4E38A

Crystal structure of probable keto-hydroxyglutarate-aldolase from vibrionales bacterium swat-3 (target efi-502156)
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
213
structure length
213
Chain Sequence
FQSMMSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSDAAVEAIRLLRQAQPEMLIGAGTILNGEQALAAKEAGATFVVSPGFNPNTVRACQEIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMVKSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLVTNGEWDEIARLTREIVEQVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of probable keto-hydroxyglutarate-aldolase from Vibrionales bacterium SWAT-3 (Target EFI-502156)
rcsb
source organism Vibrionales bacterium swat-3
molecule tags Lyase
molecule keywords Keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate a
total genus 78
structure length 213
sequence length 213
chains with identical sequence B, C
ec nomenclature ec 4.1.3.16: 4-hydroxy-2-oxoglutarate aldolase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01081 Aldolase KDPG and KHG aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4e38A00
4UNLA 3EX1A 1SO3A 1G7VA 4JR5A 4CQ9A 3TIMA 1GOXA 4UR7A 1V7YA 3MMTA 3W75A 1D9EA 3B0PA 3OVPA 3P82A 3W22A 1K3UA 3TE9A 3C4UA 3RNDA 4K6AA 1G4PA 3AJXA 5HNRA 4AXKA 1UJPA 5KZDA 2Y7EA 5CPNA 5T26A 2ATMA 3IV3A 4QAIA 1FQ0A 3GKAA 1IXPA 2ZA1A 2ZDRA 3NL3A 2ISVA 4L4LA 1SFJA 4HSOA 1OK4A 5AHLA 3A23A 1XM3A 1OHLA 1TIMA 4UCGA 3I7SA 5FEXA 4NXSA 1KFKA 1RVGA 4MPQA 1PV8A 4M6PA 1HO1A 1XUZA 2B4GA 4LVFA 1X8FA 3NOEA 3RLVA 3P67A 5EBUA 1P0NA 1EX5A 1D3HA 3G18A 4JNMA 3LM7A 5E1QA 1OFQA 5AFDA 2AGKA 4UTWA 3DH7A 1VH7A 3N73A 2QCDB 3GYEA 1ICSA 3GAYA 5FEZA 1GYNA 1O5KA 4AHOA 1I2PA 3ATYA 1ZFJA 4XBKA 2JGQA 2VFFA 4NQ1A 5LHEA 4UTLA 4AF0A 5D04C 1X1OA 3NQDA 1SQ7A 3O15A 3FFSA 3WJWA 3NDOA 1FCBA 4UTHA 3UZ5A 3OG3A 3Q37A 3TSDA 2H3BA 4NJIA 1TCDA 3UXDA 5K3VA 4UTTA 4O1AA 1YTEA 2Z6IA 3CEUA 3IIOA 3TXZA 4IPIA 5CKSA 4JN6A 3LV5A 3O8AA 3W85A 3C2OA 2VC6A 3EWXA 2E5BA 2CU0A 4NZJA 5G4EA 5KTLA 2B0MA 3INPA 4WD0A 1DBTA 1TQXA 1Y0EA 1SZGA 1S3HA 3QH2A 1TJRA 2FPTA 4NJJA 3BPWA 3C52A 2CLEA 3GX9A 4O12A 2ISWA 3LGEA 1R46A 1LORA 1G7UA 4DBEA 3T7VA 2FPVA 3GKFA 4IMEA 2ZRUA 4I7VA 4AVFA 2D73A 3HOJA 4O0KA 2YW3A 3L0KA 3UYCA 3DENA 5TBOA 1KBIA 2TSYA 4GE8A 2Z1BA 1I8JA 1EIXA 1O4UA 1DQXA 3W1XA 1W37A 3WK2A 4JDBA 3S6DA 2ZYFA 1QFEA 1LP6A 4AF0B 1MZHA 3OIXA 3UY7A 2I9EA 3GDLA 3IEBA 3G1DA 1FWTA 4MYXA 3S5OA 1AMKA 3LHWA 4NXKA 1H7NA 1LLWA 2FJKA 5K9CA 1EWEA 2QAFA 2FDSA 4AWSA 3W23A 1F2JA 4LRSA 3W7NA 1H1YA 4U28A 4FF7A 4JTJA 4OQVA 4I9AA 3TR2A 3BLIA 1Z42A 2WNQA 4ZL1A 1VHCA 4LY8A 3TDFA 5DY3A 2FQIA 1OVDA 3OBKA 1WX0A 5HINA 2YDAA 2X16A 1LROA 3MBDA 3TSBA 1QO2A 3MYOA 1YDOA 4A2SA 4UMBA 3W07A 3SZ8A 1FDYA 1ALDA 4UFLA 3M5XA 2C14A 3W2LA 4BI6A 3G22A 3IIZA 1SPQA 4QQ3A 3QM3A 4LS2A 1KFCA 1WDWA 1XI3A 4LUIA 4RV8A 5AC8A 5CZSA 3B04A 3O6YX 5AC7A 3S42A 2E6AA 4FO4A 4C1KA 2CZ5A 3N9RA 3G1VA 2C15A 2PC4A 3ELFA 1ONRA 3EB2A 1KM1A 1XDLA 4JIQA 5LNSA 2E09A 3MI6A 4M19A 1X6UA 8TIMA 3ABOA 1S5WA 2J9ZA 2VENA 4BWLC 4ADTA 3GIYA 2Y7GA 3WJYA 1SO5A 2AAMA 1EWDA 2XFWA 1NSJA 3WK0A 3NPVA 2O7SA 3ABSA 4M6VA 1O60A 1OF8A 2YZRA 3SGZA 3B05A 4YCOA 3HPZA 4ADUA 1TRIA 4UTJA 5F4SA 1TPC1 2VFEA 3PB2A 4JTTA 3O06A 4O10A 1JCMP 1JCNA 1KFLA 3QRHA 1TJPA 1OG0A 3QQ0A 2QR6A 1A5CA 1DKWA 3GNDA 3B0UX 3HPXA 1TTPA 1TPDA 1VYPX 5DELA 2KZHA 1SSGA 3NA8A 3W7PA 4XWUA 3EX3A 3HBLA 3R2GA 5G4WA 1VCVA 1YTKA 1JQXA 3DGRA 5D2YA 3S8HA 1WAUA 1W5MA 1W56A 4UUIA 3T78A 1FWSA 3W9ZA 2GVLA 3BG5A 1KLZA 2GOUA 1IXNA 2NV1A 3BGGA 2H8XA 3SR7A 4TIMA 1SUXA 5G2IA 1JR1A 1OYCA 3N14A 3S1XA 1OJXA 1SR9A 1W1ZA 4YLWA 5DXXA 1FCQA 2V9DA 1CX9A 1TRDA 2XN2A 3LTYA 5CGQA 2DORA 5AHFA 3C6CA 5K9DA 4HPXA 3MJYA 5ABTA 3LTPA 3P61A 3TA6A 1ADOA 1G6CA 4BFAA 3CT7A 4ZQRA 2VFDA 5TQLA 2EPHA 1VZWA 2FB2A 1W0MA 3PG8A 1XKYA 1NF7A 5J5DA 3WK1A 3C56A 1IXQA 4K7YA 3LBCA 3S1VA 4WUIA 4IUOA 2ZZ4A 4OHQA 4JX4A 1X7FA 2QCLA 5D05A 3M41A 3BW4A 3KVLA 1LOSA 1UCWA 1KTCA 1XBXA 4NNAA 3GR8A 3FJLA 5K4ZA 5DBTA 2G95A 3GDMA 3G0SA 3KRZA 2E1DA 3CQ0A 2UV8G 2WSYA 1Q6RA 1H7XA 2B7OA 4ZQNA 1Z44A 3W1MA 3GDKA 1VYRA 4X3ZA 5FEPA 2QCMA 3E9AA 3L67A 4IMGA 3IIVA 3QMRA 2QCGA 4XKYA 3M5VA 5DLCA 2JGYA 1L2UA 3STCA 3L66A 2CWNA 3NAVA 4MZYA 5HWJA 1QPOA 3PUEA 1R2SA 4XBSA 2QAPA 3RFAA 2E5CA 2J27A 1ZAIA 1VYSX 5AC6A 3C2FA 5CPOA 2A6NA 2C3ZA 2DZWA 1JVNA 5F2LA 3CEPA 1OYAA 1AL8A 2ZFAA 5FF4A 3UWYA 3TSMA 3P5YA 3KRUA 3NQVA 2YYUA 1LBLA 4O16A 3NO5A 5EY5A 3O16A 4NJGA 3ABQA 3UQNA 2FLIA 2H3DA 3EKLA 5LNRA 3QQ1A 3VFLA 3F4NA 3DFOA 1F76A 3F1QA 3MW7A 1C29A 3HG5A 1BWKA 4NX0A 4RKAA 1EP1A 1HO4A 5HWNA 4JS3A 4LOCA 4MY9A 2EHHA 4POCA 3W1PA 4IX0A 5LHFA 3NQ2A 1UASA 3P81A 2P10A 1F05A 2X1TA 3M7WA 3PBWA 5I3HA 3QMTA 2V5LA 3DKJA 1B57A 2RDUA 2BTMA 4M7TA 3BV4A 3QW4B 3EXRA 3W7MA 2ZZ2A 2B7QA 4HKPA 4LVGA 4PEKA 3F4WA 3QF0A 2JKEA 4NU7A 4UFHA 3UWVA 1YADA 3W86A 2A7PA 4Z1CA 2PRLA 1DOSA 3NQMA 3NR0A 5AYXA 1WBHA 1O95A 3O6CA 1QPQA 3A9IA 2YFOA 1H7OA 3MBFA 1VGAA 1OX4A 3VE7A 3TC6A 3WJZA 3L5AA 3NG3A 4FX7A 4NX5A 5D2XA 1TTQA 1DJQA 3P62A 1WA3A 4GUJA 3LHTA 4MZ8A 4MFEA 2I1OA 3NL2A 3MHUA 3CIXA 4QIUA 3UZJA 3E02A 1OFAA 4YMZA 3MUXA 1HTIA 3QFEA 2VELA 1JCXA 5D2VA 4LT9A 4Z1BA 2NX3A 1OX6A 4S1FA 3L9CA 