4E38A

Crystal structure of probable keto-hydroxyglutarate-aldolase from vibrionales bacterium swat-3 (target efi-502156)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
b'FQSMMSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSDAAVEAIRLLRQAQPEMLIGAGTILNGEQALAAKEAGATFVVSPGFNPNTVRACQEIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLVTNGEWDEIARLTREIVEQVNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate a
molecule tags Lyase
source organism Vibrionales bacterium swat-3
publication title Crystal structure of probable keto-hydroxyglutarate-aldolase from Vibrionales bacterium SWAT-3 (Target EFI-502156)
rcsb
total genus 78
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature ec 4.1.3.16: 4-hydroxy-2-oxoglutarate aldolase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4e38A00
3EWXA 1YXDA 5BRBA 1TRDA 5DLCA 4UTJA 4WJEA 1KM2A 3NQ7A 5LHEA 2YW3A 2C3ZA 2DZTA 4CNPA 1JUBA 4NXSA 3T40A 3EXRA 3MI3A 5KITA 2NXHA 4O1CA 1TIMA 2NUWA 2NX9A 1TB3A 3L0NA 4NUWA 5D32A 5D38A 1JVNA 3R12A 1KM3A 3USBA 4Y6GA 3HMJG 4A21A 5J5RA 4BWLC 1H7PA 2JGQA 2W6RA 4YCOA 3HOJA 2X1RA 1RD5A 3L5MA 1GEQA 1GVFA 3OG3A 4O11A 2J27A 4N4PA 3KFTA 3LCIA 4JTTA 1XCFA 2WQPA 4ALDA 2EKCA 2E6DA 3C3NA 1ZY9A 2ZA2A 1PCKA 4H4IA 1K8XA 1KM0A 4PFMA 5HUPA 1LRTA 3EX1A 1XC4A 5FF7A 2ZTKA 4FX7A 2X2GA 5BNKA 3F1QA 4YLWA 5CPOA 1VLIA 4IPJA 1U5JA 1XL9A 3STEA 5C5YA 3LCXA 4QNEA 1Z42A 3LI0A 4WUIA 1K03A 1DQWA 1LLWA 5AHNA 4NJJA 2Y63A 2H6RA 1HO1A 3BPWA 3W1XA 5K2ZA 2E68A 4Z08A 2J6XA 3E9AA 1T96A 3G22A 4O28A 2VKZG 3O8AA 1DHPA 3W7QA 1TPVA 4K7VA 5A8GA 1IGSA 4IWWA 4YMZA 1TPH1 4K38A 3LCWA 1WXJA 3V1PA 5LHFA 4AVFA 3BO9A 1YDNA 3DFPA 3O05A 4M7SA 3QW3A 1SSGA 1SUXA 2QCLA 1EP3A 3P8IA 4HHPA 4ZL1A 1BEUA 2ZZ7A 1K7FA 1WAUA 3G18A 1NF0A 1KTCA 4PODA 5AYZA 5K3VA 4K39A 3ZWSA 3L5LA 3GDKA 3DENA 1OVDA 4ZQNA 2ZZ3A 3AJXA 5C6MA 1T8XA 3HPZA 1Q6OA 3A23A 3EWUA 3H55A 4FIQA 3WK2A 3IV3A 3NA8A 4CNOA 1VCFA 3BGJA 2YX0A 2H90A 5C55A 4JGDA 4JTLA 2ZBTA 1OFBA 3MYOA 1EPXA 3GXPA 3DAQA 3SECA 5CG7A 1MXSA 3W1NA 1FX6A 1DOSA 2B7NA 2WV8A 3TXZA 3KRSA 1SZFA 3M41A 1F5ZA 1C9DA 4GWEA 1OYCA 3DKLA 2YDAA 4JX6A 3U8GA 3PBUA 5CZSA 3GR7A 4HIBA 3RF9A 3S6DA 2X30A 4NZJA 4FEZA 1FWTA 2Y7DA 3HGSA 2ZYFA 2C1HA 5G2WA 5F2MA 5F4XA 2Q3OA 4Y96A 5SWUA 3N9RA 3THQA 1B57A 2DZWA 2EF9A 4N02A 3NPUA 3M9YA 2FPTA 3R2GA 3MP5A 4L4MA 3NQ8A 1WDWA 2YR1A 5FEXA 1RZMA 3SJ3A 2GVJA 4N9CA 3TNOA 3OEXA 3W73A 1Q6QA 5HNRA 2V9DA 1G6CA 1AW5A 1GPWA 1W31A 2V5BA 1XDMA 2C16A 4OHQA 3MUXA 1TPWA 4DELA 3S5ZA 1FDYA 5KTLA 2OX1A 3W23A 1TQJA 4HNVA 4AWSA 1SFJA 1HO4A 3HG2A 3LBCA 3MJYA 1TPFA 1VYPX 3FEMA 3CTLA 2NLIA 4DXVA 3P67A 1OF6A 4M5PA 1JRBA 1H7WA 3TKFA 4R34A 2WSQA 3DI0A 2GQ9A 2QCNA 2NXIA 4WY0A 4UC5A 3O6DA 2J9ZA 3C2RA 1OX4B 1QPQA 2Z6IA 4UMBA 3MHUA 2B7PA 3UWUA 1W0MA 4RR4A 1TTPA 4I7UA 3MMTA 4LVBA 3TAOA 3B0PA 3S1WA 3W2NA 3CHVA 3QMTA 4HPJA 1AMKA 3S42A 3WJSA 5CPNA 5L9FA 1JRCA 2Q3RA 5DXYA 2E5BA 4YL2A 1W8SA 3M7WA 3NR0A 4NVTA 3G1VA 1K7XA 4PC8A 3CQ0A 1GTHA 3W1TA 1ME9A 3HG5A 3FIGA 1Z48A 2NXGA 2VFGA 3INPA 1FCVA 1LLZA 5G4EA 5DCBA 4JNMA 2QCEA 1TPDA 1TPB1 1HFBA 3NQ2A 2OT0A 4G1KA 4UFJA 2PE4A 4JTKA 4UMCA 3DH7A 3EX6A 3GNDA 3TJXA 4ORIA 3QM3A 3W7LA 3RU6A 3T55A 3KVLA 4LVFA 3TSDA 4HNNA 5TBOA 2ZA3A 3G3MA 1FWNA 3DZ1A 1H1YA 5CKSA 2E1DA 1H60A 2ZQ0A 3N19B 5D33A 3S0CA 3GDMA 3W76A 3UWQA 5DELA 5AB3A 3P5YA 3MHGA 4MKNA 4IJBA 4N9BA 1UUMA 5LNVA 1YXYA 1VZWA 1BWLA 1SQ7A 1ZHAA 1OFOA 3KRZA 1C8VA 2QCMA 1AL7A 3GAKA 3TQ0A 1KBIA 3EKLA 3G1HA 2NV2A 1KV8A 3VE7A 4NX0A 1AK5A 5EY5A 2B7QA 2PC4A 3F4NA 1SPQA 2JK2A 3M5XA 1DV7A 3FFSA 2DU2A 3S8HA 4JTEA 4WX2A 4O52A 1XM3A 3ATZA 1EB3A 3PULA 3NQMA 4A22A 1PHQA 1QNVA 2WJZA 4TMBA 1M5WA 2OCZA 1FXPA 3NXFA 1QOPA 3W1QA 2W0UA 3H54A 4DO5A 4Y90A 3E0IA 4AF0B 1P5BA 3NZRA 1KTNA 3MI2A 3DFOA 4QJ1A 4H6KA 3NPXA 4WY0F 3W1LA 1KM4A 3YPIA 1TYGA 2VENA 3W7DA 4AB4A 1D3GA 4E0CA 3JR2A 1ICQA 3PY2A 4IMDA 4RV8A 1ICPA 3EX2A 2QCFA 1FDJA 3LHTA 1YPIA 4QISA 3G1YA 2WPBA 1O95A 3W74A 2PRLA 4QAIA 2Z2UA 4UFKA 3L9CA 2Z0IA 4UXDA 5CPMA 2DJXA 1OFAA 2X1TA 3UWVA 5HJLA 4C1LA 1WV2A 1M7PA 4NU7A 3U2OA 4O54A 3W83A 2HTMA 2F7FA 4S2BA 2QEZA 3M6YA 4HSNA 2I1OA 1KV5A 3TX9A 3WJWA 4IQLA 3VI2A 1JUKA 3TW6A 1LYXA 2I14A 2A6LA 3QZEA 4EIVA 3BW4A 1DL3A 3P80A 4CCEA 5MHBA 1VR6A 4N2YA 1FWRA 2ISSA 2EGZA 1LOSA 1UASA 1ZAIA 1A5SA 4RK8A 4UR8A 2Q8ZA 3IGXA 4ORMA 3W86A 3QYQA 3CB8A 3M1ZA 1VPXA 1A5BA 2CLFA 1M7OA 3KX6A 1TMHA 1OFRA 3FOKA 2XN1A 4FNPA 1Q6RA 2ZRYA 1WOBA 3LHYA 3P61A 1UCWA 4JX5A 3NQEA 5F1UA 2FPVA 5KZDA 3PC0A 3GR8A 4K6AA 1OHLA 3B0VC 1K3UA 4RZ4A 4DF0A 3H53A 1H63A 1N8FA 1JCYA 3GKAA 4AWUA 3LBMA 2V2DA 4AMAA 4A2SA 4PL1A 4JN6A 3L0KA 1LTDA 4O4WA 5CGQA 1LBLA 2G97A 3UWZA 1W5OA 2NZLA 4JTFA 4FB7A 3M16A 4O16A 5I3GA 5LNUA 3O15A 1SZNA 5FI8A 1H50A 2FFCA 4MFDA 2QJHA 4UFLA 4E2DA 3C2EA 4OE7A 4NJIA 3TCEA 2VFHA 4HN4A 3E12A 1G7UA 4N9DA 3VNDA 6ALDA 5KZMA 4JIPA 4LRTA 2A0NA 3W85A 4IX2A 1KFBA 3W2UA 5H91A 3N2XA 1V7YA 4AXKA 1JCMP 4ZZ9A 3BK0A 1WBJA 3QEZA 1I45A 5EPDA 2A2IA 1LOQA 4PCFA 4QM1A 1I2NA 1ZCOA 4OGZA 2VFFA 3FA5A 2ZTJA 4LVGA 2I9EA 3EXTA 4D2JA 1DVJA 3TFCA 2WOQA 5LNRA 4TIMA 5BW6A 3P84A 5F2IA 2YPIA 2CWNA 2QJIA 3W7IA 2Y85A 3GIYA 