EKW A;  4DV6 O;  4LF5 O;  4ZM1 A;  4LFB B;  1EN4 A;  1OCC C;  3RBZ A;  1GH6 A;  1K33 A;  4NVP A;  1JJO A;  1NS1 A;  1ARO P;  2CGO A;  1P4R A;  2JVD A;  4JAA A;  4LF8 O;  3ZBH A;  4RWU A;  2DYR C;  1YZB A;  5EBM C;  1XBL A;  4U3J B;  4YHH O;  4DR5 O;  1I08 A;  4FLU A;  4CH3 A;  5CBF A;  2WLI A;  3UT5 B;  1CEZ A;  2DWD C;  2F1M A;  2ZDI A;  3JCU Z;  4O4J B;  2QGN A;  5FPR A;  2IJJ A;  4HZ3 A;  1JCH A;  1GN3 A;  4LF4 B;  4DO2 A;  1WAZ A;  4ZI7 A;  2KG7 A;  2QKC A;  3JAW A;  3TCU A;  1XEQ A;  1NTZ H;  3SPC A;  3H1L H;  3KCY A;  4MVS A;  3R66 A;  1PPJ H;  5IJ0 B;  5KMG A;  3OMA B;  4LFC O;  1SS3 A;  3OMI B;  4J7J A;  4PI0 A;  2P7T C;  3TXQ A;  1JA8 A;  3UO2 A;  4FFB A;  3JD2 A;  3P3N A;  1EN5 A;  4YJ3 B;  1VQM V;  1ZX3 A;  4FLW A;  4JI1 B;  4O4I A;  3E35 A;  2WA3 A;  2UU9 B;  4LF6 O;  2W0F C;  5CA3 A;  1TVK B;  3MD0 A;  5JQG B;  1S76 D;  5B1N A;  2Q0A A;  3SYQ A;  1VF7 A;  2DE0 X;  3A0H Z;  4TV9 B;  1M9N A;  4PA7 A;  2DQ3 A;  3N2K B;  1HNX B;  4X64 B;  4JI4 O;  1Q6U A;  5IWA O;  3HKD B;  3D3I A;  1WB8 A;  1JX9 A;  3JAS B;  2MW2 B;  3OGI B;  3APO A;  4UB8 Z;  3AG3 B;  1KKD A;  4TOI A;  1LR1 A;  2Q68 A;  4OPA A;  1UFI A;  5KHK A;  1YI2 V;  4F6R A;  2ZM6 B;  2A3Q A;  4NR1 A;  4MVQ A;  4JI7 O;  1IXM A;  1OCR C;  2WLM A;  4Q20 A;  3OAA G;  2JS5 A;  3BAB A;  4GX2 A;  2EIJ B;  2X6B A;  4X62 O;  3X2Q C;  3ABL C;  3P3P A;  2AGA A;  5GTI Z;  4LF7 B;  3B8P A;  2HP8 A;  4CH5 A;  1AR1 B;  1GMG A;  1I7F A;  2UUB B;  2P5O A;  5LMU B;  3QO7 A;  1GKF A;  4DV5 B;  2Q67 A;  2UUC B;  5EC2 C;  4FLY A;  4PA4 A;  1L8D A;  1KB9 F;  4BWA A;  3JD4 A;  4DK0 A;  2W6I G;  2X6C A;  4DV4 O;  3DXR B;  5L3D A;  4ASU G;  2YXH A;  3CCL V;  3ML0 A;  4DV2 B;  2Y69 C;  1F4N A;  2XUM A;  5BR8 O;  5B1A C;  3FAV B;  4YY3 B;  2Q7E A;  4H0L B;  2P06 A;  5LMN O;  1HR0 O;  4MSW C;  3SDL A;  5J2T B;  2NN4 A;  5BY1 A;  1GN6 A;  2BCC H;  3L9D A;  2Q4P A;  2KSD A;  3GVM A;  3SYC A;  5CN0 A;  4PJ0 Z;  5LYJ A;  3T1H B;  4GKJ O;  4ZKI A;  1V9P A;  1BGY H;  3CC4 V;  4LF9 O;  1KU9 A;  3D8C A;  1F4M A;  1SC5 B;  1XNR O;  4QJF B;  3FB8 C;  4CS2 A;  1K8A W;  5K1X A;  2IH3 C;  4I55 B;  5LP6 C;  2EIL C;  1L0L H;  1NKD A;  4JI8 B;  3RVZ A;  4XBF A;  1AR5 A;  3L74 H;  2JJ1 G;  3W7X A;  4DV0 O;  1R3K C;  1RM1 B;  5KX5 B;  4JI3 O;  1K3E A;  5CA1 B;  4MTG A;  3AK3 A;  4LWS B;  2HHH O;  2VRZ A;  3OUF A;  2Y4T A;  5C8Y B;  3T4Z A;  1Q90 D;  1IBK B;  2ADQ B;  2PI5 A;  2JRI A;  4AQY B;  1W0K G;  1SQQ H;  4P2Z A;  5LBQ A;  3NXS A;  3K0D A;  4CBC A;  2D3O W;  4MVR A;  3WFV A;  