4E3JA

Crystal structure of ampc beta-lactamase in complex with a designed 4-tetrazolyl benzene sulfonamide boronic acid inhibitor
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
351
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Fragment-guided design of subnanomolar beta-lactamase inhibitors active in vivo.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e3jA00
4YFMA 5M1AA 1XGIA 2ZMAA 2WKEA 3CZDA 4WELA 4N1HA 1TDGA 2RCXA 2UWXA 3BECA 4B4XA 2OV5A 3O3VA 5EE8A 3VP4A 3FV7A 2H5SA 2OLUA 1RGYA 4OLGA 5D3OA 1ES4A 3FKVA 4OLDA 1BT5A 2XD1A 2G2UA 1GHPA 1LLBA 1I2WA 5EVIA 1NXYA 3WRTA 4WEJA 2Y2OA 3IF6B 5FA7A 4GD8A 3S1YA 1O07A 2EX8A 1RP5A 3WWXA 4WZ5C 3RXWA 3VOYA 2J9OA 1K54C 2R9XA 3BFEA 3ZG0A 2HDUA 3UE3A 5EVID 3QNCA 1CK3A 3A3DA 4CJNA 3G34A 4KQRA 3VFFA 4ZJ3A 1Q2QA 3BYDA 3P98A 3CMZA 3UY6A 4S2NC 2XLNA 4GNUA 3TG9A 5CGWA 4LV2A 2QZ6A 3V39A 2GDNA 4ZTKA 2DCFA 3ZVWA 2EX6A 1MWRA 1MWUA 3NDEA 2DNSA 2X71A 5E2FA 1IYSA 3IWIA 5FQIA 2Y2HA 4GN2A 1WYCA 2J8YA 2Y2KA 5HFOA 5FI6A 4R3JA 4FH2A 5CHUA 4DE2A 3Q7VA 1BLCA 4X68A 5JYOA 5FI2A 5FATA 1E4DA 4Q8IA 1XPBA 3MXRA 1BUEA 4KZ3A 4KZ8A 1XGJA 4DRTA 1TEMA 1IYOA 3G31A 3IT9A 4LV3A 2VGJA 4OOLA 5F82A 3OCLA 3TSGA 4JXVA 5FQQA 1NYYA 4P85A 2Y4AA 4WMCA 4X56A 3WS1A 4B4ZA 4BJPA 1WE4A 4KG5A 1YLTA 4S2JA 2BG1A 2PBYA 3FZCA 1MKIA 3FWLA 2WGWA 5AQ9A 3MKEA 1ES2A 3FKWA 4WMCD 5DF7A 3W4PA 5AQBA 3UPPA 3ZHHA 2JBFA 2Y2IA 1K57A 1WYBA 3GV9A 4KZ9A 1PI4A 3N4IA 5FQJA 3B3XA 4X53A 3W4OA 3ZG9B 1MWTA 1JWZA 4S2KA 3LY3A 3ISGA 3NC8A 3HLGA 4KZ6A 1K4EA 1I2SA 3S4XA 4FH4A 1SKFA 1HD8A 3TOIA 4LCMA 2X02A 1SCWA 5EVLA 3O86A 3D4FA 1ZG4A 3V50A 4ZJ1A 4IBXA 2XEPA 5TR7A 2ZM8A 4JXGA 4EBNA 4P87A 1FCMA 1XX2A 4UAAA 1FSYA 3VFHA 1LHYA 3G2ZA 3VP2A 2ZC6B 5FQKA 1YLYA 3A3EA 3HREA 1YMXA 4OQIA 1YLJA 3MZFA 3Q82A 3WS0A 4NK3A 3M2KA 4KG2A 4MBFA 2V2FF 3HLCA 3PBTA 4HBTA 4DE0A 3GTCA 3MZEA 1W8YA 5U47A 2G2WA 1KDWA 3GSGA 1GA0A 5HAIA 5HW3A 1G6AA 3UPOA 5CGXA 3GRJA 4E6WA 1L0DA 3NIAA 1AXBA 2XK1A 1JTGA 4KZ7A 4E3NA 3IF6C 4QY6A 5CGSA 3IHAA 4K91A 1S6RA 2Y91A 3W8KA 4IEDA 4R23A 4FSFA 3ZGAB 4KG6A 3BFCA 3IXDA 3VP0A 3S22A 4BL3A 1ONGA 1BLPA 1MY8A 3BLSA 2C6WB 5EECA 2HP6A 4FCFA 3IXHA 4MEZA 4GB7A 4E3OA 4GOGA 2WKIA 5GHYA 2I72A 1MPLA 1U60A 3G2YA 3A3IA 1EROA 1DJAA 3Q1FA 1BTLA 3VP1A 4OP8A 4E6XA 3C7UA 4E3JA 1W7FA 3VP3A 4A5RA 2CC1A 1K38A 4KQQA 3MKFA 1G68A 4C3QA 5CEBA 2JCHA 1KVLA 5CECA 3GVBA 3HL9A 4MNRA 1CEGA 5TGFA 2WZXA 1PIOA 5EOOA 3AGFA 2IWCA 1KDSA 2HPBA 5GLBA 2JE5A 3IXGA 5E2EA 3ZDJA 2EXAA 2ZLYA 2XQZA 2Y55A 5CTNA 5BOHA 4GDBA 2P9VB 3NCKA 2H0YA 3IWOA 1OMEA 4HEFA 4U3TA 5E2HA 3UDIA 5J8XA 1ES3A 3RXXA 4OPQA 3O87A 3OPRA 1MXOA 4DF6A 1IEMA 2EXBA 2JC7A 2WGVA 5EVIC 4QU3A 2B5RA 4MBKA 3MFDA 5A93A 4E3LA 3DWKA 4JXSA 4WEKA 1LI9A 5DTTA 1K54A 4MLLA 1HVBA 3ITBA 1KGEA 2XD5A 1GCEA 1ZKJA 4CPKA 4F94A 1K4FA 1ZC2A 4R4RA 4S2NA 1L0FA 2ZJ9A 3IH8A 3ZFZA 4UA7A 1MWSA 3RJUA 1NYMA 3G30A 4M3KA 1LL5A 4N9LA 4P6BA 1KVMA 1XKZA 2J9PA 4DXBA 2WAFA 5HARA 1YQSA 4OQ0A 3P09A 4RVAA 4RYEA 5EOEA 1E25A 2ZQCA 1ERMA 2OSUA 3IWQA 1YM1A 2Y59A 1PW1A 1CI9A 1KE4A 2Y2NA 2C5WB 5DVAA 1PZPA 3UDFA 3QHYA 1GHMA 4OKPA 2WUQA 4OP5A 5GHZA 3SH7A 1W8QA 3OPPA 3PBRA 4FD8A 5DF9A 2ZC5B 3G4PA 2FFYA 2HDSA 3HLFA 4KZAA 5CERA 2Q9NA 4LCLA 5EVIB 2EX9A 4D2OA 4RX3A 2Q9MA 4LV1A 4Y7PA 3PAEA 3IXBA 1KE0A 4JKTA 2ZM2A 3O88A 4U0XA 1BLSA 2V20A 1L0GA 2WAEA 2QPNA 4EV4A 3VSLA 4C75A 1L2SA 5FAPA 4BD1A 4GD6A 1H8ZA 2XFSA 3NBLA 4R4SA 4DE1A 1O7EA 5GLDA 2E8IA 1PYYA 3IH9A 3PBQA 4WYYA 2XF3A 1ESUA 5FAQA 3OC2A 1EI5A 1PW8A 1ONHA 1RCJA 2Y2LA 3UE1A 5IHVA 1QMEA 3V3SA 3ZNTA 1N4OA 1PZOA 4BQMA 5G18A 2Z2MB 1M40A 4BL2A 4ZJ2A 2XR0A 3LY4A 3EQUA 1IYPA 4E3KA 5AQ7A 3LEZA 2ZM0A 4OONA 3BFGA 1K55A 3Q7VB 3UDXA 3N8SA 4WZ4A 3V3RA 1E3UA 1NY0A 2WADA 1TVFA 4GZBA 3UNWA 1JWVA 1NJ4A 3IF5A 5DF8A 3A3FA 4OVDA 3C4PA 4LV0A 2XFTA 3I7JA 3NDGA 4MBHA 3BFFA 3OZHA 1E3UD 4N1XA 1Y54A 3G35A 4EBLA 5CXWA 3SS3A 4H8RA 4BENA 1IELA 3M6HA 3OPLA 2IWDA 2PU2A 3Q07A 5F1GA 2VGKA 3ZG7B 4QHCA 3LO7A 3GR2A 2PU4A 3SS5A 1FSWA 3BFDA 4RX2A 4S2LA 1CEFA 4JF6A 3CJMA 4QY5A 5GLCA 3FYZA 1HTZA 5HAQA 1FCOA 1YLWA 4QJGA 1FCNA 1XA7A 3Q7ZA 1FR6A 2HP9A 4KENB 4XUZA 3ZG5A 4DDYA 2ZQAA 2ZQ8A 4UA6A 4OQHA 1VM1A 3IF6A 4U0TA 2ZD8A 1HZOA 2WK0A 1SHVA 3VMAA 3N8LA 2HDRA 5CRFA 3SOIA 1GHIA 5KSCA 3MBZA 1FOFA 5CTMA 4EBPA 5A92A 1KE3A 4OPRA 2V1ZA 3C4OA 1K56A 3HUOA 3WS5A 1S0WA 4C6YA 2DRWA 3UN7A 1FQGA 1PWGA 4N9KA 2FFFB 2A49A 2Y2GA 1NZUA 5FI7A 2ZQ7A 3CG5A 4NETA 5E43A 4X6TA 3Q81A 5F83A 4PM7A 5JYPA 1VQQA 2Y2MA 3M6BA 1BZAA 1XA1A 2BLSA 5KSHA 4Z9QA 4DDSA 4E3IA 3BRMA 4BLMA 3JYIA 1JTDA 5HAPA 1W79A 1I5QA 4K0XA 4XUXA 1DY6A 3UE0A 1W5DA 4PM6A 3HLWA 1YT4A 1NRFA 4WZ5A 3V5MA 2Y2QA 5TFQA 5GLAA 3IHBA 4IBRA 2ZC7A 3ITAA 3WS2A 2ZC3B 1IKIA 1M6KA 3SS4A 4ZDXA 4O7DA 4KZ5A 1K6SA 3E2KA 4PM8A 2IWBA 1K6RA 2QMIA 5KZHA 1ERQA 2H0TA 3MZDA 5M19A 4ID4A 4YINA 4OOYA 3PAGA 4XXRA 3DW0A 1Q2PA 2WZZA 2J7VA 1PWCA 4X55A 1ESIA 1PI5A 3WS4A 3AGDA 3WRZA 5DTSA 4BD0A 1RGZA 3VSKA 3GMWA 4LENA 4S2IA 3GQZA 4EWFA 1BSGA 3HLBA 4KZ4A 1LL9A 4QD4A 1MBLA 1ES5A 5FAOA 1DJCA 3HUNA 2R9WA 4HBUA 1YMSA 4OPYA 3HVFA 3SH8A 1C3BA 2WGIA 5FDHA 3BM6A 1GA9A 4DE3A 4IVIA 4E3MA 5HL1A 1FR1A 3OCNA 3MXSA 1PWDA 1K57C 1K25A 1SDNA 2Z2LB 4JXWA 5I94A 3DWZA 4EQIA 4S2MA 4PM9A 5A90A 4PM5A 4P0MA 3E2LA 4UA9A 5M18A 4JBFA 5FQMA 2ZQDA 4JLFA 3UPNA 3VOZA 2XH9A 4OPZA 3PBNA 4DKIA 3QNBA 1IKGA 2P74A 1BLHA 1NZOA 3BLMA 4Y0OA 3SH9A 4WBGA 1XP4A 3HLDA 3NY4A 4ZAMA 4OOMA 4B88A 5F1FA 2EX2A 5L2FA 1K55C 3LCEA 3BEBA 5FQ9A 3IQAA 4Y0UA 3G32A 4DXCA 1JWPA 2X01A 3N8RA 4L0LA 3PTEA 4JF5A 2WGWB 5CHMA 1ZG6A 1KGFA 4JF4A 2Y2JA 3N7WA 2XGNA 2ZQ9A 5HX9A 4PPRA 2OLVA 4WM9A 3ZCZA 1KGGA 1L0EA 5DTKA 3W4QA 3ZVTA 5FASA 2ZC4B 3ZNYA 3A3JA 3C7VA 4N92A 2HDQA 4OQGA 3EQVA 4S2PA 3ZG8B 3HLEA 4JPMA 3PBSA 5CEDA 3N6IA 5EUAA 3AGEA 1ALQA 1XXMA 2XDMA 2Y2PA 4GKUA 5E2GA 4GDNA 2P9VA 1EWZA 3UO9A 4R1GA 2A3UA 5GHXA 4X69A 2RL3A 1YLZA 4R3BA 5CHJA 4QB8A 3M2JA 1QMFA 2WYXA 4R0QA 4S2OA 4ZBEA 1LI0A 5KMWA 1SDEA 1J9MA 5AQAA 1BULA 2H10A 1H5XA 5GL9A 4Y0TA 3C5AA 1Z6FA 4K0WA 2EFXA 4PMAA 2HP5A 4RA7A 3OPHA 1K56D 2EFUA 3DTMA 4HESA 4IVKA 1IYQA 4KQOA 1CI8A 1H8YA 1YLPA 5FSRA 1JVJA 4KZBA 3NI9A 5A91A 4EUZA 3HUMA 2WKHA 4OH0A 4UHUA 5EPHA 1DJBA 3PBOA 1N9BA 3HBRA 1TDLA