3TU9A 4K7YA 3L0GA 4JICA 4OWGA 1OK4A 2FIQA 3W7EA 4UFHA 3W72A 4O8RA 1G4EA 2QUVA 2DP3A 4KFNA 1XUUA 1ICSA 1ZNNA 4DPPA 4IMCA 1WX0A 1EIXA 3CC1A 3BG3A 3M5VA 2GVLA 2RDTA 3PG9A 4N9EA 1GVSA 1Z44A 4OQVA 3W1PA 3FYOA 5LGZA 4UTWA 3C2FA 3U6WA 2QAFA 3KHJA 1ZJIA 2Y88A 2ZZ5A 1KLZA 3ANYA 3DBPA 3IIZA 1OYBA 1F76A 3CWNA 1VS1A 1OFPA 3NNTA 3KVMA 4TU1A 4MY9A 5KINA 4ZQMA 1WOAA 1ME8A 1ML1A 3P8JA 3EX4A 4DPQA 2X16A 3MWAA 3IIPA 1H62A 3L67A 4XWUA 4Q33A 5LNSA 1WYIA 2EAWA 3DXIA 3B04A 1GVQA 1WQ5A 3NQCA 4JTIA 1QMLA 1O5KA 1B3OA 1KM6A 5A5WA 1XBXA 2QDHA 3NQFA 5LGXA 1OF8A 2E6YA 4FO4A 5K9DA 4AH7A 1HL2A 4MZ1A 4XTDA 2ISVA 3UY8A 3DKJA 3I65A 3ATYA 4O18A 1AG1O 2ZZ6A 5AHMA 4GXMA 3WJXA 4CCDA 3PBWA 3NO5A 5AC7A 1LORA 1T0OA 3HGOA 4WOZA 2E77A 2BSLA 1IXNA 1XFBA 3B0UX 4GUIA 3ABSA 2PURA 2YXGA 3NOEA 1SSDA 2Y89A 4XQ6A 5G1YA 4BI6A 1O94A 2ZRZA 3PSWA 4XZ9A 1H7OA 2A6NA 2A7PA 1WBHA 5DY2A 1TV8A 1G4TA 1JUEA 4JY9A 1X8FA 1QO5A 3SR7A 4QSHA 3PSVA 3LLDA 3R89A 4UNLA 2BXVA 5CZJA 3B03A 1W5PA 1U83A 3W6YA 4CNNA 2J9XA 3LERA 4LVAA 2TSYA 5HR6A 1MO0A 1I2RA 2Y62A 3OVPA 2CLHA 4LT9A 3VFLA 3P5ZA 3SY5A 2A21A 5IBXA 4O1AA 1H7RA 5D09A 3QMRA 3C2VA 4HSOA 1PL9A 4KWWA 4UTWC 1LROA 1CI1A 5IM51 3LCHA 4OV9A 1DJQA 3GZ3A 2D73A 1R2SA 4ZVJA 1OABA 3PR2A 4W9TA 1ALDA 3TQVA 2A7NA 3F03K 5F2LA 3G0UA 3DFSA 1HTIA 3T78A 2A4AA 3TC6A 2DZPA 1P0NA 5LKYA 3NQAA 2O7QA 3M44A 4HPXA 3TAKA 3I6RA 5AN7A 5D05A 3N34A 4M19A 3LXCA 5D2YA 1S5WA 5E0KA 1VCVA 1MEWA 4UTTA 1LP6A 3M47A 1LBMA 3EWBX 4MZ8A 1EWEA 3WJZA 1UB3A 5AYYA 3FJLA 4JTUA 2FLIA 4MIMA 1VC4A 4ADTA 3LRKA 1P1XA 5IBXC 3TJLA 3N9SA 3GDRA 3W1MA 2GPTA 3IVUA 2WNNA 4XUGA 1RV8A 2A1YA 5I3HA 4JS3A 5LNWA 4MZYA 2YYUA 5I3JA 3NQGA 1KFJA 5J5DA 2XN2A 4GUFA 1TTQA 1K7EA 1LDCA 3M5ZA 4QQ3A 3FKKA 1SO6A 4N6EA 3I7RA 1T99A 4Q4KA 3WFAA 3MBDA 3BARA 2P1FA 3FLUA 3KVKA 1QFEA 4I7WA 3W84A 1XUZA 4LUIA 2P10A 1SO3A 5F1VA 1PVNA 2H3DA 1J2WA 1PCWA 1KA9F 1G4PA 4YCPA 3L66A 4N4QA 2J9YA 4LV9A 4BR1A 4DEFA 4LS1A 1CX9A 3C61A 5DXXA 2WNQA 6TIMA 1ME7A 3CM4A 3MHFA 3KVJA 4QITA 5C2XA 3PG8A 3W3OA 1I2PA 2VFDA 1W3TA 3LCFA 4NX5A 1GQNA 3TIMA 3LHUA 3TW7A 2CW6A 1F73A 4BF9A 3EWWA 3DFTA 3LCGA 3DI1A 4P61A 1L2UA 4N6FA 4LWWA 2A5HA 5HUOA 3PAJA 4R7JA 4GUJA 1K8YA 3LHWA 1TREA 1XKYA 2FB2A 2C18A 2VEPA 1S5VA 1GWJA 3LCLA 1KBJA 3QSTA 4OT7A 4EVZA 1W5QA 3MP3A 2QUTA 1B4KA 1LCOA 3M43A 1I2QA 4DO4A 3A5FA 5CSRA 1H7XA 1FCQA 1LBFA 3NYZA 4NZFA 4UNKA 4GBUA 1IIGA 1W37A 2Y7GA 3BW3A 3W9ZA 5AHLA 3STFA 1TV7A 3G1FA 4PH6A 1RVGA 3P74A 1DBTA 4IPIA 1SW3A 1NFBA 2H3BA 3MI6A 3W7NA 4O4VA 2CZ5A 3C8FA 1WA3A 3IGUA 4NT0A 2B0MA 1A5CA 4S1FA 1DQXA 3HQ1A 4GNJA 1IF2A 1NAL1 2DZSA 5FF3A 2J24A 4IXHA 3P82A 4HNUA 4MFEA 3EEGA 1SFLA 3NM1A 3Q37A 5BMXA 2HSAA 1KLYA 1YXCA 2C6QA 5TIMA 3ZS4A 1ONRA 2QCCA 1SR9A 3VKJA 1TPEA 3NPVA 4HNTA 4C1KA 3NM3A 3OVRA 1GZGA 5AHIA 3L21A 1YTDA 2CZEA 3RK8A 4ZQOA 1QR7A 3R13A 5U7SA 4CQ9A 4XKYB 3C4UA 2QCDA 5DCEA 1FY6A 2FJKA 4R53A 1JCNA 2AAMA 3C52A 4X2RA 2Y61A 1TJRA 3AO0A 3CPRA 5I3KA 5D2VA 1OG0A 4IX0A 1F2JA 3K30A 4IMEA 3MW7A 1NF7A 3BLIA 2VEMA 3GDLA 1A53A 3P7YA 5K7JA 5F4SA 3CIXA 4FX8A 2C15A 4O19A 1E51A 3N2MA 3W7PA 4M6VA 3W7CA 5FF2A 3EWYA 4MUZA 3TXVA 4Z0SA 2ATSA 5DBUA 2HMCA 1F05A 2CFFA 4JTGA 5H2ZA 1UJPA 4IXXA 3CEPA 4Z1CA 4O0ZA 3SW6A 2BX7A 4FNTA 1BKSA 1ZFJA 7TIMA 5G4WA 4FHAA 3QC3A 4O0KA 5EL1A 3LGEA 4LS0A 5F2GA 2B7OA 4AF0A 3T7VA 4UUIA 4ZQCA 3NL6A 1VRDA 4AHPA 4JY8A 1G4SA 3DFQA 2Z6JA 4JR5A 3W88A 2BLEA 3O6YX 4O13A 1L9WA 4JEQA 4UTMA 2GJNA 1UBSA 3S1UA 3QSRA 5HULA 1SZGA 1ZAJA 1EWDA 3UPBA 2VOMA 4LVDA 1MSSA 2ALDA 1IXPA 5G2IA 1GYNA 2OZ0A 1SO5A 4MVAA 2HS6A 1LZOA 4U28A 4NNCA 3QQ0A 3W7GA 1C29A 1KFKA 5FEWA 3LRMA 4K8HA 3W2LA 1SU5A 4BFAA 3QFEA 4M7TA 2RDUA 5L6UA 2YW4A 2ZRVA 2ZDRA 4UCGA 4B5NA 3B4UA 3NL5A 4XKYA 1GVOA 1L6WA 4ZQRA 1P4CA 3G1XA 4IGHA 4EOUA 3O63A 4LU0A 3RMJA 2Y6ZA 1LOLA 3A22A 1RQHA 1FWWA 4IUOA 3B05A 2YGYA 4UTIA 4L4LA 1XXXA 1TV5A 3UZ5A 3OHIA 1GJPA 4LRSA 5G1TA 3BV4A 1XBYA 4WOQA 3TV8A 5U4NA 2E6AA 4WQ6A 5LZLA 4TX9A 1W5NA 4AAJA 2XFWA 4JTHA 1OX6A 5C54A 1JCJA 3IGSA 3NQDA 1NSJA 5EYWA 1JJKA 1GG1A 3FS2A 2R94A 2EPHA 1X6UA 2YSWA 4YWIA 2WSRA 3LHVA 5HQEA 3I7QA 2PRHA 4UTUA 1GTEA 3QMSA 2HS8A 2NWSA 2ZZ4A 2C14A 3L65A 3HB9A 5I3FA 1TRIA 1QAPA 1VLWA 2QCGA 5FESA 2NWRA 3I7SA 1MEHA 4RZ5A 4P2VA 1VCGA 1L6SA 2OT1A 4WXYA 1QPRA 3SGZA 2QCDB 1VH7A 2V2CA 1SO4A 2V81A 4NJKA 4BK9A 2GQAA 1O5XA 2VFEA 3G0SA 1TJPA 3RLVA 3LXBA 1FBAA 4UTHA 2ABAA 4WZHA 1M6JA 3HJZA 4LY8A 1SW0A 3IEBA 3UXAA 1OX5A 4UTTC 3LB0A 2QF7A 3SI9A 5GVJA 4O14A 4E2BA 5KMYA 1Q6LA 1F7BA 4JTSA 1ADOA 2GOUA 4U4MA 4X9SA 1TCDA 4IMFA 3SIZA 3TSBA 4DF1A 1B4EA 1K8ZA 4GFSA 1KM5A 3E96A 3M5YA 3MYPA 1AW1A 4O1BA 3PS7A 3W2JA 1D9EA 1NEYA 4NNAA 3S9YA 2QJGA 3GXTA 3Q58A 3O1NA 4RZ6A 2CLEA 4GUGA 3UD6A 3UPWA 3QH2A 2ISWA 5D02A 4FNQA 4CQ8A 5KSWA 1FCUA 3GB6A 2Q8LA 4DF2A 5DBTA 4MYXA 2R91A 4S2CA 1W5MA 4CCCA 2VEKA 2RFGA 2DZVA 1GT8A 3ELFA 3A21A 3LTSA 2X1SA 3GAYA 5D30A 3S1VA 1W3IA 1FWSA 3PBVA 3HF3A 4GJ1A 3WJYA 1EX5A 5AC8A 4Q32A 5FF0A 3C0JA 5D37A 2ZA1A 5D04C 3I68A 3WK1A 1J5TA 2YCEA 3IIVA 1GG0A 3NQ6A 1EP2A 5BMWA 4R33A 3W7MA 3TUUA 1DKWA 2JBMA 4O1DA 4FXRA 1F6KA 1QOQA 1ZAHA 1S5TA 1VYSX 3R5EA 1VHCA 2QKFA 5D2WA 4AEOA 3WK0A 3KOFA 4MOZA 1IXOA 