2E3C A;  2Z3Y A;  1YJ9 V;  2FML A;  2FL4 A;  2QWN B;  5J2U A;  1Z5V A;  2AZ0 A;  3FX7 A;  2ZNJ A;  4MW3 A;  1YEW A;  4IYI A;  4MVZ A;  4E4E A;  5LP6 A;  2X0L A;  3RYH B;  3ABK C;  4UCT A;  3K9S A;  4LF5 B;  3AG1 B;  5L3F A;  2F23 A;  3LNN A;  3WG7 C;  2X6A A;  4B08 A;  4GT1 A;  1JPX A;  2F4V O;  2ZIN A;  4ABM A;  5LL6 Y;  1QU7 A;  3R65 A;  2EIM C;  2OCC B;  4LF8 B;  1XRE A;  3CRC A;  4TQF A;  1YXB A;  3EHB B;  2KG7 B;  1OCC B;  1NI8 A;  1E1R G;  1K92 A;  3TET A;  4OX9 B;  2IU3 A;  1BMF G;  3RWR D;  2HVK C;  2XTA A;  3ABT A;  2N05 A;  4FZ1 A;  2YID A;  4BW5 A;  2OIE A;  2RN9 A;  1K97 A;  5JJJ B;  1H8H G;  2VQF O;  4E2C A;  1DF4 A;  1TUB A;  4CS3 A;  4FFB B;  4CH6 A;  2RQ6 A;  1JJ2 U;  4DV7 O;  2YXL A;  4FFK A;  4O4I B;  5DN6 G;  2W6J G;  2BSK B;  3PJS K;  2RDC A;  4P9P A;  2GV9 A;  1FXV A;  2ZE7 A;  4H44 B;  3STZ C;  4LFC B;  3OW2 U;  1G6U A;  5IYZ B;  2L6L A;  2OWO A;  5F2V O;  3AG7 A;  3NR7 A;  5L3G A;  2W0X A;  2ZD9 A;  1MSD A;  1DLB A;  2H8P C;  4U3J A;  3L70 H;  4TT3 G;  4UCU A;  5LHG A;  4LF6 B;  3WB0 A;  3CCJ V;  1ROP A;  2YDE A;  3RVY A;  3CEI A;  3E89 A;  4U7N A;  2WLJ A;  3FKS G;  1H8E G;  4DV1 O;  1PL0 A;  4JI4 B;  4F6R B;  5IWA B;  1BQ0 A;  2O57 A;  1N33 O;  5JJN B;  1THZ A;  5ITZ A;  1NJI W;  4CH4 A;  5IJ0 A;  3OTO O;  3OFN G;  1SES A;  3AG3 C;  2JEX A;  3A2F A;  1Q81 W;  1NVP B;  5EYP B;  3E8B A;  3DC6 A;  3JSN A;  4UVB A;  1GN4 A;  4YJ3 A;  2QSA A;  2XAQ A;  4KXR A;  4LFA O;  1V55 C;  1CP9 A;  3CCQ V;  5BXZ A;  1ENV A;  2CTP A;  2YIC A;  3B40 A;  2WLK A;  1TVK A;  4X62 B;  4JYY A;  2Z0A A;  1SZT A;  2QM7 A;  5KUK A;  3I56 V;  4QGP A;  3K59 A;  1R3L C;  4I0X A;  4X1K A;  4JYB A;  1N36 O;  3CMA V;  4QE7 A;  2V4D A;  3HKD A;  4DYL A;  4G27 B;  1I94 B;  3OEE G;  4B3R O;  3JAS A;  5FL7 G;  3ABL B;  1P7G A;  1RPO A;  2EIK B;  4X89 A;  3F7Y C;  3HKC A;  3JCZ A;  1WN7 A;  4O2A B;  1H38 A;  4JI6 O;  1G8M A;  4DV4 B;  2ODM A;  1UJW B;  3E22 A;  3ZN1 A;  2WLN A;  5LYJ B;  4DR3 O;  2R70 A;  5BR8 B;  3G80 A;  2ITD C;  1WPB A;  4J42 A;  2EZO A;  5LMN B;  1HR0 B;  3VQY A;  1AIL A;  1VQ5 V;  1BL8 A;  2DN9 A;  4Z1V A;  5CA0 A;  1BT8 A;  1PM9 A;  5JCO A;  3SJQ C;  1NH2 D;  4UCS A;  2QKA A;  3BVO A;  4GKJ B;  3JAT A;  4ZBM A;  2WSS G;  2CTQ A;  2DMX A;  4LF9 B;  2IW5 A;  1XNR B;  2CAZ C;  1FFT B;  3LSU A;  1IXB A;  3QVN A;  1XNQ B;  3BRC A;  3VBB A;  2X7R B;  4BIU A;  3DXR A;  3IC9 A;  1B06 A;  5B1B B;  1UPG A;  1RM1 C;  3ZRS A;  5KAI Z;  4JI3 B;  3T1Y O;  2QTO A;  4DR1 O;  5J2U B;  2F43 G;  3EFF K;  3FAV