chains in the Genus database with same CATH superfamily
3D72A 2WKEA 5HPFA 2RCXA 2XA7S 4AFIA 4OLGA 3LI9A 3EEAA 5D3OA 3LR4A 2GX5A 2H28A 1I2WA 3IX4A 3IF6B 5FA7A 3S1YA 1DP9A 1O07A 3WWXA 3S7NA 4LGWA 4WZ5C 2OWJA 3BFEA 3UE3A 1CK3A 3A3DA 3G34A 3NOPC 3BYDA 2ZMFA 4LV2A 2QZ6A 2W3FA 1ODVA 2B95A 3LIEA 2X71A 5E2FA 3A0RA 1H8MA 4GN2A 2VJWA 2Y2KA 4X68A 1BLCA 3CUEC 4CQHA 1XGJA 2JKTI 4OOLA 4LV3A 5HL6A 5F82A 3OCLA 1OTIA 4X56A 2Y79A 1VB6A 4WF0A 1T1BA 4S2JA 2PRFA 3T1SA 3FZCA 3FWLA 1ES2A 3ZHHA 2Y2IA 1K57A 1WYBA 4KZ9A 3W4OA 3LY3A 3LFVA 4PKYA 1I2SA 4FH4A 1SKFA 1NLYA 1VEUB 4LCMA 2X02A 1SCWA 4EESA 3K3CA 2XEPA 4UAAA 3ZYTA 5EV0A 1LHYA 1OJGA 3VP2A 3MJQA 2ZL1B 3HREA 3MZFA 3Q82A 2PDRA 4CLCC 3WS0A 4MBFA 2FZ0A 3MZEA 4EERA 5U47A 3UPOA 3LR3A 2XK1A 4KZ7A 1YSPA 1AWIA 4QY6A 1MC0A 3IHAA 5TJJA 3W8KA 3IXDA 1KOUA 4JGRA 3BLSA 4FCFA 2M1CA 2I72A 1CF0A 1MPLA 1EROA 3VP1A 2PAVP 4E3JA 2CC1A 1K38A 4KQQA 2JCHA 2V9AA 2WZXA 1PIOA 4DMZA 1P0ZA 2QWSA 2JE5A 3IXGA 5GLBA 3LR5A 5BOHA 2P9VB 1TD5A 5E2HA 1ES3A 4HJ4A 4IUKA 1XJ2A 5A8BA 4Y2FA 4E3LA 5DTTA 1HVBA 4WN5A 3T4KA 2BASA 3E4OA 4CPKA 4S2NA 1L0FA 2ZJ9A 3ZFZA 4GHIB 4Y13A 1V9YA 3RJUA 3CWFA 3QP1A 4NXGA 2ZQCA 1ERMA 1N9OA 2QYBA 3LIAA 1YM1A 2Y59A 5DVAA 1PZPA 2J3WA 4OP5A 4WUJA 5DF9A 2BTFP 3IX8A 4LLOB 2FFYA 2D01A 2HDSA 5CERA 4LV1A 2V1BA 3O88A 4U0XA 1BLSA 2V20A 4Q0JA 4DE1A 5GLDA 1PYYA 3IH9A 4WYYA 2O9CA 2Y2LA 4EETB 4HY8A 1QMEA 4BQMA 5G18A 3LY4A 3UE6A 1IYPA 3VE3A 5AQ7A 1K55A 3Q7VB 3V3RA 3UNWA 4GZBA 4KUOA 4OVDA 4EXOA 4LV0A 2INWA 4QWOA 4N1XA 4G3WA 4EBLA 5CXWA 1OTEA 5HWWA 4BBUA 2A2LA 2PU2A 3SS5A 1FSWA 3KSFA 2DMWA 3IBRA 3K3DA 1FCOA 4HJ6A 4QJGA 4KENB 4XUZA 5DKLA 2ZQAA 1VM1A 3IF6A 1BYWA 3KSHA 2LB5A 1SHVA 3QP5A 2V1AA 3VMAA 3SOIA 2XROA 4BMWA 4EBPA 1KE3A 2VKSA 4OPRA 2W3EA 1CJFA 3WS5A 1S0WA 1PWGA 4N9KA 2A49A 4RQ9A 4X6TA 3Q81A 5JYPA 4PM7A 1CQAA 3OLOA 1VHMA 1I5QA 4K0XA 4ME4A 3UE0A 1W5DA 4ETXA 3V5MA 4IBRA 1OTBA 5F5YA 5KZHA 2VGLS 4EU0A 4YINA 3T50A 4OOYA 4YWZA 3DW0A 1Q2PA 2WZZA 5DFYA 1PI5A 3WRZA 3VSKA 1VEUA 5F69A 1BSGA 4NG2A 4KZ4A 2V0WA 5G4ZA 1DJCA 4OPYA 2ZL1A 3D3OA 4IVIA 3CLOA 4I3AA 1NLZA 3OCNA 3MXSA 1K25A 1NRJA 2Z2LB 5EFWA 3DWZA 2KLIA 1UWNX 4PM9A 4P0MA 5FQMA 4JLFA 3UPNA 4OPZA 2PD8A 3MMHA 1IKGA 3SH9A 1XP4A 2VLGA 4B88A 5F1FA 2EX2A 5L2FA 1K55C 4DN0A 5FQ9A 4O8GA 3F1NB 1GSVA 3PTEA 1XJ4A 2XGNA 2W1RA 4PPRA 4WM9A 1KGGA 3MQOA 3C7VA 4N92A 3ZG8B 1T1AA 1TF1A 3N6IA 4GKUA 2Y2PA 5E2GA 2P9VA 1V9ZA 3OBFA 4R1GA 4LRYC 3UO9A 3H82A 2QKPA 4X69A 2RL3A 3CPTB 4R0QA 4ZBEA 1QMFA 5KMWA 5G4YA 2VEAA 5DJUA 5AQAA 5CX7A 5GL9A 1Z6FA 4R3AA 1D1JA 2EFXA 3KSIA 4RA7A 2EFUA 4IVKA 1IYQA 4EUZA 3HUMA 4UHUA 2UV0E 4OH0A 5EPHA 1N9BA 1TDLA 5M1AA 4N1HA 2UWXA 1TS8A 2OV5A 5EE8A 4NXEA 2H5SA 2OLUA 1RGYA 3UMEA 3FKVA 4NEED 2XD1A 1GHPA 3T4JA 1LLBA 1NXYA 4WEJA 2Y2OA 2EX8A 1RP5A 3RXWA 3VOYA 2R9XA 2HDUA 3QNCA 4CJNA 2A24A 3LIFA 3P98A 2J3TD 3L7HA 4HH2A 1VETB 3MXQA 2VV7A 4ZTKA 3ZVWA 4X25A 2DNSA 2J8YA 5HFOA 5F68A 1ACFA 4FH2A 5CHUA 3Q7VA 5FATA 2QJ5A 4Q8IA 3MXRA 4DRTA 1TEMA 1F9IA 5FQQA 1NYYA 2Y4AA 5L8MA 4B4ZA 4KG5A 2BG1A 3L9KA 4B93A 2LB9A 3C38A 2WGWA 5AQ9A 2MJ6A 4HP9A 3UPPA 2JBFA 3GV9A 4EUVA 2VX8A 5FQJA 1MWTA 1JWZA 2XSSA 3NC8A 3TOIA 1HD8A 1K0KA 3KO6A 3O86A 4HQAA 1ZG4A 4IBXA 3ZQ5A 1FCMA 3VFHA 1OPXA 3G2ZA 3S7PA 1YMXA 3HCYA 3KYEA 3PBTA 4HBTA 4DE0A 1W8YA 2G2WA 1GA0A 5HAIA 2M7VA 3DBAA 1L0DA 2JKRM 1PNEA 4E3NA 3MR0A 4M4XA 4K91A 1S6RA 2Y91A 4R23A 2XRNA 4FSFA 3VP0A 1MY8A 3H7WB 5EECA 3IXHA 4E3OA 4GB7A 2QJ7A 5GHYA 3G2YA 5EM0A 3Q1FA 1BTLA 3VOLA 4E6XA 3C7UA 3VP3A 1SKOB 1G68A 1WA9A 2V0UA 4C3QA 5HPIA 1A0KA 2GNXA 4EW7A 2YKHA 5J7EA 2IWCA 4YOFA 3KYZA 3CHWP 1S1ZA 4GDBA 3UDIA 4U3TA 3RXXA 3O87A 3F1OB 4DF6A 1IEMA 2WGVA 4BBTA 3MFDA 5A93A 4JXSA 1LI9A 1K54A 1KGEA 4HP4A 4JGPA 1K4FA 5FEGA 2AVXA 4R4RA 3G30A 3MSHA 4F3LA 1YQSA 2D02A 4RYEA 3P09A 4MDZA 1E25A 3PYPA 1CI9A 2Y2NA 2C5WB 5GHZA 4OKPA 3SH7A 4I39A 3PBRA 3CITA 3HLFA 3F1NA 2P08A 1ZHHB 1KE0A 2VA0A 2ZM2A 2HJ9C 1P9WA 1DP8A 2QPNA 4R4SA 3PBQA 5FAQA 2XF3A 4ARZB 1N4OA 4ZJ2A 3EQUA 3CPTA 4E3KA 3LEZA 5CEBA 3EOIA 1NY0A 2WADA 1TVFA 3ULFA 3UMDA 3BY8A 4MBHA 3ICYA 3CI6A 2W27A 2EA9A 4BENA 2IWDA 5F1GA 3LO7A 3GR2A 5FEFA 2P04A 4RX2A 2W0NA 5GLCA 1HTZA 4CLCD 5HAQA 2HP9A 2K31A 3ZG5A 4DDYA 2ZQ8A 4OQHA 1N9LA 3BW6A 5EVEA 2PR5A 5A92A 3K2NA 1TS0A 2IA2A 3UN7A 1FQGA 1VETA 2FFFB 2Y2GA 3HJIA 4XT2B 4MN6A 3T1RA 2HZ5A 4II7A 1IOUA 1VQQA 1XA1A 2BLSA 4WL9A 4I3IA 4MN5A 4BLMA 3H82B 5HAPA 1W79A 4XUXA 1DY6A 3GDIA 3HLWA 1NRFA 3IHBA 3EGDC 3WS2A 1K6SA 3E2KA 2JKGA 3MZDA 3NOTC 3B42A 1UWPX 4Q0HA 4X55A 1ESIA 1S67L 4ESPA 3A0VA 1H3QA 4EWFA 1T18A 2GZAA 1ES5A 4Y3IA 2A24B 2Q0OA 1C3BA 4DE3A 3P01A 5HL1A 3JVUA 1K57C 2HGVA 4UA9A 3TJZC 4R6LA 3VOZA 2XH9A 3BQAA 3PBNA 3BLMA 1NZOA 1TS7A 3NY4A 4O01A 3H7WA 3LCEA 3BEBA 3IQAA 3G32A 2X01A 3N8RA 2WGWB 1ZG6A 4JF4A 3T1QB 3N7WA 1SKOA 5TBMA 5HX9A 3T4QA 3TE8A 3W4QA 5FASA 4GW9A 4JPMA 3FPVA 1S1YA 1EWZA 4P6ZM 2A3UA 4R3BA 3F1OA 1BULA 2H10A 1H5XA 3LI8A 3EEHA 4Q0IA 4PMAA 3OPHA 2HF6A 1YLPA 1JVJA 5A91A 2WKHA 1S66L 1XGIA 4CLCB 1TDGA 1SZVA 3BECA 4UQIM 4B4XA 3VP4A 3FV7A 1ZTUA 3NULA 4OLDA 1BT5A 3LICA 3ZG0A 