4E38A

Crystal structure of probable keto-hydroxyglutarate-aldolase from vibrionales bacterium swat-3 (target efi-502156)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
b'FQSMMSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSDAAVEAIRLLRQAQPEMLIGAGTILNGEQALAAKEAGATFVVSPGFNPNTVRACQEIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLVTNGEWDEIARLTREIVEQVNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate a
publication title Crystal structure of probable keto-hydroxyglutarate-aldolase from Vibrionales bacterium SWAT-3 (Target EFI-502156)
rcsb
source organism Vibrionales bacterium swat-3
molecule tags Lyase
total genus 78
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature ec 4.1.3.16: 4-hydroxy-2-oxoglutarate aldolase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4e38A00
1G69A 1TPDA 4DPQA 3KVJA 4H3DA 1SW7A 1XBVA 2A6LA 3FYPA 1LYXA 1RZMA 1OYCA 2A21A 3HPSA 3HGJA 3W85A 1KLYA 2C1HA 2X1SA 4XUGA 4WXZA 2QJGA 4AHOA 3NQDA 3BLFA 1L6YA 1PCKA 4JYEA 2QCNA 3B8DA 2CLIA 3P80A 1ONRA 4I9AA 3MBDA 4RLIA 4IUOA 5FI8A 3QMRA 3UWVA 3MI6A 1P4CA 2WJZA 3IIZA 3NYZA 4JGDA 4ZQMA 3NQ7A 1SZFA 1O5XA 1NVMA 3OBKA 1I4NA 4LUJA 4O28A 2FQIA 3TXZA 4POCA 4JTUA 5F2GA 3D0CA 2E6FA 3UXDA 3CIWA 3O05A 1HUVA 1DL3A 1W3NA 4C1KA 2FTPA 3HG5A 2VXNA 4ZQRA 4FX6M 2CLKA 4E2BA 1OFDA 4JEQA 4JR5A 4P2VA 3STFA 4S2CA 4IMDA 2VEKA 4HPXA 4MZ8A 4UTWC 1VYPX 3HJZA 5CPLA 3L21A 3M5YA 1DVJA 1N55A 3W07A 3GDLA 3W1PA 3L5AA 3L5LA 4H6KA 3W88A 3GR8A 4IMGA 5F1UA 4IOTA 4DPPA 3BLIA 2WQPA 2YW4A 3PM6A 4EIVA 4Z1AA 4ZQCA 3DFTA 2NUXA 5AN7A 2CW6A 2NZLA 3UPBA 1QPOA 1GVSA 1FCUA 3P67A 3OHIA 5IBXC 1U83A 1WX0A 3KX6A 1KFEA 4NNCA 2OJPA 3LBCA 2JGYA 3MP5A 3C3NA 3IIPA 4FF7A 3UPWA 3P8IA 1D3GA 2NX3A 1HG3A 3DI0A 5AC6A 1JCYA 1IIGA 3YPIA 2NLIA 2CZEA 1WOBA 2Q8LA 1XI3A 3G1HA 2JKEA 1K7XA 3OA3A 3MP4A 1G67A 5AYXA 5HWMA 3IIXA 4M7SA 2LLEA 3GKFA 5CGQA 1R2SA 4QISA 3TR2A 1AMKA 1QOPA 4N4QA 4LU0A 3RLUA 1PV8A 3NPVA 3N19B 2V30A 1F73A 4TMBA 4IPJA 3LCWA 3W7KA 4UTJA 5AYYA 1GYNA 1WDWA 1X7FA 3LOTA 1AW5A 3DENA 3HBLA 1YLVA 3NQGA 4LWWA 4OBTA 3VCRA 1PHQA 4ZQOA 2ZZ7A 4HPJA 1KW1A 1SW3A 1EWDA 1M7OA 4OT7A 3S5ZA 2BWGA 2VFDA 4XBKA 1GG0A 4JX4A 3W1LA 1JULA 3EKLA 5DELA 2CWNA 5LNWA 3PULA 1O5KA 2YYUA 1BEUA 3W7EA 1QFEA 4AWUA 4MZ1A 2C13A 1V5XA 3U2OA 4QIUA 2ALDA 2CLLA 1WQ5A 1H1ZA 2J24A 4GUFA 3LLFA 2YXGA 1L6WA 3SW6A 1GTEA 5BNKA 3PY2A 3G24A 2I1OA 4LT9A 1M7PA 5EY5A 1SQ7A 3S1XA 1JUBA 1P0NA 1WA3A 1OABA 2V2CA 4DF1A 5AHFA 2F7FA 2B7OA 3K30A 5LNRA 3CT7A 1GJPA 3A9IA 3RLVA 2VEIA 1SO3A 1OX6A 2Y7EA 1OFBA 3N2XA 4YLWA 1N7KA 5AHMA 1YDOA 2C15A 3CHVA 4NUWA 1NF7A 4QNWA 4K8HA 2ZCGA 1KM0A 3M47A 2GJNA 3DFNA 2B7QA 5HINA 1GOXA 4YL2A 4O10A 4GWEA 4NXKA 1VLIA 3W76A 3NQ2A 2PRHA 3C2EA 2VOMA 2J27A 4O8RA 1FDZA 2Y7GA 4MKNA 5F2LA 6TIMA 2JBMA 4LUIA 2TSYA 1CI1A 1UJPA 1VYRA 4ZQNA 4WD0A 2ZRUA 3SJ3A 3NL5A 3N9RA 2O7QA 1TPH1 3R5EA 3G3MA 4LS0A 3N34A 5FF0A 3QSTA 3HGSA 3G1VA 1R30A 1QCWA 2TMDA 1H61A 3LXCA 1QPQA 3W7HA 3JS3A 4D2JA 5LKYA 1PE1A 3NL2A 1XL9A 1EEPA 3UZJA 4O4WA 4LV4A 3ATYA 4OWGA 2WNQA 3GNNA 4AHQA 2AAMA 1F05A 3GYEA 1W1ZA 1EUAA 2G97A 4KFPA 1SPQA 1TV5A 4IX0A 1K8XA 1SZNA 1ZFJA 5I3IA 4RKAA 5LZLA 4O50A 1MEHA 4A2RA 2YCEA 3PB0A 4LOCA 2H90A 2H3BA 1W37A 3I7RA 4TIMA 1YDNA 3KFTA 2GVGA 4N9DA 1BTMA 1KV8A 2X1TA 1VRDA 2Y6ZA 2ZTKA 3G1SA 2E77A 3QEZA 3C8FA 3W1MA 1GTHA 2R94A 3LI0A 5CSRA 1GVRA 2ZA1A 1H62A 4UTTA 3ATZA 2E5BA 2X2GA 3G1XA 1LOSA 1KTBA 4NX5A 2CLMA 5KTLA 1ME9A 3ZWTA 1ME7A 4TX9A 3HGOA 5T26A 2JKPA 3TA6A 4M19A 4MJMA 5FESA 3GKAA 2VFGA 2HTMA 1XBZA 3MUXA 3B03A 4UFKA 1O95A 3EWZA 3ABQA 1K02A 3M43A 5D03A 1ZHAA 1H7PA 1YPFA 2ZA2A 3CEPA 3F4NA 2NUWA 3UNDA 2NXGA 4OV4A 3WJWA 4B5NA 3QPZA 4OE7A 2YZRA 4E38A 1A5AA 1SSGA 4BI7A 1W56A 1QWGA 3W2LA 4EF8A 1R46A 4O4VA 4ML9A 5I3KA 3UY7A 1SW0A 2R91A 5EPDA 2ZZ2A 1GWJA 3O63A 1J4EA 4ZQPA 1YYAA 3A5FA 1XXXA 3FA5A 4N9BA 3LHUA 2RKXA 4JICA 2DU2A 1DOSA 1X6UA 2Y85A 1VPXA 3LHTA 4UTKA 3B0PA 1F76A 3R13A 5D38A 2NXHA 4ZVJA 4UMCA 3PG9A 4YMZA 5L6UA 3VE7A 4Z08A 3V1PA 4QNEA 3B0VC 3PUOA 4UC5A 8TIMA 3CWNA 3LXAA 2BTMA 1EX5A 2V9DA 4JY9A 4HNUA 3TROA 4WOZA 5I3GA 3SI9A 3W1QA 4EWND 1NEYA 1TQXA 4NXSA 5TQLA 3TJLA 1B57A 3HIJA 5D2TA 3IRDA 5CZSA 1W3TA 4Z0SA 1QAPA 5F4XA 4EOUA 5LGZA 4NT0A 2R14A 1LRQA 3G22A 3QM3A 4DEFA 2VKZG 5U7SA 1EIXA 1H60A 3KHJA 4MIMA 1KLZA 2JKAA 1ZJIA 4A29A 3NG3A 2QCEA 1S3HA 2X16A 3RU6A 2DZUA 1H50A 3LTYA 3T78A 3M44A 2HMCA 1TV7A 4GJ1A 1K8ZA 2OMAA 3TDFA 4HHPA 3TQKA 5HUPA 4LW7A 3W1TA 1M6JA 1ICQA 1JRCA 3BG5A 3SECA 5EBUA 1TB3A 3GVGA 1VC4A 3NQ6A 3OVPA 3BARA 2QCLA 4LS1A 4K37A 3L0GA 4QAIA 3I65A 4N02A 4OQVA 5D04C 1O60A 4AAJA 1W3IA 3HG3A 5TIMA 1QPRA 5FF4A 4GUGA 3TC6A 1KV5A 5BOOA 3T7VA 4AXKA 1XUZA 3P81A 4HSNA 3NM1A 5G1YA 5CSSA 5FEPA 1FQ0A 5CZJA 1F74A 2Y89A 3GNDA 2Y88A 3W83A 1D3HA 1FCVA 4LNYA 1FY6A 2NWRA 1TTQA 2AGKA 2ISVA 4PEKA 3DKLA 4G1KA 4JDBA 3GXNA 3LI1A 2B0MA 3MYPA 1TJPA 2V82A 3QFEA 3JR2A 4WOQA 3R8RA 3TU9A 1TSIA 4MZYA 3T55A 3UWYA 1ML1A 3LDVA 1LRNA 3AJXA 4DELA 4UTLA 1IIHA 3P8JA 1J2WA 2VEMA 3IVTA 3GZ3A 1F6KA 3QJAA 4E0CA 2ZRYA 2DP3A 1VYSX 5G1TA 3LHVA 4BF9A 1H7XA 5C5YA 1T96A 5G2HA 3LRMA 2PCQA 4KWVA 3I68A 1SO4A 4X2RA 