A;  2YUA A;  2HHH B;  5EC1 C;  1I94 O;  2ZIM A;  2IM9 A;  5LP6 B;  1YJW V;  2ATK C;  3VQX A;  3D36 C;  4RO2 A;  2RMK B;  2YIB A;  3EVK A;  1PD3 A;  2P4V A;  1BSM A;  1Q3E A;  3RYF A;  3M99 B;  4X65 B;  3O65 A;  1S3J A;  1BHB A;  2DW4 A;  4X1Y A;  4I55 A;  4R50 A;  1BQZ A;  1R3J C;  5IYD O;  4JAS A;  4I5S A;  5JJE B;  5B3S C;  2LW1 A;  5EK0 A;  5J9P C;  2XT9 A;  3RFR A;  3ZMU A;  1TA8 A;  1MNG A;  2F4V B;  2EUL A;  2D2C B;  1F51 A;  3G6B A;  1K4C C;  1TUB B;  2OCC C;  4TUY A;  4I50 A;  2HR3 A;  3D36 A;  4ICG A;  5LGT A;  1H2N A;  4R8C A;  1N34 O;  5IY5 B;  1IVS A;  4XDL A;  1SQB H;  3FYI B;  1NT2 B;  2LFR A;  3CXC U;  1YHQ V;  4JI2 O;  4UXN A;  3WG7 B;  1KYO F;  3DTU B;  5DED A;  4JI5 O;  3AK2 A;  4FZ0 A;  2VQF B;  4B3M O;  2EIM B;  4JPR A;  5C93 A;  3RYH A;  1XMQ B;  1CXZ B;  3ASO B;  2BTQ A;  3AG2 B;  4EFE A;  3W7T A;  4DV7 B;  3VOU A;  1RFY A;  1FS0 G;  1J95 A;  3JYC A;  3ZHT A;  2LQT A;  2XAH A;  3QF7 A;  2Q69 A;  1S5H C;  3CRA A;  5B5E Z;  3UM7 A;  4IT5 A;  1YTF B;  2LP7 A;  3P32 A;  1Q8I A;  4NYK A;  1ZAU A;  1FPO A;  3OM3 B;  1SKV A;  1S5L Z;  3J7A U;  4IIJ A;  4JI0 O;  5IE9 A;  5ITZ B;  3ZX6 A;  3CCM V;  2WAM A;  1HP8 A;  4PDV A;  1Q43 A;  4HAM A;  3DGE A;  5L3E A;  1BZK A;  4X8A A;  1VMG A;  4IL6 Z;  4DV1 B;  5CBG A;  1I5Y A;  4CC6 A;  1YF2 A;  2V1D A;  2NNU A;  1N33 B;  4BIZ A;  2QWQ B;  3F5W C;  4J11 A;  2BSK A;  4PEL A;  4JTC B;  3OTO B;  1EZV H;  4JTA B;  1JVM A;  2G38 A;  5IYZ A;  1K5S A;  2ETN A;  3SPJ A;  3WB1 A;  1I0H A;  4ZIB A;  4I0X B;  4X1K B;  2YXY A;  3K5M A;  4PDL A;  2YS8 A;  4FK5 C;  2FTK A;  1XL6 A;  3IC7 A;  4GZR B;  1N0N A;  5E79 Z;  1OJH A;  1IDS A;  4FM0 A;  2KQX A;  4JGS A;  5FLX N;  2VWK A;  3H1I H;  3H01 A;  3L72 H;  4RUE A;  3HKC B;  2VWJ A;  2QM8 A;  3ZHR A;  3K9A A;  4PV1 B;  1NR1 A;  1N36 B;  3EXA A;  1KKC A;  2OT5 A;  3K06 A;  3FB7 C;  2QE7 G;  1V55 B;  1QVG U;  5IJ9 A;  3E22 B;  1H2S B;  4IHJ A;  1Y4M A;  3SYA A;  4B3R B;  2E75 B;  2UXC O;  1S5J A;  1SQG A;  3E2E A;  5IYB O;  5H6R A;  2ZIO A;  2EIK C;  4FM1 A;  1YTF D;  5EYP A;  5LOV B;  3S3X A;  2CUG A;  4JI6 B;  1ZL8 B;  5CA0 B;  2WWW A;  4WF9 V;  2HEP A;  3ASN C;  3STL C;  4DR3 B;  4J9Z B;  3JAT B;  4ZOL A;  2VQE O;  3JAL B;  1MOF A;  1WJZ A;  5EZY A;  2EX3 A;  2QDO A;  4B3S B;  3CCE V;  1H2M A;  1MAB G;  4UVC A;  4Z2W A;  2IJI A;  1VP7 A;  1ZTE A;  3CCS V;  2EZP A;  3TJT A;  1FJG O;  3IGA C;  2XOK G;  3SGI A;  1HW7 A;  1SQF A;  3CX5 F;  4UUJ C;  1HNZ B;  3W7W A;  1XDC A;  1BS3 A;  4O2A A;  4LC1 A;  3ABM C;  