2ZA3A 5U7SA 2OT1A 4K37A 5EPDA 3TW6A 4CCEA 4JYDA 4O4WA 3BW3A 4PA8A 3N34A 3FLUA 3S1WA 4JTFA 5EMUA 2ZZ3A 3LCWA 4JTEA 3ZR4A 3LXAA 1Q3NA 1IGSA 3QEZA 3IGUA 5I3IA 5HR6A 2VEMA 3QYQA 3T44A 3WFAA 3O07A 2V8ZA 4FX6M 3TH6A 3LCFA 1KV5A 2BSLA 5D32A 1LOQA 4CNOA 3PB0A 2BXVA 4N4PA 1P1XA 2OX1A 2ABBA 3NQAA 1K8YA 5D02A 1KA9F 3RK8A 4DO4A 1QOPA 4PL2A 1PHQA 1SFLA 3LX9A 5AYZA 2PURA 4D2JA 1B4KA 1QAPA 5D2WA 2HS8A 2R94A 3GDTA 5L6UA 1TSIA 3N2XA 4TMCA 1KW1A 3MI2A 4IPJA 3R5EA 4MKNA 4O13A 2Z0IA 3NPWA 4FNSA 5D30A 3W1NA 4IWWA 4TMBA 1J2WA 1R2TA 4MOZA 1ME9A 4BWLA 3TQ0A 5DXYA 3H55A 3DHDA 5BW6A 1FX6A 2VFHA 3W7GA 1QR7A 3DI0A 5BOOA 1OFPA 4Y8FA 1HG3A 4ZVJA 2YW4A 1GZGA 2RH9A 2Z6JA 4EOUA 2QEZA 5HJLA 2J9YA 1TPB1 3PSVA 1PHWA 2DJXA 3UD6A 2DZVA 1DHPA 3ANYA 2V0TA 3QMSA 4CCDA 4DQWA 2ZZ7A 1QNVA 5D38A 3BVJA 2NUXA 3W87A 4ZZ9A 2G96A 3W1LA 1DORA 3KOFA 3C2VA 2A7NA 3HGOA 1F6PA 4R7JA 3HG3A 3S0CA 1VLIA 1H1ZA 2Y63A 3PBYA 1GJPA 3W76A 1Z48A 3THAA 3M0ZA 4DF1A 2BX7A 3B4UA 2V30A 1GG1A 3PUOA 1WV2A 3E0IA 4Y6GA 2ISSA 2NZLA 2R14A 2Y6ZA 3LCHA 4O28A 3MHFA 2FB3A 4P61A 3HPSA 5BRBA 2E6YA 2DU2A 5AYYA 4BI5A 1BTMA 1FCVA 2ZRVA 1OX4B 3NQEA 2YFNA 4IXXA 1W31A 3HG2A 4NVTA 5FF2A 1GWJA 3SFKA 3A5FA 2JBMA 3PR2A 2QJHA 3G8EA 1I2RA 1FXQA 3ATZA 4UIOA 4GBUA 3W1AA 5AHIA 3KVJA 4LVDA 5FF0A 4PODA 3CLMA 3EX2A 2BLEA 2Q3OA 3GVGA 1T0OA 4X9SA 4JDYA 1JUBA 1K02A 4KFNA 3LXBA 4BK9A 1UUMA 5I3GA 3NL6A 1FDZA 3TAOA 1K7XA 3W7QA 2V81A 2QCEA 2ZRXA 2ZZ5A 4EIVA 3UPBA 3CB8A 1LDCA 4S2BA 4JIPA 1LZOA 4ZMGA 5D03A 1I4NA 1T8XA 2NXGA 1A5AA 3W73A 1G4TA 1J5TA 3P60A 3I7QA 3L0NA 1MO0A 4HNUA 1SSDA 1YDVA 2ZQ0A 4FNQA 1R47A 5LSMA 1F6KA 4MLRA 1H7WA 2QCCA 1SW7A 4ML9A 4O57A 1KM6A 4PH6A 2VFGA 1SZEA 1K7FA 2NV2A 3LB0A 1Q6OA 2BWGA 3MHGA 4HSNA 3SW6A 2EKCA 3SJ3A 3I68A 3MWAA 3TQKA 2RKXA 3TKFA 4ZQPA 4OE7A 5G2HA 5F2IA 5A5WA 3PBVA 2QCFA 1XBZA 1ZNNA 3G0XA 2CLFA 2ZTKA 4WJEA 1TV5A 1T96A 5K9XA 1FY6A 3N3MA 4JXCA 1F5ZA 1M5WA 3Q2DA 3W6YA 4RZ5A 4N2YA 3C8FA 3EXSA 2VOMA 3AO0A 4ORMA 4KKXA 2A1YA 1ICPA 1AW2A 2CLMA 3QW3A 5I3KA 5FI8A 3TMLA 1BKSA 2TYSA 3W2UA 1KBJA 2QCHA 3GNNA 2NWRA 1VS1A 3OHIA 2G5WA 1ZHAA 2C18A 2XN0A 1GVSA 1VCFA 2DZTA 2J88A 3JR2A 1DQWA 4GUGA 2Y7DA 2NX1A 1GEQA 1B9BA 1TV7A 4YL2A 4AHPA 5D37A 2E77A 3HGRA 1JCJA 1O94A 3EKZA 2QUVA 4ONVA 2CLOA 3NEVA 4N9EA 3CU2A 4H4IA 4EF8A 2GJLA 4JGDA 3ABRA 1XUUA 1CI1A 1FXPA 1H51A 1XDMA 4UFIA 2JKAA 3BG9A 3C2RA 3EX6A 4CNPA 3R13A 3A22A 2TPSA 5LGZA 1YDNA 1NFBA 5EL1A 3S5YA 1MXSA 4IXHA 3W7CA 3VKJA 3GAKA 1HFBA 3B0VC 3QZEA 4WXZA 1G67A 5LNWA 3A24A 4E2BA 3QSRA 2P1FA 4ICNA 4OV4A 3PBUA 1GVFA 4AEOA 4EVZA 3G3MA 5K7JA 1TPVA 2DP3A 2Y88A 4JTGA 3BK0A 2C19A 2Y85A 3NQCA 1DJNA 4LVBA 4O15A 4O18A 4GUHA 2CZEA 1TMHA 3PG9A 3WJSA 3I7RA 1ZAJA 4AWTA 1RD5A 4YCPA 2DZXA 2EAWA 3C61A 4K36A 3TMQA 5MHBA 1PIIA 2BZNA 1V5XA 4Y90A 3GDRA 1H61A 1BEUA 3CWNA 2V2DA 3DFNA 5F4XA 4UTMA 2NUWA 5C54A 5DCDA 4ZQOA 1PVNA 4FNTA 2V5BA 4O8RA 5DN1A 1TO3A 1Z41A 3I65A 1Q6QA 2Q8ZA 3NNTA 5E93A 3W84A 3D0CA 4WY0A 3FYOA 3L21A 3W7IA 2WNZA 2B7NA 1F74A 4R34A 5LZLA 3HG4A 4QJ1A 4QNWA 4Z08A 3G1XA 3MP4A 1H7RA 1JCLA 2R91A 2TMDA 4AH7A 4O52A 4PFMA 1VRDA 3F03K 4ALDA 4GC4A 4LWWA 1R30A 3KRSA 1VJIA 3LI0A 5C5YA 1AW5A 1K8ZA 4DEFA 4N02A 1A50A 1N7KA 4UTKA 2B7PA 3G8RA 4KWWA 3HF3A 4WXYA 2YR1A 4J9JA 1TREA 1FUYA 4HNVA 1LCOA 1TTJA 3TNOA 1QPRA 4X22A 2E5DA 4EF9A 3R8RA 1L6SA 1HL2A 2OMAA 3WK3A 1H5YA 4NZFA 4LW7A 1YPIA 2RHGA 4AWUA 5H2ZA 3W2MA 4E0CA 4IJBA 1I45A 2FIQA 3NL5A 4DO5A 1KM3A 1QDSA 4HNTA 3MI3A 3LHZA 2WKJA 1KFBA 3N9SA 1ZJIA 2QKFA 4O1BA 1OFEA 3IGXA 3HGSA 5IBXA 4A2RA 4GNJA 1ZY9A 4K38A 4UXDA 2CFFA 3W1RA 1VHNA 1XBVA 5F2GA 1ML1A 3M6YA 3OEXA 4YXGA 4O14A 3LOTA 4NT0A 1F7BA 3HMJG 4I7UA 1K8XA 3PWAA 4LVAA 4JTUA 3WJXA 1U5JA 2OJPA 2X2GA 1KM2A 3TROA 5LGXA 4MY8A 4JTKA 5BMXA 4JTIA 1FDJA 1S5TA 3E96A 3LRKA 4CCCA 1KFJA 3N2MA 4QITA 3FS2A 4LUJA 1QMLA 4N9DA 3USBA 1PE1A 2I14A 3K30A 2VEKA 3GK0A 4OT7A 4RR4A 4B5NA 3T40A 2YCEA 3GXTA 1LRQA 4PCFA 1SO6A 5LNUA 3O1NA 4IGHA 3TCEA 1F73A 2VEIA 4S2CA 1EPXA 3TJXA 3W7JA 3W71A 4KFPA 4XZ9A 4FIRA 1A5SA 3C3NA 3O63A 4JTHA 1NF0A 1OFBA 5F1UA 1BWLA 2C6QA 3W70A 3SSJA 1H63A 4CQ8A 2R8WA 3DKLA 4UC5A 3TFCA 2GQAA 4QNEA 2QCNA 3FYPA 3IVTA 3TK7A 3GR7A 1H62A 4MYAA 3LHUA 3W7OA 4HN4A 3V75A 4FNRA 4CLMA 1SZNA 2DZUA 2C13A 3YPIA 4HT3A 2Z2UA 3U8GA 4W9TA 3R89A 5H91A 5AHNA 5G1TA 1MEIA 5FESA 2A21A 2GPTA 3EWWA 1EP2A 3Q94A 4JTLA 3KXQA 4MY1A 2E6FA 3QC3A 3IIPA 2NXHA 4WX2A 1JRBA 4UTIA 5K2ZA 5AHMA 4H3DA 2A7RA 3FA5A 3N19B 4MLJA 3M44A 3VE9A 4DXVA 2E6DA 2VEPA 1VCGA 2JKPA 1LRNA 2EGZA 2V2CA 3BGJA 3G1YA 2NUYA 3DFSA 4DELA 4RK8A 4LU0A 3SY5A 1PCKA 1VLWA 5HMSA 1P5BA 3P7YA 3W1TA 1RV8A 2EF9A 4QSHA 1W8SA 4TR9A 1TQJA 1KM0A 2C16A 3H54A 4U4MA 4RCXA 5HQEA 3LCXA 4O53A 5D33A 5E0KA 1QCWA 5F4WA 3LI1A 3R12A 4FXSA 2CZFA 1OFRA 4MFDA 4MZ1A 4RJEA 4M7SA 4GFSA 5K4XA 3HIJA 1UBSA 4OBTA 1GVOA 4LNYA 3TU9A 2VXNA 4RZ4A 2TRSA 4A3UA 1DL3A 3NXFA 3S1UA 2NX9A 2YPIA 3TQVA 3B8DA 1FWNA 1KLYA 5KSWA 1UB3A 3G1SA 4JX5A 2GUUA 2ABAA 1QWGA 2J9XA 1WQ5A 3W7RA 4ORIA 3FOKA 3KVKA 3PULA 3NPUA 1GVRA 4IMDA 1LYXA 4LRTA 1B4EA 4X2RA 1QOQA 4N6FA 1K03A 2CLHA 4UMAA 5LNVA 1TTIA 4GXMA 3PVFA 4JY8A 1XCFA 1NVMA 4Q33A 4YWIA 3SGUA 3KAOA 1T99A 3A21A 1W5QA 3DU0A 4M5PA 4UFMA 4UMCA 