4GFSA 3IIVA 2FJKA 1EWEA 4CNPA 4MYXA 3LRLA 2V2DA 5IM51 3V75A 1OF8A 2YR1A 5L9FA 3BPWA 2XFWA 2QR6A 3W9ZA 3E02A 1V7YA 1XKYA 2RHGA 3W7CA 3LRKA 1YPIA 4AHPA 3QSRA 1JUKA 2QJHA 4GC4A 4K7YA 4O16A 3TXVA 3U6WA 1KFBA 3GDMA 5LGXA 3GLCA 1DORA 4O57A 3W7RA 4O0KA 1FBAA 4WUIA 4KFOA 1TTJA 2WSYA 1MEWA 4LVDA 3NM3A 1PL9A 3M41A 1X1ZA 4KFNA 3G1AA 4HNTA 4MY1A 1ZENA 3S5NA 1AW2A 1JVNA 1Q6LA 4JTFA 4DBEA 3BO9A 4O53A 3GDRA 3DHDA 3UD6A 1QR7A 3MI2A 5DY2A 4PCFA 4O1BA 1A5BA 2JGQA 2XN0A 1I2OA 2RDTA 3TH6A 1GVOA 3P82A 3C6CA 5K2ZA 3USBA 4QSHA 4AMAA 5FEWA 1GYLA 2Y62A 4K39A 1VHCA 3DFSA 3GAYA 4HNVA 5HR6A 1SFJA 3MP3A 3O8AA 2QF7A 1WOAA 3CIXA 5HMSA 3L67A 1Q6OA 3EX3A 4Q33A 1TYGA 3PSWA 3ZR4A 2Z2UA 2GOUA 4IX2A 4JTEA 2A7PA 5LNUA 3TMQA 2WV8A 3KRSA 3VE9A 2WKJA 1JCMP 2VFHA 1TJRA 3P60A 5BRBA 1OFAA 4FNTA 3DFQA 3IVUA 1DJNA 4UTHA 3BGGA 3C2RA 3HMJG 3EWYA 4WJEA 3N73A 3C61A 3G1YA 5AFDA 3PBYA 1XUUA 5D2VA 1FDJA 4LTSA 4NJIA 1BWKA 2DORA 5AC7A 2QJIA 1W5OA 3PF3A 1MEIA 3G1DA 3N14A 1JQXA 2X1RA 3QZEA 3P62A 2XN1A 4ZL1A 5C54A 4O1AA 2HS8A 4BWLA 1J5TA 3W1NA 4AF0B 5H2ZA 1G7VA 1HFBA 2DZSA 1ZCOA 2ZZ4A 3B4UA 4AF0A 4ORMA 1KM4A 1WV2A 5CPOA 3TUUA 3O16A 1LLWA 4M6VA 3ABSA 4XQ6A 1HTIA 5I3JA 1H7RA 1TRDA 5FF3A 1UASA 3N3MA 1QMLA 3WJXA 3W70A 2J6XA 1VCFA 3E0IA 1G4EA 1TPVA 4JYDA 1IXQA 4EF9A 3W87A 1TCDA 4UR7A 4JX5A 2A6NA 2RDWA 4ICNA 4XWUA 3NZRA 3W7DA 2QAFA 4N6EA 1HO4A 3FKRA 3QH2A 1C9DA 2E5CA 3GAKA 3UQNA 5D02A 3NQAA 1JCJA 3S0CA 5G2WA 5K4ZA 1ZALA 4RR4A 3FYOA 1LBLA 3P7YA 2QEZA 4BFAA 4PODA 4HIBA 4BR1A 3P61A 3EX2A 2CZ5A 3DGRA 4CQAA 1UB3A 1OFRA 1RQEA 1OK4A 3PBUA 5DCBA 1TV8A 3O06A 2BX7A 1ZY9A 5J5DA 4FXSA 4LVFA 2X30A 4UMAA 1A5CA 3S5YA 4FXRA 3TAOA 5K3VA 5FEZA 2WNNA 4MY8A 4UXDA 3QQ0A 1SO6A 4JTLA 2RDUA 2QCMA 2VENA 1IXPA 3STGA 2QCGA 4JXCA 3UZ5A 5BMXA 1KM1A 1DBTA 3BW4A 4UTMA 2FPTA 2EF9A 3KVLA 3F03K 3NPXA 3W7JA 4MFEA 1FCBA 4PTNA 3ABRA 4LV9A 1VHNA 3NGJA 4JTJA 4CNOA 2OCZA 3G0SA 2PRMA 4UFIA 1SSDA 1I2RA 4LC6A 5HWNA 1W5MA 3HB9A 3DFOA 1S5VA 3NQEA 5AHIA 1AL7A 1OYAA 3BW2A 3STEA 2C3ZA 5DLCA 3QQ1A 3P74A 3U8GA 2YPIA 3TK7A 2A85A 4U28A 2WPBA 1DKWA 3W7PA 4JN6A 5DBTA 2FIQA 3SIZA 3HGRA 4GBUA 3C4UA 4Y9AA 2X1UA 2NWSA 1X1OA 3ANYA 4LVBA 3GDKA 1TRIA 4UTTC 3CQ0A 4WY0B 3ABOA 1KTNA 4LC8A 2RFGA 2E6DA 4WY0A 3NO5A 3BVJA 3LHWA 4JD4A 1TIMA 1M5WA 5K7JA 5HULA 2C14A 4PL2A 1LOLA 4P61A 3PVFA 4FB7A 2GVLA 4UNKA 3KVKA 4S1FA 1XCFA 3WK2A 4AB4A 1I2NA 3DFPA 3QF0A 1Q6RA 4IXXA 3W2NA 3W1XA 5EA9A 3TSBA 2QCCA 2QDGA 3C0JA 2TRSA 1W5PA 4H4IA 1JQVA 1B4EA 2WO5A 2C18A 4XBSA 2GJLA 2HS6A 4N2YA 5LNVA 1PIIA 2W0UA 3W1AA 3DZ1A 5AOUA 2DJXA 3OVQA 3W71A 3FJ6A 3FOKA 1GEQA 3M1ZA 1QNVA 6ALDA 4UMBA 2YW3A 2QAPA 2PC4A 4RZ6A 1LORA 1EPXA 2YDAA 4HNNA 1EUNA 2DZVA 1YXYA 1JUEA 5FF2A 3OVRA 3W6YA 5DN1A 3FIGA 3EX4A 3HQ1A 3MHUA 5LNSA 2CLFA 5D05A 2E5DA 3ZWSA 4QQ3A 3O6DA 1ADOA 1S5TA 3NEVA 3EWUA 1KA9F 2VFIA 3S1UA 3G0XA 4JDYA 3LERA 3QRHA 1T0OA 1RVGA 2A7NA 2Q8ZA 3S6DA 3PR2A 1TMHA 4NVTA 4R34A 4Y6GA 1A5SA 3BLEA 3OIXA 3TV8A 1YDVA 3QMSA 3NQCA 3GX9A 4IWWA 1IGSA 3WJZA 2CLEA 1CW2A 2HSAA 5DXYA 4FNRA 3W73A 4RZ4A 2BLEA 3M6YA 4QITA 3W22A 1P0KA 2ZFAA 4ADUA 1B9BA 4JTSA 1XDLA 1G4PA 4CCDA 3Q94A 3NOEA 4MPQA 1AK5A 2Z1BA 3QYQA 1YXCA 1SR9A 3EXTA 1LOQA 5AB3A 4UFLA 5DCEA 2NV1A 3R2GA 4O1DA 2ISSA 4S2BA 2J9XA 2YYTA 5HQEA 2VFEA 2J9ZA 1ALDA 1PHWA 2Y61A 4MVAA 2VC6A 1DQXA 1L9WA 1SZEA 2ZBTA 4UTUA 3NQMA 2ZZ3A 1VGAA 2BZNA 1LROA 4K36A 3A21A 1W54A 2PURA 1HL2A 3EXRA 5SWUA 2DZPA 2TPSA 7TIMA 3TNOA 1GVQA 1VCGA 4AWTA 4GE8A 1H7WA 3LCHA 4JX6A 1O94A 1W31A 2QCHA 5F4SA 4NNBA 3QMTA 5I3FA 1JR1A 2C6QA 3A22A 3L2IA 1NSJA 4UUIA 1OVDA 1Q45A 2W6RA 1D9EA 2VFFA 4IPIA 4WZHA 3F1QA 1P5BA 4WY0F 1LDCA 3M7WA 3SSJA 4RXGA 2YFOA 4A2SA 4ALDA 2KZHA 5HR7A 4CCEA 5EMUA 1MSSA 1TQJA 4JS3A 3PWAA 4NNAA 4O13A 1G4SA 4WXYA 4Z1DA 4HN4A 4XTDA 2NX9A 2A7RA 4WX2A 3TQVA 3PBVA 4EVZA 2Y70A 3BG9A 4A22A 3B06A 3NQ8A 3TW7A 3IEBA 1YXDA 5DXXA 3FEMA 3OEXA 2EGZA 2ZA3A 4Z1CA 2P10A 1TPUA 1FXQA 1A53A 3A23A 1LBFA 3EXSA 3G1FA 3W1UA 3M0ZA 4FHAA 3GIYA 1JJKA 3FKKA 1MZHA 2ZRXA 5C55A 3DXIA 5BW6A 4O12A 2GUUA 1G4TA 2A2IA 2XN2A 3LTPA 4M7TA 1H51A 1OFQA 1OFEA 3E96A 2GQAA 4IMEA 2ZZ1A 1L2UA 3T4CA 3EWXA 3CEUA 3L66A 4GNJA 3L0KA 1OFPA 1JCLA 2Y63A 1F2JA 4CQ8A 1Z41A 3I6RA 3INPA 2VEPA 1EP3A 3IGXA 3HO8A 5C6MA 3UWQA 4YWIA 3QPYA 5E1QA 4NJJA 3T44A 4KWWA 1YTKA 1SU5A 5K9XA 3HG2A 3TIMA 2ISWA 1H1YA 2QCFA 4DF0A 3SGZA 3VNDA 4XKYB 1SUXA 4O14A 2V81A 3C2FA 4JTKA 3ELFA 3TSMA 1K03A 2E6YA 2DZXA 4XKYA 1C8VA 5AHLA 1EA0A 4GRSA 2RH9A 3RNDA 4UFMA 5EL1A 5E93A 3PB2A 3BW3A 1GVFA 5A5WA 3W74A 2FPYA 1L6SA 4DO5A 5MHBA 2W79A 1H5YA 4LVAA 4UIOA 1QOQA 4O1CA 5D2YA 1XC4A 3O15A 4DO6A 3G3DA 3E12A 5FF7A 4LVGA 3GB6A 3G0UA 4AVFA 4LS2A 3HPZA 4JTGA 1KM5A 3NQVA 3G8EA 2B7NA 4NJGA 5GVJA 2CFFA 4X3ZA 4RZ5A 5DCDA 3EB2A 3OG3A 3E49A 1LCOA 1QO2A 1EP2A 2G5WA 3LCXA 3SR7A 2FB3A 5D30A 2ZRZA 1KFKA 3LB0A 4U4MA 4MUZA 2FPVA 2TYSA 2P0OA 4R7JA 4BWLC 1KFJA 1SFLA 2YX0A 5CKSA 3S9YA 4QM1A 3TMLA 1FX6A 2E09A 4C1LA 5AC8A 4ZMGA 1JCXA 2ZRWA 3CM4A 1FXPA 1OYBA 3W86A 4TMCA 4O15A 5G2IA 5K4XA 1JRBA 5F1VA 3W3OA 3VI2A 3NA8A 4N9CA 5H91A 4LRTA 3NZ1A 4JTHA 4MLJA 3W7MA 5CZ0A 4UFHA 3LXBA 3DU0A 4JTIA 4LRSA 1KBIA 1ZNNA 3G8RA 3CB8A 3PSVA 