5KLV H;  1VQ7 V;  3QTC A;  4NKG B;  5JWP A;  3A0B Z;  4GKK O;  1IX9 A;  5B1B C;  3G6E V;  1GM8 A;  1KMI Z;  1QVF U;  4AI8 A;  1EBO A;  4UFZ A;  4X20 A;  3RYF B;  4DR1 B;  4WFH A;  1U97 A;  3ZMV A;  2P67 A;  4X1Y B;  1PL4 A;  4WFA V;  2N04 A;  4Q6G A;  1P49 A;  1XQ8 A;  3LDE A;  1N0J A;  5FPO A;  2LJ2 A;  1K4D C;  2VS0 A;  2GBO A;  1NU1 H;  3KG2 A;  3C90 A;  3RYC A;  3OTF A;  4K3A A;  2CDY A;  1AP5 A;  4P30 A;  2M7W A;  2RJZ A;  5L3C A;  1X4T A;  4TUY B;  4I50 B;  4BAY A;  4KFM A;  1M93 A;  1EM1 A;  4DRX A;  5B66 Z;  1MA1 A;  4G28 B;  4B3T O;  4DK1 A;  1EZJ A;  1OV9 A;  4RQE A;  1IUR A;  3RYI B;  1SA0 B;  3SPH A;  2Y0I A;  4C7U A;  1HWY A;  1P84 F;  1NZ6 A;  1S77 D;  3CC7 V;  1XIL A;  3AEI A;  3H1H H;  4DV3 B;  3BA9 A;  1N34 B;  1LUV A;  1R1B A;  2BTQ B;  5IY5 C;  5B3S B;  4DV6 B;  1GK9 A;  1D5N A;  4CS4 A;  2XAS A;  3QO5 A;  4FLV A;  4HYO A;  1XMO O;  4NXN O;  4MTF A;  4LNU A;  4H13 B;  4JI5 B;  3LDC A;  3E8F A;  2Q5Z A;  4UCO A;  3HKB A;  4JZ2 A;  4KL1 A;  3OT7 A;  2CTW A;  5H6Q A;  4MTO A;  3H1J H;  3K3W A;  3ASO C;  3AG2 C;  1MSW D;  4IIJ B;  4YHH B;  4DR5 B;  2A7W A;  5EBL C;  3BY6 A;  4JV5 O;  4OGQ B;  3B2E E;  2HJD A;  5KA6 A;  2JS3 A;  4YXW G;  2PYJ A;  3A0R A;  4NTW A;  3IAY A;  4JYA O;  4LFB O;  2QM4 A;  5KHG A;  2A06 H;  2ZE5 A;  1VQ9 V;  5IT9 N;  1MZF A;  3K79 A;  2HJF C;  2QEX V;  5LXT A;  3CJH A;  3K58 A;  4FVM A;  1TGO A;  1K9M W;  2Q73 A;  3RW0 A;  4DR7 O;  4YIO A;  5LGU A;  4X9Q A;  3OUS A;  2DQ0 A;  3ICX A;  1Z2G A;  3ZHU A;  3ZRX A;  1U96 A;  1N32 O;  1R3I C;  3TGU H;  2Q0O C;  1FYJ A;  2NR5 A;  3N2G A;  5CBH A;  3M7M X;  4LF4 O;  2WPD G;  3LSS A;  2AW9 A;  3B77 A;  1AR4 A;  4MVU A;  3T4D A;  3E83 A;  3SJB C;  1XOU A;  5CMU A;  5IJ9 B;  5EIB C;  3UQ8 A;  4DR6 O;  3JAR B;  3ZED A;  4IHJ B;  3J80 N;  5LA6 B;  4D7T A;  1WB7 A;  1BE3 H;  2AHZ A;  4BIO A;  4BW9 A;  4H33 A;  4JI1 O;  4DW0 A;  2Q7H A;  2ADP A;  2Z5U A;  5BMV B;  5KHI A;  4JI7 B;  4X1I A;  3ZRW A;  3GWK C;  2UXC B;  4ZOL B;  4WCE V;  2QWO B;  2JGD A;  3CS5 A;  1XI1 A;  5KA5 A;  3CHX A;  4K35 A;  4YIP A;  3W7S A;  5EZY B;  2CGN A;  5JCO C;  1HNW O;  5LHH A;  1WP7 A;  4E2L A;  2QWP B;  4QE9 A;  1M57 B;  3E8H A;  3QNE A;  2OTL V;  1OCO B;  4GUN A;  5LGN A;  1JFF B;  4E2H A;  2IBZ H;  5H5N A;  1AP6 A;  3F7V C;  5AG2 A;  1M90 W;  1IBM O;  2ILM A;  1L1F A;  2CH7 A;  3AK1 A;  2OCH A;  2ZR2 A;  2ZM6 O;  4GLX A;  2JEU A;  3ZMS A;  3SYP A;  1F7Y A;  4LCU C;  1VF6 C;  3ZN0 A;  1H2L A;  3ASN B;  3CYO A;  1FJG B;  4QPK A;  4X20 B;  2IJH A;  