4FXRA 2QJGA 3CTLA 4WOZA 3W2NA 3ZWTA 3KX6A 2WQPA 4DF2A 4IOTA 2QUUA 4KWVA 2ZRWA 4DBDA 1D3GA 4OGZA 5HUOA 3RF9A 1YTDA 4AMAA 3FIGA 2OZ0A 1I2QA 4N4QA 2HSAA 4LV4A 1U83A 5HULA 2A4AA 2PRHA 2QDGA 1XFBA 3KHJA 3STEA 1I2NA 1W5OA 4BF9A 4HNNA 4O0ZA 3W3OA 4JYFA 3PF3A 1JRCA 2RDTA 2P0OA 3JRKA 1PS9A 2YX0A 3MO7A 2Y62A 5DY2A 1SZFA 1W54A 3W74A 4Z1DA 1RPXA 5KMYA 2WSRA 1YLVA 2H6RA 4NJHA 4IMCA 4JY9A 5HUPA 5KITA 3NVTA 1IIGA 3BG3A 5CPMA 3KFTA 2QDHA 1UUOA 1FWWA 1OYBA 1HUVA 3PUDA 4N9CA 4ADSA 2OT0A 1E51A 2GQ9A 1EA0A 4Y96A 1Q45A 2IQTA 2J24A 4ZQCA 1A53A 1KTNA 2HMCA 4O17A 4WZHA 4IX2A 1RQEA 3W72A 1O5XA 2VKZG 2Q3RA 1EUNA 2YGYA 3LRLA 3T55A 3P8JA 5FF3A 4XTDA 3TJLA 1H60A 4H6KA 7TIMA 3P80A 3W1QA 3CHVA 3DFQA 3ZS4A 3ZFHA 4O1DA 3LDVA 4O50A 1WOAA 5SWUA 4TO8A 1R2RA 5EA9A 3L5LA 4RLIA 4HIBA 3VNDA 2RDWA 4P2VA 4XUGA 1LRTA 2W0UA 1G69A 4JICA 2QUTA 3G1HA 3OVQA 2FTPA 4XTIA 2YSWA 1K7EA 1YXYA 1LM1A 2E68A 4RXGA 4QM1A 2YYTA 1IF2A 1I2OA 1NEYA 3GLCA 3PC0A 3G1AA 3M43A 4GWEA 3U6WA 2A5HA 4UTUA 5FEWA 4Z1AA 1LTDA 1W5PA 3L65A 2G97A 3O6DA 1P0KA 5DCBA 1WOBA 2X1UA 4MJMA 3RLUA 3LCLA 2CLIA 1GTHA 3QSTA 2V82A 1S5VA 3W83A 2ZTJA 4XQ6A 4O11A 5EYWA 5TIMA 3ZWSA 2A2IA 3W2JA 4DPPA 1LBMA 4OU1A 5CZTA 1GT8A 2V2HA 5HR7A 1SO4A 3A5VA 1SU5A 3FKKA 3NZRA 2DZSA 5AOUA 4UFJA 3TFXA 2DJLA 4K7VA 3W7EA 4GJ1A 1VQTA 3W1UA 3W88A 4NJKA 2QF7A 4WY0B 3NYZA 2O7QA 3NZ1A 4RX0A 3BLEA 3E12A 3NM1A 2JK2A 2J6XA 4A21A 1TPEA 3JS3A 3OVRA 3S9YA 4JTSA 4JYEA 4RZ6A 1MEHA 2CLKA 1PCWA 1N8FA 1Q6LA 5FF7A 3TAKA 1MSSA 1EB3A 3HJZA 5CSSA 2H8ZA 1GTEA 4LC8A 1THFD 3W7KA 2QJIA 4I7WA 4MIMA 1W3TA 3GXNA 2WOQA 3L5MA 2RFGA 3IVSA 3LTSA 5DBUA 3HGJA 3O05A 5C6MA 4WOQA 5G5IA 1TV8A 3M47A 4A29A 1ZAHA 1M7PA 3SIZA 1A5BA 1ZCOA 2ZZ1A 4K39A 3VI2A 1OX5A 3NPXA 1VC4A 3DFTA 1C9DA 5G2WA 3P84A 1J4EA 3P74A 4OWGA 3W7DA 4IMFA 4BI7A 4FX8A 5CZJA 1W3IA 4GUIA 1ICQA 1JULA 1C8VA 1M6JA 4FNPA 2A6LA 4NNCA 4HPJA 1ME8A 4UTTC 4FB7A 3UWWA 5F2MA 3EEGA 1YYAA 5BMWA 3W7HA 5L9FA 2GVJA 1W3NA 5IBXC 1ZALA 3I6RA 1XXXA 4QISA 4Z0SA 1TPUA 4PTNA 3HO8A 4NNBA 2HS6A 3NQFA 1EEPA 3LXCA 2OCZA 3PAJA 2VFIA 5KINA 4MJZA 1GQNA 3SI9A 3V1PA 5U4NA 2WSQA 4WQ6A 2PRMA 1EUAA 4O19A 1YPFA 2ALDA 2CW6A 2Q8LA 1GPWA 1OF6A 2CZDA 3DAQA 4Y9AA 3EWZA 3G3DA 4DO6A 4OV9A 3TUUA 2GQ8A 2X1RA 1DVJA 2CLLA 3L2IA 1OABA 1ME7A 5CSRA 1DV7A 1KTBA 4XKYB 3CIWA 1OFDA 3UXAA 4HHPA 5AHEA 4AAJA 3CM4A 5J5RA 3FEMA 4AB4A 5I3JA 3NQ7A 1FBAA 3GB6A 3UWZA 3LCIA 1N55A 1JJKA 2FFCA 4M6QA 3BLFA 4WY0F 4DPQA 2F84A 4LC6A 3DI1A 1VR6A 1WXJA 4UFKA 3TV8A 3OA3A 1B3OA 2W6RA 4BR1A 3GXPA 2GVGA 3NGJA 1LLZA 1H7PA 3M9YA 3BARA 3LRMA 3U2OA 3NM3A 4KFOA 1YXDA 1EP3A 5F1VA 3L0GA 3STFA 2PE4A 2FPYA 6TIMA 1QPNA 3EWUA 3FJ6A 1W5NA 4LS0A 3RU6A 4IQLA 2XN1A 3LHVA 1ZENA 2ZRZA 2ZZ6A 3IIXA 1KM5A 1OFOA 1RR2A 1TPH1 3C0JA 4C1LA 3EWYA 5BNKA 3B03A 1M7OA 4O1CA 3M5ZA 3HQ1A 4A22A 3IVUA 4L4MA 4Q4KA 5LKYA 3CWOX 2C1HA 1SW0A 4ZQMA 5AB3A 2PCQA 3M1ZA 2WV8A 2ZRYA 1JQVA 2NWSA 3PS7A 3QJAA 4Z0JA 1NAL1 3TX9A 1GVQA 3TW7A 4JD4A 4GRSA 2WJZA 2YXGA 3STGA 2A85A 1GYLA 4R33A 4CNNA 1AL7A 3P5ZA 5DCEA 3G24A 6ALDA 3RMJA 4LS1A 2GJNA 1OK6A 5G1YA 1TPFA 3TXVA 1IIHA 5I3FA 1L6WA 4MUZA 4PL1A 1TB3A 4EWND 3UWQA 1LOLA 1PL9A 2Y89A 3G0UA 4GUFA 3M16A 4NUWA 1G4SA 1L9WA 4LTSA 3PSWA 5C55A 1CW2A 4UNKA 2ATSA 3MP3A 1GG0A 1KV8A 3CC1A 1SW3A 1VPXA 3LV6A 2H90A 1TYGA 3P8IA 3DXIA 4UTWC 2AQWA 2X1SA 1G4EA 1L6YA 3BO9A 3EWBX 2Y7FA 3G1FA 3M5YA 1P4CA 5IM51 1IXOA 4R53A 3W7LA 1LBFA 1RQBA 1XBYA 1RQHA 2X30A 3QPZA 2W79A 3W2KA 4TX9A 1RZMA 2ZBTA 1FCUA 2Y70A 3LLFA 3UNDA 3UWUA 5KZEA 5CZ0A 2DZPA 2LLEA 4N9BA 4AHQA 3UPWA 2C0AA 3DFPA 3THQA 4JX6A 3VCRA 3EX4A 4MVAA 3Q58A 4FEZA 4O4VA 1FWRA 4Q32A 3E49A 3S5NA 5D2TA 4TU1A 3GZ3A 5A8GA 5CG7A 5HWMA 3DZ1A 3H53A 3PY2A 4PC8A 3TC7A 5D09A 3IRDA 3NQ6A 4G1KA 3IGSA 3SECA 4FNUA 4JEQA 3C2EA 4UR8A 3QPYA 4E38A 3LHYA 4FIQA 4CQAA 1H50A 4O54A 4K8HA 1KM4A 1YXCA 2WNNA 5AN7A 3LBMA 3S5ZA 4RXFA 1XL9A 3DHFA 1KFEA 1MEWA 5CPLA 3DBPA 5C2XA 1WBJA 4FHAA 3BW2A 1QO5A 1AW1A 1WYIA 4N6EA 5KZMA 3FKRA 1JCYA 1X1ZA 1JUKA 4K8EA 1JUEA 3PM6A 3L68A 3HB9A 3NQGA 3MYPA 1XC4A 2F7FA 3MP5A 2A0NA 3NQ8A 2ZCGA 3B06A 2HTMA 5EKYA 1AG1O 1AK5A 2Y61A 2QCDA 4E2DA 3UY8A 2WO5A 3LCGA 3EXTA 4DF0A 4LV9A 2NXIA 1TPWA 5GVJA 2NLIA 2WPBA 3KVMA 3T4CA 3CPRA 3LLDA 3LERA 2ZA2A
chains in the Genus database with same CATH superfamily
3EX1A 1G7VA 5HAOA 4K68A 4CQ9A 3F4VA 1GOXA 3AIVA 1D9EA 3RM9A 4QR6A 1K3UA 3WF2A 4K6AA 4IL0A 4WDUA 6REQB 3QN3A 4J1OA 4L1GA 2UY2A 3LGGA 1SJCA 4H9VA 2G3MA 4G7EB 1G9HA 3OPSA 5CPNA 4QAIA 3RCNA 1FQ0A 1IXPA 4ASTA 2ZDRA 3NL3A 5EMLA 3ZLHA 4F2TA 1SFJA 4HSOA 1ZBWA 3FK4A 1OK4A 3A23A 1KO0A 1R3TA 1FHUA 2VEFA 1U5HA 1KFKA 4IIHA 3CPGA 1HO1A 1X8FA 1XSJA 2JF6A 3NOEA 4P7RA 4HOXA 2BODX 2XJ7A 4KPLA 3P67A 1JZ2A 3BLPX 1D3HA 3VUSA 3WH6A 1TG7A 1CXLA 3SCNA 2OKOA 2CHOA 1VH7A 3WBXA 1XLLA 3GYEA 4S3BA 5FEZA 1BSLA 3B0YA 1O5KA 1I2PA 3ATYA 2JGQA 4NQ1A 1V02E 3O15A 3LK6A 4J3ZA 1FCBA 2CITA 1OINA 2H3BA 4NJIA 3UXDA 4DWSC 5K3VA 4UTTA 4PTDA 2CBUA 4IPIA 5CKSA 2Q71A 1U2YA 2GDUA 3W85A 2WBKA 2L5HA 4YTSA 2DW7A 1F8MA 4WD0A 2EKGA 3AYTA 3SDOA 4FOUA 3O0KA 3LBOA 2FMNA 2FGLA 4IIFA 4WF7A 1TJRA 3K2GA 1VEOA 2GYIA 1OGSA 3CHDA 3GX9A 4E3TA 4IFKB 1J9YA 3T7VA 4Z2JA 1V6VA 2ZRUA 2OTDA 4AVFA 