4CQ9A 3L9CA 2ATSA 4N9EA 4NZJA 1UUOA 5G4EA 5LHEA 2FDSA 2P1FA 2YFNA 1K7FA 1OFOA 3CTLA 3GR7A 2EAWA 4BI5A 1LZOA 1VH7A 1YTEA 5AHEA 2B4GA 3LHZA 1ZAJA 3EX1A 1VZWA 1GT8A 5DY3A 1E51A 2V5LA 2YGYA 2WSQA 1R2TA 1BWLA 1VR6A 3C2VA 4R53A 2I14A 1LRTA 4IMFA 4O19A 4UTIA 2OZ0A 1AG1O 5KZDA 5K9CA 4AEOA 3KOFA 3G18A 2C19A 3GK0A 3LCGA 4BK9A 2A0NA 4I7WA 2C0AA 3TSDA 1EB3A 5CPNA 3KRZA 1IF2A 4PH6A 2ZTJA 1OX4B 4Z1BA 3MI3A 2F84A 2PRLA 2A4AA 2J9YA 4UTWA 1XBXA 4DQWA 1OX4A 3UWUA 4FX8A 3BGJA 4I7UA 1KM6A 1C29A 1ICPA 4IXHA 3M5XA 2JK2A 3IGSA 3I7SA 3QW3A 3BK0A 4RCXA 1I2PA 2A1YA 1FWTA 1KM3A 4E2DA 4X22A 4A3UA 3M16A 1LP6A 1KM2A 1VCVA 3SY5A 5ABTA 5TBOA 3PUDA 4J9JA 4FEZA 3NQFA 4XTIA 1A50A 3IVSA 1DHPA 1IXNA 1LM1A 5D2XA 2ZDRA 5HNRA 2EHHA 1TTIA 3H55A 3SZ8A 3GXTA 5I3HA 4O52A 4PFMA 4N6FA 2NX1A 1FUYA 3S42A 3UY8A 5IBXA 3W2UA 2FLIA 3TW6A 1G7UA 1Z42A 3A5VA 2NV2A 3IGUA 3NXFA 1X8FA 4Z0JA 1VQTA 4UCGA 4NJKA 4W9TA 3NL6A 1O4UA 1NFBA 3EWWA 2DZWA 5D37A 1WAUA 2ABAA 1SZGA 3AO0A 3S1VA 3CPRA 2OX1A 2EKCA 3EKZA 4IQLA 3W2JA 3TC7A 3UYCA 3Q37A 3LV6A 3TFCA 1KFLA 2QUUA 2GVJA 4JIPA 2BSLA 5F2IA 1GQNA 1WYIA 2H8ZA 5HWJA 4MYAA 4OGZA 3W7QA 4FIRA 3RK8A 3L68A 4RK8A 3LLDA 1H7OA 2ZZ5A 4DO4A 3TCEA 2V2HA 3NDOA 2E6AA 4GXMA 4DXVA 1W5NA 3NPUA 3O6YX 3C52A 3LHYA 2FB2A 3MHFA 4RV8A 5G5IA 2CZDA 3TKFA 3PBWA 1FWWA 1FDYA 1QDSA 4L4LA 3KXQA 2WNZA 1DJQA 1HO1A 4O18A 1ME8A 1LLZA 3THAA 5BMWA 2PE4A 4TU1A 3FS2A 1OX5A 5D33A 1TPFA 2A5HA 1B4KA 4KKXA 1QO5A 5FEXA 1R2RA 2DJLA 2QUVA 1WBJA 3CC1A 1FWSA 3P5YA 1RQHA 1ZAHA 3MJYA 3UWWA 3MBFA 1UCWA 3LX9A 3P84A 5LSMA 2OT1A 1NF0A 3Q58A 3TAKA 2DZTA 2Z6IA 1ICSA 2H6RA 1CX9A 1VLWA 2C16A 2EPHA 5F4WA 2QCDB 1I8JA 4MY9A 3WJSA 1RQBA 1Q3NA 3QC3A 2QCDA 1R47A 2FFCA 2QUTA 3DBPA 5K9DA 1LBMA 4OHQA 3LCFA 4CNNA 3E9AA 2Q3OA 4FNQA 5EKYA 1LTDA 3HF3A 2R8WA 2BXVA 3CU2A 4TO8A 2E68A 4BI6A 1T8XA 2GPTA 2VELA 4K7VA 2QKFA 4K8EA 2YSWA 4K38A 4CCCA 2Z6JA 3SGUA 4UR8A 3NPWA 3DHFA 3LBMA 2UV8G 5D32A 4K6AA 2CLHA 4GUJA 4HSOA 3M5ZA 2GQ8A 3N9SA 2B7PA 5DBUA 2WOQA 3DAQA 3DI1A 3W7GA 1G6CA 3MO7A 3PC0A 1GZGA 3P5ZA 4MJZA 3NAVA 3JRKA 1OK6A 1OJXA 4JY8A 4Q32A 2NXIA 3IV3A 3LGEA 2Y7DA 4IGHA 1TPC1 1PVNA 4YXGA 3GXPA 1VS1A 3W2KA 5HJLA 2NUYA 5J5RA 2D73A 1TTPA 2E1DA 3L0NA 1I2QA 2WSRA 4JYFA 2V8ZA 1EP1A 3HPXA 1RR2A 3B04A 2ABBA 2ATMA 3I7QA 2CLOA 1TPB1 2CZFA 4OU1A 3W7LA 3B05A 4ADSA 2J88A 3FLUA 4O54A 4RXFA 1TPWA 3S1WA 4UNLA 1YADA 4XZ9A 2ZYFA 3DKJA 3LCLA 3O1NA 1AL8A 1IXOA 4PC8A 1RV8A 4Y90A 3L5MA 3Q2DA 5D09A 1MO0A 2Q3RA 1RD5A 3W23A 3NL3A 1FCQA 3PAJA 4JNMA 4O11A 3C2OA 4RX0A 5CPMA 1RPXA 2QDHA 1F5ZA 3L65A 1H7NA 3F4WA 4YCOA 4MOZA 4RJEA 1KTCA 1TO3A 2H8XA 3W2MA 3SFKA 4FNUA 1Y0EA 3C56A 5KZEA 4WQ6A 2G96A 4GUIA 3PUEA 3A24A 3FFSA 4Y8FA 2Z0IA 3RF9A 4YCPA 4X9SA 1SO5A 2H3DA 1T99A 3UWZA 5KITA 4DF2A 4A21A 1GPWA 3FJLA 1FWRA 5EYWA 1I45A 2I9EA 4LY8A 1Z44A 1XM3A 5D2WA 1F7BA 3LCIA 3HOJA 3MYOA 3RMJA 2G95A 4FX7A 1XFBA 3TE9A 3S5OA 3PS7A 4FO4A 1K7EA 1H63A 4NQ1A 4Y96A 3TQ0A 2Y7FA 4IJBA 5G4WA 1AW1A 3EX6A 3RFAA 4AH7A 3WFAA 1N8FA 3LM7A 3H53A 5AHNA 5A8GA 1FWNA 3O6CA 4L4MA 1W5QA 1UBSA 3NVTA 1UUMA 1F6PA 4NU7A 3TJXA 3UXAA 1Q6QA 3GDTA 2V0TA 2IQTA 1K3UA 2OT0A 4ADTA 3WJYA 5HUOA 3KAOA 4O17A 1S5WA 4MLRA 3TFXA 3B0UX 3IIOA 3O07A 4JIQA 1TPEA 1W8SA 3NR0A 3DH7A 3R12A 3EEGA 3THQA 4PL1A 1XBYA 3MHGA 3PG8A 4ZZ9A 2V5BA 4M5PA 1KFCA 3STCA 1QPNA 4FNPA 4M6PA 3TX9A 3W7OA 4OV9A 2CU0A 2GQ9A 2AQWA 1ZAIA 3W7IA 4I7VA 3VFLA 4CLMA 1B3OA 1P1XA 3CLMA 1U5JA 3EWBX 3KVMA 5AYZA 3H54A 4O0ZA 2ZZ6A 5CG7A 1GG1A 4AWSA 1PS9A 4FNSA 3M9YA 1NAL1 3HG4A 5F2MA 4NX0A 3T40A 4ORIA 3R89A 4R33A 5KMYA 3MMTA 3LV5A 3WK0A 4PA8A 4Q4KA 1Z48A 4M6QA 4ONVA 5E0KA 3W7NA 3ZFHA 1THFD 4TR9A 5KSWA 1KBJA 4QJ1A 3QW4B 5CZTA 5U4NA 3BG3A 3WK1A 3ZS4A 4NZFA 1MXSA 3W84A 4JTTA 5KZMA 1XDMA 1WBHA 3MW7A 4GUHA 3W72A 1BKSA 1PCWA 3CWOX 1JCNA 3NNTA 4MFDA 1OHLA 3BV4A 1K8YA 1YTDA 1OG0A 1W0MA 3KRUA 1VJIA 3S8HA 3MWAA 3W1RA 1DV7A 2ZQ0A 4FIQA 4NJHA 3M5VA 1TREA 3N2MA 3W75A 5LHFA 4N4PA 4UFJA 3LTSA 1WXJA 1OF6A 1DQWA 4DBDA 2ZRVA 5KINA 4HT3A 5C2XA 2O7SA 3VKJA 4HKPA 3WK3A 4IMCA
chains in the Genus database with same CATH superfamily
1EL3A 1G69A 1OM0A 4MTVA 1TPDA 1U22A 3S2NA 3KVJA 4UOQA 2J47A 5CH9A 2OPJA 2DGAA 3VIOA 1LYXA 4HMDA 4HCHA 1KLYA 2X1SA 4WXZA 4YYCA 3NQDA 1W9BM 2PB1A 4Z2IA 3O3RA 1XHGA 2IXUA 1PCKA 2QCNA 3B8DA 2QV4A 3P80A 1CDGA 1C3FA 4RLIA 3MI6A 3NYZA 1R86A 4ZQMA 2VZTA 3SM0A 3CMJA 4HJFA 1NVMA 2C1GA 2WMIB 2QJNA 1BYDA 1GHRA 2FTPA 4QEHA 4D6HA 4MWAE 2VXNA 3MKVA 1RA0A 1B5TA 1OFDA 4MB4A 4P2VA 5GPRA 2YBUA 3GRIA 4S2CA 4HPXA 2I5IA 3AU2A 4OBSA 3ZT7A 1XLDA 3L21A 3W07A 3AIWA 4H6KA 3GR8A 2D22A 3N13A 4M6UA 5F1UA 3BLIA 2ISDA 4GYPC 1I1WA 3PM6A 4B5TA 3VKDA 4AIOA 4B3KA 1LQ2A 1EF3A 3E38A 5M17A 4W87A 1TE6A 1LL7A 3CZEA 3AS0A 3DFTA 5AN7A 2PWFA 4ZTXA 4IFRA 1UR9A 1FCUA 4XB3A 4B5VA 1WZKA 2REQB 5IBXC 3KX6A 3LBCA 5FD0A 4RW5A 2REQA 1D3GA 1HG3A 1QVBA 3DI0A 1IIGA 2INFA 3YPIA 2NLIA 1EGZA 1E6QM 3MQTA 3G1HA 4GKLA 1K7XA 1G67A 1OSEA 3WN6A 5CPQA 3IIXA 3IJ8A 2LLEA 1R2SA 2P76A 3MKKA 1PXGA 1MXGA 3LCWA 1R3VA 5FSEC 1WDWA 4WVXA 1QK0A 1X7FA 1MFUA 2WBKA 2GSJA 1EGVA 2NQZA 4MADA 3TCSA 1QPKA 3EOLA 4ZOAA 3WNOA 3GHSA 4HPJA 1UD3A 1EWDA 2BWGA 4XBKA 3W1LA 