1SET A;  1PNM A;  4FJC C;  4LF7 O;  4NTX A;  2R9R B;  3T1C A;  2F95 B;  5LOV A;  1IBL O;  2YI8 A;  4GCZ A;  1ZL8 A;  3MAQ A;  4HNA A;  1VQK V;  1Y66 A;  5CB4 A;  1K34 A;  1P7B A;  2P22 C;  1US6 A;  3TXS A;  2Q9L A;  4GKK B;  2HFE C;  3RYC B;  4PD4 F;  1CPY A;  2F93 B;  3APQ A;  1VF5 B;  1WP8 A;  3MDS A;  4W4L A;  1NVP D;  2PZS A;  3JAL A;  3CCR V;  4PA3 A;  3JSL A;  3ABM B;  4DRX B;  1QHT A;  2EJ7 A;  4GX5 A;  4X88 A;  4DV0 B;  1VF6 A;  4JAU A;  4PA9 A;  5H2F Z;  3FB5 C;  3JAM N;  3T2M A;  1GN2 A;  1Y74 A;  4YY3 O;  2YSU B;  1NTM H;  2UXB O;  1GM9 A;  2XAG A;  2QTS A;  2IJK A;  2GSM B;  1A32 A;  1W0J G;  1XL4 A;  1WNS A;  2UXX A;  4O4H A;  3ZS8 C;  2DYS B;  2ZKO A;  4B3T B;  2A79 B;  4MVM A;  4L8J A;  1IZ3 A;  1QNM A;  4LNU B;  2B1G A;  1JMK C;  4MS2 A;  2LW7 A;  3ZJZ A;  4MT8 A;  3HKE A;  1RP3 B;  3HKB B;  3KKY A;  4NXM O;  3BCC H;  4JI8 O;  5DM6 V;  4J41 A;  5D5Q A;  2QKS A;  4A5U B;  3ZMZ A;  5FNV B;  1JR9 A;  1URF A;  4TV8 A;  3HR0 A;  3E8G A;  3U11 A;  5JH7 B;  5KHH A;  1IBK O;  1H2G A;  2YIA A;  1KEC A;  3LUT B;  3Q4H A;  2JDI G;  2ZNI A;  1EFR G;  3CB2 A;  1YSC A;  3G67 A;  4JYC A;  1AI7 A;  2YI9 A;  5LXT B;  1I5X A;  3CJH B;  3W7U A;  4JV5 B;  3RYI A;  1SA0 A;  2OIG A;  1QLN A;  2EJR A;  3ZCC A;  2QA4 V;  1QQC A;  4UB6 Z;  3MHS C;  4JYA B;  2KKW A;  1M56 C;  2HVJ C;  3SPG A;  1RSO A;  5IYC O;  4LH7 A;  1NQT A;  3OEH G;  2BOB C;  4O2B A;  3G71 V;  3K57 A;  2F66 C;  2BTO A;  1PNK A;  2EIN C;  4K0K O;  3N2G B;  2AXT Z;  4DR7 B;  3DC5 A;  1V54 C;  1S72 V;  3N27 A;  4IYH A;  4ZHQ B;  1WA8 A;  1FFX B;  2Y48 A;  1F23 A;  4FMT A;  1OZ0 A;  3CRM A;  4PI2 A;  3TK1 A;  4DUY O;  4OX9 O;  1N32 B;  2FYU H;  4FLT A;  1SQX H;  3BA8 A;  2GTA A;  1R73 A;  4DR2 O;  1VQO V;  2Y0P A;  4X66 O;  3U0Z A;  2WLL A;  3JD1 A;  1N4C A;  2E5L O;  2ZXW B;  1AJP A;  3VQW A;  2P4K A;  3KCX A;  2LGW A;  2XHB A;  2Q6A A;  4O4L A;  4TWK A;  4X1I B;  3CME V;  3ZRW B;  2DWE C;  4DR6 B;  1VQP V;  4GX1 A;  2CTR A;  3F5T A;  3CCV V;  2JGD B;  4R6Z A;  1B6Q A;  3RN4 A;  3OR7 C;  2PY5 A;  3OE7 G;  3K08 A;  1E1Q G;  2Q8V A;  2GUZ A;  4LFA B;  4I4T B;  2K1E A;  1G1X B;  4DW1 A;  5KAF Z;  1MMM A;  3BAA A;  2H94 A;  1ZSP A;  3CD6 V;  4ZM5 A;  4WFF A;  2CH7 B;  4K8X A;  1MZE A;  4WFB V;  4JAV A;  1K73 W;  2A0L A;  1HNW B;  3ETD A;  1K5Q A;  1YCI A;  4I7Z B;  1Y6X A;  1M57 C;  3JAR A;  3FB6 C;  1OCO C;  1Q6I A;  2PI4 A;  5LA6 A;  5LHI A;  3ZIA G;  3ZHV A;  1IBM B;  3IJ4 A;  3J81 N;  2CE4 A;  4HNA B;  5CB4 B;  4L87 A;  2PGG A;  5BMV A;  4DXW