5EVID 3NHQA 3DAVA 4KQRA 4ZJ3A 1STZA 3CMZA 3UY6A 4S2NC 4GNUA 3TG9A 4ARZA 5I5LA 5AVEA 1Z09A 2GDNA 2JHEA 3T4SA 2ZOIA 1MWRA 3NDEA 4PKYG 1OT6A 1IYSA 5FQIA 2Y2HA 4R3JA 4DE2A 5FI2A 1XPBA 4KZ3A 3OOVA 3TSGA 3T4OA 4NKPA 2PBYA 3MKEA 4WMCD 1HLUP 3W4PA 2G7UA 5AQBA 4F3LB 2Z6DA 4PAUA 3E4QA 3N4IA 3HLGA 4KZ6A 3LYXA 1G28A 3S4XA 1XJ6A 5EVLA 4JGQA 3D4FA 3A0SA 3H9WA 4L9GA 3V50A 2OAP1 5TR7A 3QP2A 4JXGA 4P87A 1XX2A 1W63Q 1FSYA 1F5MA 1P9RA 4XT2A 2ZC6B 5FQKA 1YLYA 4OQIA 1X0OA 4GS9A 3M2KA 4KG2A 2V2FF 3HLCA 3GTCA 1MZUA 3C8CA 3GSGA 4BWIA 5HW3A 1G6AA 3GRJA 2L4RA 3LIDA 3NIAA 1AXBA 3BQ8A 3IF6C 5CGSA 3GECA 4IEDA 4GLQA 3ZGAB 3TRCA 2OAQ1 3S22A 2K2NA 4BL3A 4FTXA 3LEQA 2HP6A 4MEZA 4GOGA 2FH5A 3V67A 1S4RA 1U60A 3A3IA 1DJAA 3EGXC 4A5RA 3SW1A 5IU1A 1KVLA 5CECA 4MNRA 1CEGA 4HOIA 5TGFA 3AGFA 4IJGA 2HPBA 2PR6A 5E2EA 2XQZA 2Y55A 5L10A 5CTNA 4PHTA 2JN7A 5IT5A 1H0MA 2H0YA 3U2AA 3DTKA 4OPQA 3FG8A 4LRZE 4EQ1A 2EXBA 1F2KA 4QU3A 4MBKA 3DWKA 3LGOA 3JVVA 4MLLA 3ITBA 1GCEA 2I9VA 1ZKJA 1NWZA 4LPZA 3MQQA 4F94A 5HD5A 1NYMA 4M3KA 1LL5A 4N9LA 4P6BA 1XKZA 5HARA 2HJEA 2OSUA 1PW1A 3UDFA 1MKMA 3QHYA 1L3LA 1GHMA 2WUQA 3OPPA 3DTIA 3SZTA 3IX3A 5EVIB 4MCWA 4D2OA 2KOIA 2Q9MA 4JKTA 3IXBA 3MS6A 3EWKA 1L0GA 2WAEA 5L07A 3VSLA 4C75A 1L2SA 5FAPA 4HHDA 4GD6A 1H8ZA 2XFSA 1LSXA 1O7EA 2E8IA 1ESUA 1PW8A 3UE1A 2VZWA 5IHVA 3ZNTA 3R4KA 3PXPA 1PZOA 2Z2MB 1M40A 2W1TB 2ZM0A 4OONA 3UDXA 3N8SA 2O0YA 1NJ4A 5C5KA 1XFQA 3F1PA 3I7JA 3NDGA 3OZHA 1E3UD 1Y54A 3G35A 1IELA 3OPLA 1TS6A 4CLCA 2O99A 3BFDA 4JF6A 1S4SA 3FYZA 2CMNA 1YLWA 1XA7A 2JKFA 3LIBA 2ZD8A 1HZOA 3N8LA 5CRFA 5HSQA 3T1XA 2V1ZA 3HUOA 2DRWA 4KQDA 4HH3A 5TBMB 5J4EA 2ZQ7A 5IS1A 1BZAA 5KSHA 2B18A 3PR6A 1LL8A 4Z9QA 3BRMA 1JTDA 4I3JA 4PM6A 2VV8A 1YT4A 2Y2QA 3CAXA 5F6AA 1FIKA 1M6KA 3SS4A 3KX0X 4KZ5A 4PM8A 2IWBA 2QMIA 4ID4A 3VE4A 4YNRA 3UB9A 4ETZA 3FC7A 4XXRA 2J7VA 2JKRI 1OTAA 2P7JA 3WS4A 3AGDA 1RGZA 3GMWA 4LENA 4X1LA 2WKQA 4K08A 4IHQA 3HLBA 1LSVA 4QD4A 1MBLA 4H6JB 4CLCE 2ZMVA 3HUNA 4HBUA 3S7OA 3G6OA 3C30A 3QP4A 3SH8A 1GA9A 5HDCA 2OOLA 4I38A 4JXWA 3MFXA 4FUWA 2VK3A 5M18A 2ZQDA 3E0YA 4EEUA 2E8JA 4DKIA 3D9YA 2P74A 1EW0A 4ZAMA 4OOMA 2VGLM 1LSWA 4Y0UA 4DXCA 3R7WB 1JWPA 4L0LA 2EWWA 5CHMA 1OT9A 1KGFA 1DP6A 2ZQ9A 4R70A 2OLVA 2QHKA 5DTKA 4ZRRA 3ZNYA 3A3JA 3E4PA 2HDQA 4S2PA 3HLEA 3PBSA 5CEDA 4B9OA 4KUKA 1ALQA 4GDNA 2V8FA 5CHJA 5HZHA 3M2JA 4S2OA 3UB5P 3NJAA 4G3VA 1IFQA 4NXBA 4K0WA 4MN7A 4KQOA 1CI8A 1H8YA 4KZBA 3NI9A 4GS9B 3RH8B 2ZBBA 4GJ4A 3T12B 3PBOA 3HBRA 4YFMA 2ZMAA 3CZDA 4WELA 3O3VA 3NECA 1ES4A 2G2UA 5EVIA 3WRTA 4GD8A 5DFXA 3E98A 5EM1A 2J9OA 1K54C 2ZOHA 1YPRA 3U4LP 3VFFA 1Q2QA 2XLNA 5CGWA 3V39A 2DCFA 2VV6A 2EX6A 1MWUA 3IWIA 2KDKA 2EWVA 2NUPC 1WYCA 5FI6A 2W1TA 3O5YA 5JYOA 1E4DA 3VV4A 5HWTA 1Y4OA 4FOFA 1BUEA 5J3WA 4KZ8A 3G31A 1IYOA 3IT9A 2VGJA 1P97A 4JXVA 4P85A 4WMCA 4BJPA 3WS1A 1WE4A 3HJKA 1YLTA 3MQ0A 1W63M 3NOUC 1YSQA 1J3WA 1MKIA 3FKWA 5DF7A 1LT0A 3QP6A 1PI4A 3B3XA 4X53A 3ZG9B 4S2KA 3TW8A 1G6OA 3ISGA 1K4EA 1OJ5A 2PD7A 2PYPA 1GSXA 3MF0A 4ZJ1A 2ZM8A 1T1CA 4EBNA 2ACGA 5LBRA 5KIZA 5HD3A 3A3EA 3UB6A 5DJTA 1YLJA 4NK3A 3BWLA 4G3KA 5K5BA 1KDWA 4Y17A 2M7UA 5CGXA 4E6WA 4JGOA 2L1MA 1JTGA 4L9FA 3IS2B 3RTYA 4KG6A 3BFCA 3F1PB 4R38A 1ONGA 1BLPA 2C6WB 2R78A 5MC7A 3JPUA 4MMNA 2WKIA 2O9BA 2B02A 4OP8A 3LUQA 1W7FA 2PT7A 3MKFA 3QP8A 1OTDA 3GVBA 1XFNA 3UB8A 3HL9A 1FILA 1T19A 5EOOA 1KDSA 3ZDJA 2EXAA 2ZLYA 3P7NA 3T4LA 3NCKA 3IWOA 1OMEA 4HEFA 5J8XA 4H6JA 2GJ3A 3OPRA 1MXOA 2JC7A 1YAXA 5EVIC 2B5RA 4D60A 3UB7A 4WEKA 2XD5A 1JNUA 1GSWA 2W3HA 1UGUA 2J80A 1ZC2A 3IH8A 5FDSA 4LFUA 4UA7A 1MWSA 1N9NA 1KVMA 2J9PA 4DXBA 2WAFA 4OQ0A 5EOEA 4RVAA 4HJ3A 5L09A 3IWQA 1KE4A 3BY9A 2W3GA 1W8QA 4FD8A 2ZC5B 3G4PA 4KZAA 2Q9NA 4LCLA 2EX9A 3R7WA 4RX3A 4Y7PA 3PAEA 2XA7M 4X1MA 5DKKA 4EV4A 3KSGA 4BD1A 3NBLA 4GCZA 4Y5FA 3OC2A 1EI5A 1ONHA 1RCJA 3PHYA 3V3SA 4I5SA 4BL2A 2XR0A 4UEYA 1D7EA 3BFGA 4WZ4A 1E3UA 1PRQA 1JWVA 3IF5A 5DF8A 1F98A 3A3FA 3C4PA 4HI4A 1DRMA 2XFTA 3BFFA 3W2ZA 3S7QA 3SS3A 4H8RA 5HWVA 3M6HA 5HDSA 3Q07A 2VGKA 3ZG7B 4QHCA 1Y28A 2PU4A 4S2LA 4WLAA 1CEFA 2PBDP 3CJMA 4QY5A 4LRXC 1FCNA 3Q7ZA 1FR6A 4UA6A 5AJGA 2K7SA 4U0TA 2WK0A 5FL3A 2HDRA 1GHIA 5KSCA 3MBZA 1FOFA 3C2WA 5CTMA 4Z1WA 3C4OA 2HV1A 1K56A 4C6YA 5FI7A 1NZUA 3DTEA 3CG5A 4NETA 1D06A 5E43A 5F83A 3M6BA 2Y2MA 4GHIA 4DDSA 4E3IA 3JYIA 2V8CA 1PFLA 4WZ5A 3BJNA 5TFQA 5GLAA 2J3TC 2ZC7A 3ITAA 2ZC3B 1IKIA 4ZDXA 4O7DA 1YKDA 1K6RA 1ERQA 2H0TA 4NXFA 5M19A 2KX6A 4HNBA 3PAGA 4E04A 3B47A 5HDDA 4QPRA 5AVFA 1PWCA 3T4TA 4BD0A 1G5UA 3CUEA 5DTSA 4S2IA 3GQZA 1LL9A 4HIAA 5FAOA 4P6ZS 2R9WA 1YMSA 3HVFA 3LR0A 3IBJA 3FPWA 2PYRA 2WGIA 5FDHA 3BM6A 4Y15A 3RFBA 4E3MA 1FR1A 4L9EA 1PWDA 2YKFA 1SDNA 5I94A 4EQIA 4S2MA 2WKRA 4BBVA 5A90A 4PM5A 3E2LA 4JBFA 2Z6CA 3IS2A 3B33A 3QNBA 4Y0OA 1BLHA 2WKPA 4UQIS 4WBGA 3HLDA 4DJ3A 4IUHA 4JF5A 2Y2JA 2OWHA 4EEPA 3KYQA 3ZCZA 1L0EA 3ZVTA 2ZC4B 4OQGA 3EQVA 4DJ2A 5EUAA 3AGEA 1XXMA 2XDMA 4O0PA 2O9AA 5GHXA 1YLZA 2L0WA 2Y8HA 2WYXA 4QB8A 1LI0A 1SDEA 2PHYA 1J9MA 2JKTM 4Y0TA 3C5AA 2HP5A 2NUTC 1K56D 2W3DA 3DTMA 4HESA 5FSRA 1XJ3A 1DJBA
chains in the Genus database with same CATH topology