4BCEA 4QGCA 5AY7A 3GFYA 3DENA 2TSYA 1EIXA 3VIKA 1DJYA 3T8LA 2XWDA 1XDJA 1JCTA 2ZYFA 2X7WA 1J2BA 1LP6A 4UQ9A 3LU2A 3LPOA 4X9YA 3CL6A 4CQCA 3GDLA 4AZBA 3PZIA 1AMKA 3LHWA 4ZXOA 1LLWA 3OU8A 1EWEA 1XLAA 4WJXA 3FJNA 5CBBA 1EDGA 4H83A 1I0DA 1M7JA 1XQKA 4CD5A 3BLIA 1XD0A 3FA4A 1VHCA 4LY8A 4D9PA 1J79A 5DY3A 2FQIA 4H8VA 4HYVA 1OVDA 3OBKA 1GOWA 3RMEA 2J75A 4A2SA 4ERIA 4JQ2A 4KCWA 4RW3A 1SPQA 1DQUA 2HE5A 1XI3A 1VPYA 5C9ZA 1E4MM 3U0HA 1H41A 2VHLA 1NDWA 1SJDA 2CZ5A 2PC4A 3ELFA 1ONRA 1XDLA 3NZQA 5LNSA 3OLGA 1B30A 3MI6A 4JAWA 5FSDC 8TIMA 2J9ZA 1W17A 2WW5A 2UY3A 5REQB 4M8UA 4GZEA 1NSJA 1ZLPA 4P8UA 3PK7A 3AMCA 2PA6A 3ABSA 5GNYA 1OF8A 2D0FA 4K2SA 4ZCWA 4PRRA 3SCUA 1J0IA 1TUXA 3O06A 4CNUA 1TVNA 1W9PA 1KFLA 3QRHA 2OWCA 1TTPA 3B4YA 3UGRA 2HXTA 3EX3A 3IJ7A 4P8VA 3DGRA 2E8ZA 1X1NA 3TYAA 3LQLA 3AIUA 4UUIA 3T78A 3WYZA 4C6KA 3BG5A 1KLZA 1UH4A 3BGGA 5MKGB 4DNHA 1HZYA 3SR7A 4TIMA 4C65A 3VDCA 1A49A 1OYCA 2G41A 2GJPA 2XVLA 3N14A 1SR9A 4OFCA 3GVRA 4RNHA 2X2YA 4MGGA 5CGQA 5AHFA 4W84A 4IM4A 1F4HA 3TA6A 3FHQA 1ADOA 1V6YA 4BFAA 4KMQA 5A3HA 1TJ1A 2EPHA 2DUXA 3EDEA 1TV2A 1W0MA 3GNRA 4XISA 2WMIA 1DIDA 1UC5A 3ARQA 3LBCA 4WUIA 4JFTA 3GFXA 4JX4A 1X7FA 1ZL1A 2QVHA 2QCLA 3NURA 3WBWA 2D24A 3O2LA 4MM1A 1XBXA 1Z6KA 2BV9A 1C91A 1UROA 2O4QA 4ZXLA 3KRZA 2UV8G 1Q6RA 2QS8A 1Z44A 4FS9A 3WG6A 2J8TA 1WDSA 3VD4A 4IMGA 3L67A 1KRAC 1SMAA 1Y5VA 2Y1HA 5DLCA 2JGYA 1RA5A 4MZYA 3VNIA 3PUEA 3VNYA 3AXXA 3AROA 1ZAIA 4GFIA 5AC6A 3C2FA 5CPOA 4GNVA 4YTQA 2BP1A 2PGWA 4C6JA 4FAMA 3KBJA 3TSMA 1DWAM 4L1XA 3SADA 3R43A 3VILA 5EY5A 1B3ZA 1J0YA 2F9RA 3UQNA 4S3AA 3IK2A 3EKLA 1BAGA 3IAQA 3M46A 5AC5A 1OG6A 4D71A 1BQCA 4HYRA 3AUOA 5CAHA 4LEQA 2Q09A 4GVIA 1E15A 2OSWA 4R5EA 3LA4A 2V5LA 1P1MA 1FWIC 1RAKA 1UA3A 1WKFA 4M7TA 4DJED 4WRHA 4FLOA 1R5YA 2YB4A 1XW8A 4G5DA 1FWDC 2ZXAA 4O1EA 1KKRA 4HKPA 1QHOA 3F4WA 2PBGA 4PUEA 2JKEA 2J7FA 4UFHA 2A7PA 2EPOA 1D7KA 1M1BA 2PP3A 2PRLA 3ECQA 5AYXA 4KS0A 2QW5A 4Q22A 1QPQA 4F9DA 1KRCC 2YFOA 4ROQA 1OX4A 2FZ9A 3L4UA 1E9IA 5LA2A 3OQEA 3LSCA 4NX5A 4FX7A 3SQSA 5CXPA 1Q2SA 1TTQA 4GUJA 3MSRA 1K8CA 3AYRA 4LUSA 4MFEA 2I1OA 3CIXA 4QIUA 3UZJA 2BY2A 3E02A 2PTZA 4KW2A 3QFWA 1LUCB 1X97A 2VELA 1JCXA 2G4FA 4LBRA 4XBJA 5C2CA 4LT9A 4ZTYA 4S3JA 4AC1X 3A9BA 4GG9A 4K37A 3CH9A 1TZ9A 1KR1A 4O4WA 3TTEA 3BW3A 4PA8A 1RJPA 1XCXA 3N34A 3VVGA 4C6DA 1CEOA 3VPLA 3UJRA 4IF2A 2YXXA 3QEZA 1A5OC 4LUTB 3SUSA 4DAIA 4K3ZA 1A0CA 1M7XA 4FX6M 4A3RA 4MB1A 4DJEC 2P3ZA 4N4PA 3T81A 3UJEA 1K8YA 1WE5A 3D3FA 4DO4A 1QOPA 1SFLA 4NI8A 1BRLB 2PURA 3WLJA 5D2WA 2HS8A 1I6NA 2Y8UA 4EACA 3GDTA 1RD6A 3N2XA 3MMUA 1TKKA 1UKOA 2Z0IA 3NPWA 3ABXA 1AODA 4IWWA 2P53A 1ME9A 4DJDD 1V0LA 3TWBA 5BW6A 4TTGA 4WCJA 2WCGA 4BQ3A 1XIMA 2YDSA 1B31A 3N13A 3B97A 3DI0A 4RE0A 1OFPA 1JPIA 1HG3A 1F3XA 3N2OA 4BEUA 2RH9A 3ZM8A 2J9YA 2W5FA 1OGBA 3PSVA 1PHWA 3UD6A 1QTWA 2DZVA 1DHPA 3QTGA 4UWMA 1CCWB 4C6PA 1K6AA 1NOFA 2ZZ7A 1N8IA 1QNVA 4L56A 3BVJA 4X2PA 5EFDA 1Q2RA 4ZB0A 2FKPA 3W1LA 1AQFA 3KOFA 3URQA 3UWEA 1F6PA 2XYLA 1IT8A 3HG3A 3KCOA 3MS8A 1H1ZA 2ESCA 2Y63A 1ESWA 4PTMA 3THAA 3PZMA 4GQRA 3ITXA 3MT1A 3B4UA 2V30A 1GG1A 5H6HA 5HBFA 1WV2A 2HROA 4Y6GA 4R9XA 3WQOA 1UKTA 3REQA 5DT7A 1AH4A 1QK2A 4C90A 4P5UA 2FB3A 3SCVA 4EANA 2YFNA 1PTDA 2OQHA 4NVTA 3A5FA 4ERAA 2DEPA 2QJHA 3SCTA 2VVSA 4J28A 4KT2A 5H8UA 1DWHM 4LVDA 3BJFA 5CJ5A 3CLMA 1AJZA 4X9SA 4JDYA 1JUBA 1AJ2A 1ZRQA 3V18A 2OLHA 2BFGA 1ITQA 3SFWA 1C92A 1C7SA 4PFHA 3TAOA 1BPLB 1JD9A 2ZUTA 2ZRXA 4Q8MA 4JCLA 3GR4A 5BZAA 1XIEA 4LF2A 3WQEA 1KQZA 4D6EA 1M65A 3P60A 2QMKA 4F0SA 4XKMA 4HNUA 2QPXA 1SSDA 2ZQ0A 1E6XM 1Y65A 2BGQA 1S39A 3L4ZA 3QZAA 1H7WA 1KCKA 4BF5A 1SW7A 1EYEA 1LWJA 3CWHA 1C8XA 1UR1A 4O57A 2J7GA 3PFMA 4PH6A 4RW5A 2VFGA 3IJ6A 1MDLA 1UP0A 4QG8A 3BURA 2WCSA 4QDMA 1T7LA 2IKGA 1F3WA 3I68A 3MWAA 4ZFCA 3MCOA 2RKXA 5CPTA 4ZQPA 2QT3A 5F2IA 2D69A 4CEXC 1AZ2A 2QCFA 4YJ5A 2CLFA 1TV5A 5K9XA 2V38A 1L8PA 1F5ZA 1M5WA 1ZS2A 3BTNA 3EXSA 5ABFB 1VFMA 1XSIA 1ICPA 2P88A 4W4QA 3TMLA 3CXOA 3AZSA 5A6BA 3IPWA 3W01A 4QP0A 3PJWA 4L64A 5E70A 4XIMA 1VS1A 3OHIA 1HJWA 3OP2A 1GHRA 1GVSA 3ZXWA 1VCFA 3M0KA 2QF8A 5JU6A 2NX1A 1VBRA 2OELA 4YL2A 2E77A 2YL5A 3JZUA 1O94A 4PRWA 1R3SA 2CLOA 5FJTA 3CU2A 1OC5A 3MC5A 1UIOA 3NZPA 2FHCA 3F7JA 1DWIM 1P6BA 1TV3A 1FXPA 1H51A 1XDMA 1QOXA 2JKAA 3BG9A 3EX6A 3CL7A 2XFYA 3R13A 1V77A 1REQA 1LWIA 3H4WA 3B0VC 1HXJA 4E2BA 2DT3A 4TUFA 1VBHA 1XYBA 5CQ1A 2AMGA 4M51A 1AQHA 1HJVA 1HGWA 1QBAA 5K7JA 1TPVA 4ZB5A 1JDCA 2CC0A 3EWDA 4R9OA 2C19A 4ZGYA 1DWJM 1TMHA 3I7RA 3PPGA 1W1B1 3CO8A 1XKJA 1DIEA 2FZMA 2NT0A 3A4JA 4JIIX 3SIMA 1MW0A 3DFNA 5C54A 4AIUA 1PVNA 4FNTA 2V63A 2Y8KA 3WLTA 3THUA 4X0VA 1UKQA 1W91A 1T40A 2W3ZA 5C9UA 4R34A 1KFWA 1UZ1A 2UY4A 3HFTA 4QNWA 1OY0A 1V79A 1H7RA 1SZRA 4O52A 4LH8A 4UNIA 1VRDA 1HT6A 1XF0A 3WUFA 4DEFA 4CU7A 4GABA 5AYBA 2JEQA 4GY0A 4F0LA 1N7KA 2WC3A 3V5FA 1Z69A 2PI6A 5CPSA 1FUYA 2VDIA 2IQDA 3ZJ6A 3H7RA 5MF5A 2XDFA 1W3KA 1GOIA 1QPRA 2E5DA 4EF9A 4JOMA 3QGKC 5I00A 3FHAA 1HL2A 2OMAA 1BSIA 1H5YA 1YPIA 3TN6A 4TTUA 4EE9A 4GIYA 1V6TA 3FAWA 4IJBA 2J66A 1RH9A 4OOUA 3UR8A 3FNDA 3MI3A 3QY7A 2EQDA 1XLHA 1ZJIA 4D6CA 3ZR6A 3NDYA 4XAFA 3FGCA 3HGSA 4GNJA 1NFGA 1ZY9A 3OVGA 2CFFA 3T0CA 3WQ8A 1VHNA 