1JULA 2CWNA 2IPWA 2OLHA 3PULA 1BEUA 5BXRA 2VRKA 1NWRA 4XD4A 2JIEA 4Q8PA 4Q8OA 1EF2A 3PPFA 2PCEA 1WQ5A 4DRSA 3LU2A 3PTKA 3EPOA 5BNKA 4DBSA 1XGEA 2I1OA 4BEUA 4MPKA 3L2MA 1YHTA 2QZRA 4DF1A 2V2CA 3FSUA 2B7OA 1XV8A 5LNRA 1WZLA 3UGVA 3VD7A 2D3LA 4D9PA 2VEIA 2Y7EA 4JKMA 1OFBA 5FJJA 1N7KA 1TG7A 1M53A 1YDOA 2C15A 3C0SA 5H8MA 1L6FA 3SCRA 3CHCA 4S3CA 3NYDA 4WSKA 4HNCA 3WDJA 3M47A 2POTA 4Z2GA 3IUIA 4GWEA 1D3CA 3ZMRA 3TR9A 4FLQA 2J27A 3ARRA 1FDZA 1K6WA 5REQB 1U1HA 5A2AA 1CI1A 3LEPA 5REQA 4ZQNA 4NAEB 2ZRUA 3SJ3A 2CBVA 2ZKMX 1V6YA 3N9RA 4LF1A 1L2QA 4NAEA 3N34A 1PX4A 3T4WA 3HGSA 5HNUA 4E2VA 4CQDA 1QCWA 1ZUAX 1F4AA 1H61A 1QPQA 3AS1A 4ZO7A 2CXEA 4LCQA 1J5SA 2XVLA 4D2JA 1XL9A 1PIGA 4O4WA 4CEUC 1A3WA 4RNHA 2PWEA 3GNNA 3LK6A 3QGKC 2G97A 4C6NA 1SPQA 1OT1A 4IGSA 4DZ5A 4IX0A 1RLDA 3PZVA 3ARTA 1MEHA 4A2RA 4LOCA 1EIBA 2BGQA 5BWFA 4ZBCA 4B9YA 2CITA 1P43A 2X1TA 3IS4A 2ZTKA 2E77A 3QEZA 3LI0A 3THDA 3EWCA 4UTTA 2DSKA 1LOSA 2WCAA 1W9UA 1XPYA 4TX9A 2OO0A 3CQHA 3CPGA 3B97A 3BZGA 5FAGA 5FESA 3GKAA 2YJQA 2CERA 1KCLA 1O95A 3EWZA 3SAZA 4FLRA 1GCYA 8RUCA 2E9LA 3PBGA 3PHAA 1XICA 3VGEA 1KBLA 1QNSA 1C92A 1H7PA 3MSGA 3CEPA 3F4NA 3WJWA 4OV4A 3QPZA 4E38A 4GY0A 4JIHA 1SSGA 4HOXA 4XZBA 3W38A 3ARYA 1QWGA 3GFZA 1QW8A 3B9EA 4EF8A 3W6LA 2GVEA 5EPDA 2ZZ2A 1US3A 4ZQPA 4XZLX 3A5FA 3FA5A 4FLOA 2I9UA 4JICA 4ROQA 1XRVA 1HVXA 1X6UA 4HVXA 2X0HA 3UCCA 1RHCA 4UTKA 5D38A 5H8PA 4US6A 2GSHA 1M3UA 3B8TA 3B9AA 4L6OA 2FZNA 2BNJA 2PU0A 1EXBA 1VD6A 4JY9A 4EACA 4RDZA 5AZ1A 4DJED 1IT0A 3B8IA 4GH1A 4WOZA 4GQQA 4EWND 2J78A 7REQB 5TQLA 3T8QA 1W2PA 7REQA 4LAOA 4QTGA 1GEHA 3K8LA 4YYFA 1H1NA 1ONXA 3E1F1 4TTUA 1LRQA 2DIKA 3AYRA 1TWWA 2VKZG 4LYRA 1EIXA 1Q63A 1ELSA 3PJTA 4NZ5A 1FWJC 1ZJIA 2WVUA 2QCEA 1UWTA 3VM7A 3F2CA 3UVIA 4F3HA 3QFWA 1Q2RA 2HMCA 1JFHA 1HJQA 3TDFA 1NQ6A 3TQKA 5HUPA 1VPQA 4H7ZA 4P8VA 1ICQA 3MSDA 1JDCA 3BJTA 4TOQA 5D9OA 5EFFA 4C1NB 1OY0A 3PN8A 1UKPA 3AU6A 4C1NA 3P3BA 2QCLA 4K37A 4XISA 4QAIA 1DIEA 3I65A 3S4TA 4OQVA 2MANA 1W3IA 3WQPA 3F4DA 1TWZA 3RRAA 4GUGA 1KV5A 3CQKA 4INFA 1XUZA 2WW5A 1PUDA 2VZSA 1K6AA 1JGMA 1Q8AA 4XO7A 3W83A 2JALA 4LNYA 3WL0A 2NWRA 4GI8A 2AGKA 4EXBA 3PJWA 4PEKA 4JDBA 4CVUA 2WKLA 3GXNA 4BCEA 2B0MA 3ARVA 1TJPA 5A6AA 2WMKA 1TSIA 2BVWA 2W61A 1EDGA 4MNMA 4A6GA 3UWYA 2VUYA 3E2SA 1LRNA 3AJXA 4DELA 3QV9A 5DRCA 2YXOA 1I9CB 7A3HA 5PTDA 2VEMA 3IVTA 2DP3A 4BF9A 3FSTA 3SADA 4C65A 3NSMA 5G2HA 3I68A 2HDJA 4X2RA 1BF2A 4UCFA 4MYXA 2XFWA 3W9ZA 1XKYA 4PRTA 3LRKA 1YPIA 4AHPA 5IDZA 2PDCA 4PTMA 1ZCCA 2QJHA 3T08A 4KBXA 1RCQA 1KFBA 3QVQA 3GLCA 1BFNA 3W7RA 1W2VA 4O0KA 4KFOA 4CU8A 2WZEA 4EANA 2DV0A 3NM3A 3VGGA 1UA7A 4HNTA 4L9YA 3GG8A 2VHLA 2OWXA 1ZENA 4IP7A 2FHFA 4Q7NA 4JN8A 3BO9A 2Z1KA 4DBEA 1EO7A 4D8AA 1QR7A 5DY2A 1OCBA 4O1BA 3M46A 1IWPA 1V02A 1VEPA 2MNRA 3ZSTA 2QGHA 2P53A 1GVOA 3P82A 3KTSA 3PZNA 5T9BG 5A2BA 1WKYA 3DFSA 4HN8A 1AUSL 3A6OA 3RAOA 5CBIA 3L67A 1Q6OA 3EX3A 3G6LA 2HJPA 2E9MA 1R87A 3IK4A 2Z2UA 2GOUA 3K8KA 4JTEA 4AD1A 3B9DA 1VJSA 1FP9A 2VFHA 3PZGA 1OFAA 4FNTA 1A5UA 1DJNA 4UTHA 1RP8A 3EWYA 2ACUA 5CQ1A 1CGTA 1B9ZA 5A3HA 3UF9A 1BWKA 2V69A 2H9AB 1BG4A 2QJIA 1W5OA 1MEIA 3N14A 2X1RA 3ZT5A 3GNOA 2H9AA 1HGYA 3ALGA 3UR2A 4OOZA 3E5BA 3VILA 1J5TA 4AF0B 4R9XA 1HFBA 3ABZA 4AF0A 4ORMA 1K1DA 1LLWA 3ABSA 4XQ6A 3D5HA 1HTIA 4KWSA 4KESA 1TRDA 3MZNA 2J4GA 3DBNA 1TJ2A 3WJXA 2DFAA 4XAGA 4JCLA 1BTCA 1C91A 3GH7A 3B9OA 4D1IA 3H2EA 4QQUA 4UR9A 2A6NA 4ICNA 4XWUA 2DUZA 3EKGA 1ITUA 1HO4A 3VDCA 3FKRA 3QH2A 2YCKX 3UQNA 4IH3A 3NQAA 1B90A 1Q8JA 4W93A 1JCTA 1E71M 3KS6A 2WLYA 3H7VA 5JXQA 3RJXA 2FGLA 4BFAA 1UR8A 7ODCA 2ZXQA 3EX2A 2CZ5A 4B5SA 1YIXA 2XFFA 4A05A 4GBDA 2F9RA 2Q6ZA 4KF1A 1KWGA 3RO8A 3AI0A 5K3VA 2E40A 4UXDA 3QQ0A 1SO6A 2VENA 2QCGA 4JXCA 3QOMA 3NFUA 3UZ5A 2PTXA 4UTMA 2Y1HA 1OGBA 4YTUA 1S2WA 5JMUA 4MFEA 1FCBA 1RXOB 1M03A 3ABRA 4LV9A 1VHNA 3NGJA 4ZFMA 1RY0A 4I9JA 3DHPA 1TFVA 4PMXA 1IYXA 5HWNA 1I2RA 1NELA 2J7FA 2BOGX 1QW7A 3NQEA 3BW2A 3TJIA 4RZBA 1GUVA 3T0BA 3SIZA 1AD4A 1JZ2A 2QNEA 4CNTA 3SEPA 2NWSA 1X1OA 1JXJA 4LVBA 4UTTC 4H9MA 5A8PA 1J0YA 4JEJA 4BS0A 1Y5XA 4XUYA 5FACA 1EH9A 3NO5A 5HNNA 3BVJA 4B3LA 2PTYA 3LHWA 4JD4A 5HULA 2NVAA 1JZ8A 4JOMA 4QDMA 4UNKA 1HJUA 5EMYA 4A8NA 1E40A 3KVKA 5HQLA 1XCFA 1Q6RA 2D3NA 3W1XA 3EOUA 3H7RA 3NJ3A 4DJFA 1F8MA 1W5PA 3CV2A 5FJUA 3U9IA 1JQVA 3RHGA 2WJEA 2C18A 4XBSA 2HS6A 1BLIA 1PIIA 3D6NA 3VOCA 4H9UA 2DJXA 3NSXA 3M1ZA 4JNYA 7TAAA 2FYMA 4UMBA 2YW3A 1PDYA 2PC4A 3BSHA 1EUNA 3PK7A 5LA1A 4JQ3A 2OSXA 3FIGA 1XISA 1XRTA 3IPWA 3O6DA 3BTNA 3MSRA 1S5TA 4K3ZA 1KA9F 2VFIA 4S39A 2VC9A 1T0OA 1RVGA 1DTUA 2Q8ZA 4Z2KA 3S6DA 3M0KA 2EG6A 3PR2A 1MRAA 4HU4A 3KBMA 2PDMA 3BLEA 3OIXA 1YDVA 3QMSA 4H9YA 3NQCA 4KPLA 3GX9A 4BA0A 3WJZA 1F4HA 1V93A 4MUPA 3H8AA 2PGRA 2OU4A 2BLEA 3NVDA 4QITA 2ALRA 1KKRA 2QS8A 1B9BA 4JTSA 4YNGA 1XDLA 1E9LA 2Z1BA 3HJEA 2VD8A 3EXTA 4W8BA 4P7NA 1CLKA 5LYRA 2NV1A 1XINA 3PJXA 4O1DA 2J9XA 1V08A 1ZBVA 1YEYA 3ARSA 3UR5A 3K5XA 1L9WA 4M1RA 4UTUA 1W17A 4Y8EA 1B3WA 1FWBC 4ZR8A 1W54A 2PURA 1HL2A 3HZ3A 7TIMA 2CIPA 1GVQA 1UC5A 4JX6A 3LBOA 4UTFA 1W31A 2VCBA 3QMTA 4KRTA 5I3FA 3GXDA 2C6QA 1XIGA 3BSMA 1Q45A 1M01A 2OEKA 2D2GA 2FTWA 3AC0A 3F1QA 