4E38A

Crystal structure of probable keto-hydroxyglutarate-aldolase from vibrionales bacterium swat-3 (target efi-502156)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
FQSMMSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSDAAVEAIRLLRQAQPEMLIGAGTILNGEQALAAKEAGATFVVSPGFNPNTVRACQEIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLVTNGEWDEIARLTREIVEQVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of probable keto-hydroxyglutarate-aldolase from Vibrionales bacterium SWAT-3 (Target EFI-502156)
rcsb
source organism Vibrionales bacterium swat-3
molecule tags Lyase
molecule keywords Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate a
total genus 78
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature ec 4.1.3.16: 4-hydroxy-2-oxoglutarate aldolase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4e38A00
3WK2A 3TAOA 1B4KA 5AYYA 3G1AA 2HSAA 5HUPA 4A21A 2NX1A 4UR8A 5F4WA 4DPPA 4IJBA 3EWXA 2NV1A 1P0KA 4GBUA 3W2MA 4KFNA 1YDVA 3PM6A 2Y63A 1O5KA 4HSNA 3W2JA 1QO5A 1Y0EA 2RDUA 5A8GA 3EKZA 3G22A 5F4SA 3GAKA 4CNOA 3EXSA 5L6UA 2C6QA 1XUZA 4XKYA 4X22A 1OF6A 2FB3A 5D2WA 3A23A 4XBKA 2LLEA 3Q94A 3L0KA 1TTQA 3M41A 2J27A 1TYGA 4HIBA 1OX6A 4LNYA 2PCQA 3P5ZA 2A1YA 2BTMA 2G5WA 1R2TA 5G1YA 2JKPA 1QPNA 5HULA 3P61A 1T0OA 4CQAA 3QMRA 2F84A 1TPVA 3BK0A 4ZZ9A 4MIMA 3QF0A 4MLRA 5E0KA 5HR7A 4NUWA 4OT7A 4N4QA 1LRQA 1OG0A 3TUUA 3SGUA 2CWNA 3P80A 5FF4A 1S5TA 2I14A 3M16A 3W7NA 1KFLA 4H3DA 1XXXA 4UNKA 4MY9A 1JUEA 3FOKA 1L9WA 3QJAA 4N9BA 4RXGA 3M5YA 3P5YA 3B03A 3DFTA 3LCWA 1TRIA 2NXHA 3R5EA 3TW6A 1W1ZA 3GDKA 1LBMA 2FPYA 2CZEA 2ZZ3A 4LS0A 4DO4A 1LCOA 5DY3A 5D2TA 1VH7A 1TPWA 3TAKA 5K9CA 2NX3A 3W1AA 2J88A 1YXCA 4N2YA 4XQ6A 4NT0A 1FXQA 4K6AA 1GPWA 4DF2A 4X2RA 3LCFA 3FLUA 2NWSA 3LHZA 5FEPA 1IXOA 2J9XA 3EX2A 3LTSA 3UWWA 3WJSA 3IIZA 2E77A 5K4XA 4ZQPA 3MHUA 1H7RA 4NZJA 2NUYA 3UWYA 3NQFA 4UIOA 2ZRYA 3O06A 4DEFA 3C2RA 4TMCA 3BG9A 1TPB1 2CFFA 4BI6A 2Y7DA 3EWZA 3LI1A 1TTJA 4O19A 5DELA 1OABA 3RMJA 4LVFA 3MHGA 1LTDA 4FX7A 5C54A 3WJWA 2VFGA 4R34A 3MMTA 3N19B 4FXRA 4K8HA 2Y88A 3TJXA 4UMCA 5G4WA 5D04C 3I65A 2P10A 3UPWA 1SW7A 3W1QA 2Z2UA 3PBWA 1XM3A 5I3GA 2QF7A 3NR0A 3LX9A 4OV4A 5KMYA 1WBJA 4TMBA 5G2HA 2QUTA 1N7KA 2DP3A 3B0PA 1YDNA 3NQ2A 4I9AA 4AF0B 2PC4A 2QR6A 1PIIA 1GTEA 1YPIA 1LRNA 4JYDA 3LHWA 1SZNA 5AN7A 3PR2A 3MJYA 1Q45A 4K7VA 5FF7A 3P74A 1ZENA 4GNJA 4O11A 2ZTJA 1DQXA 3LLDA 1NVMA 3CEUA 2ZFAA 3NQAA 4O0KA 2I1OA 3I68A 4YLWA 1KM4A 1MEIA 3WK3A 3O05A 2C13A 1FWSA 4ZQMA 1WA3A 2X1UA 4UNLA 4DF1A 1QPQA 4FF7A 3UZ5A 4GUFA 1EUAA 5BRBA 1H1ZA 4IMDA 2VC6A 4AHQA 1G69A 3PUEA 1JUBA 1ZNNA 3N2XA 3TSDA 3WK0A 4UC5A 4WZHA 1VZWA 2WO5A 2CLLA 2B7PA 1YADA 4DO6A 3B06A 3GVGA 3LHVA 3UY8A 3MHFA 4GUJA 4YL2A 1Q6RA 3G8EA 1VS1A 1GTHA 2VEKA 3OVPA 4Y6GA 3A24A 2Z0IA 3OHIA 1DJNA 5LSMA 4HN4A 3C3NA 2EAWA 2ZA2A 3MUXA 1HL2A 1I2NA 5TIMA 2G96A 2ZTKA 3HGJA 3M43A 3W84A 4R53A 1G6CA 3INPA 5CSSA 3E49A 3PUOA 4LTSA 2ABBA 1N55A 3IIVA 1FY6A 2QEZA 3C56A 2NZLA 4XUGA 5CZ0A 3S1UA 3TU9A 3NL5A 1PHQA 3LXAA 1K02A 4AH7A 1FWTA 1VCVA 4RV8A 3HG5A 4GUGA 4ALDA 3STGA 3KRZA 5CPNA 5I3HA 1SW3A 4NXSA 4JX5A 3V1PA 1TJRA 1JRBA 3P60A 2DU2A 2FFCA 2ZRXA 1M7OA 4HKPA 3KRSA 3ZWSA 1B4EA 3S6DA 3VFLA 3NZ1A 1Q6QA 4MYAA 4O53A 3TFXA 3W7RA 3QW4B 4I7WA 4S2BA 1HG3A 2QUUA 4IGHA 1M6JA 3LRKA 4ADUA 4NZFA 3RFAA 1K8XA 1OK4A 2A6LA 3HGSA 3P7YA 4FNPA 3IVTA 3LBCA 2VFDA 3W74A 5K9DA 1DKWA 5CZSA 2Q8ZA 3P8IA 3LI0A 3MO7A 3W7HA 1KM6A 1WQ5A 3A5FA 2EPHA 4GC4A 3W07A 3OA3A 1TJPA 1YXYA 4IX0A 3BW3A 2C1HA 2QCGA 5HWMA 1YDOA 2B7OA 3HQ1A 4JTLA 1TCDA 1Z48A 4UTKA 3STEA 4O14A 4LOCA 1P0NA 1W3TA 2QJIA 1RR2A 3GDRA 3ABQA 2VKZG 4M7TA 5FF3A 1H5YA 4Z0SA 3TCEA 5D09A 3IGSA 2QCEA 1OFAA 3L0NA 1C29A 2OCZA 2QDGA 1GJPA 2ISVA 1KTCA 4LV9A 1L6WA 4RLIA 2QAPA 4BFAA 4AAJA 3VCRA 4ORMA 5BMXA 1BKSA 3PAJA 3PULA 3L5LA 1PV8A 4DF0A 3FYPA 3M5VA 4O0ZA 3LCGA 4JR5A 3HBLA 4XZ9A 2C16A 4PTNA 1XDLA 1F7BA 4RJEA 1PCWA 4UTTA 1O60A 4TO8A 2J9ZA 1W3IA 2WV8A 3E9AA 4EF8A 3QEZA 1DBTA 1F5ZA 3NPXA 2GQ8A 4E0CA 5F1VA 1QPOA 1JUKA 5D2XA 4NJHA 4LVDA 2OT1A 1ZALA 1M5WA 3G1XA 3CWNA 3W2KA 1YYAA 1C9DA 1GVQA 4AWSA 1AW1A 3LRMA 4RZ6A 3W1LA 3NGJA 2VFHA 6ALDA 4PCFA 4QQ3A 1ICSA 4K39A 5EY5A 3HG4A 2V2HA 1W5QA 2NUXA 3CTLA 4JTIA 3CQ0A 4IMCA 5AYZA 5LGXA 3P67A 4ZQRA 3O8AA 1WYIA 5BW6A 1ZAJA 1Q6LA 4D2JA 4UMAA 1Q3NA 1QDSA 4JTGA 1LLZA 3T78A 2YYUA 1RD5A 3L65A 3W7JA 2NUWA 2ATSA 5AYXA 2VELA 5D2VA 4LS1A 3C52A 2DZUA 1PE1A 5D30A 3KRUA 3PC0A 1JJKA 3C4UA 2YCEA 5E93A 4WJEA 2P0OA 4K7YA 1SSDA 3W75A 3I7RA 2X1RA 3T7VA 1I2QA 3PBUA 3DBPA 1VRDA 3LV5A 2BSLA 2WPBA 2V5LA 1UUOA 4FNQA 4QNEA 4O52A 5CKSA 3BV4A 3W6YA 3T55A 3GAYA 4RX0A 2ZDRA 1W5OA 3B4UA 4DXVA 2ZZ4A 3L21A 2X30A 4NJIA 2WQPA 4JX6A 3IIXA 3G1DA 4JTHA 2DZXA 2CLFA 4ZMGA 3S42A 3O6CA 4J9JA 3JR2A 1EEPA 3IV3A 1GWJA 2TSYA 1GG0A 1LOSA 4WXZA 3TJLA 1TPUA 3SIZA 3EWYA 3QSRA 1KTNA 2RDWA 2EHHA 4UCGA 3UXDA 1K3UA 1IGSA 4OGZA 5D02A 4TX9A 3FEMA 1LBLA 2J9YA 3EWUA 4M5PA 4EOUA 3G3MA 4Y96A 3DAQA 4O1BA 4MJMA 1YTDA 3G1YA 4K36A 1RVGA 4LW7A 1KV5A 1BWKA 2E5CA 3W9ZA 3KX6A 2VOMA 1OFPA 3P62A 3IEBA 1KM5A 2FDSA 2E6FA 2H8ZA 4H6KA 4PFMA 3DHDA 2VEPA 5HQEA 2PRMA 1YPFA 2GJNA 