4YFMA 5M1AA 1XGIA 2ZMAA 2WKEA 3CZDA 4WELA 4N1HA 1TDGA 2RCXA 2UWXA 3BECA 4B4XA 2OV5A 3O3VA 5EE8A 3VP4A 3FV7A 2H5SA 2OLUA 1RGYA 4OLGA 5D3OA 1ES4A 3FKVA 4OLDA 1BT5A 2XD1A 2G2UA 1GHPA 1LLBA 1I2WA 5EVIA 1NXYA 3WRTA 4WEJA 2Y2OA 3IF6B 5FA7A 4GD8A 3S1YA 1O07A 2EX8A 1RP5A 3WWXA 4WZ5C 3RXWA 3VOYA 2J9OA 1K54C 2R9XA 3BFEA 3ZG0A 2HDUA 3UE3A 5EVID 3QNCA 1CK3A 3A3DA 4CJNA 3G34A 4KQRA 3VFFA 4ZJ3A 1Q2QA 3BYDA 3P98A 3CMZA 3UY6A 4S2NC 2XLNA 4GNUA 3TG9A 5CGWA 4LV2A 2QZ6A 3V39A 2GDNA 4ZTKA 2DCFA 3ZVWA 2EX6A 1MWRA 1MWUA 3NDEA 2DNSA 2X71A 5E2FA 1IYSA 3IWIA 5FQIA 2Y2HA 4GN2A 1WYCA 2J8YA 2Y2KA 5HFOA 5FI6A 4R3JA 4FH2A 5CHUA 4DE2A 3Q7VA 1BLCA 4X68A 5JYOA 5FI2A 5FATA 1E4DA 4Q8IA 1XPBA 3MXRA 1BUEA 4KZ3A 4KZ8A 1XGJA 4DRTA 1TEMA 1IYOA 3G31A 3IT9A 4LV3A 2VGJA 4OOLA 5F82A 3OCLA 3TSGA 4JXVA 5FQQA 1NYYA 4P85A 2Y4AA 4WMCA 4X56A 3WS1A 4B4ZA 4BJPA 1WE4A 4KG5A 1YLTA 4S2JA 2BG1A 2PBYA 3FZCA 1MKIA 3FWLA 2WGWA 5AQ9A 3MKEA 1ES2A 3FKWA 4WMCD 5DF7A 3W4PA 5AQBA 3UPPA 3ZHHA 2JBFA 2Y2IA 1K57A 1WYBA 3GV9A 4KZ9A 1PI4A 3N4IA 5FQJA 3B3XA 4X53A 3W4OA 3ZG9B 1MWTA 1JWZA 4S2KA 3LY3A 3ISGA 3NC8A 3HLGA 4KZ6A 1K4EA 1I2SA 3S4XA 4FH4A 1SKFA 1HD8A 3TOIA 4LCMA 2X02A 1SCWA 5EVLA 3O86A 3D4FA 1ZG4A 3V50A 4ZJ1A 4IBXA 2XEPA 5TR7A 2ZM8A 4JXGA 4EBNA 4P87A 1FCMA 1XX2A 4UAAA 1FSYA 3VFHA 1LHYA 3G2ZA 3VP2A 2ZC6B 5FQKA 1YLYA 3A3EA 3HREA 1YMXA 4OQIA 1YLJA 3MZFA 3Q82A 3WS0A 4NK3A 3M2KA 4KG2A 4MBFA 2V2FF 3HLCA 3PBTA 4HBTA 4DE0A 3GTCA 3MZEA 1W8YA 5U47A 2G2WA 1KDWA 3GSGA 1GA0A 5HAIA 5HW3A 1G6AA 3UPOA 5CGXA 3GRJA 4E6WA 1L0DA 3NIAA 1AXBA 2XK1A 1JTGA 4KZ7A 4E3NA 3IF6C 4QY6A 5CGSA 3IHAA 4K91A 1S6RA 2Y91A 3W8KA 4IEDA 4R23A 4FSFA 3ZGAB 4KG6A 3BFCA 3IXDA 3VP0A 3S22A 4BL3A 1ONGA 1BLPA 1MY8A 3BLSA 2C6WB 5EECA 2HP6A 4FCFA 3IXHA 4MEZA 4GB7A 4E3OA 4GOGA 2WKIA 5GHYA 2I72A 1MPLA 1U60A 3G2YA 3A3IA 1EROA 1DJAA 3Q1FA 1BTLA 3VP1A 4OP8A 4E6XA 3C7UA 4E3JA 1W7FA 3VP3A 4A5RA 2CC1A 1K38A 4KQQA 3MKFA 1G68A 4C3QA 5CEBA 2JCHA 1KVLA 5CECA 3GVBA 3HL9A 4MNRA 1CEGA 5TGFA 2WZXA 1PIOA 5EOOA 3AGFA 2IWCA 1KDSA 2HPBA 5GLBA 2JE5A 3IXGA 5E2EA 3ZDJA 2EXAA 2ZLYA 2XQZA 2Y55A 5CTNA 5BOHA 4GDBA 2P9VB 3NCKA 2H0YA 3IWOA 1OMEA 4HEFA 4U3TA 5E2HA 3UDIA 5J8XA 1ES3A 3RXXA 4OPQA 3O87A 3OPRA 1MXOA 4DF6A 1IEMA 2EXBA 2JC7A 2WGVA 5EVIC 4QU3A 2B5RA 4MBKA 3MFDA 5A93A 4E3LA 3DWKA 4JXSA 4WEKA 1LI9A 5DTTA 1K54A 4MLLA 1HVBA 3ITBA 1KGEA 2XD5A 1GCEA 1ZKJA 4CPKA 4F94A 1K4FA 1ZC2A 4R4RA 4S2NA 1L0FA 2ZJ9A 3IH8A 3ZFZA 4UA7A 1MWSA 3RJUA 1NYMA 3G30A 4M3KA 1LL5A 4N9LA 4P6BA 1KVMA 1XKZA 2J9PA 4DXBA 2WAFA 5HARA 1YQSA 4OQ0A 3P09A 4RVAA 4RYEA 5EOEA 1E25A 2ZQCA 1ERMA 2OSUA 3IWQA 1YM1A 2Y59A 1PW1A 1CI9A 1KE4A 2Y2NA 2C5WB 5DVAA 1PZPA 3UDFA 3QHYA 1GHMA 4OKPA 2WUQA 4OP5A 5GHZA 3SH7A 1W8QA 3OPPA 3PBRA 4FD8A 5DF9A 2ZC5B 3G4PA 2FFYA 2HDSA 3HLFA 4KZAA 5CERA 2Q9NA 4LCLA 5EVIB 2EX9A 4D2OA 4RX3A 2Q9MA 4LV1A 4Y7PA 3PAEA 3IXBA 1KE0A 4JKTA 2ZM2A 3O88A 4U0XA 1BLSA 2V20A 1L0GA 2WAEA 2QPNA 4EV4A 3VSLA 4C75A 1L2SA 5FAPA 4BD1A 4GD6A 1H8ZA 2XFSA 3NBLA 4R4SA 4DE1A 1O7EA 5GLDA 2E8IA 1PYYA 3IH9A 3PBQA 4WYYA 2XF3A 1ESUA 5FAQA 3OC2A 1EI5A 1PW8A 1ONHA 1RCJA 2Y2LA 3UE1A 5IHVA 1QMEA 3V3SA 3ZNTA 1N4OA 1PZOA 4BQMA 5G18A 2Z2MB 1M40A 4BL2A 4ZJ2A 2XR0A 3LY4A 3EQUA 1IYPA 4E3KA 5AQ7A 3LEZA 2ZM0A 4OONA 3BFGA 1K55A 3Q7VB 3UDXA 3N8SA 4WZ4A 3V3RA 1E3UA 1NY0A 2WADA 1TVFA 4GZBA 3UNWA 1JWVA 1NJ4A 3IF5A 5DF8A 3A3FA 4OVDA 3C4PA 4LV0A 2XFTA 3I7JA 3NDGA 4MBHA 3BFFA 3OZHA 1E3UD 4N1XA 1Y54A 3G35A 4EBLA 5CXWA 3SS3A 4H8RA 4BENA 1IELA 3M6HA 3OPLA 2IWDA 2PU2A 3Q07A 5F1GA 2VGKA 3ZG7B 4QHCA 3LO7A 3GR2A 2PU4A 3SS5A 1FSWA 3BFDA 4RX2A 4S2LA 1CEFA 4JF6A 3CJMA 4QY5A 5GLCA 3FYZA 1HTZA 5HAQA 1FCOA 1YLWA 4QJGA 1FCNA 1XA7A 3Q7ZA 1FR6A 2HP9A 4KENB 4XUZA 3ZG5A 4DDYA 2ZQAA 2ZQ8A 4UA6A 4OQHA 1VM1A 3IF6A 4U0TA 2ZD8A 1HZOA 2WK0A 1SHVA 3VMAA 3N8LA 2HDRA 5CRFA 3SOIA 1GHIA 5KSCA 3MBZA 1FOFA 5CTMA 4EBPA 5A92A 1KE3A 4OPRA 2V1ZA 3C4OA 1K56A 3HUOA 3WS5A 1S0WA 4C6YA 2DRWA 3UN7A 1FQGA 1PWGA 4N9KA 2FFFB 2A49A 2Y2GA 1NZUA 5FI7A 2ZQ7A 3CG5A 4NETA 5E43A 4X6TA 3Q81A 5F83A 4PM7A 5JYPA 1VQQA 2Y2MA 3M6BA 1BZAA 1XA1A 2BLSA 5KSHA 4Z9QA 4DDSA 4E3IA 3BRMA 4BLMA 3JYIA 1JTDA 5HAPA 1W79A 1I5QA 4K0XA 4XUXA 1DY6A 3UE0A 1W5DA 4PM6A 3HLWA 1YT4A 1NRFA 4WZ5A 3V5MA 2Y2QA 5TFQA 5GLAA 3IHBA 4IBRA 2ZC7A 3ITAA 3WS2A 2ZC3B 1IKIA 1M6KA 3SS4A 4ZDXA 4O7DA 4KZ5A 1K6SA 3E2KA 4PM8A 2IWBA 1K6RA 2QMIA 5KZHA 1ERQA 2H0TA 3MZDA 5M19A 4ID4A 4YINA 4OOYA 3PAGA 4XXRA 3DW0A 1Q2PA 2WZZA 2J7VA 1PWCA 4X55A 1ESIA 1PI5A 3WS4A 3AGDA 3WRZA 5DTSA 4BD0A 1RGZA 3VSKA 3GMWA 4LENA 4S2IA 3GQZA 4EWFA 1BSGA 3HLBA 4KZ4A 1LL9A 4QD4A 1MBLA 1ES5A 5FAOA 1DJCA 3HUNA 2R9WA 4HBUA 1YMSA 4OPYA 3HVFA 3SH8A 1C3BA 2WGIA 5FDHA 3BM6A 1GA9A 4DE3A 4IVIA 4E3MA 5HL1A 1FR1A 3OCNA 3MXSA 1PWDA 1K57C 1K25A 1SDNA 2Z2LB 4JXWA 5I94A 3DWZA 4EQIA 4S2MA 4PM9A 5A90A 4PM5A 4P0MA 3E2LA 4UA9A 5M18A 4JBFA 5FQMA 2ZQDA 4JLFA 3UPNA 3VOZA 2XH9A 4OPZA 3PBNA 4DKIA 3QNBA 1IKGA 2P74A 1BLHA 1NZOA 3BLMA 4Y0OA 3SH9A 4WBGA 1XP4A 3HLDA 3NY4A 4ZAMA 4OOMA 4B88A 5F1FA 2EX2A 5L2FA 1K55C 3LCEA 3BEBA 5FQ9A 3IQAA 4Y0UA 3G32A 4DXCA 1JWPA 2X01A 3N8RA 4L0LA 3PTEA 4JF5A 2WGWB 5CHMA 1ZG6A 1KGFA 4JF4A 2Y2JA 3N7WA 2XGNA 2ZQ9A 5HX9A 4PPRA 2OLVA 4WM9A 3ZCZA 1KGGA 1L0EA 5DTKA 3W4QA 3ZVTA 5FASA 2ZC4B 3ZNYA 3A3JA 3C7VA 4N92A 2HDQA 4OQGA 3EQVA 4S2PA 3ZG8B 3HLEA 4JPMA 3PBSA 5CEDA 3N6IA 5EUAA 3AGEA 1ALQA 1XXMA 2XDMA 2Y2PA 4GKUA 5E2GA 4GDNA 2P9VA 1EWZA 3UO9A 4R1GA 2A3UA 5GHXA 4X69A 2RL3A 1YLZA 4R3BA 5CHJA 4QB8A 3M2JA 1QMFA 2WYXA 4R0QA 4S2OA 4ZBEA 1LI0A 5KMWA 1SDEA 1J9MA 5AQAA 1BULA 2H10A 1H5XA 5GL9A 4Y0TA 3C5AA 1Z6FA 4K0WA 2EFXA 4PMAA 2HP5A 4RA7A 3OPHA 1K56D 2EFUA 3DTMA 4HESA 4IVKA 1IYQA 4KQOA 1CI8A 1H8YA 1YLPA 5FSRA 1JVJA 4KZBA 3NI9A 5A91A 4EUZA 3HUMA 2WKHA 4OH0A 4UHUA 5EPHA 1DJBA 3PBOA 1N9BA 3HBRA 1TDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFM A;  5M1A A;  1XGI A;  2ZMA A;  2WKE A;  3CZD A;  4WEL A;  4N1H A;  1TDG A;  2RCX A;  2UWX A;  3BEC A;  4B4X A;  2OV5 A;  3O3V A;  5EE8 A;  3VP4 A;  3FV7 A;  2H5S A;  2OLU A;  1RGY A;  4OLG A;  5D3O A;  1ES4 A;  3FKV A;  4OLD A;  1BT5 A;  2XD1 A;  2G2U A;  1GHP A;  1LLB A;  1I2W A;  5EVI