5AC5A 1P5BA 3ECQA 4A2SA 5EB8A 2WKGA 5ABEA 2Z2AA 3VPLA 5A8MA 3OO2A 1TQJA 3IJIA 4HA4A 3IK2A 1KCZA 4XTDA 1DJYA 3EB4A 2VDHA 3E74A 1LQAA 1NDYA 4EVZA 3BG9A 4A22A 1UWUA 3BSGA 3FEMA 3OEXA 2NT1A 2VTFA 4PMJA 1XJBA 3MCNA 4BQ4A 1YNYA 1LBFA 4R7WA 1IZCA 2X8RA 3G1FA 1AJZA 4FHAA 3GIYA 4H6QA 1E6SM 3NURA 3FKKA 4BF7A 1M41A 3DXIA 3WLLA 1J11A 1FHVA 1UD6A 1XG4A 1A47A 3LTPA 3QHMA 3RPTA 3CGTA 4O0QA 2GQAA 1NH6A 4IMEA 4JL2A 3CEUA 3GFXA 4GCXA 1OFPA 1ZSXA 3URBA 4AMCA 3U2CA 4B9ZA 4GX8A 4HA0A 3I6RA 2Z25A 4CN1A 2XINA 3HO8A 1FH9A 4YWSA 3UWQA 2PWGA 1AH0A 4GCAA 3T44A 4KWWA 3WQVA 1OCJA 1SU5A 4DAFA 3HG2A 1B31A 2ISWA 2QCFA 3GR4A 3ZR6A 4XKYB 2V81A 3V18A 3ELFA 1BPLB 4XKYA 7ENLA 3U4FA 2FFIA 3VVGA 3RN6A 1EA0A 2VL4A 2Q01A 3AIVA 2OYKA 5EL1A 3EMCA 3PB2A 1ISZA 3BW3A 2FPYA 1L6SA 4H41A 4HHLA 4DO5A 2J8TA 2V63A 2YLLA 5E0CA 4PTWA 4H7VA 1KGUA 4FOUA 4UQDA 5D2YA 1C8YA 3O15A 5FF7A 4LVGA 3FXGA 4XX6A 1AQ0A 3NQVA 4CCZA 3BAKA 1X39A 2PP0A 1ZBCA 1XIBA 5XINA 2CFFA 5DCDA 3IARA 3EB2A 3SR7A 2FB3A 1KFKA 3FJNA 4C6DA 3GNXA 1JF5A 4HA1A 4GIYA 4C6FA 2UY2A 1XC6A 4C1LA 5AC8A 4Q6JA 4M8UA 3PAOA 3W86A 5G2IA 3ZLHA 5K4XA 1JRBA 1ADDA 3W3OA 4BY3A 5H91A 4LRTA 1QI3A 3V4BA 2E7FA 1NJJA 2HNEA 4UFHA 2D23A 3DU0A 3M4HA 4Q4PA 3CB8A 1I75A 4CQ9A 1O12A 2ATSA 2OOGA 1UUOA 2P1FA 2F2KA 2OELA 5AYBA 4Q22A 3KWSA 3B8WA 4BI5A 2WYSA 3CL8A 3WEOA 4F4RA 1YTEA 2PP1A 5AHEA 1ZAJA 1VZWA 4QG6A 1OB0A 4IICA 2XH7A 5CBJA 2V5LA 3FNDA 2XIOA 1R2TA 3C2VA 2PDGA 4R53A 4UTIA 1AG1O 1UQYA 4QX4A 2C19A 4KWOA 2VX5A 1XR2A 2GDQA 3H24A 4I7WA 4XZIA 2PGFA 4CQCA 1EB3A 5TNVA 2R24A 3SCTA 4PH6A 1WZMA 1HKIA 4Z1BA 4UTWA 1YNPA 2OZTA 4FX8A 4J35A 4I7UA 4NI8A 1C29A 3O2LA 2PTDA 3M5XA 3CUZA 4RCXA 1FWTA 4V1YA 3M16A 1AH4A 1KM2A 1VCVA 4WF7A 1PWLA 2NQ9A 3AZSA 4J9JA 3NQFA 3IVSA 1LM1A 2WXDM 1XSJA 1D2KA 1TTIA 3H55A 1DPMA 5ABGA 4PFMA 1FUYA 3W2UA 3TW6A 5C70A 1Z42A 4L61A 3A5VA 2XSBA 3IGUA 1S1PA 2HXUA 1VQTA 4UCGA 1C8QA 2O92A 3QV7A 5D37A 4Q6XA 1B3VA 1DTNA 1WAUA 1SZGA 1J8VA 3CPRA 4DYEA 3W2JA 4ZOCA 4NY2A 3TC7A 3UYCA 3AMKA 3Q37A 4A3HA 2QUUA 4NF7A 5FJPA 4AZ5A 1WYIA 4MYAA 4W84A 4OGZA 1QNPA 4ZO6A 3L68A 2Z1XA 4RNFA 4JCMA 4UQEA 1H7OA 3WL1A 1HP5A 3TC3A 2P8BA 2E6AA 4GXMA 2WMHA 2BFGA 1W5NA 3NPUA 3O6YX 2QXWA 1DJWA 3LHYA 2VVNA 4XD5A 2OKOA 5FJOA 4HNOA 1CYGA 4U5IA 4XZNX 3WQEA 3WNMA 3MZ2A 1FWWA 1QDSA 1IEVA 4L4LA 1XP3A 1VPYA 2XGBA 4DJFC 3DG7A 1ME8A 4V28A 3QR1A 1OADA 1G01A 2PE4A 3E0FA 1OQFA 3FS2A 2ANUA 2QPSA 2A5HA 1QO5A 1XGDA 2IS7A 1R2RA 1W3HA 4ZE5A 2Z00A 3VKBA 1DWGM 1IWBA 5LSMA 5C9WA 2Z6IA 1RH9A 4P7RA 1VLWA 4KEUA 3CV7A 1TJ1A 3AHZA 4K68A 4P7LA 3ARPA 3TYAA 4HMEA 2EJ1A 1KXHA 2BMBA 4S3JA 2Q3OA 4AZBA 4FNQA 3HF3A 3MV01 4FR6A 1CNVA 1L0PA 3W29A 2GPTA 3FHQA 4K7VA 5DEZA 2VR5A 1X98A 1JNDA 1FKWA 2YSWA 1CCWB 3N04A 3SGUA 4Z17A 3Q4DA 2W4XA 3UGRA 4UR8A 3CUFA 1TV3A 4E5TA 3DHFA 3PTMA 5D32A 2PWVA 4K6AA 2CLHA 3UJEA 3MT1A 1GKRA 1OC7A 1G6CA 4LANA 3PC0A 3P5ZA 4WHBA 3JRKA 2PDLA 4JY8A 2I5GA 3S3GA 3NXLA 3LGEA 4LCRA 1PVNA 1D8WA 4PUJA 2GUYA 1IQ8A 1AVAA 1VS1A 5HJLA 1BYAA 4F9JA 2ZXAA 3EA3A 2WSRA 4O8AA 2R1MA 3RMEA 1IZJA 1N8WA 2ABBA 3U0HA 4D8ZA 1Q6EA 2Z1WA 2CLOA 2CZFA 3B8VA 4H6RA 4OU1A 3B05A 3W7LA 3CZKA 4O54A 5FKYA 4AYGA 1KRCC 1QHZA 4RXFA 1XG3A 3OU8A 1E4MM 4ICCX 2DY3A 4L4OA 3O1NA 1AL8A 2YKKA 3N4EA 1IXOA 1PKLA 4PC8A 3TYEA 3NDYA 3IRSA 5CC7A 5D09A 3SCVA 1MO0A 3GW3A 1E4LA 4TTGA 2C7FA 3CHDA 1F8IA 2XTKA 3C2OA 3WIJA 1F5ZA 3L65A 1FFRA 5C2CA 2GDVA 1QNRA 3FV9A 4NYYA 3SRDA 3W2MA 3SFKA 1Y0EA 3QOKA 1EJSC 4NHVA 2NVDA 1XIFA 4WQ6A 4W7VA 2G3FA 2G96A 3AXXA 3S9IA 5FIPA 4E6MA 2Z7GA 3PUEA 3A24A 1UZDA 4HQVA 1IZKA 1P6BA 3T1GA 1S38A 1EBGA 1T99A 4P7QA 1FWRA 4GPNA 5EYWA 1Q2SA 1K9EA 3FYYA 2I9EA 3RR4A 1XM3A 5CLTA 1SMDA 3SCOA 3MYOA 2G95A 1XLHA 1ZBKA 3TE9A 3ZR5A 4FO4A 1K7EA 2BG5A 4E2OA 1BF6A 1KNWA 4IJBA 2QVHA 3TLLA 5ABFB 4N7QA 3WFAA 4MB3A 1FWNA 2G37A 2PZ0A 5ABFA 4L4MA 1RSCA 4W88A 2DEPA 4ZENA 2V0TA 2IQTA 1G94A 2OT0A 3CB3A 2ZVIA 1LJYA 2PI6A 3PPCA 3C0LA 4O17A 1AODA 3TFXA 3Q45A 2VEFA 1S2AA 4QJ3B 4S3AA 3O07A 4JIQA 5JIWA 2G3MA 1J6OA 3EEGA 4W8LA 4PL1A 3KWXA 2XZ9A 1UBPC 4NZ1A 4FNPA 5FJTA 4Z42C 3GG0A 3W82A 6XIMA 2FHBA 3M0IA 1UP0A 2Y5JA 3DHUA 4Q8MA 2UZ9A 3W7IA 4V27A 3FAWA 4ASTA 3PUGA 1QNQA 1P1XA 1FH7A 3AYTA 3KVMA 1KRMA 3UJSA 4XVDA 4AWSA 1HXJA 1SMAA 3M9YA 1PO9A 3GVRA 3R89A 4R33A 2ZX7A 4Q4KA 1Z48A 1RLCL 4M6QA 3OPSA 2WJDA 4ONVA 1JDAA 3BANA 4FZIA 3VIGA 3AXMA 1PKMA 4LAMA 1U1UA 3KZSA 3PBMA 4KRZA 3RCMA 3HA1A 4AQLA 1W3KA 4WSJA 4NZFA 1MXSA 4JTTA 5KZMA 2G41A 3EOSA 1MQRA 1BKSA 1EO5A 3WQ8A 2F38A 4MFDA 3GHTA 1RBLA 1OG0A 2UY4A 3S8HA 4ZSUA 4GJIA 1DV7A 1LWIA 4NJHA 1E5JA 1MQPA 3WBAA 1DQWA 1PZ3A 4HT3A 4NRSA 2O7SA 2XISA 4HYWA 4IPPA 4H9XA 3H2CA 1L8PA 3W27A 4DPQA 4RE2A 3CIVA 4C7DA 4A8LA 3HM7A 3CV1A 4IUGA 1EBHA 1XBVA 3U5YA 4J2PA 1J01A 4H8HA 5BOEA 2WC4A 2WZTA 3KBNA 2YZ5A 3BE7A 1GPFA 2WZMA 3WQCA 1ZPTA 1UWAA 2Y2WA 3SDOA 3O0KA 3QY7A 4C6BA 3WMBA 4TV5A 1GQJA 4JYEA 2WJFA 3W0KA 1E0TA 2AMGA 1ONRA 1GK8A 2YL9A 5EMMA 3QMRA 3IIZA 5C9XA 1BKHA 2JQXA 2D20A 2HK0A 1SZFA 3BXWA 2YDQA 3OBKA 1I4NA 2VOTA 2FQIA 4POCA 1BD0A 2E6FA 1Z32X 2D0FA 3O05A 1HUVA 1CZ1A 1KQZA 2CXGA 4QSFA 5TAOA 1K8CA 2DW7A 2CLKA 4PUWA 3JUGA 2JF6A 3STFA 4U5KA 4WJXA 3QBUA 