A;  1G4Y B;  4EB6 A;  3THO A;  4UV9 A;  4UVA A;  4DR4 O;  4KUM A;  2ITC C;  1XHX A;  3U10 A;  1Z5W A;  1IBL B;  1GAX A;  4PHZ A;  4FM2 A;  4AIL C;  2XND G;  3SJA C;  4DUZ O;  4MVO A;  2PYL A;  4FPP A;  2OYQ A;  2AHY A;  1Y74 B;  2HG5 C;  3VQV A;  1FAF A;  1JFF A;  5K1P A;  4WFE A;  1GM7 A;  1WPX A;  2IU0 A;  1KP2 A;  4O4H B;  5D5P A;  3FD9 A;  1DTO A;  3RGB A;  4H37 A;  5EIB D;  2BE3 A;  2L35 A;  3JAK B;  1QR9 A;  4MW8 A;  1AB3 A;  4JZG A;  1SER A;  3T1Y B;  2A9H A;  3FFQ A;  4RUF A;  2N74 A;  3HKE B; 
#chains in the Genus database with same CATH homology
 3SPC A;  2NLJ C;  1VQL V;  3ZRX A;  1RPR A;  4QNH B;  1R3I C;  3VBB A;  4MVS A;  2X7R B;  4BIU A;  3OMA B;  3OMI B;  1FXK B;  2DYS C;  4RAI A;  5EBW C;  5B1B B;  5CBH A;  2P7T C;  1RM1 C;  4XDK A;  3ZRS A;  2WPD G;  3LSS A;  2QTO A;  3JD2 A;  2F43 G;  2UXN A;  3EFF K;  3B77 A;  1Q86 W;  4MVU A;  3T4D A;  3E83 A;  3JD3 A;  5EC1 C;  1VQM V;  4LP8 A;  2LFS A;  3ZRV A;  5CMU A;  3E35 A;  3CC2 V;  1YJW V;  2ATK C;  2W0F C;  5CA3 A;  3MD0 A;  1VQ4 V;  1S76 D;  3OR6 C;  5B1N A;  1PNL A;  4RO2 A;  3SYQ A;  3ABU A;  1M9N A;  4PA7 A;  2DQ3 A;  1PD3 A;  3CCU V;  2P90 A;  3AG4 B;  4FIP C;  1OCZ C;  2AHZ A;  3M99 B;  1S3J A;  2B5U A;  4H33 A;  1BHB A;  3K04 A;  2Z5U A;  1QLE B;  2DW4 A;  4R7C A;  1ZWI C;  3D3I A;  4R50 A;  1R3J C;  1QCE A;  3ZRW A;  2P6J A;  1JX9 A;  4JTD B;  1YIT V;  5IYD O;  4JAS A;  4I5S A;  5GW7 A;  4WCE V;  1K7D A;  5B3S C;  3AG3 B;  1KKD A;  5KA5 A;  2Q68 A;  5EK0 A;  1SRY A;  3W7S A;  3ZMT A;  1YI2 V;  5J9P C;  3ZMU A;  3E86 A;  1F51 A;  4MVQ A;  5LHH A;  1IXM A;  1OCR C;  4E2L A;  1K4C C;  2WLM A;  2OCC C;  4Q20 A;  3OAA G;  2MK3 A;  4QE9 A;  2HR3 A;  1M57 B;  2EIJ B;  2X6B A;  3E8H A;  3QNE A;  3D36 A;  2GHY A;  4GX2 A;  5LGT A;  4R8C A;  4RQF A;  2OTL V;  5IY5 B;  1OCO B;  4XDL A;  1YJN V;  3FYI B;  3GB7 C;  5B1O A;  3X2Q C;  5LGN A;  2LFR A;  2WLH A;  3ABL C;  3CXC U;  4E2H A;  1YHQ V;  1QR8 A;  3B8O A;  3F7V C;  1JOY A;  1M90 W;  3B8P A;  4UXN A;  3WG7 B;  1L1F A;  3DTU B;  1AR1 B;  2JJ2 G;  1GMG A;  2WLI B;  2ZR2 A;  2JEU A;  3FYE B;  3QO7 A;  3ZMS A;  1GKF A;  3SYP A;  3SPI A;  3B8N A;  4LCU C;  2EIM B;  2WLL B;  4JPR A;  3ZN0 A;  2Q67 A;  3ASN B;  5C93 A;  3CYO A;  4QPK A;  5EC2 C;  1M56 B;  4PA4 A;  3UKM A;  2ZR3 A;  3ASO B;  3AG2 B;  2IJH A;  3W7T A;  1SET A;  1PNM A;  2YEV A;  4FJC C;  3JD4 A;  3VOU A;  1FS0 G;  1J95 A;  2R9R B;  3T1C A;  3JYC A;  4GCZ A;  2W6I G;  4OXS A;  2X6C A;  1VQK V;  5L3D A;  2EIN B;  2XAH A;  1Y66 A;  