5XIAA 2R1LA 1ML1A 3M6YA 4F2BA 1Q4WA 4YXGA 2FHFA 2A79A 3BAJA 5KZ6A 2OOGA 4D8LA 1F7BA 1UR4A 1TWWA 3HMJG 4I7UA 3UESA 3PWAA 4HK7A 3KW3A 3WJXA 3KL5A 2OX4A 2PWFA 4GK8A 4H9MA 1HN1A 4WVXA 2V6AA 1FDJA 3LRKA 4JTIA 4CCCA 1KFJA 4RE2A 3PWIA 4U31A 3USBA 1UR8A 2VEKA 4OT7A 4OJYA 4E4UA 3T40A 2YCEA 1LRQA 1SFTA 1YE4A 3O1NA 4IGHA 1F73A 2VEIA 3W27A 4RE3A 4JTCA 3O63A 1NF0A 3PZQA 1OFBA 1VBUA 1QUMA 3MTWA 2C6QA 5I09A 4CQ8A 1CXIA 3SN4A 4I6KA 3GR7A 2ONEA 4MYAA 4HN8A 1UWAA 2Z2AA 1GKRA 2NSXA 4HN4A 2QIIA 4A8IA 1SZNA 2C13A 4HT3A 3VDBA 2VCCA 1TUFA 4B5SA 4JIHA 1R9ZA 5FESA 3EWWA 1EP2A 3KXQA 4MY1A 4XAGA 2NXHA 5K2ZA 3E2RA 3K13A 4DXVA 3VE9A 1HIZA 2D0HA 4MNJA 2VEPA 1R7OA 1Q5MA 1VCGA 3GYCA 4NILA 4DX3A 1LRNA 4DN1A 5HOSA 3S9ZA 3BGJA 3GW0A 2BY1A 1C93A 3RDKA 4Y9NA 3VABA 4GYFA 1TVLA 4LU0A 3KRBA 1P5BA 3P7YA 1RV8A 2VL4A 3WDQA 4TR9A 3MCNA 1TQJA 2J7BA 3N18A 3H54A 2R1MA 3T0BA 5CJNA 2D22A 4C1NA 5HQEA 5E0KA 4RNFA 3R12A 2ASHA 3VNZA 3THDA 1SFSA 4MZ1A 3VD9A 4GIEA 1PKYA 4F0RA 5KEZA 2G4JA 1V93A 4LNYA 4Y2WA 4IZGA 1DL3A 1O7AA 3S1UA 2PZ0A 1FWNA 1UB3A 2GUUA 2Y4SA 1UR9A 1XP3A 3KVKA 3PULA 3K4WA 3AICA 1GVRA 4IMDA 4LRTA 4KCUA 2HK1A 1B4EA 1EBGA 3E5PA 1XRSA 4LFYA 4BJHA 4HYWA 2Y5JA 3BANA 1F07A 4JY8A 3OB8A 1N82A 3GH5A 4JTQA 1E0TA 4Q33A 4ZOAA 3KAOA 1PZ1A 2WKGA 3A21A 1DXIA 4M5PA 4UFMA 4FXRA 3ITLA 2QJGA 1EXBA 1UOKA 3ZWTA 1ZTVA 2WQPA 4OUIA 1UQZA 4DF2A 2DSZA 2ZRWA 4DBDA 1D3GA 5HUOA 4TOQA 4AMAA 3EOSA 5AVHA 1U83A 5HULA 2A4AA 2ACRA 4PR4A 4AZ6A 1XFBA 4JL2A 5E0FA 2Y2WA 5DRCA 3H2FA 4O0ZA 2DH2A 3W3OA 1JD7A 5LIWX 2I16A 4C1NB 3CO4A 4I5XA 3JRKA 1SVDA 1PS9A 2IPFA 2YX0A 3B8UA 5DY2A 1SZFA 3N15A 1RPXA 1JF6A 1SR0A 1IEXA 2WSRA 1YLVA 2H6RA 2HCVA 4QS6A 4OBRA 3K4DA 2Y24A 4NI3A 4M6UA 1HUVA 5ABGA 3L2LA 3T4WA 5BROA 4MPKA 5BU9A 2W91A 3NXLA 1KTNA 1RCXB 4O17A 4GPNA 3W72A 3KTXA 1EUNA 1CBGA 3AWNA 4Q8UA 3T55A 3TJLA 2GJXB 1H60A 1MDRA 2QUMA 4OBSA 1NU5A 3P80A 3ZFHA 4NP7A 2G3FA 3ANVA 4R7WA 4O1DA 2WHMA 3EB3A 9XIMA 4MB3A 4RLIA 4HIBA 1B0IA 5BXTA 3DBNA 4XUGA 3QR3A 1QBBA 4XZMX 4JICA 1WB0A 4XTIA 1NWRA 4V1XA 3GG1A 2CERA 2YSWA 2ICSA 1NP0A 1RUSA 4LAUA 3VGGA 2VM8A 1XISA 2I5IA 4JL1A 2OG9A 1I2OA 3K8MA 4HTYA 3U57A 3M43A 3EB4A 1F6YA 3O6AA 4RDWA 1LTDA 3HZ3A 3IJLA 4IT1A 2G97A 4AZCB 3ES8A 4PTWA 3GO2A 4GQBA 1NDVA 3RLUA 3A13A 2E40A 2CBVA 1BXNA 1GTHA 1LL6A 3SJNA 3N4EA 1XIDA 1U1HA 3GTHA 1WDPA 2EG6A 4IQEA 3MMDA 5CZTA 3A5VA 1O68A 3NZRA 2OEKA 3SB0A 4AD2A 3W7EA 3VIMA 3K5XA 2QF7A 3TN4A 1H09A 5H1WA 3RN6A 8XIAA 2FH6A 1GORA 5BRPA 1ITCA 3WLHA 3E12A 4AY1A 4PMQA 3OVRA 4G8TA 4KIEA 1WZLA 2NQHA 3RGTA 3MKCA 2CLKA 3F5JA 1Q13A 3UETA 3TAKA 3GU2A 2VD9A 3ZZ1A 5CSSA 4C60A 3GIPA 3GVWA 3K46A 1A80A 1W3TA 1WO2A 3GXNA 4JFVA 3WIJA 5GPRA 5DBUA 1EH9A 1RLCL 5FKYA 2ZUWA 3M47A 1M7PA 3SIZA 1S1PA 1OX5A 1MUMA 6XIAA 3BAWA 5E6YA 2HVMA 3W37A 1J4EA 3PPCA 1W9UA 3EAUA 4OWGA 3W7DA 1DTNA 3UT0A 4R7OA 1JULA 2A3AA 2D20A 2A6LA 1NDYA 4HPJA 1HL9A 1ME8A 3KZPA 1W3JA 2W27A 3UWWA 3EEGA 3MDUA 4PMZA 4LYRA 3SUWA 3ZIZA 4ES4A 4O0QA 1XR2A 3MUCA 3SY8A 2GVJA 1W3NA 3WBYA 2J6VA 4QISA 3LXCA 2OCZA 3PAJA 1CB7B 1R9XA 3V1PA 4A8RA 2PRMA 4O19A 1JEZA 3RPDA 1EKOA 2INZA 1XCWA 2W66A 5GNZA 1MRQA 2CZDA 3DAQA 4I8DA 2X8RA 1BVZA 2CIPA 1DVJA 2CLLA 3F2CA 2X05A 1J12A 2NSOA 1MQRA 1LWHA 4EPBC 2O9OA 4BKNA 4Q6JA 3VGEA 1Q6EA 4HHPA 4W7WA 3CM4A 3FSUA 3R8HA 4PSRA 3U9IA 3UWZA 3LCIA 1CYGA 2FFCA 4M6QA 1W1IE 3VU2A 4KRTA 1FP8A 4WY0F 2F84A 4LC6A 1VR6A 4UFKA 3TV8A 3AS0A 5DEZA 4DIAA 3N04A 3MY9A 3WQ6A 4EP8C 3C3UA 1B3VA 3BARA 3LRMA 3U2OA 3NM3A 1YE6A 5LA0A 1QI5A 1YXDA 3W25A 2FPYA 6TIMA 2PGFA 3EWUA 3FJ6A 4C6QA 1ZENA 2ZZ6A 3TEVA 9CGTA 1CGXA 1OFOA 4PMUA 5JQ9A 3IVUA 1IEWA 3CWOX 1SW0A 1NJJA 3VDHA 5AB3A 4L6DA 2CKSA 3M1ZA 2XSBA 1E9YB 4GI8A 3QJAA 1NAL1 3TW7A 2EJAA 2YXGA 5DO8A 1J6OA 4CNNA 3P5ZA 6ALDA 3G24A 5A69A 3BLLA 1OK6A 5G1YA 1TPFA 3TXVA 2TODA 4NIRA 1IIHA 5I3FA 1GCYA 3MUZ1 2V3DA 1UWIA 1PL9A 2Y89A 3T0DA 4AX7A 1CW2A 1EHNA 3UEQA 3H21A 2ATSA 3MP3A 3S47A 1KV8A 4AC7C 1SW3A 4AIEA 1ZGDA 3P8IA 3R25A 1KXTA 3U7BA 1HVXA 2WYSA 1L6YA 3BO9A 1IGWA 3IUHA 1XPYA 3G1FA 3PTQA 4Q8OA 1HF6A 1F3TA 3VAVA 3SUVA 2PB1A 1PJ9A 1RALA 4JHZA 2IPWA 4TX9A 2Y70A 4YU1A 4N9BA 1OZMA 2C0AA 5FIPA 3THQA 2PDGA 1BHGA 5BCAA 6CGTA 2WMFA 4MVAA 3Q58A 3VD5A 2GGIA 3F2DA 1K70A 3GZ3A 3VTRA 3H53A 4CD6A 1JZ3A 3MB9A 1UH3A 2ZVIA 2OGJA 3VK5A 2FGBA 3IRDA 3FCPA 4D6DA 4G1KA 3CAKA 3IGSA 4X63A 1Q63A 2AKZA 2VEGA 4JEQA 4J27A 3QPYA 1MNZA 4E38A 4GZIA 3T2OA 3WFLA 1YXCA 3KDOA 4YPJA 1T6MA 4GZ7A 2CLPA 2HK0A 4FHAA 4OTKA 3QZ6A 1LQ0A 3EMCA 3FKRA 3EMQA 2FDMA 3ZJ7A 1X1ZA 3MSGA 1JUEA 3PM6A 4CD7A 4W7UA 3NQGA 4H8HA 3WSUA 3B06A 1CGYA 4JQAA 3QHMA 1PSCA 2Y61A 1HKJA 2DZBA 3CV7A 4LV9A 1L6FA 4JQ3A 3T4CA 3CPRA 4E4FA 1QATA 3GY1A 3JVAA 1X8CA 3EDKA 4INFA 2Y5SA 3TTQA 2MANA 4GKLA 1V7YA 1Q8JA 3OVPA 4IH3A 1FHDA 5B7ZA 3KWXA 3TTOA 3GWQA 3RNDA 1G4PA 3AJXA 5FCZA 2J62A 2YXOA 2CNCA 2QGHA 4PSPA 4HMNA 5IHRA 5T26A 2ATMA 4F0HA 3IV3A 1W1PA 2VC7A 3EOLA 2ZA1A 2ISVA 2FZ8A 2CETA 2F2HA 4CD4A 4I9TA 4GISA 4UCGA 1ZBKA 1P48A 4ZSTA 4ZEPA 1RVGA 2PLKA 4MPQA 1KGXA 2XIJA 3ZO9A 3M0XA 4M6PA 3RJYA 1CNVA 1H0IA 1S5MA 3POCA 2FVMA 1UIPA 2C71A 4S3GA 3WQ4A 5EBUA 1EX5A 3R6IA 1RK5A 4Q7NA 3G18A 4JNMA 5E1QA 5JXQA 1A0EA 5AFDA 5ABHA 4UTWA 1CZ1A 2ZOXA 