1VP5A 2X41A 8XIAA 4UTWC 1L6GA 4G6CA 3A9BA 3LLXA 2OX4A 4GO9A 1DVJA 1N55A 3CYVA 1NP0A 3W1PA 1PTDA 3WBWA 3NQBA 3W88A 3IJ7A 4IMGA 4IOTA 2YW4A 4PBFA 4EIVA 1RJRA 3WF1A 4Z1AA 1MW1A 1SM9A 2NUXA 4LBUA 1CLXA 2UY5A 1GVSA 3AHYA 2YB4A 1U83A 4IGNA 5HQMA 3ERPA 2JGYA 3MP5A 4B16A 4FF7A 1OGSA 3UPWA 4MWAB 3AYSA 1F9CA 2D0HA 2NX3A 5AC6A 4GI4A 2ZC8A 4YTRA 3VDHA 1DP0A 1C8XA 3WFZA 3DDMA 1G0CA 2J8FA 3MP4A 5AYXA 4R3UA 5CGQA 1R3RA 4QISA 1TMQA 1AMKA 3TR2A 1QOPA 4LU0A 3H70A 2OZ3A 4GOAA 2V30A 2X1IA 4HPGA 3RIKA 3W7KA 1K9TA 1GYNA 1AJ2A 3PFRA 3LOTA 1JXKA 3ZVIA 1FWHC 3WNPA 5HANA 4OBTA 3CQJA 3VCRA 1PHQA 1GVIA 1R0MA 3DFHA 1MDRA 4CN4A 3WBYA 3EYPA 2BHYA 1CGUA 4J4KA 3H2AA 3IJ6A 5DELA 4AZGA 1EQPA 1F3TA 1O5KA 3W7EA 2Y0FA 5DMMA 3WNKA 3KW3A 4JQ1A 3V5FA 3CHEA 2CLLA 2INEA 3AOFA 4KEMA 4GUFA 2HPIA 3MUY1 3VDBA 3UZXA 2FKPA 5JIPA 1UC4A 1CPUA 5CCZA 2ZUVA 3I6EA 2CCRA 3S1XA 1F6YA 1WA3A 1NU5A 1ZTVA 3QGVA 4NAFB 2F7FA 2FTYA 4Q4QA 2F6UA 5CAHA 4AWEA 3CL6A 1GJPA 1SO3A 4NAFA 3WUFA 3N2XA 1GGOA 1P6WA 3LZ3A 5AHMA 6XIAA 4NUWA 3LN3A 1LL4A 3CHVA 1NF7A 4DNHA 4LYPA 4QNWA 1TV4A 2ZCGA 1J10A 1KM0A 3CASA 3N3TA 2GJNA 3DFNA 2W62A 4YL2A 1V3MA 4NXKA 3W76A 3WUBA 1QI0A 3NQ2A 4MDPA 3C2EA 3EDFA 5C7HA 2VOMA 5CC5A 4O8RA 5EFDA 1BYCA 2Y7GA 3WF0A 1ONEA 3AFBA 1VYRA 3NL5A 1TPH1 1O66A 3CUHA 1RCXB 3G1RA 5FF0A 1IEIA 2XU2A 3AAMA 1NFPA 3SCSA 3NGFA 1R7OA 4L1WA 3WG6A 3W7HA 3JS3A 1PB0A 4M3PA 1W1PA 5DMLA 1XWYA 3KOYA 3XISA 4H19A 4LV4A 4REQB 3ATYA 4OWGA 2G3JA 3GYEA 1W1ZA 4Q4SA 1EUAA 1Q6DA 4GMEA 2NSOA 2ZX8A 1ZFJA 5I3IA 4LBRA 5LZLA 3F2BA 3BZJA 3VDGA 4WK9A 2H90A 1ZL1A 4PMVA 2H3BA 3I7RA 3ITGA 2GVGA 3BQ6A 4GQBA 4OOUA 1VBUA 2Y6ZA 3CJPA 1H62A 1DIDA 2GJPA 3ATZA 2CLMA 4S3FA 2Z1SA 3GTXA 4AIBA 2PFHA 1JDFA 2JKPA 4M19A 3SBFA 1MXDA 2VFGA 1X1NA 2XPKA 1PX8A 1GZ1A 4Y9OA 3ABQA 1W1YA 1K02A 2YOCA 3P93A 2ZC1A 2ZA2A 1HKVA 2BASA 3V1HA 4PGLA 4OE7A 2CHRA 4JL1A 4DM2A 1A5AA 3WLSA 1W56A 1NDZA 3V0TA 1R46A 3UA3A 4O4VA 1HNYA 5I3KA 3GUGA 2R91A 1GWJA 3O63A 1J4EA 3MC5A 1YYAA 4HYVA 3LHUA 2DU2A 2FH6A 2Y85A 2I17A 3TJ4A 3B0PA 1Q85A 1F76A 3PG9A 4JIRA 4YMZA 3VE7A 3WLNA 3V1PA 4C6PA 3B0VC 3O0FA 3CWNA 3LXAA 2V9DA 3QYSA 4LYQA 4QJ4B 5I3GA 3SI9A 3FA3A 1R7AA 4WJ8A 1ECEA 5IOBA 2VX7A 2G4FA 1HP4A 3IRDA 1KB3A 3DG3A 4Z0SA 5F4XA 4EOUA 5LGZA 5A8OA 4DUVA 2J25A 1VAHA 4UBPC 5GNXA 1KLZA 1VKFA 2JKAA 1VEOA 5E9AA 3VIJA 1BVZA 2DSWA 3T78A 3HU7A 3M44A 4GJ1A 1PSCA 2G3NA 1OGGA 1K8ZA 1VJZA 3MPGA 2JIWA 4WIWA 3W1TA 2J6VA 2PS2A 4QGCA 4LH8A 5CC3A 5EBUA 3VX1A 2R1PA 2W3ZA 4LS1A 5I6SA 3L0GA 4IP4A 4IIHA 2WHJA 4N02A 1O60A 1SVDA 3HV9A 4AAJA 4DN1A 3HG3A 5FF4A 3TC6A 4WDXA 3T7VA 4AUBA 4HSNA 3GU1A 2PLJA 5G1YA 4GIEA 1Q4WA 3WFLA 2Y89A 5FJRA 4U31A 2D1ZA 1JPMA 1FY6A 3URNA 4QDPA 1FOBA 1KKOA 2ISVA 4G1KA 7XIMA 2Q02A 3LI1A 4PB4A 4DY1A 4RPPA 3W26A 3PZIA 3EDKA 3U2ZA 3UNTA 3QFEA 1ZGDA 2WPGA 3BOXA 4EX4A 1BYBA 2VC7A 3T55A 4Y9MA 5CG0A 2ZXBA 3GG1A 2G4JA 3GZ3A 4URIA 3QJAA 1M7XA 3GW0A 2HV5A 1H7XA 4B4FA 1IEXA 5C5YA 3KCLA 2PCQA 4KWVA 3KP1A 3VTRA 3T0CA 3L4WA 3WLIA 2FJKA 4CNPA 1H0IA 3KOXA 1OF8A 5I77A 1UWRA 1XF0A 3E02A 2RHGA 1CGWA 7PTDA 3V3WA 4K7YA 3TXVA 3CMFA 2PPGA 3GDMA 2HVOA 5CZKA 1FBAA 4WUIA 1TTJA 3ZJ8A 1MEWA 3KBSA 4TV6A 5E5CA 1V3LA 2XIBA 1PL9A 3UR8A 3S5NA 4B2DA 4O53A 3UD6A 3DHDA 2YXXA 4XG1A 1IR1A 1KBKA 3KS5A 3TQPA 5GNYA 2XN0A 3C6CA 5K2ZA 4AISA 3BAXA 2Y62A 4K39A 1SYTA 5FCZA 4AD3A 3KP0A 2DQWA 2V5JA 3MP3A 2QF7A 4PMZA 3K4AA 5HMSA 1HKJA 4Q33A 3NCOA 4EAMA 3PSWA 1TR9A 5J8LA 1ZZMA 2XVPA 1SFTA 4IX2A 5LNUA 3FCPA 4AEEA 5MF5A 1XYMA 4HCLA 1F07A 4ZE4A 4L65A 4NZ4A 1AFSA 1TJRA 4R9OA 3V35A 3DFQA 2PD9A 1E73M 4CQBA 4QXIA 4ROPA 1J0IA 1O5QA 5AFDA 1XUUA 1FDJA 4NJIA 4C6MA 3PF3A 1C93A 3G1DA 3MANA 2ASHA 3AS3A 3N2TA 4LXFA 3P62A 2VZOA 4O1AA 3W1NA 2WZHA 3EA1A 2IUZA 4PULA 1ZCOA 3T81A 1KQYA 5LA0A 1V4YA 3LGDA 1HL8A 5I3JA 3RLGA 1H7RA 2Z28A 3GU2A 1UASA 9CGTA 4LGXA 1BVNP 2PC8A 3C2YA 2PDIA 4JYDA 4GNVA 1SJBA 4YTTA 6CGTA 2ZADA 3UJFA 4KEVA 2AL2B 1UWIA 4JX5A 3ZLGA 5IFTA 4GY1A 5BXPA 2AL2A 2NV9A 1GYMA 1AQMA 3QTGA 4WR3A 2CWXA 3GG7A 4BZYA 2GWNA 4F0RA 3VNLA 2PP3A 4M0XA 5AY7A 3IUDA 1JCJA 5G2WA 3JZUA 3OLIA 1ZALA 2QV5A 4L9ZA 1UOKA 3PTQA 2HBVA 3P7YA 1ONWA 2D69A 2QEZA 3QTPA 3VKKA 1TIWA 3MUIA 1A0DA 4JFWA 4PODA 3P61A 3VNZA 2DSVA 3UJ2A 2OQLA 4NKCA 5DCBA 1EJUC 2FVKA 2BX7A 1XLIA 3VDAA 1QUMA 1U1JA 1IGWA 4LVFA 4DBUA 2O0TA 2NQ5A 4GISA 3S5YA 4FXRA 1SZRA 2WNNA 4JTLA 2RDUA 2QCMA 1ODZA 1DJIA 3NPXA 3VKAA 2D2OA 4FK9A 4NSBA 4JTJA 3T0AA 4CNOA 1HQTA 2PRMA 1R8LA 1SSDA 4U2ZA 1W5MA 4RNJA 1CLVA 1M68A 4Q4OA 1EJVC 1TUXA 2C3ZA 5DLCA 4Q4MA 3SCPA 3I4EA 4IP5A 1DKWA 3UP8A 4YHGA 2WHLA 3HGRA 4F48A 3C4UA 2X1UA 4J5NA 3ANYA 3BWWA 2BDQA 3GDKA 3CQ0A 3ABOA 4LC8A 4L1GA 2E6DA 4YPJA 2CETA 4P7OA 1LG1A 4WKHA 3ZLFA 4R88A 2C14A 4P61A 4FB7A 1U30A 3PVFA 2GVLA 5A8QA 1QT1A 4K8GA 3OLDA 1V3KA 3WK2A 4AB4A 2HISA 4G7FA 3LSCA 4IXXA 2QCCA 1ISWA 3T2PA 4H4IA 4PBGA 3VC5A 4IZGA 4RV3A 3VO0A 3WF4A 5LNVA 4IHCA 5AOUA 4PRRA 1E0VA 4JTQA 3OVQA 1RVKA 1QNVA 3F4CA 2QAPA 4GINA 1LORA 1EPXA 2YDAA 3IAQA 2DZVA 4J27A 1NFGA 4JN7A 2R82A 5FF2A 4LEQA 3UG5A 2BXYA 4H00A 3OVRA 4PTVA 4YIWA 2YCLB 2W92A 3MHUA 5CPSA 5D05A 3N2CA 4DWSB 2I5QA 1QRQA 1NM9A 3T0TA 7CGTA 4DWSA 1ADOA 3NEVA 3EWUA 