3UZJA 2JKAA 1G69A 4DBDA 3NGJA 1RQEA 3O06A 4O10A 3MP4A 3NPWA 4ADSA 1PHWA 1TSIA 2JGYA 1AW2A 3BVJA 3LV5A 3QJAA 5LSMA 2CLLA 4GC4A 5DY3A 3OBKA 3PUDA 1H1ZA 2VELA 4M6QA 4A3UA 4MJMA 1XI3A 2RH9A 3JRKA 4K36A 3BGGA 1LRQA 2QCHA 4NJHA 2JKEA 3B8DA 2TRSA 4K37A 1F74A 3VE9A 1RPXA 3TMLA 2GUUA 3CU2A 2E5DA 5KZEA 3EXSA 4O17A 3KAOA 3BG5A 4AHQA 4E38A 2AQWA 1I8JA 2NUYA 2YZRA 5BOOA 1HUVA 1VGAA 2BTMA 3DFNA 1ZENA 2XN0A 5AHEA 2V2HA 2E6FA 3PF3A 4PTNA 2YFOA 4CQAA 4DBEA 1V5XA 3NL2A 4NNBA 2DZXA 4UFMA 4LNYA 2TYSA 3GXNA 3TDFA 4OU1A 3TA6A 3HIJA 2FDSA 4WY0B 3SSJA 1YPFA 3BG9A 1L6YA 5EKYA 3LHZA 4XBKA 3ZR4A 5HR7A 2YYTA 4POCA 2ABBA 1LM1A 3LTYA 4YXGA 2ZFAA 2RHGA 3SZ8A 1TPC1 2CLMA 4ADUA 3W07A 4KFPA 1X1OA 3FJ6A 1EA0A 1PV8A 1R46A 1JQVA 3PUEA 2CU0A 4AWTA 1OFDA 3G1AA 1EUNA 1O60A 4I7VA 1YLVA 3L5AA 3HGJA 3O16A 4RXGA 1OYAA 4K8EA 1A50A 3EKZA 2WKJA 3A24A 1G67A 2V30A 4WD0A 4GUHA 5AOUA 2GQ8A 3W2MA 2ZZ2A 1YADA 3W71A 2QUUA 3W87A 4O12A 4O15A 4QIUA 2QR6A 4FNUA 3IVTA 4XTIA 2UV8G 1K02A 1PE1A 1N7KA 4UMAA 1KM1A 1SZEA 3DU0A 5HWMA 3OA3A 4Z1BA 3GLCA 3G1DA 3NQVA 1BWKA 3HO8A 2C0AA 1B9BA 1TO3A 3E49A 3ABRA 4EF8A 4LV4A 5EBUA 4RX0A 3RFAA 4ZMGA 3N73A 3P62A 3GX9A 3GYEA 4XBSA 1MEIA 1X7FA 3N3MA 2EHHA 4LS2A 4MPQA 1YDOA 4Z1DA 5FEPA 1I2OA 3P81A 2QAPA 5CZTA 1R47A 3G0XA 3LV6A 4HKPA 1S3HA 3LI1A 4LC6A 2X1UA 5AHFA 4FF7A 3C2OA 3S5OA 4O53A 4LTSA 3S5NA 3STCA 1VJIA 4A29A 3PVFA 3CT7A 2H8ZA 3TFXA 3Q2DA 2G95A 4JTJA 4FX6M 4DQWA 2LLEA 2Y70A 5FF4A 1YYAA 1EEPA 1QO2A 5D2TA 2DORA 4OV4A 3UYCA 2R14A 4TR9A 3MBFA 3WK3A 4OBTA 4ML9A 1EP1A 3S1XA 1GOXA 3GK0A 4UTLA 4PA8A 1TQXA 3MO7A 2C13A 1UUOA 2VXNA 4HT3A 3QPYA 2ATMA 4IOTA 1HG3A 4MLJA 3F4WA 4Y8FA 1OK6A 5EA9A 3C6CA 4JDBA 4MYAA 3ZWTA 2BWGA 3OVQA 4LOCA 1G7VA 4FXSA 4LW7A 3TROA 4BWLA 1QDSA 2E09A 2NX3A 2ZRWA 3BLFA 5F4WA 3BLEA 4MY1A 4I9AA 1R2TA 3G8EA 3G24A 5E1QA 3TE9A 3LRLA 1OFEA 2ZRUA 4UIOA 2CLKA 4KKXA 4JIQA 3LOTA 1FDZA 1ZALA 4PL2A 3NDOA 3PWAA 4RXFA 3S5YA 3W7OA 1FXQA 4FIRA 5HWNA 1H61A 4JYEA 3EWZA 3PBYA 3SFKA 3UY7A 3R8RA 3PUOA 4O50A 2YFNA 1TTIA 1VHNA 3L2IA 3W7RA 3GKFA 3SGUA 1J4EA 3UNDA 1JULA 1W54A 5DCDA 1W1ZA 5K4ZA 2ZZ1A 4O57A 3IIOA 4EWND 3THAA 2A85A 5CPLA 3PB0A 1EUAA 2Z1BA 3HPSA 4H3DA 1W3NA 5AYXA 3STGA 2VC6A 1O4UA 1VQTA 3D0CA 1KW1A 2V5LA 2NX1A 4JXCA 2VFIA 1BTMA 3HBLA 2C19A 3CEUA 4PEKA 4UR7A 1FCBA 3HGRA 3NG3A 3DGRA 2NV1A 3C56A 2QDGA 4TO8A 4FNSA 4EF9A 1D3HA 4RCXA 3LDVA 1A5AA 2AGKA 3IIXA 3GDTA 1TTJA 4RLIA 3CWOX 3FYPA 3T4CA 2CZFA 3PB2A 1KFLA 2TMDA 2ZRXA 3GNNA 2CZDA 1JR1A 4JYDA 3TMQA 2V8ZA 3QW4B 3HPXA 3W1UA 3UWYA 3A5VA 1P0KA 2JKPA 3ABOA 2FB3A 4ICNA 3UWWA 5E93A 3N14A 3Q94A 2V82A 4AHOA 3EB2A 3EX3A 3G8RA 4J9JA 4JD4A 5HWJA 4MJZA 3QPZA 5G5IA 1F6PA 4WXZA 3KRUA 4ZQPA 1RR2A 3LXAA 1KFCA 3W1AA 3TQKA 4KFOA 1Y0EA 3W7KA 1H5YA 3CIWA 5D2XA 1JQXA 2ZCGA 1NVMA 3G3DA 4DO6A 1DJNA 2NUXA 2V0TA 3L68A 1Z41A 3QRHA 2GVGA 2WNZA 5HINA 3W7HA 1GYLA 1IXQA 5CSSA 5EMUA 2CLIA 3ZFHA 3HG4A 5K4XA 3UQNA 4JYFA 2F84A 3V75A 3ABQA 1AL8A 2P0OA 3W70A 5K9XA 2Y7FA 3IVSA 1RQBA 3OIXA 3JS3A 1XBZA 4MLRA 2WSYA 1DORA 2RKXA 2W79A 3NAVA 1I4NA 4NQ1A 3CLMA 8TIMA 3VCRA 5G2HA 2FPYA 4BI7A 1YDVA 1YTEA 5CZ0A 3QQ1A 1THFD 2GJLA 4FNRA 5FEZA 1OFQA 1MZHA 1FUYA 4Z1AA 3BW2A 1JCLA 1KFEA 5I3IA 3P60A 1TPUA 1JCXA 2PCQA 5ABTA 3QF0A 3PM6A 1N55A 5T26A 4GE8A 4RJEA 1OJXA 3W1RA 3LM7A 5HMSA 4LUJA 3RLUA 3RNDA 2H8XA 1OX4A 2DZUA 3NZ1A 1H51A 1H7NA 1Q45A 4UFIA 3DHFA 3W7JA 2KZHA 2A7RA 1IIHA 3LLFA 3LX9A 4X22A 3B06A 1QCWA 2R8WA 3W75A 1LRNA 3G1SA 3TH6A 3NL3A 1XDLA 3TK7A 3NEVA 4KWVA 1KTBA 3W2KA 3HG3A 4Y9AA 4JX4A 1PIIA 1X1ZA 2BZNA 2VEIA 4M6PA 2PRMA 3KXQA 3GVGA 2TPSA 1XBVA 1W56A 3NVTA 1R2RA 3E02A 5TQLA 2G96A 4X3ZA 5AC6A 3TC7A 3T44A 1QWGA 2DJLA 2Y7EA 4UTKA 4IMGA 3O07A 2CLOA 3A9IA 3LTPA 2RDWA 5AFDA 4LC8A 5D03A 4A2RA 2O7SA 1QPOA 1GVRA 3TSMA 4GRSA 4RKAA 4CLMA 1QPNA 4MY8A 2B4GA 5K9CA 4ONVA 3TR2A 1PS9A 3FKRA 4BI5A 2G5WA 1YTKA 2IQTA 3M0ZA 3DHDA 1R30A 2OMAA 2OJPA 5DN1A 1CW2A 4NJGA 4QNWA 1SW7A 4JDYA 3IRDA 1VYRA 4Z0JA 4TMCA 4NXKA 3W22A 2J88A 2FQIA 2WO5A 1FQ0A 2E5CA 2FTPA 3UXDA 3O6CA 1Q3NA
chains in the Genus database with same CATH superfamily
4I3GA 3WUBA 3IARA 3VGFA 1TRDA 4INFA 2XG9A 3UCQA 5LHEA 3WKZA 1X38A 2HVNA 2YL6A 1UZ4A 3EXRA 1E0WA 4O1CA 1O12A 1TCMA 2HXTA 3NXLA 5D32A 4S3FA 4B5WA 2ZXQA 3USBA 3VA8A 4NAFA 1AJ0A 1U1JA 5J5RA 3GVVA 4EK7A 1H7PA 4RE3A 3D5HA 3WNLA 2XJ7A 3MQTA 2HK0A 2X1RA 3NSMA 1A4LA 3KFTA 3CMGA 1XYBA 3G2GA 1BXCA 1HJXA 3IAPA 5BXPA 3W29A 3C3NA 1ZY9A 2YLLA 4GYFA 2WJFA 3E0VA 3V0TA 4DZ5A 2NW0A 1R6WA 2TAAA 5FF7A 1S39A 1NWSA 2JFEX 4B3LA 2V3DA 1CXHA 1Z6KA 1QI3A 2XINA 3LCXA 3D3FA 1TA3A 4WUIA 1DQWA 1DTNA 3J7HA 3W82A 3CZJA 3MA8A 3ZR6A 3BPWA 5K2ZA 3GTFA 2J6XA 3E9AA 2VKZG 3O8AA 2I16A 3W7QA 3BV7A 4IWWA 1TPH1 5LHFA 4OFCA 4M7SA 1U5HA 4GIAA 3UR5A 1SFTA 1SUXA 1H2JA 3P8IA 4HCHA 2D2OA 4REQA 4IQDA 2WZTA 3KBMA 1T6MA 1B3ZA 3H26A 3ZWSA 3GYCA 5A6KA 3GDKA 1E1EA 4GYJA 4ZQNA 2VC5A 3AJXA 3WL0A 3AHZA 3SURA 1R8LA 3A23A 3EWUA 2DSZA 3MUY1 3TYEA 4CNOA 3BGJA 3MYOA 5EU9A 3DAQA 3GXFA 3SECA 3T1GA 1MXSA 3UU0A 3W1NA 1DOSA 2WV8A 4LANA 2QHAA 2GVYA 1F5ZA 1C9DA 4GWEA 3VXGA 1SMAA 1KC7A 3DCPA 2IKJA 3DKLA 3UZXA 4TXEA 3BICA 2F9RA 5E0CA 3U8GA 2DSVA 4ZE5A 