1GKQA 3P6LA 3KBMA 4AIBA 2QCDB 3CASA 4DZAA 2I56A 3ALFA 1GVYA 1GYNA 4AHOA 2BXZA 3RYSA 5LHEA 4RZBA 3DUGA 2I17A 5D04C 1SQ7A 7A3HA 4G2DA 5D9MA 3GG0A 3KEHA 4A3YA 2PDHA 3CMGA 3QV8A 5DMLA 3OG3A 3GUGA 4XO6A 3UBPC 1HJSA 3Q37A 4JZ5A 3TSDA 4FOKA 4JQ1A 2RUSA 2ZX7A 1OC6A 1HGYA 4J2PA 3BDKA 4O1AA 2Z6IA 1EF2A 1YBQB 1XGDA 3ONCA 4R85A 4HCLA 1ITXA 5KTLA 1OC7A 1DBTA 3F5LA 2ZE0A 3H26A 4LAKA 4ENLA 1Y0EA 2RDXA 3PZOA 4MAZA 2BNJA 1VBGA 4D8AA 3HTWA 3TR9A 1DE5A 2FZDA 3C52A 3UW6A 4O12A 4OVXA 2XHYA 3VCNA 2VZSA 1R46A 3GNXA 3MO4A 4DBEA 1HKVA 2DIKA 2D73A 1F9CA 1IE7C 4LYQA 3RLGA 3L0KA 3UYCA 3AS3A 5TBOA 1I8JA 3L4VA 3W1XA 4ZOBA 1ADSA 1W37A 3WK2A 1CT5A 4JDBA 2W62A 5HMDA 3UR2A 4U3AA 3OIXA 3H7VA 3UY7A 4HQVA 4V1YA 1PTAA 4PCSA 4BQ5A 4NXKA 4CVUA 2XPKA 4HNOA 4AWSA 2R1NA 3BLKA 1JPKA 3BOLA 3W7NA 4U28A 4FF7A 4JTJA 4D6JA 1Z42A 2PTXA 4RPPA 3IJDA 2ZX5A 1WX0A 4FI4A 2YDAA 1XHGA 3TSBA 2BBFA 1QO2A 2PU1A 1UMLA 3W07A 1GPFA 2GJRA 2OZ8A 4M29A 3NSMA 3W2LA 3DG6A 5KETA 3G22A 3IIZA 3T42A 4Q8VA 5IOBA 4GNKB 1QJWA 4LUIA 3D6NA 4WK9A 5AC8A 3BOFA 5CZSA 2Z28A 5AC7A 2E6AA 4WGXA 2VD8A 2X41A 3G1VA 3T2PA 3FYYA 3EB2A 3VGBA 1E9ZB 2OKTA 4ATDA 3WLLA 4FXFA 3ABOA 3EOUA 1EOKA 3WQVA 4JIRA 5CBIA 2IKIA 1SO5A 2AAMA 4Q8QA 1J6PA 4PMYA 3S2LA 3WFZA 1O60A 2CBJA 3SGZA 3B05A 2P8BA 4YCOA 3HPZA 4GYPA 5I5RA 1TRIA 2BB0A 4UTJA 5F4SA 1TPC1 2CYGA 1WKDA 2YOCA 4JTTA 2G37A 3KZSA 1JCNA 3VGDA 1OG0A 4KIRA 1DKWA 3HPXA 1J0HA 5IDIA 3LG3A 2KZHA 2EJ1A 3AHTA 3NO1A 4DUWA 1SSGA 3NA8A 1J0KA 3W7PA 5DX7A 1E6QM 1VCVA 1YTKA 3APGA 4G7FA 3VNLA 5D2YA 3IV8A 4S3FA 3CZKA 2VRKA 3W9ZA 2X0SA 2GVLA 4GXPA 1IXNA 1F4AA 1VAHA 1W6TA 2H8XA 4N0RA 4ZSUA 1JAKA 6REQA 3I3EA 5G2IA 1F3EA 3A47A 4TV5A 5FSEC 1OJXA 3GTXA 2V5CA 2V9DA 1CX9A 1TRDA 2XN2A 4HOZA 5EU9A 2VWTA 3MJYA 2D1ZA 3P61A 4LBUA 4Q8TA 4ROPA 4ML4A 4O8AA 2ZX9A 3V0TA 3N2CA 1TA3A 3BQ6A 1H49A 3ALGA 4QE5A 1XKYA 3CT2A 5J5DA 1PB0A 3WK1A 1HP4A 2V3GA 1PTGA 1XLIA 1IXQA 2SFPA 4K7YA 4IUOA 4UQEA 4F9JA 3NJ3A 4DXKA 1W1VA 5D05A 1MNSA 1LOSA 4DWDA 3GR8A 4NAFA 1UMYA 2VI0A 3BGAA 2W61A 1ISYA 4US5A 3K1DA 1NM9A 4B3KA 3W1MA 3PTDA 5FEPA 1NELA 2QCGA 1VF8A 2WK2A 2D2HA 3STCA 3L66A 2VZUA 5HWJA 1QPOA 3BV7A 2GDQA 3C0SA 3RFAA 1IHIA 2REQA 3AQUA 4ZA0A 5LA1A 2A6NA 4P7QA 2DZWA 3VXGA 1JVNA 3CEPA 1OYAA 3OLEA 4Q4RA 2WVTA 3UWYA 4S38A 3P5YA 3NQVA 1RLDA 2BHUA 2I5GA 3NO5A 3GTIA 1E1FA 1IT7A 4MKVA 1CXFA 2AQOA 4NJGA 3ABQA 2H3DA 3H2EA 5LNRA 5HNUA 3XISA 3VFLA 3F4NA 1F76A 4UTFA 2Q6ZA 1XS2A 3MW7A 2BVTA 2V5KA 1BWKA 1EP1A 4GCAA 4M1RA 2BDQA 4B16A 2EHHA 4QLJA 3NQ2A 2HZGA 3M7WA 3PBWA 3DKJA 1B57A 1S1RA 1KC7A 2BTMA 4YTTA 3BV4A 1R3VA 3QW4B 2Z24A 2ZZ2A 2B7QA 4XVDA 4GVGA 1W2PA 4PEKA 5CLTA 2OQYA 4E4PA 3UWVA 3UPMA 2GL5A 1BKHA 3NQMA 1EEXA 3O6CA 4NF7A 2CWXA 3MBFA 1VGAA 3VE7A 4C7DA 4IHCA 2EG8A 3AUJA 2VGBA 3NG3A 1E9LA 2Z7KA 5D2XA 1CB2A 5DRIA 2CXGA 5CC5A 5CG0A 3P62A 3HA1A 4MZ8A 3ID7A 1ZSXA 1MFVA 3TCSA 3MU7A 1HTIA 4J4KA 3ARSA 4Q8PA 5D2VA 2VUNA 3AMLA 1XGZA 2ZA3A 5IXEA 3OQ8A 3TW6A 1E6NA 3UXLA 3FLUA 1VKFA 4NAEA 3S1WA 5EMUA 3OIHA 3LCWA 3LEPA 4JTEA 1CIUA 2HPMA 3E0VA 4UOJA 4PUUA 1GQKA 5AZ0A 3IGUA 5I3IA 1GGOA 3QYQA 4RPQA 2W9MA 1U1UA 2PLMA 3T2QA 5D32A 2WXDM 2BXVA 4C6FA 5D02A 3RK8A 1HL8A 4KWOA 2D3NA 1EOMA 5EFFA 1B4KA 1QAPA 3FDKA 3F4DA 5L6UA 2XIOA 1OEPA 3FEQA 4A8NA 3DESA 1EJSC 3F5KA 3UVIA 2GOKA 3W1NA 1UR3M 3U48A 4BWLA 5DXYA 3H55A 4AVNA 3PBGA 3DHDA 3KOXA 5HJYA 2VFHA 4KBXA 1QR7A 2PFHA 3I4EA 1LLOA 1BVWA 3ZYZA 4ZVJA 1XGEA 1GZGA 2YW4A 5C7HA 3WUEA 1NWUA 4UB9A 3U5UA 5C70A 3N2TA 1TPB1 2ISFA 4AZHA 2E3ZA 5HQMA 4ZBCA 2FJUB 5D38A 3BSMA 4ZZ9A 3AHYA 2G96A 3V0UA 2P3EA 4Z17A 4FPSA 1EFZA 1KCXA 3HGOA 3S0CA 3BL3A 1XYLA 5FAGA 1Z48A 3CYJA 4MJ2A 3WENA 4B9ZA 4JFWA 1JDAA 1MW2A 1YNYA 2C1IA 3DEQA 1ZCCA 2R1KA 2O4MA 3VC6A 5ECUA 3DCPA 4I9JA 3URBA 3E38A 2Y6ZA 3OLIA 3LCHA 3I3DA 3HPSA 5CC6A 2WMJA 1A5NC 2DU2A 1BTMA 5C9RA 1TMLA 4D8ZA 1FWCC 3NQEA 4U2ZA 4IXXA 4RV3A 3HG2A 5FF2A 2UWFA 4J3VA 3GHTA 3PR2A 4Z2LA 5JH2A 4YWSA 2D3LA 1QNSA 3ATZA 4UIOA 2O92A 2VCBA 2BLEA 3GVGA 1T0OA 4WKHA 4AIOA 4CD8A 1K02A 2YDRA 4BK9A 3TYEA 2FVKA 2QCEA 4EIVA 3CB8A 3OZPA 4HA1A 1RJQA 5FJIA 1EBHA 1G4TA 1QNQA 4XAZA 2VYOA 2EO7A 3R94A 2TAAA 4Q4OA 2VC5A 4Q6XA 4FNQA 3NVDA 1KBBA 4MLRA 2XU2A 3GHRA 4ML9A 4AY8A 2OSXA 2WSKA 5C8BB 4Z2GA 3LB0A 3MHGA 3BAIA 4HSNA 1I75A 1T8QA 3SJ3A 3WMSA 3VYLA 3IUIA 1EGZA 5A5WA 3DYMA 2J79A 3S46A 3PBVA 1ECEA 4U10A 5FJJA 1PXGA 2C8NA 1XBZA 3VGHA 5A1AA 3KL0A 1PAMA 4JXCA 5BWFA 1UD3A 4N2YA 3PZGA 1E56A 2C1GA 3QY8A 2WBGA 4EPDC 4KKXA 1B54A 4N7QA 1AW2A 2CLMA 3QW3A 1R3WA 5I3KA 5FI8A 3W2UA 2TYSA 1A4MA 1V0KA 4YHEA 3OZMA 1XYZA 3RITA 4AUBA 2NWRA 2VJXA 3NYDA 1WCGA 1ZHAA 2C18A 4GYJA 3AISA 2DZTA 1V6XA 3VM5A 1W8GA 1DQWA 4GUGA 5CC3A 1WZAA 3NSNA 4AHPA 1LL7A 2DIEA 1JCJA 3EKZA 4XUYA 2QUVA 1GW1A 3LUTA 3H2MA 3U7VA 3GC2A 4F0MA 1XWYA 4H4IA 2PDJA 3ABRA 2XINA 3AZTA 4OKDA 4UFIA 4LCRA 4CNPA 1A0DA 4Q7BA 1NFBA 3S5YA 4XAYA 3CH0A 1KNWA 1TWIA 4D1JA 1LT7A 2X0HA 3W7CA 3GAKA 5LNWA 3A24A 1RK6A 3QSRA 2P1FA 4LX4A 4OV4A 3PBUA 5I78A 3GVVA 2DP3A 1GQIA 3GVQA 2G8ZA 4JTGA 3BK0A 4LVBA 4O15A 5IFTA 4GUHA 1US0A 3WJSA 1V6UA 3HPFA 1ZAJA 4KEUA 4C7FA 4AWTA 1RD5A 2DZXA 5I2UA 1KRMA 1PZ2A 1V5XA 1GJWA 1M3UA 3GDRA 4KQNA 3AHZA 5F4XA 2NUWA 5DCDA 1JIBA 