3D0CA 3OBKA 3HF3A 4LRSA 1JRCA 4GE8A 5LHFA 3HPZA 4JYEA 5LGZA 3GKAA 1OK6A 3M47A 2Y89A 4XWUA 1W5PA 3TROA 3LTYA 5EA9A 2Q8LA 1PS9A 2CLOA 2C19A 1QWGA 3OEXA 5D33A 4PL1A 1DOSA 5LKYA 3RNDA 3W85A 5FESA 3PSVA 3F1QA 1LRTA 2DZWA 1XKYA 3KFTA 1FCVA 1KTBA 1DL3A 2WSYA 4GRSA 1K7FA 2BWGA 1J5TA 3GR7A 4NNCA 1KFBA 1SQ7A 3GDLA 4Q4KA 3L0GA 3OVQA 1TSIA 2PURA 3S0CA 3N9SA 1Z44A 1LYXA 1W0MA 3R8RA 3W1TA 4UTUA 3TX9A 2Y70A 4I7VA 3GXNA 2IQTA 2J6XA 4UFHA 3V75A 2ISWA 2RDTA 2PRLA 3TW7A 4CCDA 4GUIA 4LVBA 3RU6A 3W72A 2FB2A 4S2CA 4IQLA 2Y7EA 4DPQA 5J5RA 3QC3A 1W3NA 2YPIA 2VEIA 3L2IA 1PHWA 1K8YA 3NQDA 3F4WA 4WOQA 1OVDA 4NJJA 3W73A 2QCDB 3T44A 1BWLA 3L67A 3O63A 4Q33A 2RHGA 4LY8A 3LLFA 3JRKA 2HMCA 3BLEA 1G67A 1S5VA 4WY0A 3PY2A 2QKFA 1ML1A 1DHPA 3IVUA 3R13A 3O1NA 4HNVA 3C6CA 3EX1A 2E1DA 4PEKA 2FQIA 4CNNA 3DGRA 1UB3A 1SR9A 2WJZA 4MYXA 4O50A 7TIMA 3LCLA 1PVNA 5DCDA 1T99A 1U83A 5C55A 1NF7A 3QYQA 2ALDA 4POCA 1FXPA 4QISA 4PC8A 3NL3A 1WX0A 3TXZA 1QFEA 4UMBA 3RF9A 1KBJA 4O10A 4LVGA 3ATYA 2QDHA 4A2SA 1A5AA 1KW1A 4TR9A 5C5YA 4UTTC 4JXCA 3W7CA 1ZFJA 2RKXA 4CNPA 3R2GA 1SUXA 3IVSA 1G7VA 3T4CA 1R46A 3LHTA 4FEZA 3B0VC 4ZQOA 3F03K 5DBUA 2HS6A 1QMLA 3W71A 2XN2A 4JICA 1MZHA 4JNMA 1NAL1 1G7UA 5J5DA 3S5NA 1W31A 5TBOA 3BARA 1MEHA 4GJ1A 4BI7A 1I2PA 3B05A 1B3OA 4Z1DA 4O17A 1WXJA 5L9FA 4FNTA 1TPH1 4JY8A 1K03A 1HO1A 1XCFA 1TV5A 2D73A 4MLJA 4IXHA 1LOQA 2WOQA 3KVLA 4UFJA 1T96A 5EPDA 4HPJA 4NXKA 4QNWA 1SO4A 1OYAA 4LRTA 5GVJA 3QPYA 1QAPA 4NX5A 5F2LA 1R2SA 1SO3A 3TSMA 3HG2A 1OYCA 3RLUA 1QOPA 3HJZA 1A5CA 3S5ZA 3TQ0A 4HNNA 4H4IA 1AW5A 3THQA 3NXFA 5A5WA 4MZ1A 3I7QA 1JCXA 3THAA 4PL2A 3NO5A 3MI2A 4XTDA 1KLYA 1FDYA 4UTHA 4DQWA 3NEVA 4LS2A 1H7WA 5DXXA 5AHNA 3UXAA 1I2RA 3NQCA 4AEOA 3LB0A 5HINA 3MI6A 2ZZ1A 4JS3A 3RLVA 1LZOA 5KTLA 1JCYA 3MW7A 2CLEA 4W9TA 1XBZA 5FI8A 3GK0A 5MHBA 3FJLA 2GPTA 1FUYA 2V8ZA 2ZA1A 1VC4A 4JTTA 2CLHA 4GXMA 2H90A 1D9EA 2ZRZA 1KM1A 2A85A 5HNRA 5AOUA 5K3VA 4HNUA 3Q2DA 1WDWA 2YX0A 3K30A 3PBVA 4GWEA 4PH6A 1VLIA 3UWUA 3UWVA 4AVFA 1YTKA 5LNUA 5K9XA 4M7SA 4UFKA 3TQKA 1X1OA 4MFEA 3B8DA 3ELFA 4WY0B 1VR6A 1SW0A 5LNVA 4QM1A 2OJPA 5HR6A 3M0ZA 1ZCOA 4E2BA 3EX4A 4FXSA 2QJGA 4AB4A 5CPOA 1QPRA 2DZVA 3G0UA 4UTMA 1SU5A 4M6PA 2Y7GA 5C6MA 3ZFHA 2C3ZA 2QJHA 2YW4A 4A22A 1LORA 3NPWA 3W7QA 1AW2A 3MBDA 3NQ7A 4MY1A 1JVNA 2X1TA 3PS7A 3UQNA 4A3UA 1HFBA 2A7PA 8TIMA 2CLMA 2XFWA 3AO0A 3SR7A 2BXVA 3DFOA 1R2RA 1TRDA 1TTIA 1H50A 2AQWA 1F6KA 3NOEA 1EIXA 4ICNA 3LDVA 4RKAA 3QH2A 3N3MA 2I9EA 1EP2A 3FS2A 1W54A 2Q3RA 4UFLA 1VYPX 3LXBA 5AHMA 4RK8A 4U4MA 3VE7A 2GQ9A 3S1XA 1KA9F 4JD4A 1ZAHA 1EPXA 4Y9AA 4A2RA 3QZEA 1H51A 3G24A 3LXCA 3GR8A 4N4PA 4CQ9A 4KFOA 3FA5A 2Z6IA 4MKNA 1EA0A 2FIQA 2FJKA 3QW3A 3GYEA 1VYRA 2W6RA 3W2NA 3LOTA 2GJLA 1H1YA 4FNSA 5AHEA 3HIJA 4OQVA 3CT7A 1ME7A 3G1FA 4FHAA 2YXGA 4LUIA 2ZCGA 2C15A 4FIRA 2FPTA 1VGAA 3A9IA 5I3IA 1H63A 3E02A 3GNDA 5AC8A 5FEXA 5I3FA 1W8SA 4O18A 3BW4A 2JGQA 3TH6A 3NDOA 2RH9A 4NU7A 3I6RA 5DLCA 3IRDA 2QCDA 4HHPA 2DZPA 3T40A 2NLIA 3NQMA 3BGJA 2OT0A 3W76A 5D03A 2ZZ5A 4NJKA 1WAUA 2ZBTA 4YMZA 4YCOA 1VHNA 1IIGA 1VYSX 1TPFA 4K37A 3UPBA 4ADSA 2EGZA 3LTPA 2V30A 3W7DA 4C1LA 2G95A 4O15A 1VLWA 1I8JA 3EKLA 3NL2A 3O6DA 4JEQA 5AC7A 4M6VA 3TQVA 5G1TA 3UYCA 3KHJA 1I4NA 1HTIA 3GDMA 4O1DA 4UUIA 3MBFA 3W87A 5G5IA 4Z1AA 3C2OA 4N9EA 2WNNA 2OMAA 4O28A 2CW6A 4EVZA 4ONVA 1QR7A 1G4PA 1ICPA 2A5HA 1PL9A 4K38A 4FB7A 4N6EA 1LM1A 4O1CA 3O16A 4P61A 5I3KA 4JGDA 1KM2A 5LNSA 3TIMA 1J4EA 2V81A 1GYLA 1RV8A 4BWLC 2DJLA 1L6SA 2E6AA 2O7SA 3C2VA 1E51A 4NQ1A 1KFKA 1QNVA 3ANYA 3U6WA 2XN0A 1FDZA 4MVAA 1FCQA 2BLEA 2A4AA 3NQ8A 2TMDA 5CSRA 4GFSA 1SZFA 3EXRA 3A5VA 2FTPA 4WQ6A 1RQEA 1XC4A 2Y85A 4BR1A 3L68A 2YYTA 1OF8A 3U2OA 1X8FA 3W88A 1O5XA 4TU1A 3SI9A 2NXIA 3PB0A 1OFBA 3NZRA 3WJXA 3TFCA 1OJXA 5F2GA 5T26A 3PB2A 2OX1A 4M19A 4QJ1A 1KM0A 3A22A 4QITA 5K4ZA 1S5WA 1UBSA 4OE7A 2ZZ2A 4YCPA 4IPIA 2CU0A 4KWWA 3EX6A 3KAOA 5HJLA 4QSHA 1WV2A 3G0XA 2QCCA 3ABOA 3HGRA 5LHEA 2ATMA 2VFIA 1R30A 5F1UA 1SFLA 3F4NA 1UASA 1YLVA 5FF0A 1B9BA 3OG3A 3TV8A 1VCGA 3TNOA 2JKAA 1TQXA 3M44A 2E6YA 4LUJA 4S1FA 3SW6A 1QOQA 2WKJA 3KOFA 3GB6A 4WUIA 4P2VA 3G8RA 5AFDA 4MUZA 5IBXA 2DJXA 3P82A 1I45A 1VPXA 4AF0A 5AC6A 3W70A 1SO6A 1KFCA 1GOXA 1EWDA 3BPWA 1BTMA 3CPRA 3GXPA 3E0IA 3MP3A 3WJZA 5IM51 3SZ8A 4FIQA 3W1MA 1K7XA 1FBAA 1DV7A 3DI0A 1UJPA 1JULA 4AXKA 1SZGA 5DBTA 3CEPA 5LNRA 4FNUA 3DENA 4UFIA 5DXYA 4Z08A 1P5BA 3CHVA 2ZQ0A 4OV9A 2YZRA 1W5NA 2W79A 4IMEA 1M7PA 3IGXA 1IXPA 3W83A 1I2OA 4UTJA 4N6FA 1TTPA 1JCNA 4NNAA 1H62A 3TK7A 3W7EA 3W7PA 1Z42A 2PRHA 3G3DA 4BI5A 3PF3A 4HSOA 5U4NA 3PSWA 3G0SA 1TO3A 3DFPA 3N2MA 3W7GA 4FX6M 3WFAA 4TIMA 2OZ0A 3KVKA 3PG9A 1YXDA 3TDFA 3R12A 2E68A 3U8GA 4RR4A 1AMKA 5F2IA 1OHLA 4UR7A 4EF9A 3HB9A 4LC6A 3S5YA 2GVLA 4WD0A 3GKFA 3WJYA 1FWNA 4IUOA 3TMQA 4Z1BA 3C61A 4ADTA 3UY7A 2CZFA 1OFOA 1F76A 3W1RA 1FDJA 1OX5A 1TMHA 5AHFA 3LCIA 1AL7A 4RZ4A 3UWZA 4KWVA 3E12A 1L2UA 4Q32A 3UNDA 4MJZA 5CPMA 4JIPA 2HTMA 4JDYA 3SSJA 4BWLA 1GVSA 4YWIA 2JGYA 2WSRA 2Q3OA 3C0JA 3GX9A 5DY2A 3PVFA 4IX2A 3QQ1A 1LLWA 1IXQA 4JTUA 3LCXA 5K7JA 4O8RA 3C8FA 3VI2A 1GVOA 1AG1O 1RQBA 2E09A 2ZYFA 3S1WA 4LVAA 5AB3A 2XN1A 3UWQA 1A50A 