A;  1NXY A;  3WRT A;  4WEJ A;  2Y2O A;  3IF6 B;  5FA7 A;  4GD8 A;  3S1Y A;  1O07 A;  2EX8 A;  1RP5 A;  3WWX A;  4WZ5 C;  3RXW A;  3VOY A;  2J9O A;  1K54 C;  2R9X A;  3BFE A;  3ZG0 A;  2HDU A;  3UE3 A;  5EVI D;  3QNC A;  1CK3 A;  3A3D A;  4CJN A;  3G34 A;  4KQR A;  3VFF A;  4ZJ3 A;  1Q2Q A;  3BYD A;  3P98 A;  3CMZ A;  3UY6 A;  4S2N C;  2XLN A;  4GNU A;  3TG9 A;  5CGW A;  4LV2 A;  2QZ6 A;  3V39 A;  2GDN A;  4ZTK A;  2DCF A;  3ZVW A;  2EX6 A;  1MWR A;  1MWU A;  3NDE A;  2DNS A;  2X71 A;  5E2F A;  1IYS A;  3IWI A;  5FQI A;  2Y2H A;  4GN2 A;  1WYC A;  2J8Y A;  2Y2K A;  5HFO A;  5FI6 A;  4R3J A;  4FH2 A;  5CHU A;  4DE2 A;  3Q7V A;  1BLC A;  4X68 A;  5JYO A;  5FI2 A;  5FAT A;  1E4D A;  4Q8I A;  1XPB A;  3MXR A;  1BUE A;  4KZ3 A;  4KZ8 A;  1XGJ A;  4DRT A;  1TEM A;  1IYO A;  3G31 A;  3IT9 A;  4LV3 A;  2VGJ A;  4OOL A;  5F82 A;  3OCL A;  3TSG A;  4JXV A;  5FQQ A;  1NYY A;  4P85 A;  2Y4A A;  4WMC A;  4X56 A;  3WS1 A;  4B4Z A;  4BJP A;  1WE4 A;  4KG5 A;  1YLT A;  4S2J A;  2BG1 A;  2PBY A;  3FZC A;  1MKI A;  3FWL A;  2WGW A;  5AQ9 A;  3MKE A;  1ES2 A;  3FKW A;  4WMC D;  5DF7 A;  3W4P A;  5AQB A;  3UPP A;  3ZHH A;  2JBF A;  2Y2I A;  1K57 A;  1WYB A;  3GV9 A;  4KZ9 A;  1PI4 A;  3N4I A;  5FQJ A;  3B3X A;  4X53 A;  3W4O A;  3ZG9 B;  1MWT A;  1JWZ A;  4S2K A;  3LY3 A;  3ISG A;  3NC8 A;  3HLG A;  4KZ6 A;  1K4E A;  1I2S A;  3S4X A;  4FH4 A;  1SKF A;  1HD8 A;  3TOI A;  4LCM A;  2X02 A;  1SCW A;  5EVL A;  3O86 A;  3D4F A;  1ZG4 A;  3V50 A;  4ZJ1 A;  4IBX A;  2XEP A;  5TR7 A;  2ZM8 A;  4JXG A;  4EBN A;  4P87 A;  1FCM A;  1XX2 A;  4UAA A;  1FSY A;  3VFH A;  1LHY A;  3G2Z A;  3VP2 A;  2ZC6 B;  5FQK A;  1YLY A;  3A3E A;  3HRE A;  1YMX A;  4OQI A;  1YLJ A;  3MZF A;  3Q82 A;  3WS0 A;  4NK3 A;  3M2K A;  4KG2 A;  4MBF A;  2V2F F;  3HLC A;  3PBT A;  4HBT A;  4DE0 A;  3GTC A;  3MZE A;  1W8Y A;  5U47 A;  2G2W A;  1KDW A;  3GSG A;  1GA0 A;  5HAI A;  5HW3 A;  1G6A A;  3UPO A;  5CGX A;  3GRJ A;  4E6W A;  1L0D A;  3NIA A;  1AXB A;  2XK1 A;  1JTG A;  4KZ7 A;  4E3N A;  3IF6 C;  4QY6 A;  5CGS A;  3IHA A;  4K91 A;  1S6R A;  2Y91 A;  3W8K A;  4IED A;  4R23 A;  4FSF A;  3ZGA B;  4KG6 A;  3BFC A;  3IXD A;  3VP0 A;  3S22 A;  4BL3 A;  1ONG A;  1BLP A;  1MY8 A;  3BLS A;  2C6W B;  5EEC A;  2HP6 A;  4FCF A;  3IXH A;  4MEZ A;  4GB7 A;  4E3O A;  4GOG A;  2WKI A;  5GHY A;  2I72 A;  1MPL A;  1U60 A;  3G2Y A;  3A3I A;  1ERO A;  1DJA A;  3Q1F A;  1BTL A;  3VP1 A;  4OP8 A;  4E6X A;  3C7U A;  4E3J A;  1W7F A;  3VP3 A;  4A5R A;  2CC1 A;  1K38 A;  4KQQ A;  3MKF A;  1G68 A;  4C3Q A;  5CEB A;  2JCH A;  1KVL A;  5CEC A;  3GVB A;  3HL9 A;  4MNR A;  1CEG A;  5TGF A;  2WZX A;  1PIO A;  5EOO A;  3AGF A;  2IWC A;  1KDS A;  2HPB A;  5GLB A;  2JE5 A;  3IXG A;  5E2E A;  3ZDJ A;  2EXA A;  2ZLY A;  2XQZ A;  2Y55 A;  5CTN A;  5BOH A;  4GDB A;  2P9V B;  3NCK A;  2H0Y A;  3IWO A;  1OME A;  4HEF A;  4U3T A;  5E2H A;  3UDI A;  5J8X A;  1ES3 A;  3RXX A;  4OPQ A;  3O87 A;  3OPR A;  1MXO A;  4DF6 A;  1IEM A;  2EXB A;  2JC7 A;  2WGV A;  5EVI C;  4QU3 A;  2B5R A;  4MBK A;  3MFD A;  5A93 A;  4E3L A;  3DWK A;  4JXS A;  4WEK A;  1LI9 A;  5DTT A;  1K54 A;  4MLL A;  1HVB A;  3ITB A;  1KGE A;  2XD5 A;  1GCE A;  1ZKJ A;  4CPK A;  4F94 A;  1K4F A;  1ZC2 A;  4R4R A;  4S2N A;  1L0F A;  2ZJ9 A;  3IH8 A;  3ZFZ A;  4UA7 A;  1MWS A;  3RJU A;  1NYM A;  3G30 A;  4M3K A;  1LL5 A;  4N9L A;  4P6B A;  1KVM A;  1XKZ A;  2J9P A;  4DXB A;  2WAF A;  5HAR A;  1YQS A;  4OQ0 A;  3P09 A;  4RVA A;  4RYE A;  5EOE A;  1E25 A;  2ZQC A;  1ERM A;  2OSU A;  3IWQ A;  1YM1 A;  2Y59 A;  1PW1 A;  1CI9 A;  1KE4 A;  2Y2N A;  2C5W B;  5DVA A;  1PZP A;  3UDF A;  3QHY A;  1GHM A;  4OKP A;  2WUQ A;  4OP5 A;  5GHZ A;  3SH7 A;  1W8Q A;  3OPP A;  3PBR A;  4FD8 A;  5DF9 A;  2ZC5 B;  3G4P A;  2FFY A;  2HDS A;  3HLF A;  4KZA A;  5CER A;  2Q9N A;  4LCL A;  5EVI B;  2EX9 A;  4D2O A;  4RX3 A;  2Q9M A;  4LV1 A;  4Y7P A;  3PAE A;  3IXB A;  1KE0 A;  4JKT A;  2ZM2 A;  3O88 A;  4U0X A;  1BLS A;  2V20 A;  1L0G A;  2WAE A;  2QPN A;  4EV4 A;  3VSL A;  4C75 A;  1L2S A;  5FAP A;  4BD1 A;  4GD6 A;  1H8Z A;  2XFS A;  3NBL A;  4R4S A;  4DE1 A;  1O7E A;  5GLD A;  2E8I A;  1PYY A;  3IH9 A;  3PBQ A;  4WYY A;  2XF3 A;  1ESU A;  5FAQ A;  3OC2 A;  1EI5 A;  1PW8 A;  1ONH A;  1RCJ A;  2Y2L A;  3UE1 A;  5IHV A;  1QME A;  3V3S A;  3ZNT A;  1N4O A;  1PZO A;  4BQM A;  5G18 A;  2Z2M B;  1M40 A;  4BL2 A;  4ZJ2 A;  2XR0 A;  3LY4 A;  3EQU A;  1IYP A;  4E3K A;  5AQ7 A;  3LEZ A;  2ZM0 A;  4OON A;  3BFG A;  1K55 A;  3Q7V B;  3UDX A;  3N8S A;  4WZ4 A;  3V3R A;  1E3U A;  1NY0 A;  2WAD A;  1TVF A;  4GZB A;  3UNW A;  1JWV A;  1NJ4 A;  3IF5 A;  5DF8 A;  3A3F A;  4OVD A;  3C4P A;  4LV0 A;  2XFT A;  3I7J A;  3NDG A;  4MBH A;  3BFF A;  3OZH A;  1E3U D;  4N1X A;  1Y54 A;  3G35 A;  4EBL A;  5CXW A;  3SS3 A;  4H8R A;  4BEN A;  1IEL A;  3M6H A;  3OPL A;  2IWD A;  2PU2 A;  3Q07 A;  5F1G A;  2VGK A;  3ZG7 B;  4QHC A;  3LO7 A;  3GR2 A;  2PU4 A;  3SS5 A;  1FSW A;  3BFD A;  4RX2 A;  4S2L A;  1CEF A;  4JF6 A;  3CJM A;  4QY5 A;  5GLC A;  3FYZ A;  1HTZ A;  5HAQ A;  1FCO A;  1YLW A;  4QJG A;  1FCN A;  1XA7 A;  3Q7Z A;  1FR6 A;  2HP9 A;  4KEN B;  4XUZ A;  3ZG5 A;  4DDY A;  2ZQA A;  2ZQ8 A;  4UA6 A;  4OQH A;  1VM1 A;  3IF6 A;  4U0T A;  2ZD8 A;  1HZO A;  2WK0 A;  1SHV A;  3VMA A;  3N8L A;  2HDR A;  5CRF A;  3SOI A;  1GHI A;  5KSC A;  3MBZ A;  1FOF A;  5CTM A;  4EBP A;  5A92 A;  1KE3 A;  4OPR A;  2V1Z A;  3C4O A;  1K56 A;  3HUO A;  3WS5 A;  1S0W A;  4C6Y A;  2DRW A;  3UN7 A;  1FQG A;  1PWG A;  4N9K