3S6DA 4IMAA 4NZJA 3VKBA 1FWDC 5F2MA 5F4XA 2Q3OA 5C0QA 3N9RA 1IZCA 1R3SA 1J0ZA 3EPNA 4HSHA 1ODUA 2QYGA 5A6LA 3NQ8A 5FSDC 9XIAA 2GVJA 1WDSA 1UD2A 3W73A 1YE4A 1Q6QA 2V9DA 2Z2BA 5HQLA 1XDMA 4WSHA 2OX1A 2O56A 4AWSA 3NOYA 1SFJA 4GQGA 3MJYA 3GFXA 4FLSA 3SUWA 3FEMA 4GXPA 3WL1A 4WKAA 4R34A 2ASHA 1ZTVA 3H6OA 2R6OA 1UJQA 4AU0A 4WY0A 6TAAA 4PEEA 6PTDA 1U1UA 4QE1A 1OX4B 2J7FA 4JQ1A 3W25A 4UMBA 3UWUA 2X0SA 1MDLA 2CHNA 4AW7A 5BOFA 2J7EA 4O1EA 3OQEA 4LVBA 4H1ZA 4MKVA 3PZIA 5CC7A 3LMZA 2Q3RA 2GGJA 1W8SA 3M7WA 8CGTA 3HG5A 4BQ3A 4IP7A 2OQHA 2NXGA 4I6KA 1FCVA 1LLZA 1KCZA 5DCBA 3GSMA 1TPDA 2R1KA 1TPB1 1KWGA 4I5UA 2HEJA 3VDCA 4HA0A 3NQ2A 3NYDA 4JTKA 3T0CA 2PDKA 2UY4A 5I7GA 1KBLA 1JEZA 1TELA 4JFSA 2YL5A 4LVFA 4UNIA 2OYMA 5TBOA 3VDHA 1FWNA 3DZ1A 1EXPA 3WD3A 1OCQA 5CKSA 2BGSA 2ZQ0A 3S0CA 3UGRA 3GDMA 1OCNA 5DELA 2VDHA 2IPFA 2AOSA 3K1GA 3DC0A 4AZHA 5LNVA 2WVTA 3BJTA 2WCGA 2OWCA 1E5JA 1M68A 3RCYA 4O1FA 4LCRA 3FDGA 1XIIA 3G1HA 3VE7A 2FMNA 4W85A 2B7QA 3F4NA 3M5XA 1DV7A 4ZGYA 1MZRA 4IG2A 4RZBA 1DWIM 3FSTA 1CZ1A 3NQMA 3N11A 4B9ZA 4O8AA 1QNVA 4WIWA 1EFZA 1CXIA 3NXFA 4XZIA 1QOPA 4GG9A 3W1QA 1RCQA 2W0UA 3E0IA 4GI8A 4PUJA 4RW5A 3W1LA 1KM4A 3YPIA 4HU0A 3W7DA 3G77A 1D3GA 3PY2A 4IMDA 4RV8A 2WVSA 3RILA 1CB2A 2VZSA 3LHTA 1C93A 2WPBA 1O95A 4IPLA 2Z2UA 3L9CA 1J93A 3DC8A 3LK6A 4S3AA 3CH9A 5CPMA 4HMEA 1R38A 1CLXA 1VFMA 2DJXA 5BOEA 3AYVA 3GFYA 3UWVA 1LWJA 4NU7A 3DDMA 3U2OA 2VCCA 4O54A 3W83A 1XISA 3M6YA 2I1OA 1KV5A 3TX9A 3WJWA 4IQLA 2FGBA 3VI2A 4ZO8A 5D4YA 3TW6A 3ZJ6A 1V3JA 3QZEA 4GYPC 3BW4A 1MNZA 4JQ3A 5MHBA 1FWEC 4N2YA 1A3XA 6CGTA 1LOSA 1UASA 1A5SA 1UWQA 4X63A 3W86A 3QYQA 4REQB 4D6DA 1A5BA 1M7OA 3KX6A 2PDPA 1OFRA 4NRRA 3PWGA 2ZRYA 5A2AA 4C6NA 3LHYA 2FPVA 5KZDA 4MB3A 3GXIA 5XIMA 2YA0A 4DF0A 1JPIA 1U2YA 1JCYA 1KXVA 4AWUA 2OKOA 3L4ZA 1S2WA 4PL1A 2J8FA 5I03A 1CXEA 4JN6A 4M8UA 3L0KA 1E3ZA 1PKMA 4PTMA 2G97A 3WNOA 3L23A 1SZNA 4MFDA 3CHCA 1TMQA 3C2EA 3TCEA 2WANA 4FR1A 2VZUA 3V18A 4N9DA 5KZMA 4JIPA 2SFPA 1JZ5A 3KBNA 2VWTA 3S2CA 5H91A 3KDNA 1JCMP 3BK0A 1WBJA 2REQA 5EPDA 2VUNA 1RXOB 5C70A 4QROA 4OGZA 3LZ3A 3FA5A 5LIYX 2QDEA 4BQ4A 4GYPA 1Q85A 4LVGA 1Q2RA 3EXTA 4D2JA 1BF6A 1BGGA 2WOQA 3PPGA 1JI2A 5H8MA 5LNRA 3A4JA 4MB5A 4L9ZA 2F8QA 3W7IA 4GABA 2O0TA 2I57A 2Y85A 5CLTA 3SUUA 4PMXA 1JAKA 1UYQA 1S38A 4OWGA 1SGJA 4UFHA 4ERGA 2UWFA 1DJIA 3H7RA 4HHLA 1POKA 3V0SA 4B90A 4DPPA 4GY1A 7REQB 3F4VA 1XLEA 1UPPA 1NARA 3TYAA 3VIKA 4MB4A 2WZEA 5HNTA 1PB0A 4DWSB 5LGZA 3OW1A 1EJRC 3IPWA 4PBEA 1Q13A 1ZJIA 1KLZA 2X41A 3CV7A 4MJ2A 4J2PA 1F76A 3KUMA 1EGVA 2QS8A 3IUIA 3KVMA 4HQVA 4F40A 5KINA 3WLLA 2XVGA 1WOAA 3CTTA 3EX4A 2VR2A 1EOMA 3MWAA 1VJZA 4Q33A 1WYIA 1PIFA 3DXIA 3SCTA 4GC3A 4JN8A 3NQCA 4JTIA 2VZVA 2WCSA 3VOJA 1ADSA 1B3OA 4WKFA 5A5WA 4GINA 3GQYA 1US3A 4ZE4A 3K13A 2XYLA 2CYGA 2GOKA 4ZO6A 2E6YA 4I9TA 3LPPA 3C0QA 3UBPC 1K6WA 1UBPC 3RN6A 3C3UA 3UY8A 3DKJA 2V67A 3GVQA 4GXMA 4CCDA 5E5CA 4RV3A 4C6LA 1EDTA 4GVHA 1LORA 1T0OA 3HGOA 2E77A 2BSLA 1IXNA 2PURA 3FX4A 5G1YA 1WXYA 3UG3A 3PSWA 4XZ9A 4GPNA 1W32A 1L0PA 1JUEA 4JY9A 1S1RA 3UJSA 1X8FA 2PAJA 3SR7A 3F2DA 3LLDA 1K9EA 3IGHX 5CZJA 3KP1A 5LA0A 4Q4SA 4LVAA 2TSYA 3VC5A 1QRQA 3GS6A 4IIBA 3EMQA 5BWFA 3OODA 2AL1A 2A21A 1QPKA 4J2MA 3BAJA 3C2VA 2C8NA 3N13A 1LROA 1AQ0A 1KD0A 2Z25A 3DG7A 1LG1A 3ZXWA 3TLLA 3F03K 5F2LA 3AU6A 3DFSA 1HTIA 3U2CA 1GVEA 2A4AA 5CC6A 4Q8MA 2DZPA 3NQAA 3VZXA 2O7QA 3R58A 1O68A 3M44A 1CCWB 3MC5A 3TAKA 3WBYA 1PYFA 5D05A 3N34A 4M19A 1M1BA 3H2FA 5LXEA 1S5WA 1PBGA 3VDBA 3M47A 1KO0A 1UB3A 4JTUA 2V5CA 4MIMA 1J0JA 4ADTA 3KLKA 3LRKA 3ZR5A 3TJLA 3N9SA 4E8DA 2ALRA 1JGMA 3AIBA 3GH7A 5HAOA 3WEMA 5I3HA 5I3DA 1UR1A 1NWTA 1OSEA 1TR9A 1Y65A 4GUFA 2YBUA 3B8TA 4N6EA 4FOKA 4Q4KA 3CQIA 4PTVA 4HHHA 4Y9MA 1QFEA 4I7WA 2PDYA 1TFVA 1UG6A 3DHUA 2P10A 5F1VA 2JEPA 3W81A 1G4PA 2IS7A 3VC6A 4BR1A 4IFKA 3SM0A 1JZ6A 2D3NA 2I17A 1V8EA 2GSEA 1W3TA 4NX5A 2XGBA 3ZT7A 1JPKA 3FY1A 5DMMA 1OWQA 3TW7A 3IK2A 3CPGA 3GNOA 3LCGA 3ZVHA 1L2UA 3GBDA 4N6FA 5HUOA 1XCWA 1K8YA 2C18A 5HJXA 4KMQA 5CLWA 5A6JA 4H8HA 1VBRA 1FKWA 3UG8A 4D6HA 3WF1A 1YX1A 1B4KA 3TYDA 2GDUA 1VF8A 1I60A 3M43A 4IFRA 4QFUA 1QATA 1JYXA 4GBUA 3RITA 2WHJA 4PCPA 2Y7GA 4HCDA 1ZSXA 3G1FA 4D6JA 3P74A 1DBTA 1EDQA 4HA1A 1SW3A 2H3BA 3QTPA 2UY3A 4NT0A 3IGUA 1WA3A 3KBVA 1UP3A 3MKCA 3UR7A 2QJJA 3R25A 2OZ8A 3URQA 4MFEA 3VOGA 1L8NA 3Q37A 3ZO9A 1DPMA 1KLYA 1Q6EA 1YXCA 4Q6JA 3EDKA 4OECA 3H2EA 3UJRA 1MRAA 2PGFA 3OVRA 1YTDA 3OQ8A 3RK8A 4B5TA 1XRFA 3NO3A 3TTSA 3CIVA 3LS9A 2VEFA 2VZTA 2WSPA 5DCEA 1LUCB 1JCNA 1JDDA 4X2RA 3KRBA 3G6LA 3AO0A 1QBBA 1VFTA 3FHQA 1F2JA 4MWAD 3AUJA 1WKDA 2V3GA 1A53A 5K7JA 2QV5A 5F4SA 2YCKX 3PK7A 3WENA 2C15A 4FXFA 4PB4A 1IQ8A 3IJ7A 4L65A 3WBXA 1EO5A 1XYFA 1L8PA 1OD8A 2GSJA 5DRCA 1AQFA 1ITXA 4IXXA 1ZBKA 2QMKA 3ARWA 3TN3A 4FNTA 7TIMA 3LGEA 1M53A 3T7VA 3N2OA 5AYIA 1VRDA 3V0UA 4AHPA 4JY8A 2BLEA 1IGWA 4HZ7A 3NZGA 4U3CA 1AQMA 4JEQA 1UBSA 4IIHA 3S1UA 3CV1A 4IICA 4KS0A 1ISVA 1LJYA 5A1AA 3UPBA 1EWDA 3RO8A 2ALDA 2VGIA 5HDRA 2OZ0A 2J7DA 4L9XA 4C6CA 4MVAA 2J25A 2X42A 3QQ0A 3W7GA 1C29A 3W2LA 4M7TA 2RDUA 2ZRVA 2ZUTA 4UZUA 4XKYA 1P4CA 3OTRA 3BJFA 2ANUA 1LOLA 3A22A 4YTTA 1QI4A 3SADA 