2RJHA 3W6MA 4ZB2A 4DYKA 4RDYA 1C8QA 2WMIB 1Q6QA 5E93A 3WF1A 2GUYA 3IJQA 3QPEA 4IUGA 3IJ9A 5H8PA 5BYWA 2WMHA 4J35A 3M6DA 3HG4A 4PTXA 4I5UA 1BTCA 1JCLA 4D72A 3CUZA 2R91A 3A6OA 3WF4A 4AH7A 4A3QA 1PDZA 3F03K 3UXKA 4GC4A 4B3LA 4GX9A 4LWWA 1R30A 1VJIA 3LI0A 5C5YA 1K8ZA 3BZJA 3PAOA 4Y8EA 4BA0A 1PX4A 1I1XA 3CUXA 1A50A 2PGEA 2B7PA 1DIOA 2YJQA 3H70A 4NZCA 1D3CA 4MDOA 3S3GA 4HNVA 3TNOA 5JIPA 5F7UA 3R8RA 1KBKA 3VOCA 1R3YA 4GJJA 1IEVA 2NW0A 1V3KA 2IS7A 4G1NA 3WK3A 3LZ5A 4NZFA 2RHGA 4AWUA 3WLNA 4E0CA 3W29A 2FIQA 3NL5A 1KM3A 4G56A 3R8GA 4HNTA 1KFBA 2PSNA 3CUJA 4D6GA 3WDIA 3WH7A 3SUTA 4JTAA 4DLMA 2VOTA 3PPHA 5A8PA 4HPGA 2OXNA 1GKPA 3W1RA 1VBJA 1LT8A 1WAWA 4HHMA 3Q67A 3B40A 1REQB 4G9PA 2DSUA 4I6VA 4NT0A 4LVAA 3B9OA 1Z3NA 1P6CA 4MWAD 3TROA 4KWUA 4MHBA 3EPMA 1ZUAX 2VNCA 1EYWA 4RR4A 3QKEA 4GCXA 2DSKA 3ONBA 2HNEA 4PCFA 1SO6A 4HPNA 3TCEA 4S2CA 1EPXA 3TJXA 1V7AA 3W71A 4KFPA 2XM1A 3N12A 3E3HA 4FIRA 4F66A 3W53A 4AVOA 3W70A 3NGFA 1H63A 2O56A 3TFCA 1UOZA 2QCNA 1XLMA 3IVTA 1H62A 2W4XA 3LHUA 3W7OA 3SEPA 1UA7A 1EZ2A 3ARWA 4FNRA 1MI3A 2DZUA 3REQB 1BF6A 2Z2UA 3WMLA 3BLOA 4B5TA 4W9TA 3R89A 5A6SA 2GVEA 5H91A 3MSDA 3SURA 1IEQA 2A21A 1AD1A 4EK7A 5A8NA 3QC3A 3VIPA 4LSBA 1PX3A 4XVEA 2HISA 3N19B 3M44A 5DT5A 2JF7A 1V3HA 2E6DA 1NWSA 4GH1A 1UWTA 1Y8BA 2P76A 1D8CA 4F0KA 3ZJKA 3CJPA 2PDLA 4RNIA 3SY5A 1VLWA 2OOFA 3OOQA 2EF9A 4GACA 1GJUA 2EPKX 1HP5A 3H7UA 3EPOA 4RCXA 3LCXA 4EKJA 5F4WA 3C0LA 4FXSA 4J3UA 1WXZA 1VENA 4NZ5A 2FZNA 4GFSA 5D8ZA 4AG0A 4J2MA 2Z1SA 3W6LA 2TRSA 2YPIA 5ABEA 4E3VA 2BGNE 3B8DA 2WZEA 5KSWA 4EXBA 1QWGA 1IZKA 2J9XA 3ITCA 4HZ8A 3ZLGA 1RBLA 1KXHA 1EHAA 5I03A 4X2RA 2E4TA 1R3RA 1QOQA 4UMAA 5LNVA 1OZQA 3AMDA 2J8FA 1NVMA 3CBWA 4GYKA 3VZXA 3GS6A 4YWIA 4AZCA 1W5QA 3FAXA 2QGYA 1E70M 4UMCA 4GXWA 2VDHA 2CHRA 2QUUA 4OGZA 3RF9A 3FIGA 5IRPA 1T5AA 1JDFA 4N4QA 2RJGA 3AXIA 4DZHA 2G3IA 2PRHA 3BOXA 2X7VA 1XINA 1I2NA 4BF9A 4AZ7A 2Z1VA 4JYFA 1W1YA 3SBFA 5ECVA 2RDTA 3CQKA 3W74A 4AZGA 2QJMA 4IMCA 4JY9A 5HUPA 5KITA 1IIGA 3BG3A 1UUOA 3AS2A 4PMNA 4N9CA 4ADSA 4ATWA 2PD5A 1E51A 2GQ9A 1EA0A 4M80A 3EA3A 4F79A 1Q45A 2IQTA 4IP7A 4BQ2A 3NFUA 1A53A 3B0XA 2HMCA 4IP4A 2VRQA 4WZHA 1RQEA 1S2CA 3TVAA 2INFA 5D9NA 4P8XA 1XIJA 5FF3A 4XTDA 2JEPA 4KGLA 3I6TA 3ZS4A 1H11A 1M41A 3KM8A 3VD7A 5M03A 1R0MA 4EPKA 1XIBA 1R2RA 5EA9A 1QK0A 1DJHA 3U2ZA 3L5LA 3FX4A 4P2VA 1GW9A 4QQUA 4HZ6A 2QUTA 3GDBA 3AOFA 3LMYA 3TWAA 5E5CA 1S2TA 3T8QA 1K7EA 2X40A 5D4YA 3O0FA 3GTNA 3OYXA 1YHTA 3U6WA 1Q6FA 4GQ0A 5FEWA 1W9VA 4R3UA 3L65A 3O6DA 4U2YA 3MCMA 4QEHA 3NCOA 5HXMA 4FXJA 3LCLA 3QV6A 1EJTC 4AWEA 2YL6A 3EA2A 3V7PA 2ZTJA 5EYWA 1GZ1A 4K1WA 4PUKA 1E5JA 3BAXA 1FFQA 2I9UA 5CEWA 4XB3A 4DPPA 2PDXA 1FA2A 4LBSA 2YKKA 2ZUUA 4OU1A 3ISIX 2Y0FA 1XH0A 4PB4A 1SO4A 2DZSA 4UFJA 4AD0A 2DJLA 1IWBA 3W24A 3W88A 3CUHA 1EC8A 4ZO8A 1CLXA 3N6QA 3M0VA 3NZ1A 4RX0A 2F6KA 2NV9A 4P7LA 4GGBA 3ZOAA 2PCEA 2JK2A 1PPIA 3BLDA 1TPEA 1E4NA 2A3CA 4GINA 1OCNA 4JYEA 1MEHA 2PAJA 4HA4A 4GVFA 4L61A 2DPEA 1GTEA 4LC8A 3ZVHA 4IP5A 3WD1A 3RJXA 4ZTXA 5C0QA 3WLQA 2ZUVA 3L5MA 2RFGA 3O05A 3EDDA 5C6MA 5G5IA 5A6BD 1ZCOA 1PKNA 4K39A 1MWOA 2J47A 1VC4A 1J01A 4JKKA 4NHVA 3ZSTA 5M5DA 4IIBA 3SCSA 3PJUA 1E0XA 2QJJA 5CBJA 3QV9A 4ICCX 4BI7A 1ONWA 4JHOA 1ICQA 3FXYA 3WLRA 3S5SA 4P8WA 1U5VA 1JL8A 1V4YA 2QDDA 4FNPA 4NNCA 4I5RA 1A5LC 3DN5A 4IFRA 2OODA 4FB7A 3APTA 4LALA 3W7HA 5L9FA 5CJMA 4Z0SA 3WNLA 2VURA 1XIHA 1EEPA 2NLYA 4WDTA 2JFEX 1KBLA 4DI8A 4MJZA 3ARRA 5LIUX 2XISA 5DMMA 2WSQA 3OGSA 4WQ6A 5HANA 1EGMA 1CDGA 2VQUA 1QPKA 4AXNA 5HPOA 4Y9AA 3G3DA 1TR1A 3TUUA 2IW0A 4LF1A 1ISWA 1WDQA 2Q01A 1OABA 4A4AA 2DT0A 1DV7A 3N1AA 4KEVA 5A6AA 2QDEA 3FEMA 5I3JA 3GB6A 5FJOA 5A95A 3BMVA 4CGTA 3AIBA 1Z32X 3WQDA 4DPQA 4FLQA 4H00A 2VZOA 2VWSA 1GYMA 3OA3A 1KKOA 1R9YA 4HCDA 4PYSA 5HK4A 1FKXA 3UU0A 3M9YA 4B15A 1TR9A 1QXLA 5RUBA 4NSBA 2BVWA 1SYTA 1QPNA 1VPQA 2DIJA 2DUZA 1US2A 3RU6A 2X09A 2XN1A 3LHVA 3WNNA 3N3TA 4RL3A 2ZKMX 1PZ3A 1KM5A 1TPH1 3B9AA 3UF9A 4RUBA 3M5ZA 1YRRA 2YLAA 3OBEA 1UWRA 4L4MA 4Q4KA 3MDWA 3SAZA 1JQVA 1NDZA 1XLEA 3LY0A 3OO2A 1Q6GA 2WSPA 2A85A 2NQZA 3TONA 2Z4GA 2OZTA 4PULA 4D6FA 4MUZA 1ZQ5A 3AZRA 3TW9A 3UWQA 4NG3A 3G0UA 5C55A 4EPEC 2HDJA 2CHNA 1JNEA 1GG0A 4QEEA 1UH2A 4C6MA 3WLKX 1TYGA 4UTWC 2AMXA 1CECA 3EWBX 1AFSA 3UJFA 1ISZA 4QDWA 1PYFA 2Y7FA 1B9ZA 1P4CA 4R53A 1QNRA 5CC7A 1XBYA 3U3HA 4K1GA 1YBQA 3W2KA 1RZMA 4TQTA 1FCUA 5CZ0A 2DZPA 2LLEA 1OWQA 3UPWA 3MMWA 3DFPA 4HCHA 1K6WA 1XG3A 3EX4A 4O4VA 1MQPA 3E49A 3S5NA 4DJFD 4EWJA 1UZHA 5I07A 4PMDA 3DZ1A 3FXGA 3PY2A 2X42A 1OIFA 3ZR5A 3WNPA 2P5NA 1X98A 1XLDA 3NQ6A 1XD1A 4JFUA 2GWNA 2FHBA 7REQA 4HTBA 2JE8A 2WNWA 1LG1A 4GA8A 3LHYA 4FIQA 1XLCA 1H50A 4O54A 2V5DA 1V51A 2WNNA 3AXMA 3LBMA 3LSBA 2J77A 4DRSA 3DHFA 3CUGA 3TC3A 3KCJA 3IJ8A 5CPLA 3NWRA 4DBWA 1QO5A 1EPVA 3PN8A 2XTKA 1AW1A 4W93A 1Q4NX 3D5HA 3M4HA 3T08A 3H2CA 7ENLA 2KX9A 3I6EA 4K8EA 1TJ2A 4IQJA 1WDRA 3L68A 5EMMA 3MYPA 3N6JA 2PDYA 1XC4A 2F7FA 2A0NA 3LQGA 1OADA 2ZCGA 1AG1O 1VFOA 5DFAA 5A2CA 1ZPTA 4E2DA 2QCDA 2VMFA 2PC8A 3GSMA 3LCGA 3TTYA 3KOYA 3ARUA 2WHKA 2V68A 2QYGA 1Z89A 3LLDA 1O1ZA 3A3XA 2ZA2A 4UNLA 4Q3MA 4JR5A 3UA3A 3NUKA 4Y9OA 3B0PA 1BXBA 3W22A 3TE9A 4ZR8A 2BY3A 3CTTA 4AZIA 