A;  2FFF B;  2A49 A;  2Y2G A;  1NZU A;  5FI7 A;  2ZQ7 A;  3CG5 A;  4NET A;  5E43 A;  4X6T A;  3Q81 A;  5F83 A;  4PM7 A;  5JYP A;  1VQQ A;  2Y2M A;  3M6B A;  1BZA A;  1XA1 A;  2BLS A;  5KSH A;  4Z9Q A;  4DDS A;  4E3I A;  3BRM A;  4BLM A;  3JYI A;  1JTD A;  5HAP A;  1W79 A;  1I5Q A;  4K0X A;  4XUX A;  1DY6 A;  3UE0 A;  1W5D A;  4PM6 A;  3HLW A;  1YT4 A;  1NRF A;  4WZ5 A;  3V5M A;  2Y2Q A;  5TFQ A;  5GLA A;  3IHB A;  4IBR A;  2ZC7 A;  3ITA A;  3WS2 A;  2ZC3 B;  1IKI A;  1M6K A;  3SS4 A;  4ZDX A;  4O7D A;  4KZ5 A;  1K6S A;  3E2K A;  4PM8 A;  2IWB A;  1K6R A;  2QMI A;  5KZH A;  1ERQ A;  2H0T A;  3MZD A;  5M19 A;  4ID4 A;  4YIN A;  4OOY A;  3PAG A;  4XXR A;  3DW0 A;  1Q2P A;  2WZZ A;  2J7V A;  1PWC A;  4X55 A;  1ESI A;  1PI5 A;  3WS4 A;  3AGD A;  3WRZ A;  5DTS A;  4BD0 A;  1RGZ A;  3VSK A;  3GMW A;  4LEN A;  4S2I A;  3GQZ A;  4EWF A;  1BSG A;  3HLB A;  4KZ4 A;  1LL9 A;  4QD4 A;  1MBL A;  1ES5 A;  5FAO A;  1DJC A;  3HUN A;  2R9W A;  4HBU A;  1YMS A;  4OPY A;  3HVF A;  3SH8 A;  1C3B A;  2WGI A;  5FDH A;  3BM6 A;  1GA9 A;  4DE3 A;  4IVI A;  4E3M A;  5HL1 A;  1FR1 A;  3OCN A;  3MXS A;  1PWD A;  1K57 C;  1K25 A;  1SDN A;  2Z2L B;  4JXW A;  5I94 A;  3DWZ A;  4EQI A;  4S2M A;  4PM9 A;  5A90 A;  4PM5 A;  4P0M A;  3E2L A;  4UA9 A;  5M18 A;  4JBF A;  5FQM A;  2ZQD A;  4JLF A;  3UPN A;  3VOZ A;  2XH9 A;  4OPZ A;  3PBN A;  4DKI A;  3QNB A;  1IKG A;  2P74 A;  1BLH A;  1NZO A;  3BLM A;  4Y0O A;  3SH9 A;  4WBG A;  1XP4 A;  3HLD A;  3NY4 A;  4ZAM A;  4OOM A;  4B88 A;  5F1F A;  2EX2 A;  5L2F A;  1K55 C;  3LCE A;  3BEB A;  5FQ9 A;  3IQA A;  4Y0U A;  3G32 A;  4DXC A;  1JWP A;  2X01 A;  3N8R A;  4L0L A;  3PTE A;  4JF5 A;  2WGW B;  5CHM A;  1ZG6 A;  1KGF A;  4JF4 A;  2Y2J A;  3N7W A;  2XGN A;  2ZQ9 A;  5HX9 A;  4PPR A;  2OLV A;  4WM9 A;  3ZCZ A;  1KGG A;  1L0E A;  5DTK A;  3W4Q A;  3ZVT A;  5FAS A;  2ZC4 B;  3ZNY A;  3A3J A;  3C7V A;  4N92 A;  2HDQ A;  4OQG A;  3EQV A;  4S2P A;  3ZG8 B;  3HLE A;  4JPM A;  3PBS A;  5CED A;  3N6I A;  5EUA A;  3AGE A;  1ALQ A;  1XXM A;  2XDM A;  2Y2P A;  4GKU A;  5E2G A;  4GDN A;  2P9V A;  1EWZ A;  3UO9 A;  4R1G A;  2A3U A;  5GHX A;  4X69 A;  2RL3 A;  1YLZ A;  4R3B A;  5CHJ A;  4QB8 A;  3M2J A;  1QMF A;  2WYX A;  4R0Q A;  4S2O A;  4ZBE A;  1LI0 A;  5KMW A;  1SDE A;  1J9M A;  5AQA A;  1BUL A;  2H10 A;  1H5X A;  5GL9 A;  4Y0T A;  3C5A A;  1Z6F A;  4K0W A;  2EFX A;  4PMA A;  2HP5 A;  4RA7 A;  3OPH A;  1K56 D;  2EFU A;  3DTM A;  4HES A;  4IVK A;  1IYQ A;  4KQO A;  1CI8 A;  1H8Y A;  1YLP A;  5FSR A;  1JVJ A;  4KZB A;  3NI9 A;  5A91 A;  4EUZ A;  3HUM A;  2WKH A;  4OH0 A;  4UHU A;  5EPH A;  1DJB A;  3PBO A;  1N9B A;  3HBR A;  1TDL A; 
#chains in the Genus database with same CATH topology
 3D72 A;  2WKE A;  5HPF A;  2RCX A;  2XA7 S;  4AFI A;  4OLG A;  3LI9 A;  3EEA A;  5D3O A;  3LR4 A;  2GX5 A;  2H28 A;  1I2W A;  3IX4 A;  3IF6 B;  5FA7 A;  3S1Y A;  1DP9 A;  1O07 A;  3WWX A;  3S7N A;  4LGW A;  4WZ5 C;  2OWJ A;  3BFE A;  3UE3 A;  1CK3 A;  3A3D A;  3G34 A;  3NOP C;  3BYD A;  2ZMF A;  4LV2 A;  2QZ6 A;  2W3F A;  1ODV A;  2B95 A;  3LIE A;  2X71 A;  5E2F A;  3A0R A;  1H8M A;  4GN2 A;  2VJW A;  2Y2K A;  4X68 A;  1BLC A;  3CUE C;  4CQH A;  1XGJ A;  2JKT I;  4OOL A;  4LV3 A;  5HL6 A;  5F82 A;  3OCL A;  1OTI A;  4X56 A;  2Y79 A;  1VB6 A;  4WF0 A;  1T1B A;  4S2J A;  2PRF A;  3T1S A;  3FZC A;  3FWL A;  1ES2 A;  3ZHH A;  2Y2I A;  1K57 A;  1WYB A;  4KZ9 A;  3W4O A;  3LY3 A;  3LFV A;  4PKY A;  1I2S A;  4FH4 A;  1SKF A;  1NLY A;  1VEU B;  4LCM A;  2X02 A;  1SCW A;  4EES A;  3K3C A;  2XEP A;  4UAA A;  3ZYT A;  5EV0 A;  1LHY A;  1OJG A;  3VP2 A;  3MJQ A;  2ZL1 B;  3HRE A;  3MZF A;  3Q82 A;  2PDR A;  4CLC C;  3WS0 A;  4MBF A;  2FZ0 A;  3MZE A;  4EER A;  5U47 A;  3UPO A;  3LR3 A;  2XK1 A;  4KZ7 A;  1YSP A;  1AWI A;  4QY6 A;  1MC0 A;  3IHA A;  5TJJ A;  3W8K A;  3IXD A;  1KOU A;  4JGR A;  3BLS A;  4FCF A;  2M1C A;  2I72 A;  1CF0 A;  1MPL A;  1ERO A;  3VP1 A;  2PAV P;  4E3J A;  2CC1 A;  1K38 A;  4KQQ A;  2JCH A;  2V9A A;  2WZX A;  1PIO A;  4DMZ A;  1P0Z A;  2QWS A;  2JE5 A;  3IXG A;  5GLB A;  3LR5 A;  5BOH A;  2P9V B;  1TD5 A;  5E2H A;  1ES3 A;  4HJ4 A;  4IUK A;  1XJ2 A;  5A8B A;  4Y2F A;  4E3L A;  5DTT A;  1HVB A;  4WN5 A;  3T4K A;  2BAS A;  3E4O A;  4CPK A;  4S2N A;  1L0F A;  2ZJ9 A;  3ZFZ A;  4GHI B;  4Y13 A;  1V9Y A;  3RJU A;  3CWF A;  3QP1 A;  4NXG A;  2ZQC A;  1ERM A;  1N9O A;  2QYB A;  3LIA A;  1YM1 A;  2Y59 A;  5DVA A;  1PZP A;  2J3W A;  4OP5 A;  4WUJ A;  5DF9 A;  2BTF P;  3IX8 A;  4LLO B;  2FFY A;  2D01 A;  2HDS A;  5CER A;  4LV1 A;  2V1B A;  3O88 A;  4U0X A;  1BLS A;  2V20 A;  4Q0J A;  4DE1 A;  5GLD A;  1PYY A;  3IH9 A;  4WYY A;  2O9C A;  2Y2L A;  4EET B;  4HY8 A;  1QME A;  4BQM A;  5G18 A;  3LY4 A;  3UE6 A;  1IYP A;  3VE3 A;  5AQ7 A;  1K55 A;  3Q7V B;  3V3R A;  3UNW A;  4GZB A;  4KUO A;  4OVD A;  4EXO A;  4LV0 A;  2INW A;  4QWO A;  4N1X A;  4G3W A;  4EBL A;  5CXW A;  1OTE A;  5HWW A;  4BBU A;  2A2L A;  2PU2 A;  3SS5 A;  1FSW A;  3KSF A;  2DMW A;  3IBR A;  3K3D A;  1FCO A;  4HJ6 A;  4QJG A;  4KEN B;  4XUZ A;  5DKL A;  2ZQA A;  1VM1 A;  3IF6 A;  1BYW A;  3KSH A;  2LB5 A;  1SHV A;  3QP5 A;  2V1A A;  3VMA A;  3SOI A;  2XRO A;  4BMW A;  4EBP A;  1KE3 A;  2VKS A;  4OPR A;  2W3E A;  1CJF A;  3WS5 A;  1S0W A;  1PWG A;  4N9K A;  2A49 A;  4RQ9 A;  4X6T A;  3Q81 A;  5JYP A;  4PM7 A;  1CQA A;  3OLO A;  1VHM A;  1I5Q A;  4K0X A;  4ME4 A;  3UE0 A;  1W5D A;  4ETX A;  3V5M A;  4IBR A;  1OTB A;  5F5Y A;  5KZH A;  2VGL S;  4EU0 A;  4YIN A;  3T50 