3A6OA 2GGHA 3B05A 3APTA 4ZTXA 1XXXA 5A3HA 2XH0A 1RH9A 1VEMA 4QP0A 5G1TA 2R1LA 3BV4A 1XBYA 5U4NA 1D8WA 2E6AA 5LZLA 1W5NA 4JTHA 3IGSA 5EYWA 1WDRA 1YE6A 3KL0A 4ACZB 3FS2A 2G3NA 2QZRA 1UD8A 1E0TA 1TUXA 4TVDA 4BF7A 1XLIA 2WSRA 1MVYA 3AIEA 2PRHA 4UTUA 1XLLA 2O9PA 3A12A 2ZZ4A 4WK9A 1HX0A 3L65A 3HB9A 4D6EA 4PB3A 2QCGA 1MEHA 3QXBA 1EGMA 3GHTA 2OT1A 2VCAA 4KRUA 4PMYA 1VH7A 5CPTA 1SO4A 2V81A 4DJFA 4BK9A 3K4DA 2QJNA 3G0SA 4IZGA 1FBAA 2R1PA 1DP0A 4U31A 3HJZA 4S3BA 3WH5A 2WZMA 1KR1A 2R1NA 1B54A 5KMYA 1V03A 3LNPA 4GACA 4LB4A 4FSAA 3WO8A 4X9SA 3SIZA 1KXHA 4DF1A 3APYA 3PS7A 4FMVA 3AALA 1NEYA 2PDMA 3A4AA 3GG8A 3M46A 4NNAA 3W27A 2QJGA 4BZYA 3Q58A 4RZ6A 4KT2A 3ITXA 1P7TB 1GYMA 2CLEA 3UD6A 3UPWA 3OVGA 2IUZA 3QH2A 3W26A 4M56A 3RCNA 3PTQA 1XLMA 4FI4A 5KSWA 2Q8LA 4S2CA 1W5MA 3WQGA 2VEKA 4GKTA 1GT8A 1MQQA 3S1VA 4P7RA 2EJ1A 1M3UA 2VJXA 2BHZA 1FWSA 3PBVA 4GJ1A 3AAMA 1EX5A 5AC8A 1UR0A 1Q4NX 4MTVA 1HGWA 4Q32A 3URAA 2PDIA 4N0RA 3C0JA 3GC5A 1W8GA 4OOUA 2PMQA 1FP9A 3CAVA 5D04C 3I68A 3WK1A 5REQA 1J5TA 3SCSA 4B3KA 4QDWA 5BMWA 1CXKA 4R33A 3W7MA 2XHYA 2Y8VA 4K2SA 4F0SA 3TUUA 4YTRA 1MMFA 4FXRA 3W6LA 4DB7A 4DBWA 1Y8BA 1F6KA 2D2GA 1QOQA 1Q2SA 4DBSA 3N4EA 1VHCA 1RA0A 2QKFA 5D2WA 1GHSA 2ACSA 3KOFA 1IXOA 1G69A 3CUXA 1RQEA 1EJSC 3MP4A 1PHWA 5T9CE 2BHUA 2JGYA 1AA1B 1F61A 3QJAA 2E28A 1VFLA 1EJXC 3CYJA 2D1ZA 1FWHC 4GC4A 5IHRA 1Q8AA 3PZVA 4ZXLA 5DY3A 3OBKA 1GONA 1H1ZA 2VELA 4D6CA 4MJMA 1XH2A 2RH9A 5CBIA 4EPKA 4MNMA 2QCHA 1ISXA 2JKEA 2TRSA 1GOWA 3PTKA 1NDVA 3TMLA 5EMYA 2IKHA 2EQDA 3EEZA 4PR4A 3KAOA 4E38A 1PWMA 4BCEA 2NUYA 2YZRA 5A8NA 3I3BA 1VBUA 5AHEA 2E6FA 2QPSA 4UQDA 3U7VA 3NL2A 3QY6A 3UXKA 3PJXA 4D6IA 2FDSA 3OZOA 1YPFA 4KGLA 2IPWA 3IJ6A 2QLYA 3BG9A 1W3KA 3VK5A 2XIQA 2Z7GA 5HR7A 2YYTA 4POCA 2YXXA 4D8LA 1LM1A 1S2UA 3LTYA 3CJPA 1B0IA 5I24A 1TPC1 2CLMA 2ISDA 4ADUA 1X1OA 3FJ6A 4JHOA 1GOQA 4DLMA 2CU0A 2P50A 5I23A 3G1AA 1O60A 4I7VA 2Z1KA 1V3KA 2J7CA 2WKJA 5CJNA 3IJ9A 5CGTA 2PU1A 5AOUA 4I8YA 5KZ6A 3W71A 4O12A 5A6TC 4XTIA 1K02A 4AZIA 3DU0A 1C90A 3GLCA 3G1DA 1BWKA 3NFUA 3OB8A 3V16A 4LEFA 2ISFA 5EBUA 1BWVA 4ZMGA 4AEFA 4ACYA 3WDJA 4XBSA 1MEIA 3E5BA 1RBOB 2EHHA 4LS2A 3WX7A 3VKDA 1YBQB 3MKVA 1KB3A 2QAPA 4LF1A 2P0IA 1AH4A 3AZRA 1UWTA 3BLPX 1S3HA 4LC6A 1VD6A 5H8UA 4JAWA 2VM8A 3C2OA 1OGGA 2BS9A 3DHPA 3WIJA 1I6NA 4DM2A 4DWSD 3Q2DA 2GYIA 4DQWA 4ZODA 4PUDA 4DZHA 1YYAA 3OG2A 1QO2A 3KM8A 4AEEA 4OV4A 2QT3A 3THCA 2R14A 1KFWA 4H9VA 3MBFA 1V6TA 3VVGA 1BTCA 3S1XA 4PA8A 3AROA 4CN4A 2VXNA 4HT3A 4K3ZA 4PUNA 2PLMA 4HYRA 1E55A 4H7VA 4QG9A 3ZWTA 4FXSA 4G6CA 4E3VA 1QDSA 2NX3A 1XLFA 2OPJA 2C79A 3BLFA 5F4WA 3BLEA 4N42A 3KEHA 4DM1A 4LYRA 4I9AA 1XIDA 3H8AA 4UOQA 3EB4A 4GO9A 5E1QA 3TE9A 1N8WA 1OFEA 2ZRUA 2CLKA 3LOTA 7A3HA 4MWAE 4W5ZA 1R9XA 3VMPA 3BAKA 3PBYA 5ABEA 4V2XA 1NOUA 2GL5A 3UY7A 4QCEA 3R8RA 4O50A 4WVXA 2YFNA 3AS1A 3GUGA 8RUCA 2XSBA 1HT6A 1W1YA 5REQB 1A5KC 2WLZA 2GJXB 3Q4DA 4OBSA 1OINA 5K4ZA 4O57A 1E73M 3H2OA 1WAWA 1XLDA 1EUAA 4LAKA 4G2DA 5JVLA 4H3DA 5AYXA 4A3HA 3FYYA 3WLOA 1O4UA 3D0CA 4TVCA 3TJIA 3NEHA 1BTMA 4PEKA 2VHLA 4OTKA 2VX7A 3HGRA 1PYMA 3LA4A 4LUTA 1XFCA 4RCXA 2AGKA 5BU9A 1BF2A 2DQWA 1TTJA 4DNMA 1HL8A 1V02A 2ZRXA 1K1DA 2ADAA 2V8ZA 3QW4B 2CWXA 1EL3A 3KCLA 1P0KA 1KNWA 3ABOA 1UH2A 3CUIA 3UG4A 4C6JA 5A6AA 4Z2KA 2ZWYA 2C1GA 4MJZA 3QPZA 5G5IA 3O9NA 4MNLA 1KFCA 2GFTA 2PGRA 2CERA 1P48A 2W9MA 2G3JA 3CIWA 5D2XA 1Z3NA 4DO6A 2V0TA 3VD5A 3QRHA 2WNZA 2D24A 2V3EA 3W7HA 2GDVA 3VDAA 3VIOA 1T8QA 2CLIA 1JYNA 5K4XA 3GW0A 4IL0A 3MB9A 1GHRA 1JAEA 2WMIB 2HBVA 3JS3A 5BWAA 1XBZA 4MLRA 3TQPA 4MMWA 3GR4A 4V28A 5HMEA 3NAVA 4NQ1A 3RRAA 2FTWA 1XDJA 2FPYA 5JQ9A 1YDVA 5CZ0A 3BMVA 3I6TA 3UJEA 5XINA 3OA5A 4FNRA 3WLQA 5FEZA 4P5UA 3ZIZA 1TZZA 2HK1A 1JCLA 3EYPA 3NTYA 4MAZA 2VC9A 1JCXA 4A05A 4HGXA 3P6LA 1R86A 4K1GA 3PM6A 1N55A 1BAGA 3OPSA 4GE8A 2FH8A 1MRQA 3LG3A 5JH2A 1HIZA 2V5KA 3RLUA 3CO8A 3N3TA 1H7NA 1Q45A 4UFIA 3DHFA 1DWGM 2PF8A 1UHVA 1IYXA 5CQ1A 2WK2A 3LLFA 1NJJA 2R8WA 1LRNA 3TH6A 5BRQA 3VGBA 1OZQA 4FLOA 1W3LA 3E2VA 2OU4A 4C6KA 4H2CA 1XSKA 1Z32X 4LPCA 1PIIA 2VEIA 2PRMA 3R1ZA 1NELA 3GVGA 2TPSA 3AS2A 3E02A 3KLLA 4A6GA 1F3XA 2G96A 2Z1SA 3FW6A 3AHXA 4X3ZA 1QWGA 1TX2A 2NQHA 3F5KA 3O07A 2DUXA 4AC1X 5D03A 3ZT5A 1QPOA 1GVRA 3TSMA 2OEKA 4BEUA 2B4GA 2BMBA 5K9CA 4ONVA 1WUFA 1ESWA 4JCMA 1YTKA 1XHGA 3M0ZA 4U2ZA 3DHDA 4Q4OA 4ROQA 4FXJA 3CV2A 2BY3A 2F6KA 4JDYA 3WUEA 4NXKA 4X0VA 1KKOA 1XSIA 2FTPA 5D09A 4RE4A 4ZB5A 1V3MA 3V3WA 5LA2A 4W84A 1HJVA 3BE7A 3DOPA 4RDYA 3NQ7A 1ZGDA 2YW3A 3LPFA 3AHYA 3CYVA 2C3ZA 2DZTA 4V27A 3T40A 4NXSA 1BKHA 5I78A 3TZNA 1BXNA 4R5EA 3ZQ9A 1TB3A 3L0NA 1JVNA 4Y6GA 2OGYA 3GTIA 1MYRA 1W1VA 1CXFA 4NZ4A 5FJRA 3T0TA 4KRTA 1V08A 4O11A 2XM1A 4M24A 4NIRA 1DYSA 4MDPA 2WQPA 2EKCA 2E6DA 3BGAA 2ZA2A 1M9HA 4Z2HA 2ODOA 3URNA 1KM0A 1BYDA 1LRTA 3FN9A 1XC4A 4C6MA 2ZTKA 3QLLA 1AVAA 4FX7A 3SRKA 1JF6A 3F1QA 1XLBA 8XIAA 3STEA 5A8MA 5C5YA 3CT2A 4QNEA 1RA5A 3LI0A 3KCOA 3PAOA 4NJJA 1XJBA 1E4LA 3W1XA 4Z08A 2JEQA 4GA8A 2PB1A 3QR1A 5C7VA 4O28A 2BVYA 2J6VA 3UJ2A 1DHPA 1PZ2A 4PRTA 3S83A 1JXJA 1AQHA 1LF1A 5A8GA 2Z2AA 4AD2A 5DMYA 1EPVA 3LCWA 4C65A 1WXJA 1XW8A 3CMFA 3O05A 4ZCWA 2QCLA 