1XFBA 2C14A 1SO5A 3S9YA 3MYOA 4YXGA 2UV8G 2J24A 4E2DA 4WOZA 5U7SA 3UD6A 3DXIA 5EL1A 3STCA 4QAIA 1JQVA 5I3JA 3NG3A 3GDTA 4LWWA 2B4GA 4ZQCA 1KM3A 2E5DA 1LDCA 3H53A 2VFEA 3C2FA 4RXFA 3W2LA 3ZWTA 3AJXA 1F73A 3BO9A 3S1VA 3DH7A 3QPZA 2CZ5A 2NV2A 3TKFA 1GEQA 5AHLA 3HMJG 1F6PA 3HO8A 4HNTA 1O94A 1XBVA 2KZHA 2QCLA 4Z0JA 1JR1A 3IGUA 2C0AA 3MI3A 2V2DA 5DCBA 1ME9A 3VKJA 2YSWA 2YFNA 1TQJA 2YDAA 2X2GA 2JKEA 2RFGA 3P84A 1UUMA 1YTEA 3L66A 2F7FA 4LC8A 3EX3A 1RZMA 3BG3A 1TB3A 3EB2A 5CZJA 3NPVA 4QIUA 5D05A 4LV4A 1ME8A 1EX5A 3TMLA 1H7NA 3NM1A 3LGEA 3SFKA 2V82A 3O15A 1G4TA 3N73A 4IPJA 3TXVA 1EUNA 3YPIA 1JCLA 2NXGA 1KBIA 3NAVA 5FEZA 3G1SA 3W7KA 3PG8A 1EWEA 4NVTA 4KKXA 1RPXA 3W1XA 3KVMA 1GT8A 3DU0A 1ZAIA 3NVTA 2GUUA 4PA8A 3KVJA 3M7WA 3NQGA 1JCJA 1WOAA 3CLMA 2PE4A 3JS3A 3HPSA 5KINA 1TPC1 2QCFA 1EP3A 5CZTA 3L5AA 1LP6A 4AWUA 2W0UA 1H7OA 1NFBA 4O54A 3MWAA 4MOZA 3CIWA 2GVJA 1V5XA 4X9SA 4N9DA 3ATZA 3PWAA 3W1UA 3ABSA 5D38A 1UCWA 2ZRWA 1A5BA 4CCEA 5D37A 1KFEA 5CG7A 3P81A 3NL6A 4N02A 1F74A 2R94A 4CQ8A 2Z1BA 2A6NA 3TSBA 2AAMA 3G18A 3CM4A 3Q58A 3SJ3A 4DBDA 5BNKA 1FCBA 4OBTA 3LBMA 1DVJA 1LROA 4XTIA 4L4MA 3H55A 4DELA 2P1FA 3GNNA 4JN6A 1TV7A 2A7RA 2ISSA 4O1AA 4HPXA 1N8FA 2HS8A 3H54A 1A53A 1G4EA 3W1PA 1ALDA 3NPUA 1LBFA 4K8EA 1DORA 3LRLA 4ZQNA 4N9CA 2QCHA 1IF2A 5EYWA 4BF9A 1S3HA 3PBYA 4O12A 2GVGA 3TC6A 2EF9A 4I7UA 3WK1A 5CGQA 1V7YA 3O07A 4JIQA 1F2JA 4IWWA 3MYPA 1QCWA 2ZRUA 3CU2A 2R91A 3LERA 1C8VA 3M1ZA 1WOBA 4AHOA 2AGKA 3IIPA 5EBUA 2VXNA 3IIOA 3S8HA 3NQVA 1J2WA 3QQ0A 4R33A 5KZEA 1VQTA 3LHUA 4AHPA 1XUUA 1D3HA 2H3BA 4U28A 1A5SA 3B0UX 3FKKA 1CI1A 3PUDA 3ABRA 3W7LA 5LZLA 1H7PA 2C18A 5HUOA 3BVJA 1GZGA 3BW2A 3W7MA 3EWBX 3B04A 3GIYA 1TPDA 2A7NA 1O4UA 1VHCA 2WNZA 2ZA3A 3DHFA 3KXQA 1OFEA 4IOTA 4ZVJA 4Y90A 1IIHA 2FPVA 5CPLA 4JX4A 4UTIA 5D32A 2QUVA 4WX2A 3N9RA 2DORA 2YW3A 2JBMA 1ADOA 4OU1A 1OFRA 2R8WA 5F4XA 3FYOA 1FWWA 2VFFA 1TREA 2JK2A 1GQNA 2O7QA 1H7XA 4JTEA 2H3DA 3LV6A 3SECA 4UTWC 3QSTA 5EKYA 3NQ6A 2E5BA 5G2IA 3L5MA 1NSJA 1DJQA 1MXSA 2A2IA 3N34A 3BLFA 3TC7A 3CB8A 1GG1A 2V9DA 3LCHA 4JYFA 1SSGA 2BX7A 4EWND 1HUVA 2H8XA 3DFNA 1CX9A 5BMWA 1XL9A 4UFMA 3BGGA 2X1SA 3EXTA 1ONRA 3VNDA 1AL8A 3E96A 4ML9A 3STFA 4O13A 4FX8A 3FFSA 3BG5A 1EP1A 2V2CA 3TR2A 1FX6A 1DQWA 1FCUA 1O95A 3M9YA 3HPXA 3L9CA 1MEWA 1SZEA 2GQAA 3I7SA 1FQ0A 5KZMA 2E6DA 1X1ZA 3DFQA 1HO4A 2VEMA 4XBSA 1RQHA 1Z41A 4R7JA 1P1XA 3W7OA 3G1HA 3QM3A 4MFDA 4E38A 4MZ8A 4O4VA 1THFD 1H60A 5KSWA 1MO0A 4G1KA 5HMSA 3GLCA 1R47A 3ZR4A 3G1VA 2Y6ZA 4Z1CA 5HWNA 4BK9A 3HGOA 2YFOA 3UZJA 2NWRA 1KV8A 2CZDA 1K7EA 2Y7FA 1BEUA 1JQXA 3RK8A 3NNTA 5IBXC 3CIXA 2B7QA 3TE9A 3EEGA 4LU0A 1CW2A 4RZ5A 4UTWA 3W86A 1KFJA 3EWWA 5E1QA 5LNWA 3W23A 2DZSA 1W5MA 1ICQA 3FIGA 1WBHA 3M5ZA 3P8JA 1OX4B 3SGZA 1ZHAA 3HG3A 3LHYA 3Q37A 4ORIA 5DCEA 2TYSA 1OFDA 1H61A 3QFEA 4OHQA 1B57A 1U5JA 4JTKA 3USBA 1NF0A 5G2WA 4GUHA 1FWRA 1SFJA 1W37A 1X7FA 2V0TA 1GVFA 3C2EA 2TPSA 5TQLA 1TPEA 4RCXA 2TRSA 3LM7A 1D3GA 1OFQA 4WXYA 4WY0F 3M5XA 4CCCA 4B5NA 3OVRA 4JTFA 5BOOA 1W56A 1GYNA 3GXTA 3OIXA 1SPQA 4JTJA 2YR1A 4JY9A 2DZTA 2QCNA 2CLIA 1TIMA 3NQEA 4IXXA 1PCKA 4IMFA 4XKYB 2Z6JA 3DKLA 1ZJIA 5SWUA 4MZYA 2CLKA 5G4EA 4MY8A 1OX4A 3QMSA 3W3OA 3FJ6A 4PODA 1MSSA 1IXNA 4A29A 3BLIA 1XBXA 2YGYA 1XDMA 1X6UA 2V5BA 4FNRA 1OYBA 5HWJA 2X16A 3SY5A 4X3ZA 1Q6OA 2FLIA 4O16A 2H6RA 3TA6A 1JCMP 4ZL1A 5F2MA 3GZ3A 4DO5A 2G97A 4Y8FA 4DBEA 2QCMA 2Y62A 1VJIA 2BZNA 5ABTA 3ZS4A 4FO4A 4NX0A 4OWGA 3DI1A 3FKRA 4NNBA 4O4WA 4CLMA 3DFSA 4JDBA 1F05A 3QMTA 1KLZA 1XBYA 3NM3A 4JTSA 5H91A 5C2XA 2ZRVA 2VENA 4HT3A 4IMGA 3MP5A 1L6YA 2ZZ7A 1XI3A 4AMAA 1P4CA 4UXDA 4NJGA 3DZ1A 4KFPA 2EKCA 6TIMA 1AK5A 3DKJA 4UTLA 1GVRA 1LOLA 1ZY9A 1K8ZA 1NEYA 3CC1A 3MP4A 2NX9A 1TV8A 4AWTA 3VE9A 2B7NA 2ZZ6A 3M6YA 3S5OA 4EIVA 4LT9A 5K2ZA 5FEWA 2QAFA 3W2UA 2WSQA 4C1KA 2WNQA 3QRHA 5H2ZA 1QO2A 3R89A 3NYZA 2Y61A 5D2YA 3NA8A 5EMUA 2ABAA 1T8XA 4MPQA 5DN1A 2A21A 4M6QA 3N14A 5KZDA 1VCFA 2GOUA 4L4LA 2A0NA 3W1NA 3A21A 2B0MA 3W7IA 3CWOX 4O57A 2R14A 3HOJA 3O6YX 5KITA 5AHIA 3W22A 1G4SA 1EB3A 5FF2A
chains in the Genus database with same CATH superfamily
1C8YA 5CAHA 4D1IA 3IUIA 4UR8A 4J7RA 1ITQA 2O55A 1OGBA 3W2MA 4L4PA 2WNWA 1RJQA 1O5KA 2Q6ZA 4H8HA 5LIUX 4W88A 3UZZA 3VDHA 3N4EA 3UJFA 2C6QA 1SMDA 4F79A 3K8KA 4XKYA 3SADA 5JU6A 1DPMA 4FS9A 2LLEA 3NSMA 3Q94A 5HNNA 4H83A 2PCQA 1R0MA 4Q8TA 3SEPA 5ABEA 4PUJA 5HULA 3P61A 1T0OA 4CQAA 2H9AA 3BK0A 3BSHA 4NSBA 5GPRA 5IOBA 4U3CA 2YB4A 1MW1A 4C7FA 3VGHA 1A0CA 1J0JA 4QFUA 5E0KA 4UTFA 5A6TC 1ZJAA 4OT7A 2AGTA 1T5AA 1Q5MA 4GQ0A 5M17A 3M16A 3ZT6A 1DXFA 4W4QA 3O7UA 3PJXA 4UNKA 4KRZA 5T9BG 1JUEA 2HISA 3QJAA 4N9BA 3M5YA 4YN5A 3B03A 4PBGA 2WHMA 2NXHA 3W6LA 3WD1A 3OA5A 1W1ZA 1RLDA 2EPNA 3BAWA 3GDKA 1LBMA 2CZEA 1O5RA 3AYSA 5E6YA 1LCOA 5DY3A 1DWFM 1TPWA 2NX3A 3VNZA 4PMVA 2E40A 1YXCA 2F2HA 4XQ6A 1VPYA 1VJSA 4DJED 4K6AA 3MS8A 4GI9A 3LCFA 3FLUA 4PN2A 3OZMA 3LHZA 4YIWA 3FGCB 3UWWA 5FA5A 3WJSA 5A2CA 2V5DA 1NQKA 5CPTA 3ARRA 1YRRA 4NZJA 2QULA 2Z4GA 3OGVA 3UCCA 3KLLA 4EAMA 1TTJA 4O19A 3U57A 3MHGA 1LTDA 3BCFA 4R27A 5BOEA 2F6KA 2VDIA 3DGBA 1V6WA 2PLCA 1TIWA 4FXRA 3H4WA 4UMCA 3WUFA 1T40A 4IP7A 4C65A 