A;  4OOY A;  4YWZ A;  3DW0 A;  1Q2P A;  2WZZ A;  5DFY A;  1PI5 A;  3WRZ A;  3VSK A;  1VEU A;  5F69 A;  1BSG A;  4NG2 A;  4KZ4 A;  2V0W A;  5G4Z A;  1DJC A;  4OPY A;  2ZL1 A;  3D3O A;  4IVI A;  3CLO A;  4I3A A;  1NLZ A;  3OCN A;  3MXS A;  1K25 A;  1NRJ A;  2Z2L B;  5EFW A;  3DWZ A;  2KLI A;  1UWN X;  4PM9 A;  4P0M A;  5FQM A;  4JLF A;  3UPN A;  4OPZ A;  2PD8 A;  3MMH A;  1IKG A;  3SH9 A;  1XP4 A;  2VLG A;  4B88 A;  5F1F A;  2EX2 A;  5L2F A;  1K55 C;  4DN0 A;  5FQ9 A;  4O8G A;  3F1N B;  1GSV A;  3PTE A;  1XJ4 A;  2XGN A;  2W1R A;  4PPR A;  4WM9 A;  1KGG A;  3MQO A;  3C7V A;  4N92 A;  3ZG8 B;  1T1A A;  1TF1 A;  3N6I A;  4GKU A;  2Y2P A;  5E2G A;  2P9V A;  1V9Z A;  3OBF A;  4R1G A;  4LRY C;  3UO9 A;  3H82 A;  2QKP A;  4X69 A;  2RL3 A;  3CPT B;  4R0Q A;  4ZBE A;  1QMF A;  5KMW A;  5G4Y A;  2VEA A;  5DJU A;  5AQA A;  5CX7 A;  5GL9 A;  1Z6F A;  4R3A A;  1D1J A;  2EFX A;  3KSI A;  4RA7 A;  2EFU A;  4IVK A;  1IYQ A;  4EUZ A;  3HUM A;  4UHU A;  2UV0 E;  4OH0 A;  5EPH A;  1N9B A;  1TDL A;  5M1A A;  4N1H A;  2UWX A;  1TS8 A;  2OV5 A;  5EE8 A;  4NXE A;  2H5S A;  2OLU A;  1RGY A;  3UME A;  3FKV A;  4NEE D;  2XD1 A;  1GHP A;  3T4J A;  1LLB A;  1NXY A;  4WEJ A;  2Y2O A;  2EX8 A;  1RP5 A;  3RXW A;  3VOY A;  2R9X A;  2HDU A;  3QNC A;  4CJN A;  2A24 A;  3LIF A;  3P98 A;  2J3T D;  3L7H A;  4HH2 A;  1VET B;  3MXQ A;  2VV7 A;  4ZTK A;  3ZVW A;  4X25 A;  2DNS A;  2J8Y A;  5HFO A;  5F68 A;  1ACF A;  4FH2 A;  5CHU A;  3Q7V A;  5FAT A;  2QJ5 A;  4Q8I A;  3MXR A;  4DRT A;  1TEM A;  1F9I A;  5FQQ A;  1NYY A;  2Y4A A;  5L8M A;  4B4Z A;  4KG5 A;  2BG1 A;  3L9K A;  4B93 A;  2LB9 A;  3C38 A;  2WGW A;  5AQ9 A;  2MJ6 A;  4HP9 A;  3UPP A;  2JBF A;  3GV9 A;  4EUV A;  2VX8 A;  5FQJ A;  1MWT A;  1JWZ A;  2XSS A;  3NC8 A;  3TOI A;  1HD8 A;  1K0K A;  3KO6 A;  3O86 A;  4HQA A;  1ZG4 A;  4IBX A;  3ZQ5 A;  1FCM A;  3VFH A;  1OPX A;  3G2Z A;  3S7P A;  1YMX A;  3HCY A;  3KYE A;  3PBT A;  4HBT A;  4DE0 A;  1W8Y A;  2G2W A;  1GA0 A;  5HAI A;  2M7V A;  3DBA A;  1L0D A;  2JKR M;  1PNE A;  4E3N A;  3MR0 A;  4M4X A;  4K91 A;  1S6R A;  2Y91 A;  4R23 A;  2XRN A;  4FSF A;  3VP0 A;  1MY8 A;  3H7W B;  5EEC A;  3IXH A;  4E3O A;  4GB7 A;  2QJ7 A;  5GHY A;  3G2Y A;  5EM0 A;  3Q1F A;  1BTL A;  3VOL A;  4E6X A;  3C7U A;  3VP3 A;  1SKO B;  1G68 A;  1WA9 A;  2V0U A;  4C3Q A;  5HPI A;  1A0K A;  2GNX A;  4EW7 A;  2YKH A;  5J7E A;  2IWC A;  4YOF A;  3KYZ A;  3CHW P;  1S1Z A;  4GDB A;  3UDI A;  4U3T A;  3RXX A;  3O87 A;  3F1O B;  4DF6 A;  1IEM A;  2WGV A;  4BBT A;  3MFD A;  5A93 A;  4JXS A;  1LI9 A;  1K54 A;  1KGE A;  4HP4 A;  4JGP A;  1K4F A;  5FEG A;  2AVX A;  4R4R A;  3G30 A;  3MSH A;  4F3L A;  1YQS A;  2D02 A;  4RYE A;  3P09 A;  4MDZ A;  1E25 A;  3PYP A;  1CI9 A;  2Y2N A;  2C5W B;  5GHZ A;  4OKP A;  3SH7 A;  4I39 A;  3PBR A;  3CIT A;  3HLF A;  3F1N A;  2P08 A;  1ZHH B;  1KE0 A;  2VA0 A;  2ZM2 A;  2HJ9 C;  1P9W A;  1DP8 A;  2QPN A;  4R4S A;  3PBQ A;  5FAQ A;  2XF3 A;  4ARZ B;  1N4O A;  4ZJ2 A;  3EQU A;  3CPT A;  4E3K A;  3LEZ A;  5CEB A;  3EOI A;  1NY0 A;  2WAD A;  1TVF A;  3ULF A;  3UMD A;  3BY8 A;  4MBH A;  3ICY A;  3CI6 A;  2W27 A;  2EA9 A;  4BEN A;  2IWD A;  5F1G A;  3LO7 A;  3GR2 A;  5FEF A;  2P04 A;  4RX2 A;  2W0N A;  5GLC A;  1HTZ A;  4CLC D;  5HAQ A;  2HP9 A;  2K31 A;  3ZG5 A;  4DDY A;  2ZQ8 A;  4OQH A;  1N9L A;  3BW6 A;  5EVE A;  2PR5 A;  5A92 A;  3K2N A;  1TS0 A;  2IA2 A;  3UN7 A;  1FQG A;  1VET A;  2FFF B;  2Y2G A;  3HJI A;  4XT2 B;  4MN6 A;  3T1R A;  2HZ5 A;  4II7 A;  1IOU A;  1VQQ A;  1XA1 A;  2BLS A;  4WL9 A;  4I3I A;  4MN5 A;  4BLM A;  3H82 B;  5HAP A;  1W79 A;  4XUX A;  1DY6 A;  3GDI A;  3HLW A;  1NRF A;  3IHB A;  3EGD C;  3WS2 A;  1K6S A;  3E2K A;  2JKG A;  3MZD A;  3NOT C;  3B42 A;  1UWP X;  4Q0H A;  4X55 A;  1ESI A;  1S67 L;  4ESP A;  3A0V A;  1H3Q A;  4EWF A;  1T18 A;  2GZA A;  1ES5 A;  4Y3I A;  2A24 B;  2Q0O A;  1C3B A;  4DE3 A;  3P01 A;  5HL1 A;  3JVU A;  1K57 C;  2HGV A;  4UA9 A;  3TJZ C;  4R6L A;  3VOZ A;  2XH9 A;  3BQA A;  3PBN A;  3BLM A;  1NZO A;  1TS7 A;  3NY4 A;  4O01 A;  3H7W A;  3LCE A;  3BEB A;  3IQA A;  3G32 A;  2X01 A;  3N8R A;  2WGW B;  1ZG6 A;  4JF4 A;  3T1Q B;  3N7W A;  1SKO A;  5TBM A;  5HX9 A;  3T4Q A;  3TE8 A;  3W4Q A;  5FAS A;  4GW9 A;  4JPM A;  3FPV A;  1S1Y A;  1EWZ A;  4P6Z M;  2A3U A;  4R3B A;  3F1O A;  1BUL A;  2H10 A;  1H5X A;  3LI8 A;  3EEH A;  4Q0I A;  4PMA A;  3OPH A;  2HF6 A;  1YLP A;  1JVJ A;  5A91 A;  2WKH A;  1S66 L;  1XGI A;  4CLC B;  1TDG A;  1SZV A;  3BEC A;  4UQI M;  4B4X A;  3VP4 A;  3FV7 A;  1ZTU A;  3NUL A;  4OLD A;  1BT5 A;  3LIC A;  3ZG0 A;  5EVI D;  3NHQ A;  3DAV A;  4KQR A;  4ZJ3 A;  1STZ A;  3CMZ A;  3UY6 A;  4S2N C;  4GNU A;  3TG9 A;  4ARZ A;  5I5L A;  5AVE A;  1Z09 A;  2GDN A;  2JHE A;  3T4S A;  2ZOI A;  1MWR A;  3NDE A;  4PKY G;  1OT6 A;  1IYS A;  5FQI A;  2Y2H A;  4R3J A;  4DE2 A;  5FI2 A;  1XPB A;  4KZ3 A;  3OOV A;  3TSG A;  3T4O A;  4NKP A;  2PBY A;  3MKE A;  4WMC D;  1HLU P;  3W4P A;  2G7U A;  5AQB A;  4F3L B;  2Z6D A;  4PAU A;  3E4Q A;  3N4I A;  3HLG A;  4KZ6 A;  3LYX A;  1G28 A;  3S4X A;  1XJ6 A;  5EVL A;  4JGQ A;  3D4F A;  3A0S A;  3H9W A;  4L9G A;  3V50 A;  2OAP 1;  5TR7 A;  3QP2 A;  4JXG A;  4P87 A;  1XX2 A;  1W63 Q;  1FSY A;  1F5M A;  1P9R A;  4XT2 A;  2ZC6 B;  5FQK A;  1YLY A;  4OQI A;  1X0O A;  4GS9 A;  3M2K A;  4KG2 A;  2V2F F;  3HLC A;  3GTC A;  1MZU A;  3C8C A;  3GSG A;  4BWI A;  5HW3 A;  1G6A A;  3GRJ A;  2L4R A;  3LID A;  3NIA A;  1AXB A;  3BQ8 A;  3IF6 C;  5CGS A;  3GEC A;  4IED A;  4GLQ A;  