4QG8A 3IGHX 3M7SA 4A8IA 3LERA 2GDUA 3HQNA 3VIPA 3RGTA 5A6JA 1WDPA 1TMHA 3ARXA 2RJGA 3ZJ6A 2VX4A 4Y6GA 2IQ0A 1CWYA 3DN5A 3KZPA 1H5VA 4IWWA 2CLEA 1CW2A 2HSAA 1D7KA 3VNKA 4FNRA 4L6DA 4MNJA 3M6YA 3W22A 2E9BA 1P0KA 3MS8A 4ADUA 4Z2HA 4BEQA 4XAZA 1V79A 3LSBA 1G4PA 4KCTA 3NOEA 4MPQA 1A3HA 1AK5A 5CBBA 1W32A 4H9TA 1E9ZB 4HMCA 4Q8WA 1LOQA 5AB3A 4UFLA 5DCEA 3WEZA 3R2GA 2YYTA 3L4VA 2VFEA 5HQEA 1ALDA 1PHWA 2Y61A 4MVAA 4DX3A 1DQXA 1BHGA 2PDBA 3BDKA 1SZEA 2ZBTA 1IWAA 2ZZ3A 1VGAA 3GVQA 2BZNA 3PWGA 1YBQB 3A21A 2V5KA 1KR0A 3WQWA 1J93A 4GX9A 1KRAC 1YBQA 4AWTA 2QUMA 1RJQA 1H7WA 4PEEA 5F4SA 9XIMA 3AMLA 4GVHA 4P8UA 4AVOA 1JR1A 1ZP3A 4GXWA 1NSJA 4UUIA 2OTDA 4IIBA 1D9EA 1K9FA 4IPIA 4WZHA 4O1EA 3WMSA 4WGHA 3SSJA 2VGIA 1UP3A 2YFOA 5HPOA 1VBHA 3GH5A 2OXNA 4C7GA 4CCEA 4B91A 4LAKA 1RK6A 4O13A 1G4SA 4WXYA 3SUSA 3RM4A 4Z1DA 4HN4A 2NX9A 3GY1A 3TQVA 3GYCA 2Y70A 1MVYA 3A3XA 5DXXA 1QHOA 3NUKA 2DSZA 1VBGA 4FMVA 1Y8BA 3GTIA 1B3YA 3ARZA 4GY7A 3DOPA 2WC3A 2VDIA 4DNMA 1TKKA 1DYSA 4J7RA 5A69A 1JZ5A 1JJKA 1MUWA 2W66A 1MZHA 4PMUA 5C55A 3L4XA 4DBWA 5JQ9A 2GUUA 2XN2A 2VGBA 3R8HA 3I3BA 2EPMX 4M7TA 2UY3A 1OFEA 3KUMA 3UESA 1FA2A 2NQJA 1MI3A 5H1WA 4GNJA 1EGMA 1JCLA 1E1FA 2OEMA 2HE5A 4KW2A 1F2JA 1LLOA 2QPXA 3T9PA 5C6MA 4XZMX 1PYMA 2O56A 5E1QA 1YTKA 2ACRA 5HDRA 4A3RA 4QBXA 3TIMA 3UZWA 2WBGA 5BZAA 4DUXA 5AVHA 1YW1A 1JI2A 2RDXA 5GJMA 4MGGA 3RRXA 1W9XA 4UFMA 2VM8A 2E8ZA 1TR1A 1J9YA 1WPCA 4EPKA 1GVFA 1A0EA 1WCGA 2OWCA 3RX4A 4LVAA 3V16A 1U5VA 1GKPA 1QOQA 2XIIA 3FW6A 3IAPA 5XIMA 1X7IA 1XC4A 3G3DA 4PE8A 2EO7A 5D4YA 2HRWA 2XM2A 5A6LA 3BL3A 1OEPA 1NWSA 2EPKX 3PTDA 5GVJA 4X3ZA 1BGAA 1LCOA 4H9VA 1EP2A 2G5WA 2ZRZA 4NP7A 1GW1A 3S83A 3LB0A 2GSEA 1FWAC 4AD5A 2FPVA 3T05A 2OODA 1U5HA 4EK7A 2YX0A 2J66A 3RX2A 1FX6A 2VNCA 2PDWA 1W9PA 2E09A 4LFYA 3VFCA 4KCVA 4OJYA 4EWJA 4QAWA 5HMDA 3NA8A 3AZRA 2ADAA 2GGIA 4GQ0A 1I1XA 4MLJA 3W7MA 1NWTA 2X05A 1VFHA 4JTIA 4I9MA 4MNKA 1LG2A 2GWGA 3SGGA 3L9CA 5LHEA 2FDSA 3U7VA 1E6RA 1L8NA 3H2NA 2YL5A 2VR2A 4Q4RA 3CTLA 1VRXA 1JYVA 2EAWA 1VH7A 2QDDA 3O6AA 3LHZA 4AIUA 4DIAA 3T2QA 3QKZA 4GYKA 3LPOA 3VOIA 4PZVA 3SN0A 9XIAA 2CBJA 4WCJA 3OP2A 1ESWA 1OG6A 4QEEA 5KZDA 5K9CA 3CYJA 4AEOA 3WSUA 1PWMA 1NDVA 3GK0A 3LCGA 4AW7A 1JDDA 2A0NA 3TSDA 1EC7A 2ZTJA 1V6UA 1OX4B 3MI3A 1JDEA 3IV8A 4GD0A 1XBXA 4DQWA 1OX4A 1WB0A 3QY8A 2V5CA 4TUFA 4MG4A 1XIDA 4PCNA 5LXEA 3BLDA 4F9DA 3QW3A 3CAVA 2WM1A 3BK0A 3AISA 4E8CA 2A1YA 4E2DA 4X22A 1UR0A 4IT1A 1T7LA 4GJJA 4LBSA 3PUDA 1LF1A 4XTIA 1IXNA 5D2XA 1YE4A 1BAGA 5I3HA 4O52A 3RITA 4IMAA 1YDYA 3VC6A 2NQLA 4F8XA 4C6EA 5JU6A 2E1WA 5RUBA 5A6BD 4Z0JA 3BC9A 2IQDA 1HKKA 3NL6A 2WCSA 1O4UA 3EWWA 1EHAA 3KOWA 1PYFA 2V6AA 3AO0A 3NOYA 3S1VA 2OX1A 2EKCA 3EKZA 5BOFA 4Q7IA 4PBEA 2HEJA 5DRIA 2GVJA 1P0DA 3ZQ9A 2BSLA 5T8GA 5F2IA 2ZUWA 1GQNA 4AXNA 2H8ZA 1AJ0A 3W7QA 4GIRA 3WY1A 5B80A 1EZWA 4RK8A 3TCEA 2V2HA 3NDOA 2VP8A 4DXVA 5FOOA 1UR3M 3PPGA 2PODA 2C79A 5G5IA 4PCPA 4LPCA 2CZDA 4KMQA 1RALA 3FN9A 3TKFA 4L6HA 2WHMA 3NEHA 4QS6A 1VFFA 4AEFA 3URQA 1OZMA 3KXQA 1HO1A 4WLCA 4HU0A 3TN6A 1TPFA 2VWSA 3LUTA 2XVNA 2PDPA 2QUVA 2DJLA 3P5YA 3LX9A 1NF0A 3TAKA 3KCJA 3EZ4A 1ICSA 2H6RA 5D9MA 3R8GA 4F0LA 4HSHA 4MY9A 3WJSA 1KWKA 1RQBA 1FWIC 4IIFA 5K9DA 2A79A 3MO4A 3QV8A 2Y8KA 3E9AA 5EKYA 2X7WA 2V3EA 4DWSC 4TO8A 4D6FA 3VKCA 1B2YA 3AIUA 4RE4A 2QKFA 1HL9A 4K38A 2ZDSA 4X63A 4WDTA 3NPWA 2L5HA 4GACA 4RE0A 3APYA 1W1B1 3N9SA 2WOQA 3W7GA 3N12A 2AMXA 1OK6A 1OJXA 3ME3A 3LS9A 2NXIA 2VZUA 3BJFA 1BGGA 1GONA 5AYIA 4IGHA 2WAGA 4IPNB 3W2KA 2NUYA 2E1DA 3P2VA 3L0NA 3TA9A 3MCMA 4OZOA 1B30A 3UW6A 1SFSA 2V8ZA 3FXYA 4D1JA 1XIIA 1RR2A 3B04A 5EMJA 2ATMA 3BMWA 4ADSA 2J88A 1JL8A 2OG9A 3W25A 4GVGA 1YADA 1X97A 4TXEA 3WH6A 5IFPA 1VFTA 3WELA 4LUSB 4MJ4A 4LUSA 3L5MA 1RD5A 4UNIA 1WXYA 3PAJA 3OOQA 5CPTA 3QC0A 1ZBWA 3ITLA 3F4WA 4YCOA 1HF6A 3CAWA 3LMYA 1KTCA 4FNUA 2E4TA 1Q6CA 5KZEA 4JTRA 4ZXOA 3WQ6A 4Y8FA 2Z0IA 1SO5A 2NSXA 6TAAA 1WXZA 3E5PA 4V1XA 1DWJM 1CB2A 1A0CA 3TYBA 5D2WA 4NILA 1XD0A 4J40A 3N2OA 4XIAA 5D9PA 1SJAA 3PS7A 4Y96A 1W1IE 1UW9A 5M5DA 4G7EB 2TODA 1EYWA 4PMDA 5G4WA 1AW1A 1UUQA 2ODOA 4G7EA 4UB9A 5A8GA 1RD6A 2OZ8A 4DM1A 4JPGA 1NOFA 5BXTA 3AUJA 2PD5A 1F6PA 1XX1A 4MF4A 1Z7AA 3SSZA 3UXAA 1Q6QA 3R11A 3S5SA 3OJGA 1XFCA 2A3AA 1S5WA 3OBAA 4C6OA 3B0UX 3IIOA 3OG2A 3NR0A 3T07A 3CQIA 3MY9A 4ZZ9A 4Q3MA 3RO6A 1C7SA 2V5BA 3MUCA 3STCA 1QPNA 2KAUC 4M6PA 1FRBA 3TX9A 1XD1A 2VQTA 2FVMA 1JPHA 4EKJA 4Y7EA 2AQWA 1ZAIA 3VFLA 1KCXA 4FI4A 2VGFA 2GOKA 1TWSA 4GA8A 2VVSA 4ZO9A 4AZHA 3CXOA 5CG7A 5LIWX 1GG1A 1PS9A 4OTKA 4PSPA 1NAL1 1Z3NA 3WBXA 5KMYA 3MMTA 4FXFA 4P5UA 3WK0A 4PA8A 1PAMA 3U7BA 1LT7A 5E9XA 3E2VA 1Z8AA 2GJXB 4Q7BA 3WLTA 3W7NA 2GJXA 5KSWA 2PBOA 2D0GA 2OSYA 3QW4B 1BSIA 5JUVA 3ZS4A 3EBVA 4NI3A 2C91A 1UQZA 3H2FA 4A3YA 3PFMA 4GUHA 3QLDA 1PCWA 1K8YA 1YTDA 5D8ZA 3KRUA 4UOZA 1VJIA 1E15A 1E6NA 1CGXA 3NDZA 4FIQA 1GQKA 3M5VA 1J96A 1TREA 3W75A 4ZOBA 1XRFA 1X6LA 4DBDA 2QT3A 5KINA 3VKJA 3UJRA 4G56A 3WUEA 1E55A 3Q65A 4H3DA 2BXZA 1SW7A 2E25A 4LSBA 1A3XA 1RZMA 1ITQA 1OYCA 2A21A 2DDXA 1S3TC 5GJNA 5DANA 3MMDA 4ATWA 2J7CA 2C1HA 4XUGA 3KLKA 2QJGA 4AHOA 5H8UA 2CLIA 1CB7B 4I9AA 3VCNA 1XLEA 3MBDA 