3UPWA 1SW7A 3W1QA 3PWIA 5CPSA 1HJWA 3QYSA 2Z00A 5JUVA 3PBWA 2REQB 1XM3A 4RDWA 2QF7A 1B90A 3NR0A 4OV4A 1WBJA 1NM9A 4IFRA 2QUTA 4KQNA 4KEMA 1YDNA 4AF0B 2QR6A 1GHSA 3V18A 3PPGA 4IQEA 3PPHA 3LHWA 1SZNA 3UNTA 1UPMB 3MJYA 1Q45A 4Z2JA 5FF7A 1QRQA 3KL0A 4A3HA 1ZENA 3QR1A 5FCZA 4YU1A 2ZTJA 3SCOA 3VMOA 1ZJBA 3LLDA 2J25A 1KM4A 3FGCA 1MEIA 1SJAA 4FMVA 3QTGA 1DXEA 3PBMA 2X1UA 1QPQA 4MDOA 3UZ5A 4AHQA 1PZ1A 1Z6KA 1G69A 4DBWA 3WK0A 4WZHA 2WO5A 1UKSA 2ZOXA 4KWUA 2PC8A 4PTXA 4GZEA 3DG6A 3H2OA 3QZ6A 3ONCA 3WDIA 4YL2A 3WLPA 1BVWA 4X0NA 2ZX7A 2WVSA 1DQUA 1DJNA 3T0BA 3SURA 5EU9A 3CK5A 3IACA 4EX4A 3KS6A 2ZTKA 1F3XA 3GVWA 1GZ1A 4L1GA 2WJDA 3W84A 4R53A 5CSSA 3L2LA 3PUOA 2OLHA 3GS6A 4UR9A 1G01A 3UU0A 2NZLA 1RJPA 2WBGA 5CZ0A 4ZCWA 2D0FA 4MNJA 4GIYA 1Z69A 4GUGA 1VBRA 5I3HA 2XDFA 1SW3A 2BHUA 5ENLA 1YDYA 1S2TA 3P60A 3LEPA 2WM1A 2ZRXA 3FVMA 3KRSA 3GIQA 3VFLA 4DM1A 3MVIA 3NZ1A 4MYAA 4KH2A 5IXEA 2PUZA 3TFXA 3W7RA 1HG3A 2D2JA 4JEJA 1M6JA 3LRKA 4ADUA 3RFAA 1OK4A 2A6LA 3HGSA 3RPTA 3AI0A 3LBCA 4U2ZA 4R5EA 2VFDA 3AHYA 5K9DA 4GCAA 1R6WA 5MF5A 2IUZA 4DRSA 1KM6A 4B9ZA 3BW3A 3AICA 1YDOA 3HQ1A 4UTKA 4LOCA 2WXDM 1OCJA 3GDRA 4WLCA 2PDFA 5FF3A 3EWCA 4H41A 2IW0A 4KCVA 4LV9A 4HA1A 1L6WA 3XIMA 1MQRA 2ZXAA 2VHLA 1PKLA 3DOPA 1BKSA 2V5CA 4LUTB 1PV8A 2V3DA 3F4DA 3M0IA 3FYPA 1E72M 5HBFA 4GI6A 1F7BA 4UTTA 4LUTA 4ZO8A 3BQ5A 3FY1A 2IKHA 2PB1A 3CZEA 2WV8A 4G8TA 3WLKX 4PMNA 1RP9A 3QEZA 2XIBA 1KWKA 4HA0A 1GOQA 4ZGYA 1OGSA 5F1VA 3TYDA 5GNYA 1K6WA 4NJHA 2OT1A 1ZALA 1M5WA 4PCPA 2BHZA 3G1XA 1JEZA 1M1BA 3W2KA 4AD0A 2IPGA 4ZENA 4FALA 2GK1B 4ATDA 3W1LA 1QHZA 6ALDA 4QQ3A 4K39A 5EY5A 2PDMA 4W7WA 3CTLA 3O8AA 1HVXA 3THDA 1ZAJA 1Q6LA 4D2JA 2TODA 4YTUA 4C5YA 3D6NA 2YYUA 1RD5A 3T78A 2P3EA 3FW6A 2NUWA 2PD5A 2VELA 1ZU8A 4RE0A 2GYIA 4LS1A 3C52A 4QGCA 4PCTA 2YBTA 1UWTA 3PC0A 3WEMA 1JJKA 1E4LA 3PN8A 4K7YA 3GG1A 3W75A 3T7VA 3PBUA 1VRDA 2WPBA 1UUOA 1WAWA 3AALA 3MKKA 3VUSA 1A0EA 2YLLA 4UB9A 4C6PA 5CC5A 2ZDRA 4QJ3B 2WMIB 3IIXA 2CLFA 1R3SA 4J9JA 3GFZA 3JR2A 3LZ5A 4NZ5A 1GWJA 1GG0A 3CHEA 1R9ZA 4IG2B 2XWDA 3R94A 5I5RA 4WSKA 3MQTA 3CYVA 1VKFA 4X2PA 4UCGA 2F2KA 4OGZA 3FEMA 3PTDA 4YTSA 3CPGA 4QG9A 1IEXA 4PFHA 3SRHA 3QR0A 1US3A 2BGNE 1AH4A 4K36A 3VOGA 4A8IA 4PMJA 7ENLA 2ESCA 1KM5A 4PFMA 3DHDA 3EDDA 3GH4A 3E5PA 1YPFA 2GJNA 5TF0A 3B9AA 1EBHA 4LFYA 3VGGA 4H1ZA 3SQLA 4XAFA 4JYEA 5LGZA 3GKAA 3A64A 3DG3A 1UWQA 4MF4A 5EA9A 5XINA 4GGHA 4OUEA 3SCNA 1PTGA 4EANA 3VIMA 4PL1A 3N04A 4HCDA 1POKA 3ZR6A 1XKYA 1FCVA 3NIYA 1YE4A 1ZCCA 3WLTA 1J5TA 2NW0A 4NNCA 3GDLA 4Q4KA 3E5BA 3L0GA 1K70A 1W1B1 3HV9A 3S0CA 1LYXA 3W1TA 5CJ5A 3KWSA 3TX9A 4PTDA 3R6IA 2Y70A 3WSUA 3AMGA 3G5EA 2HXTA 4ZO9A 2IQTA 4MAZA 3UPMA 3LBOA 4D6CA 3B9DA 4LVBA 1J01A 2FB2A 3FDGA 4IQLA 4WKHA 3T05A 5C9UA 3R7MA 2WAGA 3QC3A 1W3NA 1UD2A 5HDRA 2VEIA 3L2IA 1PHWA 2XPKA 4Y9PA 1BQGA 2BGSA 1Q6EA 2OYKA 1WDDA 3OP2A 3N2TA 3KBVA 1X1NA 4WKFA 2QCDB 1BWLA 3L67A 2F6XA 3LLFA 2HMCA 1OIFA 1G67A 1NWSA 2QKFA 4YVXA 2FVKA 1TE6A 1M01A 3BAYA 4PEKA 4MB5A 3D47A 4F2UA 2GVYA 3LCLA 3NQBA 1T99A 5DCDA 1U83A 3GRIA 3TYEA 2WWDA 2ALDA 4V28A 5C8BB 3LD5A 1C92A 4PC8A 1Q6FA 3B8WA 3OB8A 3E6EA 4WSJA 4DWDA 2ISFA 4UMBA 4LY4A 1XLKA 4V1XA 1O1HA 5EMJA 1KW1A 1M3UA 4TR9A 1SUXA 1QW7A 3BJTA 1FWEC 3CNYA 4FEZA 2X41A 3B0VC 3F03K 5EFDA 3VTRA 3N2OA 1G1YA 2OZTA 2EPMX 2ODOA 1MZHA 1UA7A 1QNQA 1HQTA 1MEHA 4O17A 1WXJA 3M0HA 3VOCA 1K03A 2DW6A 2PMQA 4MMWA 1ITUA 4UFJA 1T96A 2J62A 1UIOA 1SO4A 4KRUA 4NHVA 4AX6A 3UETA 3KBSA 2KAUC 4TVUA 4DXXA 1JD7A 3TSMA 2RJHA 3V0SA 2E0PA 4KEZA 3VCCA 3TQ0A 3P93A 4GK8A 3H2NA 2QZRA 5A5WA 1Y65A 4Q22A 3DYMA 9XIAA 4HYVA 3T2OA 2YCJA 4YPJA 3THAA 4PL2A 4XTDA 3VOJA 1KLYA 4DQWA 1V6XA 2CHNA 4QEEA 1H7WA 5AECA 4W8BA 1I2RA 3NQCA 5HINA 5A69A 1NWUA 4HSHA 1XBZA 5FI8A 5MHBA 3FJLA 3WQ8A 3B9NA 2GPTA 4PULA 1OM0A 4JTTA 2CLHA 1GOMA 3WUBA 2ZRZA 4U10A 2A85A 2HVOA 3CMGA 2ASHA 4GYPC 5F7UA 1SVDA 3VGDA 1SR0A 4GWEA 1VLIA 3UWUA 3SCPA 2Z1KA 2BOGX 4OJYA 3IS4A 2J74A 3WENA 2XIMA 5FJRA 4HTBA 1X1OA 4CD7A 4WY0B 4CNUA 5LNVA 4QM1A 3KZPA 1RY0A 3M0ZA 2HJPA 3EMQA 5FJTA 4PMRA 4AB4A 4IIDA 1QPRA 4RNJA 1EBGA 2V38A 1SU5A 1V51A 2B31A 2DSZA 1EQCA 2DVUA 1LORA 3CUHA 2J4GA 1AJZA 3W7QA 3K4DA 3UQNA 1X6LA 1TZZA 1A3WA 2CLMA 2RJGA 1N2VA 3DFOA 1R2RA 1TRDA 4CD4A 1EIXA 3WLQA 4B4FA 4UFLA 2WKLA 3LXBA 5AHMA 4DUWA 5LIWX 4Q8OA 2GDQA 4HZ7A 4ERGA 3QZEA 1S38A 2GVEA 3KLKA 1H2JA 4D72A 2Z27A 3FA5A 3SCWA 3DX5A 3PPCA 3VIFA 1UP0A 1U5VA 3LOTA 2GJLA 3HIJA 4OQVA 3R58A 2C15A 1E0UA 2FPTA 1JYVA 4ERAA 1H63A 3E02A 5FEXA 3IJ8A 5J8LA 4O18A 2DVXA 2P8CA 2RH9A 3B9OA 3S2JA 3MC5A 4EP8C 4MB4A 1QJWA 3TOYA 3OQEA 3CGTA 3BGJA 3QKEA 4KWOA 2FZMA 1XF0A 4DJFA 2ZZ5A 3OODA 4JTCA 4NJKA 2BVWA 1QNSA 1VHNA 1IIGA 4L56A 4ADSA 3LTPA 3W7DA 2HE5A 1VLWA 5HMFA 4E8DA 2ISDA 3VABA 3NL2A 4JEQA 4QSFA 5AC7A 3AHZA 2PTZA 3QVQA 3UYCA 3KHJA 1ZQ5A 4DBUA 4H9UA 2WSKA 3OBEA 4BQ5A 1E43A 2GK1A 2WNNA 2OMAA 1U22A 1FFQA 1G4PA 3E2VA 1LM1A 4GO9A 3O16A 4JGDA 1KM2A 4ZOAA 5LNSA 3VA8A 5AVNA 4NYYA 3VKDA 2DJLA 1EZWA 3AMCA 3C86A 2CKSA 4KEVA 2CZVA 3T81A 3VIKA 1E1CB 1KFKA 3ANYA 1ISVA 3MMDA 4J5NA 2Z1VA 4GY7A 1KR0A 4U5KA 2EJ1A 3S9IA 1SZFA 1BF6A 4R9XA 3A5VA 2FTPA 1RQEA 4BR1A 1C3FA 1QI2A 