4ASU G;  2Q69 A;  4QIW F;  1K34 A;  1P7B A;  3CCL V;  1S5H C;  2HFE C;  3ML0 A;  1V54 B;  3I55 V;  4WFG A;  3UM7 A;  1CPY A;  2Y69 C;  1KQS U;  1F4N A;  1YTF B;  2DYR B;  2LP7 A;  2ZXW C;  5B1A C;  3P32 A;  3OM3 B;  1NVP D;  4KP4 A;  4MSW C;  1DF5 A;  3CCR V;  4PA3 A;  3GWO A;  2XAJ A;  1TUE B;  3CCM V;  2WAM A;  3ABM B;  2HLD G;  4PDV A;  4HAM A;  3DGE A;  4GX5 A;  4X88 A;  1ORQ C;  4F4L A;  4X8A A;  1GTO A;  5L3E A;  4JAU A;  4PA9 A;  3SYC A;  5CN0 A;  3FB5 C;  5CBG A;  1I5Y A;  3T2M A;  4ZKI A;  1WLE A;  2YSU B;  3CC4 V;  2V1D A;  2R9I A;  1F4M A;  4GX0 A;  4QJF B;  3FB8 C;  2NNU A;  2XAF A;  3OGC C;  4BIZ A;  4G2K A;  1K8A W;  3F5W C;  2IH3 C;  1GM9 A;  3MHH C;  2XAG A;  4P9O A;  2IJK A;  2EIL C;  2GSM B;  1NKD A;  1W0J G;  1XL4 A;  2UXX A;  4UV8 A;  4J9Y B;  4PEL A;  3RVZ A;  4JTC B;  4XBF A;  2DYS B;  2JJ1 G;  3W7X A;  1AI6 A;  4JTA B;  3SYO A;  1JVM A;  1R3K C;  1RM1 B;  1K5S A;  3SPJ A;  3QO8 A;  1QBZ A;  2A79 B;  1K3E A;  4MVM A;  4MTX A;  2JK5 C;  4MTG A;  2B1G A;  4MS2 A;  4PDL A;  3ZJZ A;  4MT8 A;  3OUF A;  5KUM A;  4FK5 C;  3CP1 A;  4U7O A;  2FTK A;  3T4Z A;  2ZQM A;  1XL6 A;  2CK3 G;  3IC7 A;  1NH2 B;  2PI5 A;  5E1A C;  5DM6 V;  1E79 G;  2QKS A;  1W0K G;  4P2Z A;  5LBQ A;  4JGS A;  3NXS A;  5HFM A;  3H01 A;  3K0D A;  3ZMZ A;  4CBC A;  2D3O W;  4RUE A;  2OTJ V;  1PKX A;  4MVR A;  1AJN A;  3WFV A;  2Z3Y A;  1YJ9 V;  2QM8 A;  3K9A A;  1NR1 A;  4CZZ A;  4I9W A;  1YIJ V;  2OT5 A;  4MW3 A;  1KP3 A;  3K06 A;  3E8G A;  3FB7 C;  2QE7 G;  1AJQ A;  1V55 B;  4MVZ A;  1QVG U;  1H2G A;  1KEC A;  3LUT B;  1Q82 W;  1GO3 F;  2JDI G;  2X0L A;  2EIJ C;  1MG1 A;  3ABK C;  1Y4M A;  3SYA A;  2C2A A;  3E2E A;  1EFR G;  3AG1 B;  5L3F A;  1YSC A;  5H6R A;  5IYB O;  2B1I A;  4JYC A;  2EIK C;  1AI7 A;  1YTF D;  3WG7 C;  2X6A A;  1I5X A;  4GT1 A;  3W7U A;  1JPX A;  1QLN A;  2EJR A;  2WWW A;  3ZCC A;  1S0V A;  4XDJ A;  1OCR B;  2QA4 V;  3R65 A;  2EIM C;  2OCC B;  4TSF G;  3MHS C;  4WF9 V;  2BOC C;  3ASN C;  3STL C;  4J9Z B;  5H9C A;  1M56 C;  3EHB B;  1M1K W;  2HVJ C;  3SPG A;  4PDR A;  1JQ0 A;  3X2Q B;  5IYC O;  1OCC B;  1E1R G;  1K92 A;  3HPL C;  3TET A;  1NQT A;  2IU3 A;  1BMF G;  3OEH G;  1KC8 W;  1MOF A;  2BOB C;  2HVK C;  3ABT A;  3JD0 A;  3CCE V;  3G71 V;  4BW5 A;  1K97 A;  1MAB G;  4UVC A;  1W2B U;  2HKO A;  2IJI A;  2EIN C;  1H8H G;  1PNK A;  4PDM A;  4E2C A;  1DF4 A;  1V54 C;  3CCS V;  2EZP A;  1S72 V;  3IGA C;  2XOK G;  3BEH A;  2Y48 A;  1F23 A;  4FMT A;  1OZ0 A;  1JJ2 U;  3TK1 A;  4UUJ C;  5DN6 G;  3W7W A;  