3PP7A 1BEUA 3A4XA 3MV11 1CLVA 1QNSA 3EPOA 1WAUA 4GKLA 4GQRA 3L5LA 2I56A 3DENA 5CJ5A 4F2TA 5C6MA 1MW0A 1T8XA 5FJPA 3AWNA 3HPZA 2WMHA 1Q6OA 3P14A 1GQLA 3IV3A 4E8CA 3NA8A 1NFGA 2YX0A 1QT1A 4ZSUA 1EF3A 4RPPA 1XS2A 1OFBA 1JNDA 5C9XA 4AZCB 2W3ZA 3TXZA 3KRSA 4DI8A 1SZFA 3M41A 1BGAA 2WZIA 5DRIA 4I8DA 4D9PA 3U5UA 3PBUA 3GR7A 3RF9A 4FEZA 2Y7DA 2C1HA 3CHEA 2QUNA 2G8ZA 2W63A 2EF9A 5AZ1A 3TW9A 4PFHA 4N02A 2FPTA 3WQEA 3MP5A 4L4MA 3ONCA 3CUZA 4N9CA 3OEXA 3IWPA 1BFNA 1QI2A 1ZB5A 1H0IA 1OIMA 2V5BA 5C2CA 2C16A 1ISYA 1FDYA 3MCOA 5KTLA 3VZYA 3W23A 5AVNA 2HQAA 3VD4A 3I4KA 4GXWA 4JTRA 1OGSA 4LF2A 3RX2A 3WD2A 5LYRA 4GZ7A 3LBCA 4F9JA 4IGSA 3H7VA 3CTLA 1RJRA 1Q6FA 2VR4A 4MB1A 5GJMA 4DXVA 3P67A 1OF6A 3VIIA 4QHRA 1H7WA 1C8XA 3M07A 1EDGA 3DI0A 2GQ9A 4CKQA 2QCNA 3E38A 4UC5A 3DYPA 2OLSA 3O6DA 2RGLA 1MW3A 1V79A 3C2RA 4IM4A 4YVPA 2RDXA 1QPQA 4ZFCA 2Q01A 1I0BA 3MHUA 2B7PA 2HNEA 4UQAA 3M7SA 2D69A 2IQDA 4S3CA 4FALA 5A6SA 3LSBA 3OJGA 3TAOA 1RBAA 3S1WA 3W2NA 1K4GA 3CHVA 4HPJA 3S42A 5L9FA 5DXYA 2DT3A 2E5BA 4YL2A 2PZNA 1XC6A 1K7XA 4PC8A 3CQ0A 4XZWA 2NQ9A 2Z27A 3FIGA 5C8BB 1Z48A 4ZTYA 2VFGA 3INPA 4X61A 2DZAA 5G4EA 2OQLA 5HPOA 4QLLA 4AY7A 4W4QA 1VFSA 4F79A 3MUIA 2QCEA 4LBSA 1EEXA 3AIVA 1HKVA 2KAUC 1W2PA 2OT0A 3N15A 2PE4A 4H9XA 3CHDA 5AKQA 1CIUA 3DECA 4UWMA 2ZWZA 3GNDA 8A3HA 2PLJA 3H2AA 3W7LA 3RU6A 3T55A 2PU0A 2PDGA 4M81A 5JUVA 2AQVA 1HVXA 4E4UA 1UR3M 1CENA 3FSUA 3DEQA 3N19B 2PTXA 5D33A 4Q8VA 3KDOA 2YOCA 4MKNA 2DIJA 4L1XA 4N9BA 1UUMA 2HROA 1YBQA 4PMDA 1ZHAA 4XISA 3UR2A 3HMCA 4PMZA 1FFRA 1IR1A 1LG2A 7CGTA 5FACA 1QWKA 3QOKA 1T40A 1ZJHA 4NX0A 4LAMA 5EY5A 1UUQA 3OGVA 4DHGA 4HPGA 4WX2A 2PDQA 4O52A 1XM3A 2R9RA 5EFFA 1HJQA 1LWIA 3PULA 3HU7A 3BQ6A 1Q63A 1E1CA 4HB7A 1C8YA 4M3PA 6REQA 2WJZA 4TMBA 1Q4WA 2OCZA 4LXFA 3AMCA 3H54A 4H7CA 4AF0B 2PC8A 4WY0F 2WW5A 4IP5A 1RD6A 1VKFA 4E0CA 1ICQA 1XQLA 1ICPA 3SRDA 3P0XA 1YPIA 3G1YA 1VPYA 1XCXA 2PRLA 4QAIA 2ZADA 1KWKA 4D8ZA 1EHAA 4AIBA 1OFAA 3MJMA 2X1TA 2RUSA 5HJLA 4EXQA 3VM7A 2VT0A 1VENA 2HTMA 2F7FA 2WJDA 2R1MA 1QASA 3SN0A 2G4FA 4KBXA 2OYLA 3M64A 4DAFA 2HISA 3P80A 4DYKA 3W4RA 5CAHA 2WKLA 3IANA 3ITCA 3VOHA 1UKSA 4H8NA 5DMNA 3PUGA 5FOOA 2HE8A 2PDNA 1ZAIA 3IGXA 4ORMA 1XLJA 5FAGA 2O4QA 3M1ZA 3BOFA 4B3ZA 1KXQA 1LL7A 1HKJA 2FZMA 1L6GA 1Q6RA 1ZUAX 1PTGA 3MSDA 3DG3A 3O0FA 3T05A 4PCTA 3S5SA 3PC0A 5TNVA 4B4FA 3BSMA 4QTGA 4RZ4A 1RUSA 4F0RA 3MVIA 1NU5A 3RDKA 4OBRA 3S6OA 1H63A 4CN6A 2V2DA 3Q45A 1YNYA 4AMAA 1LTDA 3MUZ1 1LBLA 3UWZA 1S3TC 1C9WA 3M16A 4URIA 5A94A 4F8XA 2HVOA 3MO4A 1H50A 1IE7C 1CWYA 4HOWA 1XLKA 1PTDA 3QR0A 3H70A 4EPEC 3ICJA 3SCNA 2DZBA 3T0BA 1G7UA 3W85A 2I5GA 3W2UA 3EDJA 4QDMA 1KBBA 1OBAA 3CZGA 1K9DA 3AYTA 4ZZ9A 3HQOA 4Q4RA 1CPUA 5D8WA 3UZYA 2J62A 3BSHA 1E6SM 5E70A 2VFFA 2CC0A 2ZTJA 3N2TA 2PDCA 3TFCA 3TP4A 3GBEA 4DAIA 3P84A 2YPIA 3VNJA 2Z7KA 3KL3A 2EEXA 3GIYA 3TU9A 1PO9A 2RJHA 3L0GA 3NJ3A 4JICA 1L2QA 4WDTA 1B3VA 4ZB2A 3W72A 4O8RA 2QUVA 4IG2B 1S2VA 2PCEA 3V4BA 4GHRA 2BOEX 1WX0A 3CC1A 3BG3A 3M5VA 2RDTA 3PG9A 1W9DM 3S2JA 1US0A 4OQVA 3FYOA 3GU9A 3U6WA 2QUMA 3DBPA 4CN1A 3ANYA 4BQ5A 1QXLA 3CWNA 3WH6A 2ZUVA 4PRWA 1OFPA 2GDQA 1QUMA 4IISA 1MUMA 4ZQMA 4DJDD 1ME8A 1JZ8A 3P8JA 4ZFMA 4DPQA 5LNSA 1GVQA 3BC9A 3W28A 1QMLA 1P43A 1FHUA 5FJJA 2YL8A 3QLDA 3NQFA 5LGXA 4GIEA 2VRKA 3UA4A 2FTYA 4KETA 2PP0A 2ISVA 3LGDA 3L4TA 3I65A 3ATYA 4TV6A 4R7OA 5CPQA 3UG5A 1E9LA 5HA7A 3FJ4A 3CZEA 4KCVA 3T08A 1YMYA 4WOZA 1XGDA 3B0UX 2W61A 2YXGA 3NOEA 1SSDA 2Y89A 1O94A 2ZRZA 3ZLGA 4QE5A 5DY2A 1G4TA 3NQBA 3U4FA 3UZZA 4IJRA 3GG1A 1X98A 3ARUA 3U7BA 4XD6A 2OOGA 4CNNA 3JVAA 3KCJA 4PTDA 5CJMA 5HR6A 1MO0A 4A35A 4GBDA 4PMUA 3T6CA 2H9AB 2W27A 3EOLA 5M5DA 5IBXA 1H7RA 3W01A 4S39A 4RDVA 5I6SA 4UTWC 1CI1A 2REQB 5IM51 2VOTA 3LCHA 1DJQA 4GQ0A 3GZ3A 1ZBVA 2OSWA 1O5QA 2CETA 4ES4A 4ZVJA 5EMLA 3PR2A 5HMFA 1IEWA 1MNSA 1OC5A 3ITVA 1BYAA 4KWSA 3G0UA 3UETA 4JBRA 4LUTB 2WKGA 2PD5A 2FGLA 3I6RA 5B7YA 3LXCA 5GNYA 5D2YA 5E0KA 2FJUB 4UTTA 3VNZA 1LP6A 1LBMA 4MZ8A 3WJZA 3CAKA 5AYYA 3UGVA 1VC4A 1EA9C 4E6MA 2V5JA 3B8UA 5IBXC 3REQB 3GDRA 4U2YA 4XBJA 1LQAA 2FDMA 4G8TA 3GXMA 1AJ2A 3T0AA 4CNSA 2UZ9A 2A1YA 2BGQA 2OGJA 4JS3A 1E6XM 1XGZA 1JL8A 5I3JA 3NQGA 1KFJA 5J5DA 4C7FA 2XN2A 3LLXA 2E7FA 3M5ZA 3S3GA 3TYCA 2YXOA 3CL7A 3OU8A 4ACZA 3KVKA 1XUZA 1PVNA 2H3DA 3KZSA 2VC7A 3PFRA 4YCPA 3L66A 4L4OA 2J9YA 5KETA 1XRTA 3WF2A 1C7TA 3C61A 4H01A 3HA1A 3WBWA 1V3LA 5CCZA 3BUVA 1NOFA 3EB3A 3MHFA 3KE0A 2GZXA 3WLKX 1T5AA 2B81A 1XLGA 5C2XA 3WDQA 4PB5A 1ISWA 2UY5A 4ILSA 3O6AA 3NUKA 2CITA 4H9ZA 1F73A 3T09A 4BF9A 1NOWA 1J10A 4US5D 4P61A 4HNCA 1H4PA 4I6VA 1OGBA 2A5HA 4QAWA 4GUJA 3AISA 1U33A 1S5VA 1PDYA 5ENLA 1KBJA 3QSTA 4JL1A 4AZ6A 1EHNA 1Q7QA 1X97A 2QUTA 3A5FA 1UOZA 1YEYA 4KCUA 1FCQA 1LBFA 3SSZA 4UNKA 2Z1WA 3BMXA 3G5EA 8XIMA 4CVWA 1HGYA 1X6LA 3STFA 3H7UA 3WG6A 4PH6A 4E2VA 1RVGA 4HZ8A 5TD4A 1NFBA 3MI6A 3W7NA 2CZ5A 1WZKA 1JNEA 2B0MA 1A5CA 4WDXA 4GNJA 1IF2A 5FF3A 4IXHA 5H6HA 1NP2A 4PGLA 4W88A 4BEQA 1KRAC 3ZS4A 1RBLA 4GVIA 1TPEA 4UBPC 1LWHA 3B0XA 3BMWA 3NPVA 4P7LA 3GVRA 3ARYA 1BVZA 3HURA 5ABGA 4AG0A 3NM3A 1HL9A 2XIOA 5KEZA 5AHIA 3HTWA 5JH1A 4DYJA 1VP5A 5U7SA 1T7LA 3LBOA 1WE5A 5J8LA 