2UWFA 5AC4A 3VM7A 4IQJA 4JKKA 3GC2A 1O5XA 3THUA 2IKGA 1BQCA 3WJXA 2W5FA 5ABGA 4B92A 5AZ1A 1QHPA 5T26A 3AOFA 1FRBA 1HW6A 3QV6A 1CLKA 3DC8A 3R11A 5A2BA 2CHOA 2PDCA 3RRAA 5K4ZA 1S5WA 2ZZ2A 5A6LA 4XD4A 3WD3A 5CQ1A 4KWWA 3KAOA 3SJNA 4HNLA 2FZNA 2FZDA 1ISWA 1YLVA 2QMJA 1ZRQA 3M44A 3VX0A 1YIXA 4TTUA 1JNDA 4JTQA 3FAWA 4PB5A 1F3WA 3PP7A 1DIKA 3G8RA 5M3WA 4XZMX 2DJXA 3SFWA 1WZAA 1I45A 1W32A 3OTRA 1O68A 4AZ5A 3PJUA 4QBXA 1K7XA 1FBAA 1LWIA 1JULA 2G41A 5DBTA 5LNRA 4RL3A 4UFIA 3G77A 1DTNA 3CHVA 2PGRA 3W29A 2XTKA 2VDGA 1M7PA 2PTDA 3VD4A 4N6FA 1ONWA 3W7PA 4LAUA 3A13A 3VOIA 3PSWA 3DFPA 3GE7A 3LYEA 4HN8A 3K4AA 3PG9A 3QOMA 1QNPA 1AMKA 1FWJC 3NTYA 4MB3A 2OQHA 2POZA 4PYSA 4I8YA 2PZ0A 1JPMA 4Z1BA 3C61A 1V3IA 3A4AA 1OX5A 4GHRA 7A3HA 5CC3A 3ARWA 3KL3A 4DJEA 3VC5A 2JFEX 5CPMA 5A8QA 4JDYA 4LF1A 1EDTA 4YWIA 2BODX 3FDKA 3AHTA 2Q3OA 3MJMA 4JN8A 4CGTA 1JDEA 2OEKA 4HOWA 1SJBA 3NSNA 1UMYA 3QC0A 5DRIA 1JL8A 4M3PA 4IG2A 2E09A 2GDVA 3AC0A 3VCNA 2VM8A 3VNLA 1HZYA 3HFTA 1A50A 4UOZA 3S9YA 3H23A 2PAJA 3MYOA 4YXGA 5AVHA 1XLFA 4E2DA 2QS8A 5EL1A 3BJSA 1QWKA 4J4KA 4QAIA 3JU2A 4P7RA 5I06A 4RXFA 1DWJM 1QVBA 1ZBVA 1NU5A 3S1VA 2BXZA 3BXWA 2V5JA 1PIGA 1W1TA 5I23A 4YTQA 1FA2A 2Y5SA 1KO0A 3OJGA 1J0HA 1OINA 4Z0JA 3UF9A 3UCDA 4I8DA 2V63A 1ZBWA 4IP5A 1CLXA 4J3VA 4AYGA 1TV4A 4AZBA 2X2GA 3EDKA 3LY0A 5KZ6A 3TEVA 3TQPA 3AYTA 1R8LA 3NPVA 1GKPA 3UG4A 2QJNA 3DERA 1G94A 4A3QA 1H7NA 3GTNA 1R3RA 3LGEA 1ZBCA 3Q65A 1V7AA 3ARXA 4FAMA 4GQRA 4DJDD 3MMWA 1QASA 3SQSA 2Q09A 4AYSA 3MT1A 5HJXA 2X09A 3PG8A 3KVMA 2XSXA 7REQA 1J93A 3NVTA 3PZNA 2PDPA 3H2AA 1EYWA 1J12A 1WOAA 5A6KA 3CLMA 2PE4A 5FIPA 3HPSA 1UOKA 5KINA 2IKJA 1EP3A 3S3GA 1YBQA 1LP6A 1GOOA 2D0GA 1EZ2A 3PZGA 1MUCA 3CIWA 1IT7A 2GVJA 3AHXA 1FP8A 2QNEA 3ATZA 3NZPA 3PWAA 1XLGA 3S47A 3WNPA 3VIIA 3XISA 1KFEA 4Q8WA 1FH8A 3TTYA 3NL6A 2MUCA 4P7QA 1F74A 2R94A 3LGGA 2Z1BA 2A6NA 3CM4A 3Q58A 2IQDA 3LMZA 4DBDA 3JVAA 4XTIA 1DXIA 4L4MA 3GNNA 4W87A 3HQPA 3TCSA 1N8FA 3EGJA 3E0FA 2R24A 2YIHA 4CKQA 2F38A 3SN0A 2J7BA 4LALA 3HJEA 4BKNA 4ZQNA 1DJIA 1UC4A 1IF2A 4BF9A 2QVNA 4JIHA 4O12A 4EXBA 4C90A 2EF9A 5CGMA 3WK1A 1GK8A 4MKSA 5C9WA 3O07A 4MM1A 2R91A 4L80A 3LERA 1EFZA 3SB0A 3S8HA 3KBNA 3NQVA 1GOIA 3RITA 1UG6A 2DT0A 1J2WA 3QQ0A 5A6MA 3M6DA 2NQLA 4MKVA 1DIOA 4U28A 3VKAA 3WLOA 3PUDA 3UYIA 4DYJA 4BHYA 3WN6A 3N6QA 5HUOA 5CJNA 1GZGA 4JTDA 3RU8X 3BW2A 4C6NA 3EWBX 3GIYA 1TPDA 1LL6A 1O4UA 1VHCA 4JHOA 1HKMA 4BJHA 4ZVJA 3P0WA 1CXLA 4XO6A 4C6FA 1JZ7A 1PDZA 4PB4A 4OU1A 1EJXC 1CGWA 1UJQA 3QR3A 5F4XA 2NT1A 1MQQA 4OECA 1E9LA 2VFFA 4KIEA 2JK2A 2O7QA 3RG6A 2H3DA 1E6NA 1VPQA 1E5NA 4LEFA 3HPFA 1CIUA 1AFSA 3CWHA 2QDEA 1F8IA 1L6FA 1DJQA 3KCJA 7TAAA 3CB8A 1SFTA 4E4UA 1SSGA 2Y8VA 1IEQA 4PUDA 1FP9A 5DFAA 3HM7A 1XL9A 4UFMA 1POJA 1DTUA 2X1SA 3EXTA 8XIMA 1JZ3A 4ML9A 2CCRA 4Z17A 6REQB 3T09A 3T2PA 3EMCA 4IFKA 4FX8A 1ZPTA 2A3BA 2GQAA 1FQ0A 1V08A 5KZMA 3XINA 2HPMA 3IV8A 1P0EA 3VZYA 4O4VA 4H7CA 1H60A 3EA3A 1T8QA 3LZ3A 4US6A 1R47A 2Y6ZA 5RUBA 3HGOA 2YFOA 2NWRA 3NSXA 3AS2A 1KV8A 2CZDA 2E28A 1HKIA 3RPDA 3NNTA 4P8WA 1SMAA 3EEGA 3PZMA 4GXPA 3G6LA 1H09A 5LXEA 4ZBCA 3W86A 3PZVA 2WMFA 4LGXA 3P3BA 1K9EA 4CQCA 4P7LA 3GC5A 3UR7A 1UKOA 3SGZA 5HNTA 1ZHAA 1W3HA 8CGTA 3EPNA 3GG8A 4PTVA 4WJ8A 4JKMA 1VEMA 1MDRA 1B57A 1U5JA 2CBVA 3USBA 3L4WA 5HA7A 1VD6A 7CGTA 1P6BA 1S1PA 3URAA 4REQB 2WB5A 4A6GA 2W91A 1OY0A 1CB7B 2BG5A 1WDSA 3SCSA 5LIXX 2VC7A 3VIHA 4PUNA 2VEFA 3UXKA 3UT0A 5BOOA 1GYNA 4ZEPA 4JY9A 2YR1A 3HN3A 3ZVHB 5CG0A 1LG2A 4XKYB 2Z6JA 1ZJIA 5SWUA 4ATLA 2CLKA 3QMSA 1QK0A 4HU0A 3NURA 3VIJA 5M03A 4W7VA 1FWCC 1N82A 4C6IA 4FNRA 4OVXA 1OYBA 2B81A 3VILA 3TYZA 3SY5A 2GJXA 4F9DA 2J78A 1TFVA 2Y5JA 2MANA 1UWUA 1HKKA 4O16A 2H6RA 3IPWA 3K1DA 4ZL1A 4JOMA 4U5IA 4DO5A 2XZ7A 3DBNA 4Y8FA 1HJQA 4IT1A 3KBMA 4F4RA 3VKKA 1MW0A 1VJIA 5ABTA 1GOWA 4H6QA 5DT7A 1ZSXA 1F05A 4X63A 3D3AA 3MA8A 2DV0A 2QV5A 1BKHA 4JTSA 4HZ8A 3BOLA 2X1IA 5H91A 1TUFA 2ZRVA 3CUZA 3MP5A 2XM1A 3UR5A 4AC7C 4UXDA 1V6YA 1E6PA 2CHRA 4KFPA 2WSPA 1LOLA 1NEYA 3MP4A 2NX9A 1TV8A 4HK7A 1W9UA 3QHOA 2B7NA 2ZZ6A 3LPOA 1JZ6A 4Q8UA 1PZ3A 1RY8A 2WZHA 4ENLA 1RA5A 4H9ZA 1LWHA 5FEWA 2P53A 2WSQA 3FEQA 1EDQA 1ENUA 1TMLA 3R89A 3NYZA 4IFOA 2FGBA 1KCXA 2ABAA 2P3ZA 5G4HC 5DN1A 1E6QM 4M6QA 4L61A 1EXBA 3GNOA 4L4LA 2A0NA 1L8PA 1SM9A 3A9BA 5LXXA 1W2VA 3LNMA 2RAGA 3W22A 5FF2A 2VURA 4XSLA 1B4KA 1M7XA 3UW6A 3RILA 4GQBA 2HSAA 5F4WA 1WP6A 3EWXA 1FWAC 2HVNA 1PZ2A 2D1ZA 1EC9A 4F66A 2JE8A 4O1EA 4ASTA 4KFNA 4RDZA 2OWXA 3A3XA 4J28A 3UGRA 1M41A 4M56A 2VCAA 1Y0EA 4Z2IA 4BEUA 3HU7A 3EKZA 3G22A 4CNOA 4NRSA 4H9MA 3LK6A 3BUVA 2WZTA 4LUYA 4J40A 4JHMA 4G7EB 1XUZA 1K9FA 4Y9NA 4PUWA 2REQA 4GX9A 4QDWA 3PWGA 4GOAA 1TYGA 3R25A 2PS2A 1CENA 2XIJA 5AYBA 4Q7IA 3RRXA 4GKTA 1LL7A 2R1MA 1R2TA 5MKGB 2FH8A 4GXWA 1CWYA 1EHAA 1KQZA 1Q13A 1QPNA 5JIPA 3QMRA 1SJCA 4MIMA 4HPGA 5E9AA 4MLRA 4G9PA 1YHTA 4NUWA 3R0DA 1P7TB 1LRQA 1OG0A 4UWMA 4H01A 4Y9OA 4F2BA 3TUUA 1WB0A 3P80A 5FF4A 4DX3A 3MTWA 3SSZA 4Z1YA 2PU0A 3VM5A 4H3DA 1XXXA 3U3HA 3ZSSA 2EXOA 1NFGA 5B7YA 3FOKA 5E0CA 2A3CA 3MUAA 3WH9A 3P5YA 3LCWA 3DFTA 1R3YA 2WMKA 3EOSA 2CERA 4UOJA 7ODCA 2OR2A 3RX3A 4KETA 3UA3A 3AWNA 4G2DA 