1R6K A;  5BZB A;  3G4S V;  2W6J G;  3P30 A;  1R73 A;  3PJS K;  3ABM C;  4LC1 A;  4P9P A;  1FXH A;  1VQ7 V;  3STZ C;  1FXV A;  1VQO V;  2EBO A;  1FXK C;  3OW2 U;  2WLL A;  1BHA A;  2V7Q G;  5B1B C;  3G6E V;  1GM8 A;  1QVF U;  1N8R W;  1EBO A;  3K0G A;  5L3G A;  1R6N A;  2Y69 B;  3JD1 A;  2ZXW B;  1AJP A;  5B1A B;  1LNQ A;  2ZD9 A;  1DLB A;  2H8P C;  4WFH A;  3ZMV A;  1OHH G;  2Q6A A;  2P67 A;  4TT3 G;  4TWK A;  1NR7 A;  3CME V;  4WFA V;  5LHG A;  1VQN V;  3ZRW B;  2DWE C;  1VQP V;  3CCJ V;  2IH1 C;  1ROP A;  4GX1 A;  1VQ8 V;  3LDE A;  3CCV V;  3RVY A;  3OMN B;  4R6Z A;  1B6Q A;  1KD1 W;  1K4D C;  3E89 A;  4U7N A;  5L3B A;  2WLJ A;  3FKS G;  1H8E G;  3KG2 A;  3OR7 C;  3OE7 G;  1PL0 A;  3K08 A;  1E1Q G;  1VQ6 V;  3AG4 C;  2KB1 A;  3B8M A;  4P30 A;  4E29 A;  2M7W A;  3IFX A;  1NBM G;  2K1E A;  5L3C A;  1QLE C;  1THZ A;  2EIL B;  1NJI W;  4BAY A;  2H94 A;  4KFM A;  3OFN G;  5IDJ A;  1FXK A;  3ETE A;  3LDD A;  1SES A;  3AG3 C;  3CD6 V;  4LBE C;  4G28 B;  2JEX A;  4PA6 A;  1Q81 W;  1NVP B;  1EZJ A;  4ZM5 A;  4WFF A;  3E8B A;  4RQE A;  1OCZ B;  3LSQ A;  4UVB A;  4WFB V;  4JAV A;  3SPH A;  2XAQ A;  1K73 W;  2A0L A;  3K03 A;  2JIZ G;  1HWY A;  3ETD A;  1S77 D;  1V55 C;  1K5Q A;  5HFL A;  4Z1M G;  3CC7 V;  1CP9 A;  3CCQ V;  3AEI A;  4N23 A;  1ENV A;  1M57 C;  2WLK A;  3HB3 B;  1SZT A;  2QM7 A;  5KUK A;  4QPJ A;  3I56 V;  3FB6 C;  5IY5 C;  5B3S B;  1OCO C;  2PI4 A;  1GK9 A;  4JF3 A;  5LHI A;  2XAS A;  3AG1 C;  1AI4 A;  2YEV B;  3QO5 A;  1R3L C;  3ZIA G;  3CPW U;  3ETG A;  4HYO A;  4N21 A;  4JYB A;  1AI5 A;  1Q7Y W;  1COW G;  4MTF A;  3CMA V;  2ZDI C;  4QE7 A;  3LDC A;  4L87 A;  3E8F A;  4DXW A;  1G4Y B;  4UV9 A;  3ABK B;  4UVA A;  3LNM B;  4G27 B;  3OEE G;  5H6Q A;  4MTO A;  4EKW A;  4ZM1 A;  3K3W A;  3ASO C;  4KUM A;  3AG2 C;  2ITC C;  1OCC C;  3ABL B;  5FL7 G;  1MSW D;  1RPO A;  3RBZ A;  2EIK B;  4X89 A;  3F7Y C;  5EBL C;  3BY6 A;  3JCZ A;  1K33 A;  1H38 A;  2XND G;  1G8M A;  1ARO P;  5KA6 A;  1P4R A;  1UJW B;  3ZN1 A;  4YXW G;  3A0R A;  4MVO A;  2WLN A;  4FPP A;  2AHY A;  2DYR C;  2HG5 C;  2ITD C;  5EBM C;  1VQ9 V;  2EZO A;  3K79 A;  4WFE A;  1GM7 A;  1VQ5 V;  1BL8 A;  2HJF C;  2QEX V;  1WPX A;  5CBF A;  2IU0 A;  2WLI A;  1KP2 A;  1CEZ A;  2DWD C;  2ZDI A;  1K9M W;  1DTO A;  4H37 A;  3RW0 A;  2IJJ A;  3SJQ C;  4HZ3 A;  1JCH A;  1QR9 A;  1NH2 D;  4MW8 A;  5LGU A;  3OUS A;  1SER A;  2DQ0 A;  4DO2 A;  4ZBM A;  2WSS G;  2A9H A;  4RUF A;  2IW5 A;  3TCU A;  1FFT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...