4CQ9A 3AIQA 3WFLA 3ZVIA 4PMJA 4W7UA 2BODX 2CKRA 3C52A 2HJPA 1E56A 1RJPA 3E1F1 4EP8C 1TJRA 4DJEC 5I3KA 3SRHA 1REQB 3MW7A 3VGHA 3UA3A 4XVDA 1U22A 3G1RA 3P7YA 3R0UA 1DXEA 4LYPA 3N2MA 1VEOA 1NDZA 4M6VA 3W7CA 5FF2A 1QI0A 2AMGA 3EWYA 5A6BA 4Z0SA 7ODCA 4NRSA 1IT8A 1US2A 3BCJA 3AQUA 4O0ZA 3PWIA 3UESA 3SW6A 3VNMA 2UBPC 4C6PA 2VGGA 5G4WA 3FHAA 2H9AA 4FHAA 1NDYA 4LS0A 5F2GA 2HVMA 3SCOA 3WLPA 4UUIA 5DT7A 3NL6A 2XZ9A 3QBUA 1G4SA 1XYCA 2I9UA 2UY2A 5H1WA 4H9TA 3O6YX 1CECA 3DGBA 4KCTA 4O13A 1L9WA 4UTMA 4OKDA 1LL6A 1CT5A 2YLAA 3O3RA 5HULA 3VINA 1MSSA 2CXGA 1IXPA 1FWFC 1B3XA 2QNEA 1B5TA 2ZOXA 3WCZA 1SO5A 2VR5A 4U28A 4H19A 1DTUA 2PUZA 2ZDSA 1WNOA 2WLYA 1SU5A 3W02A 1QJWA 2YW4A 4UCGA 3CZKA 4YYFA 5D8ZA 2GLKA 3REQA 3G1XA 2MANA 4EOUA 1ZBWA 1GQJA 2EPKX 5IDZA 1R87A 3CO4A 3ANUA 4Q8NA 4M0XA 3BURA 1A5NC 3OLGA 1H41A 3TWAA 3UZ5A 5ABFB 1EZWA 3T81A 1UKPA 1R3TA 4HU4A 4WQ6A 4WSKA 4H41A 2DDXA 4HD5A 1OX6A 5C54A 3CUJA 3VYLA 4JFTA 4G7EA 1PEZA 2WC3A 3LHVA 5EMJA 4Y9OA 5C9WA 1GTEA 3MY9A 4LGXA 3CGTA 2NWSA 4V1YA 3SQMA 4P7NA 3UCCA 5IOBA 1TRIA 1QAPA 2XVPA 1X7IA 1VCGA 2ZVIA 1JZ4A 4YNGA 2QGHA 3BZGA 3NSNA 4Q7IA 3MMWA 4TX6A 2NSOA 3UYIA 5CC5A 1QW8A 4Q7NA 3T9PA 1VFHA 1O5XA 2PWGA 1M6JA 4PTWA 3UXAA 1PIGA 2G3FA 1Y5XA 5GVJA 4O14A 5DFAA 1X96A 1Q6LA 4IUGA 3UNTA 2OSXA 1BHGA 4JTSA 4PMVA 4W5UA 1GVYA 1KM5A 2BASA 3E96A 3M5YA 2C91A 1AW1A 4O1BA 1O7AA 2X05A 3GXTA 3FVMA 3O1NA 2PTZA 1GW1A 1RK6A 4JIHA 2ISWA 4FNQA 4H7ZA 3GY1A 1G5AA 2VWSA 1FCUA 1XYMA 3ERPA 1TVNA 4LSBA 1G0CA 2Z1XA 2R91A 3N1AA 4MYXA 5DBTA 4CCCA 2BOGX 1GORA 2DZVA 3ELFA 2FZ8A 3WJYA 4KRZA 1Z8AA 5FF0A 5D37A 4MADA 1M65A 4C6QA 2EBNA 3II1A 3VKKA 3WLSA 3SAZA 1A5OC 3NQ6A 4NG3A 2NV9A 2GQ3A 5DANA 2YBVA 4FLRA 3M0JA 4JTDA 1ZAHA 2WVVA 1S5TA 1VYSX 3R5EA 3V5CA 2JF6A 1AD1A 1W2VA 3IS4A 4XX6A 3WK0A 3WFZA 2NVAA 4MOZA 3UZJA 3ES7A 4DBDA 3NGJA 3O06A 4O10A 3NPWA 4ADSA 3VIGA 2CXEA 4ATWA 1JPDX 1AW2A 4BQ2A 4K68A 3N17A 3CMJA 5LSMA 2DSWA 1S5MA 4NI3A 2OWWA 4GH1A 3PUDA 1ZU8A 4M6QA 4NZ3A 3RLGA 4JIRA 1MW2A 3C0LA 4K36A 2XSXA 4G7EB 4DWSC 3N29A 1S2AA 3B8DA 3GG0A 3N6QA 2C7FA 3U57A 2WNWA 2E5DA 5KZEA 5GNZA 3EXSA 6A3HA 3S9IA 2AQWA 1I8JA 3GWQA 4DUOA 2HXUA 3DFNA 1Q8JA 2V2HA 1JFHA 2QIWA 2Y8UA 3IUDA 5CZKA 3IUHA 1DJGA 4CQAA 4DBEA 2DZXA 3HFYA 2J75A 2TYSA 4J3TA 4OU1A 4YHEA 5DQPA 3SSJA 1F3WA 5HBFA 5DMLA 3NGFA 4XBKA 3ZR4A 3H2MA 1XG4A 1J0KA 1DJWA 2RHGA 1K8CA 1E1CB 1ZP3A 1B30A 5E9AA 4ICCX 3QOMA 5TAOA 1XIFA 3LYEA 2ACQA 2NQJA 2YIHA 3HGJA 4RXGA 4TVUA 3MMDA 1A50A 4PUMA 1EKOA 3EKZA 3A24A 4KCWA 2KX9A 2W4XA 1G67A 4WD0A 4GUHA 2O4MA 2D3LA 2GQ8A 1VPQA 3E3HA 2ZZ2A 1CYGA 4BS0A 1G9HA 1V3IA 2GGEA 1ZBCA 4UQEA 3IVTA 2UV8G 1N7KA 1J01A 4XIAA 4JIEA 5HWMA 3OA3A 3NQVA 3GHSA 2C0AA 1VIZA 1B9BA 3SN4A 2OVLA 1F9CA 2X09A 1J96A 5G4HC 4EF8A 3RFAA 3P62A 2OEMA 1N2VA 1X7FA 2X8RA 3N3MA 1UQZA 5M1TA 4IPPA 4MPQA 4PMRA 1PTAA 3NURA 3BZJA 2XVNA 4EWJA 1DE5A 4IL2A 1WZAA 1R47A 3MZNA 3G0XA 4AX6A 5MKGB 3PZMA 3VMNA 3LI1A 3WH8A 1GKQA 3SUTA 3S5OA 4B15A 4W8LA 1M7JA 4PUEA 3PVFA 4CNTA 1IV8A 2PDBA 2XU2A 1GJUA 3NVDA 2G95A 1JGIA 2LLEA 2P53A 3WLMA 1WKEA 1KGXA 2Y70A 1WDPA 2GUYA 1G94A 3EOUA 1CGXA 1EEPA 2FZDA 2DORA 3BJSA 3WK3A 4ML9A 5AYBA 1EP1A 1GOXA 1O1ZA 2E8YA 5AC4A 5LXXA 3MO7A 2C13A 3QPYA 1F3EA 2ATMA 1QVBA 3QV6A 4HTBA 2YB1A 3F2BA 5EA9A 4HNLA 4JDBA 3GO2A 1IEQA 3N12A 2BWGA 5HNUA 3OVQA 3TROA 4LW7A 1UP2A 2E09A 2YB4A 4H83A 1UC5A 4LAZA 3L4VA 3M0LA 3G24A 4UIOA 4RXFA 3NDOA 3PWAA 3U2EA 1FXQA 4FIRA 5E9XA 3EMZA 2VDGA 1U30A 3EWZA 4M6UA 4G1NA 5FA5A 2NQZA 3B4YA 2ACUA 1R9YA 1EBGA 3PUOA 1TTIA 3F4CA 4YJ5A 3GKFA 1J4EA 3UNDA 1JULA 2Q71A 3SFWA 1D3CA 2Q02A 3MSYA 3WQDA 2BXYA 4IFKB 4EWND 2WPGA 3THAA 3DX5A 5CPLA 2QDDA 3N04A 3B8IA 4BA0A 3PB0A 5EGRA 3VIMA 3HPSA 1E0UA 2FZNA 2BY2A 1TE1A 2V5LA 1FRBA 3CAQA 3T8LA 4UR7A 1UR9A 3NG3A 3SRFA 4TO8A 2QDGA 4EF9A 1YRRA 4LAUA 1A5AA 1XIJA 3ABXA 3CWOX 4DJED 3MCMA 4EPBC 3NCOA 3T4CA 1FP8A 2CZFA 1NQKA 2CZDA 1JR1A 3TMQA 3W1UA 2JKPA 4C5YA 4ML4A 3AMLA 5FCZA 3CZ8A 2G41A 3EB2A 3EX3A 3QGAC 5E6YA 1F6PA 4ZQPA 2HWGA 1WB0A 2W91A 3W1AA 4ZEPA 5CG0A 2GK1A 2P3ZA 1TJ2A 4WR3A 1UA7A 3UZWA 3H2NA 1JQXA 3G3DA 4FR6A 3L2MA 3EBVA 4FOJA 3T0DA 2DFAA 2NUXA 1FWAC 3L68A 4MGGA 3ZVHB 1I1XA 5HINA 1ECQA 1IXQA 1FHVA 1UW9A 1D2KA 4GGBA 3UQNA 1GUVA 7XIMA 1AL8A 1JG9A 3BL3A 3ZSTA 3IVSA 1RQBA 3RR1A 3OIXA 1IEIA 3O0KA 3ZJKA 1MUCA 4GO8A 4NAEA 3VIPA 3N9KA 2G0WA 3LMYA 1OC7A 3VNKA 1THFD 2GJLA 1OFQA 1FUYA 3U9IA 2OELA 4Q8TA 1XLCA 5I3IA 3VO0A 3COTA 3OZYA 2PCQA 1XIEA 5IXEA 2OZ3A 2OKTA 3VOIA 1A80A 5T26A 4IIFA 3ZM8A 2V63A 1OJXA 3LM7A 1XLHA 3IJIA 3VAVA 4LUJA 1GOMA 2DZUA 1H51A 3B8SA 2A7RA 2ZXBA 3A47A 3CL8A 3LX9A 3TZFA 3B06A 3GVWA 3POHA 3DYOA 4FPSA 5AY7A 4DUXA 3G1SA 4UQBA 4WKHA 4ZOBA 2VI0A 4HMNA 4KWVA 4Y9AA 3BAIA 4GFIA 1X1ZA 2BZNA 4M6PA 3DIPA 1XBVA 2PWDA 3FXGA 3NVTA 1R2RA 4UCFA 5AC6A 3TC7A 2DJLA 4CU8A 4A2RA 2O7SA 3PZOA 2JF7A 1R7OA 4MY8A 1Q65A 1GEHA 3WLRA 1PS9A 2WMGA 3TC3A 4BI5A 2G5WA 4M80A 3W6MA 1R30A 1W9PA 2OJPA 5DN1A 1CW2A 3TTYA 3MU7A 1FH8A 3IRDA 2I7GA 1JPMA 1TJ0A 2FQIA 2WO5A 1FQ0A 3ARZA 3UXDA 4FP1A 3O6CA 1Q3NA 3U4AA 3R7MA 1HVQA 1YXDA 5BRBA 5ABFA 5DLCA 4WJEA 3E74A 4DVOA 4C6EA 4ZENA 3DN5A 3EZ4A 2YL9A 2OOFA 4CNPA 