2ZZ3A 1RCQA 4AUBA 4DO4A 1XIBA 2I16A 5D2TA 3WYZA 1VH7A 4CN1A 4XZIA 1KXTA 4U31A 3W1AA 1WUFA 1XCXA 4N2YA 3ZJ6A 1E15A 3JUGA 3CUIA 1XDJA 4DF2A 2NWSA 2XVLA 2NV9A 1XRSA 3EX2A 3LTSA 3IIZA 2E77A 3QOKA 4ZQPA 4ML4A 1H7RA 1PAMA 1D8WA 4UIOA 4DEFA 4MWAA 2W92A 1TPB1 2CFFA 1SZRA 2Y7DA 5DT5A 4LVFA 4D8ZA 3CV2A 2FGZA 5C54A 1XC6A 1EA9C 1RUSA 4R34A 3MMTA 2VX5A 3BQ6A 3AIUA 2Y88A 1PX8A 5G4WA 1OCBA 2OWCA 4XZLX 5BZAA 2Z2UA 2OFJA 5KETA 5I3GA 4LYRA 3RM9A 1J11A 4TMBA 3VDAA 1JFHA 3RAOA 3TTQA 4JYDA 2CBUA 4RE4A 2DIEA 3ZZ1A 2WC7A 4KW2A 1E56A 4GNJA 4O11A 1DQXA 4XUYA 3CEUA 2ZFAA 3NQAA 4JPGA 1WA3A 4DF1A 2XVGA 1RD6A 2NVDA 1Q7ZA 2DFAA 2WZEA 1NOUA 5BRBA 1H1ZA 1S2VA 1BLIA 1XH1A 3K4WA 5BU6A 3PUEA 3OOQA 1JZ2A 3TSDA 1XD0A 4LPCA 3ME3A 2XG9A 1B31A 2CLLA 2E4TA 1RK6A 5A8OA 3GDBA 2DH3A 4DO6A 3GVGA 3PZTA 1W3JA 2IPWA 4PMDA 4TQTA 2Y8KA 3G8EA 4ZSTA 1GTHA 4Y6GA 3SUVA 2Z0IA 4GISA 3C0QA 4HN4A 2ZA2A 3NZQA 1Z7AA 5ABFA 1E3ZA 3S46A 4JQ4A 1VFUA 5H8PA 3M43A 4AZCA 1G6CA 3RLHA 1BG9A 2ABBA 1N55A 3WQGA 2NVCA 3IIVA 3N11A 4AW7A 1CXEA 4W5ZA 3TU9A 3NL5A 1PHQA 3LXAA 3H7RA 4LUSA 4AH7A 1FWTA 4RV8A 3HG5A 3GHSA 1I6NA 3AROA 3KRZA 2IS7A 5CPNA 2VT0A 1MQPA 1A0DA 3E1F1 4GYJA 2DU2A 2OQYA 2FFCA 4Q8PA 3ZWSA 3S6DA 2PGWA 4CD6A 1ZP4A 4E6MA 3A12A 1Q6QA 3AMDA 4O53A 4ZO7A 3GXDA 2QUNA 3U5YA 3SBFA 5PTDA 2ACUA 3QW4B 2YL9A 4S2BA 3BJFA 4PB3A 4JNZA 4NZFA 1HKVA 1K8XA 4FNPA 2FH6A 4B15A 4JL1A 1JF5A 3KDOA 3URQA 2JF6A 4DJEC 2XVKA 5ABFB 1KCKA 2Q8ZA 3W7HA 3A5FA 1J0ZA 2XM2A 4U2YA 6CGTA 1TJPA 1YXYA 2B7OA 4O14A 3PNUA 1P0NA 2QJIA 1RR2A 2GOKA 2VKZG 1H5YA 4Z0SA 2OCZA 2QDGA 1GJPA 2ISVA 1KTCA 2VC9A 1E9YB 4RLIA 1XINA 4AAJA 4ORMA 3FJ4A 2AKZA 3KCLA 3M5VA 3AAMA 3LCGA 3QV9A 4JR5A 3HBLA 1QBBA 1Z32X 4XZ9A 3O3RA 3MSRA 4PTNA 1XDLA 2DQXA 4DWSA 2XWEA 4TO8A 1XIHA 3V5CA 2QGHA 1D3CA 4DZ5A 4ZB0A 1F5ZA 2D2GA 3NPXA 3W24A 4AY7A 1TVPA 2GQ8A 3MSDA 3AXIA 4GVIA 5D2XA 3W37A 4EAYA 3GU1A 3ITGA 4ICMA 4JQ2A 1GVQA 2YA0A 2V68A 3N18A 3H2FA 4W8LA 3NGJA 4PCFA 3HG4A 2HNEA 3OBAA 2GGGA 3WY1A 5AYZA 2VDHA 3P67A 4ZQRA 3K2GA 1WYIA 4H9YA 4E5TA 2G8ZA 4UMAA 1QDSA 1DJYA 4IGNA 2XGZA 3R79A 3L65A 1BXCA 2P8BA 1R3QA 5AYXA 2ONEA 4KMQA 3PZ9A 5D30A 4YJ5A 3E2SA 3C4UA 3ARSA 5E93A 3EPMA 4WJEA 5CJMA 5AKQA 2VTFA 1SSDA 2J66A 4QAWA 1HX0A 2X40A 2QMKA 1R9XA 4Q4RA 1DJXA 4MNLA 2BSLA 5DEZA 4FNQA 4QNEA 4NAEB 3F5LA 1Q6CA 1TWZA 1B0IA 3BV4A 3B4UA 1W3LA 4DXVA 4QQUA 3BTNA 1P48A 2G3FA 2WQPA 4JX6A 3G1DA 2DZXA 3MWCA 4X0VA 1KXQA 3KBJA 2EPKX 3II1A 1ZTVA 3O6CA 4AZ6A 1BGAA 3IV3A 5GNXA 3TJLA 4HB7A 2OB3A 4H8VA 7XIMA 2NQHA 4L9YA 4TX9A 1LBLA 3EWUA 1BVZA 2I5IA 3PANA 2XIQA 3DAQA 3WFZA 3MUCA 2GSJA 1RVGA 4S3FA 1KV5A 3E3HA 4HD5A 1O12A 1BWKA 2E5CA 1Q66A 2VOMA 2DT1A 3AXKA 3IEBA 2FVMA 4H6KA 1ONXA 1IGWA 3LM3A 3OBKA 1JRCA 1LQ0A 4GE8A 3AXXA 4LANA 3M47A 1K4GA 2Q8LA 4WR3A 1PS9A 3A3HA 2C19A 1QWGA 5M5DA 4CVUA 4UQDA 3RNDA 1WDPA 5FESA 2HPIA 4E8GA 3CV6A 2FMNA 1DL3A 2WSYA 3GR7A 4JNYA 4KF1A 3CZJA 3ANVA 1RJRA 3EYPA 1TSIA 2V6AA 2PURA 1HIZA 3IK2A 3P14A 4I7VA 3OYZA 2J6XA 4M6UA 2RDTA 4CCDA 1UR1A 4GUIA 4S2CA 1S39A 1UC5A 4DPQA 2Q01A 1Q85A 5I07A 3PJTA 2YPIA 4IIEA 3TA9A 4DJDA 3KE0A 1I60A 1KCLA 4I9MA 3RGTA 5LA2A 3O63A 4Q33A 1UA3A 2RHGA 4LY8A 3JRKA 3BLEA 3CQIA 1UD6A 1CECA 1S5VA 4WY0A 1O7AA 1ML1A 1HJXA 1E1EA 1DHPA 4NL1A 3IVUA 3O1NA 1JD9A 3C6CA 4U3AA 2E1DA 4OOUA 2FQIA 5HANA 4DM2A 3EA2A 4O50A 1SR9A 7TIMA 4LBRA 3QYQA 1ONEA 2DDXA 3NL3A 1V3MA 3WD4A 3AMLA 3LQGA 1WX0A 2OSWA 1KBJA 4O10A 2QDHA 1GW1A 5C5YA 4TVCA 3F4VA 3CQHA 4HK6A 3S5SA 3R2GA 1BSLA 5A6AA 4JIEA 4J27A 4OOZA 2HS6A 2G0WA 1QMLA 3S2CA 4JNMA 1G7UA 2OYLA 3S5NA 1W31A 1I2PA 1GHRA 5L9FA 3GY1A 1LQ2A 2R9RA 3IAPA 3NXLA 1TCMA 2JEPA 5D4YA 3ITVA 1V02E 2BFGA 2D73A 4C7DA 4IXHA 1QPKA 4D6HA 2WOQA 3KVLA 5REQB 1IZKA 4UZUA 3S83A 1LJYA 2PWFA 4QNWA 1X8CA 5GVJA 1QAPA 4B3ZA 4F48A 3CHFA 4AQLA 4NX5A 1GVEA 2INEA 1OD0A 1Q8JA 3FYYA 1R2SA 4ZE4A 2I5QA 3HG2A 5KEZA 1QOPA 1W1VA 3S5ZA 4HNNA 4H4IA 3ITXA 1EF2A 4L4OA 3DHPA 2HCVA 3NXFA 2OOFA 1DJWA 3AS0A 1GEHA 1R3VA 3CH9A 3IUDA 3GXIA 5CGTA 2YOCA 4IIHA 4J3UA 4HZ6A 4R3UA 4UTHA 1N8WA 3NEVA 4LJ3A 4QLJA 4I90A 1TA3B 2YXOA 3MI6A 2VWSA 3RLVA 1LZOA 2WVTA 5CBJA 1JCYA 3MW7A 4W93A 4W9TA 4TOQA 3GK0A 2DVTA 1UYQA 1NDWA 4WKAA 2V8ZA 1VC4A 4L6DA 2H90A 4A8NA 2G3MA 4S3AA 3MUIA 2Y5EA 2Q71A 3GQYA 4GBDA 4J35A 5ABHA 3WMBA 4GO8A 3Q2DA 3OYXA 4HZMA 2YX0A 2X05A 1FOBA 2DH2A 2HDJA 3SCTA 1QBAA 3BLDA 3VDCA 3O6AA 1VR6A 5IFTA 5HR6A 4H2CA 4I9TA 1ZCOA 4E2BA 3BDKA 3EX4A 4MWAC 1UUQA 1MVYA 3KBWA 3VDBA 2DZVA 1UPPA 1OT2A 3G0UA 1S2WA 2YW4A 2HEJA 1E0VA 1LT8A 1AW2A 3NQ7A 4WHBA 2IPFA 2X1TA 1YQ2A 5FJIA 1HFBA 4KRTA 2A7PA 5HAOA 4HTYA 3AO0A 3E2QA 4L1XA 1GGOA 2UY5A 1W9PA 1FWIC 4ICNA 4GVHA 4JBRA 1AMYA 3FS2A 1W54A 2Q3RA 3WDHA 1X39A 4DY1A 3VE7A 1Q7MA 4UZSA 2GQ9A 3S1XA 2VX6A 5BWFA 3AQUA 3WBXA 1MWOA 4A2RA 3V7PA 4B5XA 1H51A 3G24A 1JAEA 3BICA 2JEQA 2Z6IA 1EA0A 2FJKA 3GYEA 3UXIA 4CU8A 2BY1A 5C2GA 4DWSB 4FNSA 1HGYA 3BAIA 1ME7A 2DQWA 1V79A 4PTMA 3VZZA 4RNFA 3CO8A 5AC8A 3B40A 1W8SA 5FAGA 2JGQA 4PUKA 3V36A 4DAIA 1JZ4A 1ZL1A 4A4AA 2YCLB 3AU2A 2QCDA 2Z1XA 2CITA 2DZPA 3BANA 4PMUA 2NLIA 3NQMA 3G1RA 4WVXA 3N25A 1TZ7A 2OQLA 3ISIX 3UPBA 2P50A 3Q45A 1EJTC 1VFHA 1IWPA 3EKLA 1VBHA 4LF2A 