4V15A 1JD7A 1Z9AA 5FI8A 1WAWA 4YVPA 3T0DA 2WJZA 4JGDA 1EZ2A 3WDIA 3N6HA 3NQ7A 3V5CA 1XW8A 4KS0A 1O5XA 3TXZA 3UXDA 3CIWA 3GIQA 4C5ZA 1US2A 1W3NA 4C1KA 3HG5A 3SUTA 5I0DA 1HT6A 2XH2A 5DT5A 4FF5A 1W3JA 4ZQRA 4U10A 2B81A 1M04A 4FX6M 1EFZA 4AD4A 4JEQA 3UU0A 5C7VA 2TAAA 2UBPC 4MZ8A 2GGEA 4WSHA 3HJZA 5CPLA 1RCOB 4LF2A 2RJHA 1G5AA 3GDLA 3COTA 3L5AA 1CTNA 4J3ZA 1V6XA 4AZIA 1AQHA 1E1EA 4TX6A 2WQPA 3H4WA 2AKMA 3CLWA 5LIKX 3ZJ7A 2P88A 1RBOB 2BVTA 4WEVX 2XFYA 4ZQCA 1QATA 1XLFA 2J75A 3H21A 2CW6A 3UPBA 3B3DA 2XUCA 5JBFA 2PAJA 2QMKA 1UZ1A 3OHIA 1WX0A 4NNCA 1KFEA 4DZAA 2OJPA 2HBXA 5A1AA 3P8IA 4KIRA 1Y7VA 2HK1A 3OVGA 4OUIA 3VIIA 2CZEA 2Q8LA 2Z4GA 1XI3A 3GVWA 3V0SA 4L56A 4LYKA 3OA3A 3SQSA 4M7SA 3GKFA 5TF0A 3MTWA 3RLUA 3NPVA 4ZCWA 2VD9A 4IPJA 1KGWA 6A3HA 2BVDA 4UTJA 2V38A 4FXJA 1MNZA 4OBRA 2IKIA 1Q5MA 1K70A 3H4GA 1AW5A 3O7UA 3DC8A 3HBLA 4B15A 4N42A 1YLVA 5HATA 5HMFA 1M7OA 3S5ZA 3ITOA 3ZO9A 4NL1A 3EKLA 4J1OA 2YYUA 3FDKA 3MB9A 4P8WA 3SY1A 1QFEA 4AU0A 1ZB5A 4AWUA 4GXPA 1V5XA 2ALDA 4RDYA 1H1ZA 5GQBA 1P0BA 3LLFA 1L6WA 4UQAA 1GTEA 1UKOA 1KCKA 3TYDA 3AXIA 3PY2A 3G24A 3C3UA 2DT3A 4LT9A 3RYSA 2IXVA 2OYMA 3K4DA 5EY5A 1SQ7A 1H3GA 3TYCA 5J04A 1V6TA 3EOOA 1MW0A 5I23A 1W1TA 3CT7A 1TX2A 4F40A 3A9IA 1B54A 1TA3B 1OX6A 2WWDA 4FPSA 4LB3A 3APGA 2O9TA 4ECLA 3MUZ1 5FL0A 1TA3A 4WGXA 3ISIX 2B7QA 3KBWA 4UZUA 1GOXA 4O10A 1GJUA 3EPMA 4HU3A 1VLIA 4X0VA 1PKYA 2WSKA 2BHUA 2ZUNA 2ZE3A 3LZ5A 5F2LA 6TIMA 4LUIA 2TSYA 3RX3A 1UJPA 3MMUA 1TVLA 2O7QA 4KH2A 1UOZA 4XAFA 3R5EA 3G3MA 1Q6GA 3OZOA 3A3HA 4DJEA 1CGVA 3G1VA 4ZB5A 2TMDA 3GC4A 3LXCA 3VNYA 5LKYA 1AD1A 4YVVA 1J12A 4GNKB 4HGXA 1QWKA 3A3WA 2AAMA 1XYCA 2DT1A 3ITYA 1TV5A 4LAUA 3NO3A 4A8RA 1VENA 3STPA 2ZX9A 3KL0A 1SZNA 1S2CA 2F6XA 4RKAA 2Q8XA 1JZ4A 1OD8A 3N2BA 3H12A 3PB0A 3GS6A 1W37A 5DF0A 2FHCA 4N9DA 2BB0A 1BTMA 3CAKA 3G1SA 3W1MA 2GGGA 3K46A 5CSRA 1GVRA 4DZIA 3G1XA 3FVMA 1KTBA 3M0VA 2UWFA 5KTLA 1K77A 1V7AA 3UG4A 1ME9A 3OODA 1SGJA 3L4YA 3HGOA 5T26A 3N9KA 4V2XA 3TA6A 3MUAA 4MJMA 5BRPA 4NZ3A 4GVIA 2HTMA 1XBZA 3B03A 4UFKA 5BU9A 3ALFA 2GYIA 2POZA 2PDUA 2HZGA 3A64A 2OQHA 1YPFA 2QIWA 5DQPA 1S5NA 2NUWA 3UNDA 2NXGA 4B5NA 4GO8A 4BI7A 3AHXA 1O1ZA 3EAUA 1V3HA 4QE4A 3BAJA 3CH9A 4ML9A 3UY7A 3U3HA 1AZ2A 2HROA 3CZLA 1V3JA 4FR1A 2O4MA 1XXXA 3TVAA 1WE5A 2RKXA 1VPXA 4W5UA 4AY7A 2EJAA 5HAOA 3VOHA 3OLEA 3PZUA 4JIIX 2NXHA 4UMCA 1UD5A 4D6EA 4Z08A 2HVNA 1W91A 4E4UA 1GQLA 2AQOA 4FAMA 3PUOA 4UC5A 3GWQA 4H01A 2BTMA 1EX5A 4HNUA 3TROA 3HN3A 4J3VA 1UWQA 3GHUA 1NEYA 4NXSA 3WD3A 3VMOA 4S23A 3TJLA 5D2TA 3B40A 1S1RA 2AKZA 5CZSA 5LIXX 4CD6A 2OWWA 3VIFA 3FK4A 1VIWA 2YDRA 3AXHA 4MAZA 5U7SA 1H60A 2B31A 1BQCA 3NG3A 4H83A 2X16A 3RU6A 3G6MA 3USZA 1H50A 3LTYA 3QGAC 3NO1A 5A95A 2W91A 2BOEX 1TMLA 2OMAA 3LQLA 4HHPA 4LW7A 2YBTA 2ZOXA 3BG5A 3SECA 3UR7A 2WANA 4AZ6A 4A35A 1H0GA 1EQCA 3GVGA 1XLBA 2PDQA 1A5KC 4IF2A 1PBGA 1GKQA 5D04C 2V3GA 4GYFA 3V7PA 5TIMA 1QPRA 4G5DA 1PIFA 5LIYX 1CXIA 3POHA 4F2UA 5T9CE 2CLPA 5BOOA 5I24A 1H4PA 3VNIA 3P81A 3NM1A 2PWHA 1FQ0A 5CZJA 2C1IA 1F74A 5HJYA 2C8NA 1I0BA 1KXVA 1D3HA 2I57A 1TTQA 3U2EA 3DKLA 3FDGA 3CWHA 1T5AA 2VURA 3MYPA 1JPDX 3LPPA 3K2GA 2V82A 4IISA 4WOQA 2WB5A 3R8RA 2XIMA 1GVYA 3M0JA 1ML1A 3LDVA 4PMRA 4OVXA 4UTLA 1CXEA 2WQDA 4QFUA 1DJZA 2ACSA 1J0HA 1TX0A 3P8JA 4JIEA 1EC8A 3D3AA 1F6KA 1UKSA 2ZRYA 5BCAA 5G1TA 3LHVA 1Q66A 3AROA 1T96A 1EX1A 1A5OC 2ZWYA 2F2HA 4B4HA 1LWJA 1SO4A 2GLKA 3GXFA 4GFSA 2IMRA 2I16A 1HGWA 2OO6A 3V75A 3TLQA 3N29A 5L9FA 3BPWA 4PB3A 4H7CA 1V7YA 4TVDA 1GZJA 3W7CA 4BQ3A 3GBEA 1JUKA 4O16A 3W02A 5LGXA 2J7GA 4DUWA 1DORA 5DT7A 1EOMA 1JPKA 3ANVA 1ZJAA 4H8NA 1GW9A 3A4WA 4W5ZA 2WSYA 3OGVA 4LVDA 5HXMA 5HK4A 1X1ZA 4KFNA 4PUDA 4MY1A 2DUAA 1LUCB 1AW2A 1JVNA 4Q8NA 4EXQA 2FZMA 4JTFA 4QLJA 3GDRA 1LUCA 2X42A 1P7TB 2XDFA 1JYNA 2BS9A 1R3QA 1GJWA 4JFVA 1P7TA 4MKVA 3H2OA 1R9XA 3USBA 1Q6FA 4QSHA 4AMAA 1OZQA 1GYLA 3ANUA 4B5WA 1VHCA 1US0A 3GAYA 5HR6A 3ZT6A 3KBVA 1V3IA 4BQ5A 3O8AA 2XYLA 5DFAA 2WMIA 1TYGA 2A7PA 3UG3A 4MNLA 1GVEA 2YA0A 1GOOA 3P60A 5BRBA 4S3KA 3IVUA 2D2HA 4HTBA 3C2RA 5HMEA 3HMJG 2ZIDA 1EEXA 3AIBA 3N73A 3U5UA 4XSMA 3C61A 5EGRA 2GQ3A 3G1YA 3PBYA 4LTSA 3H22A 4F0KA 4MB5A 4W7UA 3S1GA 3QZEA 4CD8A 1DE6A 1K9DA 3EMQA 1VFMA 1AZ1A 4M24A 2XN1A 3F7JA 3R43A 4GZJA 2HS8A 4BWLA 1Z89A 4J3WA 1X96A 4KEZA 2DZSA 2OQYA 4KWUA 2ZZ4A 4LY4A 4XAPA 9RUBA 3TUUA 3B8UA 3O16A 1ZU8A 2VX6A 5E6ZA 3OQEA 4GC3A 3MDWA 2WZIA 5FF3A 3L12A 3AWNA 3N3MA 5G4HC 2J6XA 3SN4A 3WNNA 1VCFA 4C6KA 4FALA 2HQAA 1G4EA 3TEVA 1E70M 3CAQA 4GFIA 4B90A 1GORA 3W87A 3LYEA 2EBNA 4XVEA 5BRQA 1Q13A 3EA2A 2BY3A 4I8YA 4N6EA 3NIYA 1C9DA 2E5CA 3GAKA 4K2SA 5D02A 1UPPA 3S0CA 5AC4A 4JFUA 5K4ZA 4H2HA 2J79A 4DXKA 1LBLA 2DPEA 3OB8A 4HIBA 1DJGA 1XIMA 1MNSA 3DGRA 1Z6KA 1EPVA 4QROA 1KC7A 1RQEA 1NOUA 1TV8A 3ZM8A 2E67A 3O06A 3I6TA 2Z26A 1O68A 1TELA 1QU4A 2X30A 4UMAA 1A5CA 5FEZA 4E8GA 3STGA 1IXPA 3TW9A 1Z69A 4DJEC 4GZEA 4IQDA 3C8NA 2OVLA 4MDOA 1KM1A 1DBTA 1PDZA 3BW4A 1AMYA 2FPTA 2GVYA 4JTCA 1Y65A 3F03K 1DWIM 8CGTA 3W7JA 3GXMA 5A8NA 2VRJA 4PTNA 3D3FA 2OCZA 3BLPX 2CNCA 3G0SA 4UFIA 2W63A 4AC7C 1R38A 4JHOA 1MW2A 2E0PA 4Z2JA 3HB9A 1MDLA 3P0WA 4B5XA 1XRSA 3P74A 3U8GA