5A6MA 3MI3A 2V38A 1XPGA 1TIMA 3P3BA 2NUWA 5FL1A 4NUWA 3R12A 1W9VA 4G7FA 1KBKA 3HMJG 3D6NA 4KESA 1R3WA 4A21A 4BWLC 4US5A 5TF0A 2JGQA 5BXTA 4LBRA 2W6RA 5A2BA 3HOJA 3L5MA 1RD5A 3VZZA 1GEQA 1GVFA 4F0MA 1J0IA 3JZUA 1XF0A 3OGRA 1EBHA 3GZAA 3EOEA 1K8XA 4PFMA 4S3DA 5HUPA 2MUCA 3KTSA 1ONXA 5DF0A 4R3UA 1I0DA 1VB9A 3AS3A 5CH9A 4YLWA 4IPJA 1U5JA 1XL9A 1E15A 3WDIA 1LT7A 1Z42A 3WQFA 1EJWC 1DJHA 4E4PA 2Y63A 2H6RA 2MNRA 4QR6A 5A95A 4FA3A 2PD9A 1T96A 4HMDA 2CBUA 5BCAA 3VM5A 4AYSA 3OYZA 2XIBA 1IGSA 1S5NA 1E0VA 5IHSA 1Q7MA 4NAEB 3V1PA 3DFPA 3MUAA 2ZX7A 2DW6A 3QW3A 3TEVA 1EP3A 1A3HA 3UF9A 3E2RA 1MXGA 2ZZ7A 5C9UA 5AYZA 4AVNA 3JUGA 3PFMA 4K39A 2ZKMX 1OVDA 3RR4A 4AX7A 1EYEA 4CUCA 2ZZ3A 1BSIA 4W89A 3K8LA 3H55A 3B8WA 1IR2A 1ZP4A 1VCFA 3STPA 2H90A 4EACA 5C55A 4J28A 4JGDA 3S9ZA 3ENLA 4LB3A 2J13A 5CG7A 2AKZA 2V69A 2OSYA 2GJPA 1FX6A 4QGCA 2B7NA 3T07A 1H5VA 1P7TA 3RJYA 3TONA 3VDGA 3WQ5A 5BRPA 1EJ7L 2V3FA 4CU6A 1HN1A 1OYCA 3DFYA 1OADA 4JX6A 1H11A 4HA4A 1PWLA 3EDFA 2WMJA 2PF0A 2Y5JA 2ZXDA 5G2WA 3THQA 1B57A 4ZBCA 2DZWA 2IQ0A 4HBKA 3NPUA 5GQBA 3R2GA 3K4WA 5EFDA 4Y7EA 1HNYA 1VAHA 5FEXA 1NP0A 4U3AA 4XD5A 4NP7A 3L4YA 5HNRA 1AW5A 1GPWA 2DVUA 4OHQA 4L6DA 4DELA 1OT2A 1R9ZA 3S5ZA 3ZOAA 3HPFA 5LIKX 4HTYA 2J74A 2WVVB 3VIHA 4GOAA 4QEEA 3PJTA 1N8IA 4H00A 1HO4A 4F2UA 2DVXA 2OYKA 1TPFA 1ZLPA 4GZIA 4PSRA 4NASA 1V51A 1F6YA 3KBWA 3VNYA 3S2NA 3IK4A 4YIWA 4M5PA 4DBUA 3TKFA 4KPLA 2WSQA 3ARTA 1V6WA 2NXIA 1EQPA 4A4AA 2AAAA 4KWUA 4NZ5A 3T4WA 1TTPA 1EH9A 1LQ2A 1Z69A 1CBGA 2E67A 4JN7A 3QMTA 4ROPA 5CPNA 1Q66A 1JRCA 1KGWA 4AZCA 3NR0A 2J7GA 4DJDA 1GTHA 1EX1A 4GNKB 1Q6GA 3B9DA 1E6QM 3VKCA 1GZJA 4L6OA 4XD3A 5HXMA 2CPUA 1P6WA 3VKAA 4YTUA 1UWIA 3E0LA 1HFBA 2OB3A 1E6NA 4UFJA 3SUVA 3TLQA 3AXMA 1PX4A 4UMCA 2PDLA 2QGYA 3EX6A 3OLEA 3TJXA 4ORIA 5GNXA 3QM3A 2GWGA 5CBJA 3TSDA 4HNNA 2ZA3A 3G3MA 5IDIA 4FOUA 2DIEA 3JZEA 2E1DA 2ZUUA 1H60A 1FVPA 3RXZA 3VX0A 1E6ZA 1DJXA 1UP0A 5AB3A 3P5YA 4DJDC 3MHGA 3SEPA 2OLAA 4IJBA 3CAWA 3AWOA 1H09A 1VZWA 1BWLA 3HQNA 1OFOA 2QCMA 1XIMA 3EKLA 3KOZA 3KHDA 2NV2A 1KV8A 2PDWA 2GGIA 4DZIA 1U1HA 3B8VA 2J66A 1AK5A 4AIUA 3W37A 2PC4A 4ERIA 1C92A 1UWAA 3VD7A 3AMKA 1EO7A 3OIHA 3PPFA 4N7QA 3FFSA 3S8HA 3L7RA 2GJXA 1EB3A 2ON3A 1PHQA 9XIMA 4P8WA 3IV8A 2L5HA 5C71A 1KCXA 1FH9A 1VFUA 3GXDA 4US6A 1W91A 2P76A 4Y90A 3L2LA 4EAYA 5LIXX 1AFSA 4GK8A 1RCXB 3BWWA 3NZRA 3BOXA 3MI2A 3DFOA 4QJ1A 4H6KA 1RVKA 2VENA 4AB4A 3JR2A 1TMLA 3EX2A 2QCFA 4AXNA 1FDJA 3PZQA 4JQAA 3KS6A 3W74A 3R79A 4LCSA 2Z0IA 4AVOA 3AYRA 4S3EA 4UXDA 4PUKA 3GNRA 2QEZA 1QW7A 3AHTA 2E9BA 3LY0A 2BNJA 3GFZA 3QC0A 4LUSA 4CCEA 4OUIA 2XGIA 1E1FA 1VR6A 2Z29A 2Z1VA 3KOWA 2ISSA 1S1PA 2EGZA 2OEJA 3WQVA 4PN2A 3FEQA 5M2FX 4RK8A 4UR8A 2Q8ZA 4B5XA 1PX8A 4PSPA 1X1NA 3AHVA 3ITOA 5DX7A 3WLJA 2CLFA 1TMHA 4F66A 3FOKA 3AZSA 3CUHA 2XN1A 9RUBA 3WF3A 1B3YA 4L7ZA 2XDFA 3P61A 2FHFA 1TV2A 4JX5A 4NZCA 5F1UA 2IW0A 3KS5A 1E3XA 1PJ9A 1DIEA 3GKAA 1B90A 4K8GA 3B97A 4A2SA 4S38A 2NT1A 4AUBA 4H04A 3V35A 3AIRA 2NSXA 3RRXA 1W5OA 4JTFA 4FB7A 4O16A 4HNOA 4M1RA 5I3GA 5LNUA 3O15A 2HPIA 5FI8A 3GNPA 1HXJA 4UQCA 4IH3A 3LU2A 2QJHA 4UFLA 5CPSA 3PJUA 2V68A 1OC6A 4OE7A 4NJIA 1V02E 2AMXA 4ATLA 3VNDA 1W9BM 2VL4A 4RE0A 4IX2A 1KFBA 2ZICA 3OP2A 1GNXA 1J12A 2PDJA 4AXKA 4IHCA 1GOKA 4RUBA 1I45A 1RY0A 4HK7A 3LUTA 2A2IA 3U5YA 3CS2A 4QM1A 1I2NA 1ZCOA 1EZ2A 3QVQA 3MWCA 4DZAA 1BRLB 2I9EA 2JIEA 3O2LA 1QNOA 5BW6A 4I5XA 4XUYA 2QJIA 1TWDA 1YDYA 4Q8OA 4WF7A 4NYUA 1EIBA 4QSFA 4K7YA 2FIQA 1IEXA 3W53A 2P8CA 2DP3A 1XUUA 1ZZMA 1V6XA 4C91A 1FOBA 4IMCA 4TTGA 4C7DA 1EIXA 1YNPA 1MWOA 4N9EA 1GGOA 3WQPA 1GVSA 4QDPA 4JQ4A 2VURA 4I9JA 1CGTA 1DXIA 4YYCA 4U10A 3GG7A 3E0FA 2J77A 3KHJA 1WCGA 2ZZ5A 2VP8A 3IIZA 4X0NA 5JBEA 1OYBA 2PSNA 5ABHA 1VS1A 1XSJA 3NNTA 4WEVX 3LQLA 3VD9A 2YCLA 1XINA 1ML1A 4JKKA 2WWDA 2Z00A 2WCAA 2WC7A 2Y8KA 4U5KA 3UR8A 3L67A 4KERA 4XWUA 2XM2A 1HKKA 4B2DD 2G37A 1V3HA 2IPGA 5HMDA 1KM6A 5IRPA 1A47A 1XBXA 3OGSA 4ICMA 2QDHA 2PI6A 3ONBA 4FO4A 4TX8A 2J7BA 1HL2A 5FJOA 4MZ1A 5FJUA 4IGMA 4O18A 1JF5A 3AXKA 3ITGA 1OT1A 2VGBA 3NO5A 2ZE3A 1FHLA 3HQPA 4AISA 3QHMA 2CESA 5JXQA 4GUIA 4BI6A 3AICA 4WCJA 2A7PA 3P2VA 1WBHA 1TV8A 2XZ7A 3ZJ8A 4QSHA 3PSVA 3M0KA 4J3VA 3R89A 1XWYA 4UNLA 3B03A 4CEXC 4WGXA 3QZ6A 5JMUA 1A0DA 1G01A 2J9XA 1C7SA 2OWXA 2QULA 3LERA 1U5VA 2Y62A 5CBBA 3VFLA 1MQPA 2D0HA 1DIOA 4XZHA 3QMRA 1OIFA 2Y2WA 3GHRA 4LNCA 3SCPA 3HZ3A 3DYMA 3EA2A 4V33A 4NILA 4S3JA 4S3KA 1OABA 4Q6XA 3AUOA 2E4TA 4KEMA 1XYLA 3TQVA 5I06A 2A7NA 5HJYA 1UWSA 2XIJA 1J18A 4TUFA 2XTKA 3T78A 1P1MA 1Q6CA 1E9IA 3TC6A 5RUBA 1JZ7A 3EOOA 1RALA 4HPHA 3VNLA 1TWIA 3HV8A 1MEWA 4C1NB 3M0HA 4JCLA 3FJLA 1RCOB 3WQ8A 2FLIA 3KBJA 5G1MA 2DH3A 4A8LA 4C6FA 1P1XA 2XFFA 3GRIA 3B9NA 2ZUMA 3W1MA 1UKOA 4DJEA 2GPTA 3IVUA 3V7PA 2W62A 1C91A 2OO0A 1W9UA 4LEQA 1JDFA 1RV8A 4ZR8A 5LNWA 2YYUA 1KCLA 3OBEA 1IWBA 4KF1A 1JD9A 3MSGA 3ZYZA 2ZX8A 4E8GA 1D7FA 2WSKA 1V0LA 1TTQA 1LDCA 2PA6A 1SO6A 3BH4A 1E6RA 3I7RA 1T99A 2Y1HA 4XAPA 3MBDA 2P1FA 3FLUA 1N82A 1RK5A 4RNHA 3W84A 4H6QA 4CD7A 4DX3A 2E9LA 4AIEA 3MV01 2C71A 3S4TA 4N4QA 4JPGA 4LV9A 3D47A 4GCAA 4DEFA 5EB8A 4LS1A 1EJVC 1LT8A 4CCZA 3F2CA 3CM4A 4EE9A 4QITA 3AXHA