3VKCA 3H6OA 1AJ2A 3CL7A 1XPYA 2ZUVA 5G1TA 2PFHA 1XD1A 3GDMA 1C8XA 4O1DA 3WL1A 5G5IA 3C2OA 5M1TA 3KOWA 4H9VA 4O28A 2QDDA 4EVZA 2VO5A 4F0RA 4ONVA 1ICPA 4A8LA 1V0MA 4O1CA 2FTWA 4P61A 3TIMA 1J4EA 2V81A 3O0KA 1OC6A 3WD2A 3MZNA 1E51A 1E0TA 4LYPA 3FAXA 1R87A 3WLMA 4ZE5A 1QNVA 2R6OA 3ALFA 3IK4A 2FGLA 4E2OA 4A8RA 2XN0A 1FDZA 3B0XA 1FCQA 4TV5A 5IDIA 2BLEA 2VD9A 1C7SA 2TMDA 2XYLA 3MSYA 2Y85A 3L68A 2YYTA 4C7GA 1XIMA 3R0KA 3T42A 4C1NB 7PTDA 4MWAD 4B2DD 4TU1A 3TONA 2NXIA 1OFBA 2YDQA 4AZ7A 5TNVA 5F2GA 3ONBA 4BQ4A 2SFPA 4LBUA 2PI6A 2OX1A 2HK1A 3CZGA 3A22A 4X61A 2OYMA 1UBSA 3PZIA 1OC7A 3UVAA 3B8TA 4YCPA 2PDNA 5TD4A 4Z2KA 2DUZA 2VX7A 3CUJA 3QHMA 3U9IA 1EOKA 3L4ZA 5HJLA 2CYGA 4BY3A 3GVVA 3VMNA 2PDWA 2O4QA 5FSDC 1EIBA 3SIMA 3OLIA 3JZUA 3WBYA 3MZ2A 4IHCA 1EJUC 3TNOA 4NP7A 2JKAA 1TQXA 4DJFD 1M53A 2E6YA 1TWDA 3H7VA 1BPLB 1UD4A 1ELSA 5FJJA 1QOQA 3L4VA 2DT2A 3UBPC 3GB6A 1GNXA 5AFDA 4MUZA 5IBXA 5AC5A 1KBKA 3AIBA 4QDPA 3P82A 1VPXA 4AF0A 5AC6A 3GH5A 1EWDA 3CPRA 1VFTA 1X96A 1FWFC 3GXPA 2Z2BA 3WJZA 1K9TA 5HQLA 4FIQA 3W1MA 1GVYA 2QPXA 1SZGA 1HXJA 4FNUA 3DENA 3K13A 3I4KA 5DXYA 4Z08A 1P5BA 4G6CA 3TLQA 4GCXA 2YZRA 2WLYA 3IGXA 1NELA 1UW9A 2Z25A 4UTJA 3TK7A 2XU2A 1Z42A 2P0IA 3WLNA 4BI5A 3P0XA 1V3HA 5U4NA 3SRDA 2XFRA 3TTOA 4H8UA 4M82A 2CXGA 3W7GA 3H12A 5E6ZA 2WJEA 3N6HA 1YXDA 3TDFA 3R12A 2E68A 4HNOA 5BYWA 2ZDSA 5F2IA 1OHLA 3A4XA 3RCMA 3CAVA 4UR7A 4EF9A 3E0VA 3GKFA 3WJYA 1ISYA 2PBGA 3TMQA 1QK2A 4LAMA 4I6KA 3UY7A 2A3EA 1F76A 1S2UA 1VB9A 2VP8A 1XFCA 3LCIA 1AL7A 1IE7C 5FOOA 1GJUA 4RZ4A 3UWZA 5XIMA 3E12A 1L2UA 4Q32A 2WHJA 4L9XA 4MJZA 4P8XA 5BOFA 4JIPA 4BWLA 3SSJA 2W63A 1GVSA 4C6CA 2VEGA 2JGYA 2WSRA 4IPPA 3UZYA 1HNYA 1KXHA 5C70A 3CPUA 4JIIX 5DY2A 1LLWA 2AL2A 4OFCA 1F6YA 2ZUUA 3D5HA 4H00A 5K7JA 5T9CE 3VI2A 1QOXA 2DY3A 3W81A 5AB3A 4GQGA 2C14A 1SO5A 2ON3A 2ZXBA 1L2QA 4WOZA 5U7SA 3OGRA 1MRQA 2DGAA 3GDTA 3B9EA 3NG3A 4LWWA 2B4GA 1KM3A 1LDCA 4RDYA 3WDRA 3UJ2A 3WF1A 5CCZA 2GSHA 4DXKA 3W2LA 4Z2GA 1WKDA 2R1LA 4B90A 4XZNX 2WPGA 3TKFA 1GEQA 4XK2A 1F6PA 1V0KA 1W9DM 4WDWA 1O94A 2KZHA 4QS6A 2O56A 4HYWA 3AYVA 5BU9A 4B5UA 2QUMA 4AEFA 1JR1A 3CQKA 4QG6A 5EMYA 2AL1A 3MI3A 5A2AA 2V2DA 4PCSA 2Y24A 2YJQA 3SN1A 3SRFA 1XLIA 2JKEA 4MDPA 2ZADA 1YTEA 1KRCC 4FP1A 3EX3A 4DB7A 7REQB 1W9XA 3EB2A 1EX5A 3NM1A 3SFKA 3W26A 1G4TA 2EEXA 1HT6A 4MAVA 3ITLA 3LS9A 3T8LA 4AFYA 3DEQA 2G4JA 3NAVA 5FEZA 4LAKA 1EWEA 2V3EA 4KKXA 3W1XA 5CBBA 2ANUA 1A3HA 5HATA 3T0TA 2GUUA 3KVJA 3WLLA 1JCJA 3FJNA 1NH6A 3JS3A 3DCPA 2VMFA 2QCFA 5CZTA 1XP3A 2W66A 1H7OA 1NFBA 3UR2A 1REQB 4ZOBA 4AVOA 1VFSA 5D38A 1A5NC 4GABA 1P43A 5XIAA 1Q7QA 4NG3A 1C91A 4CQ8A 3TSBA 2AAMA 3G18A 4XO7A 1HGWA 3N6JA 2PWGA 4OBTA 2X0YA 1DVJA 1LROA 4HA4A 1MXGA 1ADDA 2JALA 1W17A 2P1FA 1TV7A 2A7RA 3RO8A 4O1AA 2HBVA 3VINA 3ECQA 4KCWA 3W1PA 3BZGA 1ALDA 3HZ3A 4IICA 1KD0A 4WGHA 4FXFA 3WQPA 2BV9A 5DMYA 5EYWA 4AZIA 4CUCA 3PBYA 4AG0A 4I7UA 1V7YA 2BGQA 4UNIA 3MYPA 1UQYA 1RALA 4Z2HA 3B8UA 3RHGA 2G50A 5BXRA 2V67A 2Z1SA 1WOBA 3ZVHA 3V0UA 1RLCL 3IIOA 5FAJA 3U4FA 3DFYA 2YCLA 5KZEA 4AHPA 2W27A 2H3BA 3HQNA 1A5SA 3BSMA 1NJJA 1H7PA 3WQEA 3BGAA 3WUGA 4HMNA 1Z8AA 2ZA3A 3DHFA 2WNZA 3KXQA 3GTIA 2GLKA 1IIHA 1N8IA 4S3CA 3WQFA 4CQDA 5D32A 3HV8A 4QP0A 4WX2A 3P2VA 2NQJA 3QHNA 1ADOA 4G1NA 2WVVA 1CNVA 4DJFC 3W6MA 1B1YA 4GI8A 1GKRA 1S3TC 4GA8A 3N12A 5B80A 1FWWA 3NYDA 3TN3A 2VC5A 3CUGA 3SECA 4UTWC 3FHAA 3QSTA 3NQ6A 1R85A 2VQUA 1OB0A 2AMXA 3EDEA 2A2IA 3QZAA 4JAWA 3EOOA 2V9DA 4JYFA 5GJMA 2BX7A 4F9JA 1Z89A 3APTA 2Y2WA 3BGGA 3VNDA 1AL8A 3CQJA 4HNCA 1V6VA 1ZGDA 4NKCA 4UQBA 2FHCA 4O13A 3BG5A 1EP1A 3TR2A 1DQWA 3PUGA 1MEWA 1SZEA 2FDMA 3I7SA 4KS0A 3IJDA 3BMVA 1X1ZA 2J7GA 3V1HA 3DFQA 1UZDA 3A3WA 2UY4A 1HO4A 2VEMA 4DWSD 3EB3A 4XBSA 1NDZA 1RQHA 3G1HA 3QM3A 2ACRA 1EC8A 4MFDA 4E38A 1THFD 1MO0A 4DLMA 5HMSA 4U33A 3ZR4A 2W9MA 2OO0A 2VUYA 5E70A 3VD3A 9XIMA 3ZQ9A 3UZJA 1HKWA 4UBPC 1K7EA 4S39A 1TVLA 5BXTA 2B7QA 1EJSC 3AIRA 4FZIA 4JHZA 1RCOB 4IPLA 1JZ5A 3EWWA 3W23A 3VOHA 1BGGA 1ICQA 1CGUA 3FIGA 5HQMA 3S9ZA 1WBHA 3M5ZA 5I6SA 3GXFA 4B16A 3SGGA 3HG3A 3KL5A 3Q37A 1VFMA 2YB1A 4ORIA 4RPPA 2TYSA 1OFDA 3WELA 2XH2A 3QFEA 3VPLA 3N1AA 3KUMA 3W4RA 4FR1A 4JTKA 1NF0A 1FWRA 3CUXA 3B8VA 3CIVA 1MW3A 1X7FA 4YVPA 3WDJA 1KC7A 2Z29A 4ROQA 5TQLA 1K6AA 2CIPA 4RCXA 2TRSA 3LM7A 4MWAE 1OFQA 4WXYA 1UWIA 4QHRA 2WCAA 2RGLA 2ZX6A 4B5NA 3B8SA 1FWBC 2CLIA 5JXQA 3H8AA 5CPQA 4IXXA 1PCKA 2WHLA 4QDMA 1XWYA 5G4EA 1W2PA 4MY8A 3KDNA 2Q02A 3FSTA 4QS5A 4PODA 4A29A 4UCFA 3BLIA 4YYCA 1XBXA 3PZQA 4H7VA 1RHCA 3RMEA 1XDMA 3PFRA 4LAOA 1JPDX 1T41A 2WW5A 3L7RA 3S6TA 1VP5A 1F4AA 1E4MM 2VGIA 4FI4A 3NO1A 2V3FA 4ZSUA 2QGYA 4XZWA 4JCLA 1G5AA 3F2BA 4HA3A 1MYRA 2BZNA 2HROA 4DHGA 4FO4A 4OWGA 3FKRA 3GSMA 1SFSA 2PLJA 3GBDA 4IPNB 1FHDA 3DUGA 1NOFA 1U1UA 2ZUWA 5I3DA 5CH9A 1PDYA 1L6YA 2ZZ7A 1BTCA 4AMAA 2ALRA 2CLPA 4NJGA 2F6UA 4C6JA 2WBKA 3WF4A 1AH3A 1NIUA 2QIIA 1UKTA 4LT9A 3CS2A 3NO3A 2QAFA 3W2UA 4GNVA 4QG8A 3SUTA 4DNHA 1G0CA 1YPXA 3SY1A 2WHKA 3R0UA 2FHBA 2ICSA 1JZ8A 3NA8A 3UG8A 2GGJA 1T8XA 4MPQA 2A21A 4H9TA 2YBVA 4H7ZA 1VCFA 4EK7A 3I3DA 3ZIZA 3W7IA 4O57A 3AZSA 5KITA 3GD6A 1G4SA 1FH9A 1EB3A 3TJ4A 3TAOA 3KOYA 4DBSA 2NX1A 