1K9FA 2PGRA 2XIQA 2BVDA 2WAGA 5M2FX 5HNRA 4ZODA 1OCQA 1UJPA 5KZDA 5FL1A 2Y7EA 4AMCA 4XD5A 3TOPA 3RHGA 4WIWA 1ELSA 1FOBA 3WEOA 4L4LA 2IKJA 1QI2A 4XZBA 1K4HA 2R1PA 3ARXA 4MDPA 5AHLA 1XM3A 1HQTA 1TIMA 5AECA 2WMKA 4ZO6A 1IWPA 1J0ZA 3VMNA 3UG3A 2XG9A 1XUZA 4LVFA 3QLDA 3HU7A 3GU1A 3K1GA 4QJ4B 2YL8A 2F8QA 3BCDA 3LM7A 2F61A 1UQYA 2AGKA 3DH7A 2PWDA 5I24A 3R0UA 1ICSA 1GONA 4NAEB 3GTFA 1GQJA 3NZGA 4J5NA 2WC4A 3TA9A 1CXKA 2AAAA 2VGIA 4AF0A 3NQDA 3N2BA 3FFSA 3WJWA 3NDOA 3HQPA 3UZ5A 2FVLA 2QPSA 1DJWA 1C7TA 4GY7A 6PTDA 1YTEA 2GLKA 4NZ4A 3VNKA 4JN6A 3LV5A 3O8AA 1VRXA 3C2OA 2V3FA 2PS2A 3EWXA 2E5BA 5G4EA 2B0MA 3INPA 1K9DA 1Q6DA 3R11A 3PWGA 1O1HA 2UY5A 1OQFA 3QLLA 1S3HA 3PTMA 3T1GA 2FPTA 4NJJA 3VINA 3TYUA 2CLEA 2NQJA 1M68A 2ISWA 3WCZA 1XFCA 5ABFA 4Y9PA 1W3LA 1FFRA 1EIBA 4ATLA 7CGTA 4I7VA 2BG5A 4IJCA 1S2AA 1BYBA 4W5UA 2R6OA 1AH3A 2YW3A 4IL2A 1KBIA 2CCRA 2Z1BA 3BH4A 3KDNA 4O1FA 5J8LA 1RSCA 3UG4A 3VX0A 4DLFA 2P0IA 2GVYA 1K9TA 1QFEA 4L4PA 4AF0B 3GNPA 3B8VA 2I9EA 1EDQA 4MYXA 2PP0A 3M64A 3K4AA 1H7NA 5K9CA 2FDSA 3W23A 2OYLA 3EKGA 2PBOA 1H1YA 4DUXA 3H2NA 4OQVA 4I9AA 4DB7A 1J96A 4ZL1A 4C5YA 3TDFA 4OOZA 1OD8A 5HINA 3BZGA 2X16A 1LROA 3BQ5A 3MBDA 1HKMA 1YDOA 4UMBA 4H1ZA 3WNOA 2C14A 4BI6A 1QWKA 3E2QA 3AXKA 3QM3A 4LS2A 1WDWA 2J7HA 3HM7A 3SUUA 7REQB 4FO4A 2VZTA 3N9RA 2C15A 1WNOA 2P50A 3DG7A 3UCCA 2ZADA 4AD4A 2WVSA 1XIGA 1UWSA 1QI0A 4ZOCA 4M19A 3THCA 3RO8A 4BWLC 5JUVA 2Y7GA 3MV01 3WJYA 1OBAA 3NPVA 3WQWA 1U22A 2O7SA 1HW6A 2E67A 4M6VA 1NY1A 3I4KA 1TZZA 3CHFA 3PB2A 1G01A 4O10A 1JCMP 3K8LA 1TJPA 3QQ0A 4V15A 5AVNA 3OZYA 3GNDA 2C91A 3L7RA 3N17A 2ZWZA 3CHEA 4W5ZA 1TPDA 3UVAA 2OB3A 2EPLX 4XWUA 5J04A 3R2GA 3KTCA 2DVXA 4M56A 3S8HA 3GC5A 1W5MA 3HMCA 2PDMA 6XIMA 4ZOEA 1ZU8A 2ZXQA 3VD3A 5IFPA 2QHAA 4Q8WA 5AYIA 4LUYA 3VDAA 3CUFA 1JR1A 3CQJA 1TA3B 5XIMA 4D6HA 1HJXA 1OT2A 5K9DA 5E9AA 4HPXA 4S3EA 5ABTA 1G5AA 1FWAC 1G6CA 3VNJA 5B7YA 3CT7A 2VFDA 3G6MA 1W1TA 3NSXA 2J74A 1VZWA 2GK1B 3WL1A 3M0IA 1AQ0A 4W8AA 5DMNA 3C56A 3H23A 1X7IA 2YBTA 3E5BA 3COTA 3S1VA 2J7DA 2ZZ4A 4OHQA 4CN4A 3WN6A 5FJRA 3M41A 3W28A 3KVLA 1UCWA 4NNAA 2Z00A 3ARTA 5K4ZA 5DBTA 1VFFA 4GBDA 2D2GA 4WKFA 2X1IA 4GGHA 4GY1A 1EX1A 2XIMA 2WSYA 1YIXA 4QLLA 4L9XA 1H7XA 2X0YA 4ZQNA 5G1MA 1E72M 3RRAA 2AL2A 1VYRA 4X3ZA 3CMJA 4XKYA 4V2XA 4JEJA 3BSGA 1W9BM 1L2UA 2CWNA 3NAVA 3BMWA 3S1GA 1R2SA 1QRQA 4XBSA 2QAPA 5BXPA 2E5CA 2J27A 4L80A 1VYSX 3OHMB 4M0XA 5F2LA 2ZE3A 2XUCA 2I5QA 4CNSA 1POKA 5FF4A 1ONEA 4J3XA 1JFHA 2YYUA 3S9IA 3VKCA 3O16A 1BYAA 2BOEX 1WUEA 2PUZA 4L9YA 1MW1A 3D46A 3DFOA 1MUWA 3B9NA 3F1QA 3ZVIA 5LYRA 1G0CA 4NX0A 3EMZA 5HWNA 3V5OA 4MY9A 1JZ8A 4POCA 3W1PA 4IX0A 4FR1A 3P81A 2P10A 1F05A 2GSEA 2X1TA 5I3HA 3AALA 2RDUA 4QDPA 4LAMA 2WMGA 3CZLA 3UCDA 1BG9A 3EXRA 4IISA 4LVGA 3QF0A 2PWGA 3E1F1 1RCQA 2PWUA 4NU7A 2I7GA 1MXGA 1YADA 4KWSA 1AMYA 4GQGA 4Z1CA 4RNJA 3NIYA 1O95A 4HU4A 2YBUA 1JPDX 3A9IA 5T8GA 2VP8A 2EEXA 2VC9A 3UYIA 1O5RA 3TC6A 1YMYA 3QGAC 4CEUC 4F2UA 1EZWA 1E73M 3LHTA 1VEMA 1E5NA 3AAMA 2JIEA 3MHUA 2HBXA 1OFAA 3MUXA 2E8YA 4LPCA 5DANA 4Z1BA 2NX3A 3PZVA 3KL3A 1OX6A 3L2MA 3RX2A 2OT1A 4S3CA 2IXVA 4F48A 1Z8AA 4H9XA 2VX4A 1IR1A 3VO0A 2VTFA 3ZR4A 3F2BA 1NQKA 4DJFA 3LXAA 3VOFA 1HKIA 4B92A 5HR6A 1JPMA 1BLIA 3T44A 4HU0A 3O07A 3R58A 2V8ZA 3PBMA 3TH6A 4IPLA 3LCFA 1KV5A 2IQ0A 4DVOA 4YHGA 1LOQA 3PB0A 3ZVHB 1P1XA 2OX1A 3NQAA 3CHCA 4KEZA 2NQ9A 1KA9F 2GZXA 1LQAA 1K9EA 3C8NA 3LX9A 5AYZA 3HQNA 2A3HA 4ERGA 4TMCA 1UG6A 1P7TB 4LXFA 2YZ5A 3UNTA 4HBKA 3ITTA 4CCZA 4FNSA 3EOOA 2DZAA 4X61A 4MOZA 2ISDA 3TQ0A 3BUVA 3PZUA 3VZYA 4AYGA 2PZNA 1B1YA 4Y8FA 2OGYA 3RM8A 2Z6JA 5HJLA 4QAWA 3BJTA 3V4BA 2QIWA 1TWSA 1JAEA 4Z2HA 3QMSA 4NYUA 9RUBA 4DQWA 1X6LA 4XK2A 3MA8A 3W87A 5HMFA 1E6SM 3CQHA 5IHSA 4GI6A 1DORA 3CV2A 4QLKA 3IAPA 3H2OA 3C2VA 4JN8A 2A7NA 3P93A 4PUMA 4R7JA 1VLIA 1AA1B 3VA8A 2YCIX 4XZHA 3M0ZA 5HDRA 3A3WA 4DF1A 4GVHA 2FZBA 5DF0A 2Q8XA 2OWWA 3RU8X 3E0IA 5CCZA 5CLWA 2NZLA 1EF3A 2WM1A 2R14A 2PPGA 3BCFA 1YEYA 4O28A 4WGHA 4D1IA 3MHFA 4P61A 4B4FA 2E6YA 1FCVA 3LPGA 2ZRVA 1OX4B 1L0PA 2BASA 4Q8NA 1W31A 3KS5A 1GWJA 1EC9A 1PUDA 4UZUA 2JBMA 5JBEA 4HA0A 3G8EA 1I2RA 3JZEA 3ES7A 1MYRA 1JDEA 1FXQA 4MB5A 5I06A 1CXHA 1H0GA 1V3IA 5AHIA 1DXEA 3KVJA 5FF0A 4IPPA 4PODA 1GNXA 4YN5A 4KFNA 4HNCA 3LNPA 2QUNA 3PP7A 5I3GA 1FDZA 3QBUA 1WPCA 3GU9A 2D0GA 1K7XA 3W7QA 1DTUA 1P0DA 2V81A 3A64A 2O55A 5A94A 3UPBA 1IEIA 4S2BA 4JIPA 2PTWA 4ZMGA 5D03A 4BQ4A 1A5AA 2ACUA 3VFCA 1J5TA 4NZ1A 4PMXA 4BEQA 1JGMA 2WJFA 3CZEA 3L0NA 1FWBC 1UJQA 4JKMA 3HFYA 5LSMA 1F6KA 4UCFA 2QCCA 1ZJAA 3RPTA 1SZEA 1K7FA 3QYSA 2NV2A 1XX1A 1Q6OA 4C6EA 2AQVA 1IZCA 5XINA 2EKCA 4AISA 1Q8AA 4IGSA 3TQKA 3W02A 5G2HA 3S2NA 1QW9A 4L7ZA 3KS6A 3G0XA 1XH2A 3N3MA 3Q2DA 3ARYA 2GWGA 3C8FA 4IFKA 2VOMA 3W4RA 3CUIA 2A1YA 4OZOA 2VVNA 4MKSA 1RY8A 5C2GA 1BKSA 3LYEA 3A4XA 3GNNA 4MG4A 3CV6A 3GBDA 1DEDA 2G5WA 1NOUA 2VGFA 4PUJA 2J88A 1Q66A 3Q65A 4GJIA 1GEQA 1G1YA 2GSJA 3AYVA 4PMVA 2PDNA 3W00A 5E0CA 5FD0A 4ONVA 3NEVA 4HHLA 1QU4A 3SQLA 1EA9C 1IV8A 3GG7A 4JGDA 4Y7EA 1XUUA 3G1RA 1CI1A 3C0QA 2CKRA 3A12A 4MNMA 2OU4A 3A22A 4XIAA 5LGZA 1YDNA 5EL1A 1MXSA 2JALA 4H41A 5BU6A 4IXHA 1PZ0A 4XSLA 3VKJA 2J4GA 1J0JA 1G67A 1O66A 4DUOA