4HU3A 4DPPA 4IJBA 4B5VA 2NV1A 1P0KA 3N15A 4GBUA 3AWOA 3A6OA 3STPA 4PE8A 4HSNA 3W2JA 1QO5A 2J8FA 3AJ7A 1FKWA 5A8GA 5F4SA 3IARA 3NDZA 3M4HA 2DPEA 5T8GA 5I77A 1L0PA 1BYDA 3MDUA 5L6UA 1IEVA 4K1WA 1OF6A 2FB3A 3MB9A 2QJMA 4XBKA 2VRJA 3L0KA 5I2UA 1R7AA 1TTQA 1H4PA 3M41A 4HIBA 5A8MA 4D9PA 3WLIA 4LNYA 4BQ2A 5LA1A 3COTA 1UR9A 3P5ZA 1J5SA 2A1YA 3SUWA 4IFKB 1F3TA 1W9BM 3VIGA 4AIOA 1YBQB 2ZE0A 3WKZA 1EJ7L 2F84A 2ZIDA 3ZXWA 3B3DA 4J1OA 3RN6A 5FL1A 1CCWB 3K1GA 2AQOA 4AU0A 4GFIA 4N4QA 2OVLA 3OLGA 3SGUA 2CWNA 2OX4A 1S5TA 3W7NA 3TYCA 4E8CA 4US5A 4Q4OA 5H8UA 4RXGA 3SRKA 1TUXA 1VFOA 3PK7A 3ZLFA 4GJIA 2DZAA 3R5EA 3TW6A 1OZQA 2D2HA 2PWUA 2FPYA 3A4JA 3NZGA 3FHQA 3TYBA 1B5TA 4C6BA 2VUNA 3TAKA 1LF1A 4IQDA 2J88A 4O8AA 3CAQA 4NT0A 1FXQA 1RVKA 1GPWA 1DWIM 4EKJA 2JQXA 1UH2A 4AC1X 3ZJ8A 3V5OA 3QTPA 3N4FA 5FEPA 3CB3A 3LSBA 1IXOA 3K46A 5JBEA 2AAAA 1JPKA 4PCNA 3MHUA 3UWYA 3EOLA 1XR2A 3O06A 4LH8A 3C2RA 3CH0A 3BG9A 5I78A 4Z42C 4BI6A 2J6VA 4F0SA 3LI1A 4MPKA 5DELA 1OABA 2CC0A 1T7LA 4FX7A 1PKNA 1EO5A 3C5QA 3Q4DA 1GQJA 2VFGA 4GINA 3N19B 4K8HA 4D6DA 3TJXA 1I1XA 5JVLA 3RXZA 5D04C 1XG4A 3I65A 2P10A 5C9ZA 3E74A 2FTYA 4V2XA 3TNBA 1FVPA 3LX9A 5KMYA 2XUCA 2DP3A 4GNKB 3B0PA 4I9AA 2WM0A 1H5VA 3TN6A 1UR4A 1GW9A 4AD1A 2G4FA 5AN7A 4K7VA 3M0MA 1BRLB 4IL2A 3I68A 3ZLHA 2GDUA 3O05A 2C13A 1FWSA 3MU7A 4GZ7A 1RP8A 1NQ6A 2PBOA 4UNLA 4HU4A 3U7BA 4FF7A 1UR3M 2R82A 1GYMA 4GUFA 4IMDA 4P5UA 3L4XA 1JUBA 4CEXC 2D20A 3THCA 2C8NA 4REQA 2OELA 3RX2A 2B7PA 2VQTA 5IRPA 1MZRA 1BSIA 1I0BA 3B06A 3LHVA 1AQFA 3I6EA 3MHFA 4PSPA 4DZIA 1XISA 1Q6RA 1TV3A 1VS1A 3T08A 2VEKA 1OG6A 3OHIA 3SCQA 3WQ5A 5LSMA 1MUMA 3MUXA 2IMRA 4B5SA 1HL2A 1I2NA 3L23A 2EO7A 3AIWA 4GYFA 3HGJA 2E8ZA 3GTHA 3PJWA 4S38A 2CBJA 3BAJA 1GPFA 2OOGA 3E49A 3OLDA 4J3TA 4YS1A 4JKLA 4FOJA 4IIGA 4GYKA 3UZXA 5ECUA 1MNSA 1XIDA 4PMYA 3QQWA 2QEZA 4HOZA 1S2CA 3S1UA 1UZ4A 1K02A 2EQDA 4S3BA 1ODZA 3E2RA 1TX0A 5ECVA 4O0QA 1I9CB 9RUBA 4E2VA 2ZVRA 4ALDA 1JPIA 4WCJA 3STGA 1MI3A 2WZMA 1HKJA 3V1PA 2PLMA 4AD2A 4BF5A 1TJRA 1JRBA 3FXYA 4TXEA 4KT2A 3I3BA 2ADAA 1EX1A 3N29A 1Y5VA 3MVTA 1V93A 5A6SA 4PRRA 1BXBA 3V3WA 4H9XA 3PZUA 3P7YA 1UQZA 3W74A 2KX9A 1DKWA 3GWQA 3P8IA 2A3HA 3SN4A 3LI0A 2EPHA 1HJUA 8A3HA 3CV1A 4IX0A 1UR8A 2OZ8A 1W9VA 4W86A 1J0IA 2DUXA 1W3TA 4EXQA 3WNKA 1R3TA 1H1NA 4C1NA 1PB0A 2QCEA 1GONA 3L0NA 1QI0A 1HL9A 4ZA0A 4BS0A 4BFAA 1PKMA 5BMXA 6A3HA 3AUJA 3PAJA 3PULA 3T8QA 4O0ZA 3MY9A 3VO0A 2OZ3A 1AZ2A 1PCWA 4IH3A 2Y4SA 2D24A 1MUWA 3AXHA 1O60A 4GY1A 1W3IA 4EPBC 3ID7A 4WIWA 1DBTA 4E0CA 4GIRA 3GR4A 3WL0A 2AOSA 1JUKA 2XISA 4LVDA 4MG4A 2X8RA 3CWNA 1YYAA 1C9DA 3U48A 4EACA 4Q6XA 1E4NA 4AWSA 1AW1A 3LRMA 1WNOA 3U5UA 3W38A 1W1PA 4P8UA 3OZYA 3VU2A 1KBBA 4ES4A 2V2HA 3BLKA 1W5QA 3V35A 2BOEX 5LGXA 3QGVA 4OTKA 3OVGA 2GUYA 4LAZA 3IANA 2ATSA 4F0LA 3MKVA 5CXPA 3DYOA 2DZUA 1PE1A 3NWRA 3URNA 4PRWA 2YCEA 1UROA 2FZ8A 4M80A 4AY1A 2X1RA 5C0QA 3GU9A 3ZYZA 1JDCA 2V3GA 3DBPA 4US5D 4PBEA 2A79A 3LV5A 2CETA 2W61A 2V5LA 2GGIA 1QI5A 2WCGA 4O52A 2DSKA 3T55A 3WH8A 3GAYA 3ZJKA 4WF7A 1KGXA 4XSMA 3L21A 4JTHA 4R88A 1KFWA 1EEPA 1WZMA 3GC4A 1US0A 1F07A 5C7VA 2TSYA 3REQA 3SIZA 3UEQA 2HBXA 3EDJA 1UP3A 2OLSA 2FVLA 1F61A 4MADA 4NZ1A 3EWYA 1KTNA 2RDWA 2EHHA 3UXDA 4DO7A 1K3UA 1UMLA 1IGSA 4H19A 1S5NA 3E38A 3G3MA 4Y96A 4GZIA 1YNYA 3RJYA 4MJMA 1J10A 3L4UA 1YTDA 4Q8VA 2DSUA 4LXFA 3W9ZA 3P62A 2FDSA 2H8ZA 5AY7A 2VEPA 1WE5A 5HQEA 3HF3A 1B3YA 4LRSA 2GWNA 3APYA 4BQ3A 1OK6A 4W85A 1MDLA 2Y89A 4XWUA 3LTYA 1J18A 3FNDA 3CAWA 3CUFA 5C7HA 3OEXA 5D33A 5REQA 1K9DA 1C93A 4OZOA 1DOSA 5LKYA 5BCAA 1CTNA 9CGTA 3TTEA 6XIAA 1CYGA 5E5CA 1KTBA 3L12A 4GRSA 1K7FA 2BWGA 2D69A 1KFBA 4AIEA 2XIOA 3OVQA 1VJZA 4NYUA 3N9SA 4D6GA 3R8RA 4UTUA 1CXIA 3LN3A 3ZO9A 4QCEA 3KRBA 1XJBA 5DQPA 2ISWA 2PRLA 3TW7A 1WPCA 4QLKA 3RU6A 1B2YA 3W72A 2Y7EA 2R1NA 1PBGA 2FKPA 3E0LA 3GU2A 3O2LA 1B3XA 4D1JA 4R85A 1W3KA 2GSEA 1KGUA 2CBIA 2QIWA 1J79A 4WOQA 1J96A 1OVDA 3W73A 3T44A 2UY3A 2PODA 2OXNA 4KCTA 3R8GA 3PY2A 2BB0A 3LNPA 1LG1A 2OLAA 3EX1A 4L6OA 3V0TA 4K3ZA 1A4MA 3T1GA 3RLGA 4CNNA 3DGRA 2PD9A 1ZLPA 1UB3A 2WJZA 4MYXA 4GY0A 5C55A 1B3WA 1NF7A 4X60A 1JDFA 1FXPA 2XSAA 3FCPA 4QISA 3T0AA 3F5KA 1J0YA 1QFEA 3RF9A 3ATYA 4A2SA 1A5AA 4NAFA 4UTTC 4JXCA 2HK0A 3W7CA 1CXFA 3BCJA 1IT8A 2RKXA 3T4CA 1XCWA 1A80A 1R46A 4G5DA 4JFTA 4GVFA 4W84A 4ZQOA 2VRKA 2VX4A 4N0RA 1H0IA 3W71A 4NASA 1PPIA 4DJDC 3LA4A 4JICA 4PUMA 1NAL1 2J7HA 1DEDA 5TBOA 3BARA 1CXKA 3B05A 4Z1DA 3PTMA 5AYIA 4JY8A 3VVGA 3WIJA 1XCFA 1TV5A 1WXYA 4K8GA 3FA3A 1LOQA 1GQIA 1Q6DA 5D9OA 1IYXA 5EPDA 4HPJA 1PSCA 4MHBA 3DYPA 4YVVA 3NFUA 1OYAA 1QI3A 1UWAA 2PWVA 3GW0A 3CMFA 4FF5A 3WEOA 1BWVA 4E4FA 4LRTA 3QPYA 2WK2A 4WSHA 3UR8A 1J8VA 4KEUA 1A5CA 4MGGA 2J7CA 1ECQA 1UH4A 3B8IA 2X7WA 4JQ3A 4MZ1A 3I7QA 3N3TA 2FYMA 3RX4A 4I9JA 2Z7GA 3V16A 2ZX8A 1FDYA 8RUCA 1E0XA 5DXXA 1UKQA 5AHNA 4HMEA 3VGEA 2Z7KA 3LB0A 4HQVA 3ARYA 2PDYA 4JS3A 4NZ4A 4W5UA 2WVVB 2IKIA 4GXMA 3GVQA 1TE1A 1UP2A 2RDXA 4DN1A 3WBWA 5HNRA 5K3VA 2PCEA 1QW9A 1QU4A 3PBVA 2Z2AA 3GVRA 5LNUA 4HU8A 2XGIA 2YLAA 4M7SA 4UFKA 3TQKA 3F2DA 4MFEA 3VC6A 3MKCA 2ZXQA 2OJPA 1Q4WA 3DN5A 4FXSA 3W02A 5CPOA 1BVNP 2Z26A 2Y7GA 3ZFHA 3CHDA