3ZGA B;  3TRC A;  2OAQ 1;  3S22 A;  2K2N A;  4BL3 A;  4FTX A;  3LEQ A;  2HP6 A;  4MEZ A;  4GOG A;  2FH5 A;  3V67 A;  1S4R A;  1U60 A;  3A3I A;  1DJA A;  3EGX C;  4A5R A;  3SW1 A;  5IU1 A;  1KVL A;  5CEC A;  4MNR A;  1CEG A;  4HOI A;  5TGF A;  3AGF A;  4IJG A;  2HPB A;  2PR6 A;  5E2E A;  2XQZ A;  2Y55 A;  5L10 A;  5CTN A;  4PHT A;  2JN7 A;  5IT5 A;  1H0M A;  2H0Y A;  3U2A A;  3DTK A;  4OPQ A;  3FG8 A;  4LRZ E;  4EQ1 A;  2EXB A;  1F2K A;  4QU3 A;  4MBK A;  3DWK A;  3LGO A;  3JVV A;  4MLL A;  3ITB A;  1GCE A;  2I9V A;  1ZKJ A;  1NWZ A;  4LPZ A;  3MQQ A;  4F94 A;  5HD5 A;  1NYM A;  4M3K A;  1LL5 A;  4N9L A;  4P6B A;  1XKZ A;  5HAR A;  2HJE A;  2OSU A;  1PW1 A;  3UDF A;  1MKM A;  3QHY A;  1L3L A;  1GHM A;  2WUQ A;  3OPP A;  3DTI A;  3SZT A;  3IX3 A;  5EVI B;  4MCW A;  4D2O A;  2KOI A;  2Q9M A;  4JKT A;  3IXB A;  3MS6 A;  3EWK A;  1L0G A;  2WAE A;  5L07 A;  3VSL A;  4C75 A;  1L2S A;  5FAP A;  4HHD A;  4GD6 A;  1H8Z A;  2XFS A;  1LSX A;  1O7E A;  2E8I A;  1ESU A;  1PW8 A;  3UE1 A;  2VZW A;  5IHV A;  3ZNT A;  3R4K A;  3PXP A;  1PZO A;  2Z2M B;  1M40 A;  2W1T B;  2ZM0 A;  4OON A;  3UDX A;  3N8S A;  2O0Y A;  1NJ4 A;  5C5K A;  1XFQ A;  3F1P A;  3I7J A;  3NDG A;  3OZH A;  1E3U D;  1Y54 A;  3G35 A;  1IEL A;  3OPL A;  1TS6 A;  4CLC A;  2O99 A;  3BFD A;  4JF6 A;  1S4S A;  3FYZ A;  2CMN A;  1YLW A;  1XA7 A;  2JKF A;  3LIB A;  2ZD8 A;  1HZO A;  3N8L A;  5CRF A;  5HSQ A;  3T1X A;  2V1Z A;  3HUO A;  2DRW A;  4KQD A;  4HH3 A;  5TBM B;  5J4E A;  2ZQ7 A;  5IS1 A;  1BZA A;  5KSH A;  2B18 A;  3PR6 A;  1LL8 A;  4Z9Q A;  3BRM A;  1JTD A;  4I3J A;  4PM6 A;  2VV8 A;  1YT4 A;  2Y2Q A;  3CAX A;  5F6A A;  1FIK A;  1M6K A;  3SS4 A;  3KX0 X;  4KZ5 A;  4PM8 A;  2IWB A;  2QMI A;  4ID4 A;  3VE4 A;  4YNR A;  3UB9 A;  4ETZ A;  3FC7 A;  4XXR A;  2J7V A;  2JKR I;  1OTA A;  2P7J A;  3WS4 A;  3AGD A;  1RGZ A;  3GMW A;  4LEN A;  4X1L A;  2WKQ A;  4K08 A;  4IHQ A;  3HLB A;  1LSV A;  4QD4 A;  1MBL A;  4H6J B;  4CLC E;  2ZMV A;  3HUN A;  4HBU A;  3S7O A;  3G6O A;  3C30 A;  3QP4 A;  3SH8 A;  1GA9 A;  5HDC A;  2OOL A;  4I38 A;  4JXW A;  3MFX A;  4FUW A;  2VK3 A;  5M18 A;  2ZQD A;  3E0Y A;  4EEU A;  2E8J A;  4DKI A;  3D9Y A;  2P74 A;  1EW0 A;  4ZAM A;  4OOM A;  2VGL M;  1LSW A;  4Y0U A;  4DXC A;  3R7W B;  1JWP A;  4L0L A;  2EWW A;  5CHM A;  1OT9 A;  1KGF A;  1DP6 A;  2ZQ9 A;  4R70 A;  2OLV A;  2QHK A;  5DTK A;  4ZRR A;  3ZNY A;  3A3J A;  3E4P A;  2HDQ A;  4S2P A;  3HLE A;  3PBS A;  5CED A;  4B9O A;  4KUK A;  1ALQ A;  4GDN A;  2V8F A;  5CHJ A;  5HZH A;  3M2J A;  4S2O A;  3UB5 P;  3NJA A;  4G3V A;  1IFQ A;  4NXB A;  4K0W A;  4MN7 A;  4KQO A;  1CI8 A;  1H8Y A;  4KZB A;  3NI9 A;  4GS9 B;  3RH8 B;  2ZBB A;  4GJ4 A;  3T12 B;  3PBO A;  3HBR A;  4YFM A;  2ZMA A;  3CZD A;  4WEL A;  3O3V A;  3NEC A;  1ES4 A;  2G2U A;  5EVI A;  3WRT A;  4GD8 A;  5DFX A;  3E98 A;  5EM1 A;  2J9O A;  1K54 C;  2ZOH A;  1YPR A;  3U4L P;  3VFF A;  1Q2Q A;  2XLN A;  5CGW A;  3V39 A;  2DCF A;  2VV6 A;  2EX6 A;  1MWU A;  3IWI A;  2KDK A;  2EWV A;  2NUP C;  1WYC A;  5FI6 A;  2W1T A;  3O5Y A;  5JYO A;  1E4D A;  3VV4 A;  5HWT A;  1Y4O A;  4FOF A;  1BUE A;  5J3W A;  4KZ8 A;  3G31 A;  1IYO A;  3IT9 A;  2VGJ A;  1P97 A;  4JXV A;  4P85 A;  4WMC A;  4BJP A;  3WS1 A;  1WE4 A;  3HJK A;  1YLT A;  3MQ0 A;  1W63 M;  3NOU C;  1YSQ A;  1J3W A;  1MKI A;  3FKW A;  5DF7 A;  1LT0 A;  3QP6 A;  1PI4 A;  3B3X A;  4X53 A;  3ZG9 B;  4S2K A;  3TW8 A;  1G6O A;  3ISG A;  1K4E A;  1OJ5 A;  2PD7 A;  2PYP A;  1GSX A;  3MF0 A;  4ZJ1 A;  2ZM8 A;  1T1C A;  4EBN A;  2ACG A;  5LBR A;  5KIZ A;  5HD3 A;  3A3E A;  3UB6 A;  5DJT A;  1YLJ A;  4NK3 A;  3BWL A;  4G3K A;  5K5B A;  1KDW A;  4Y17 A;  2M7U A;  5CGX A;  4E6W A;  4JGO A;  2L1M A;  1JTG A;  4L9F A;  3IS2 B;  3RTY A;  4KG6 A;  3BFC A;  3F1P B;  4R38 A;  1ONG A;  1BLP A;  2C6W B;  2R78 A;  5MC7 A;  3JPU A;  4MMN A;  2WKI A;  2O9B A;  2B02 A;  4OP8 A;  3LUQ A;  1W7F A;  2PT7 A;  3MKF A;  3QP8 A;  1OTD A;  3GVB A;  1XFN A;  3UB8 A;  3HL9 A;  1FIL A;  1T19 A;  5EOO A;  1KDS A;  3ZDJ A;  2EXA A;  2ZLY A;  3P7N A;  3T4L A;  3NCK A;  3IWO A;  1OME A;  4HEF A;  5J8X A;  4H6J A;  2GJ3 A;  3OPR A;  1MXO A;  2JC7 A;  1YAX A;  5EVI C;  2B5R A;  4D60 A;  3UB7 A;  4WEK A;  2XD5 A;  1JNU A;  1GSW A;  2W3H A;  1UGU A;  2J80 A;  1ZC2 A;  3IH8 A;  5FDS A;  4LFU A;  4UA7 A;  1MWS A;  1N9N A;  1KVM A;  2J9P A;  4DXB A;  2WAF A;  4OQ0 A;  5EOE A;  4RVA A;  4HJ3 A;  5L09 A;  3IWQ A;  1KE4 A;  3BY9 A;  2W3G A;  1W8Q A;  4FD8 A;  2ZC5 B;  3G4P A;  4KZA A;  2Q9N A;  4LCL A;  2EX9 A;  3R7W A;  4RX3 A;  4Y7P A;  3PAE A;  2XA7 M;  4X1M A;  5DKK A;  4EV4 A;  3KSG A;  4BD1 A;  3NBL A;  4GCZ A;  4Y5F A;  3OC2 A;  1EI5 A;  1ONH A;  1RCJ A;  3PHY A;  3V3S A;  4I5S A;  4BL2 A;  2XR0 A;  4UEY A;  1D7E A;  3BFG A;  4WZ4 A;  1E3U A;  1PRQ A;  1JWV A;  3IF5 A;  5DF8 A;  1F98 A;  3A3F A;  3C4P A;  4HI4 A;  1DRM A;  2XFT A;  3BFF A;  3W2Z A;  3S7Q A;  3SS3 A;  4H8R A;  5HWV A;  3M6H A;  5HDS A;  3Q07 A;  2VGK A;  3ZG7 B;  4QHC A;  1Y28 A;  2PU4 A;  4S2L A;  4WLA A;  1CEF A;  2PBD P;  3CJM A;  4QY5 A;  4LRX C;  1FCN A;  3Q7Z A;  1FR6 A;  4UA6 A;  5AJG A;  2K7S A;  4U0T A;  2WK0 A;  5FL3 A;  2HDR A;  1GHI A;  5KSC A;  3MBZ A;  1FOF A;  3C2W A;  5CTM A;  4Z1W A;  3C4O A;  2HV1 A;  1K56 A;  4C6Y A;  5FI7 A;  1NZU A;  3DTE A;  3CG5 A;  4NET A;  1D06 A;  5E43 A;  5F83 A;  3M6B A;  2Y2M A;  4GHI A;  4DDS A;  4E3I A;  3JYI A;  2V8C A;  1PFL A;  4WZ5 A;  3BJN A;  5TFQ A;  5GLA A;  2J3T C;  2ZC7 A;  3ITA A;  2ZC3 B;  1IKI A;  4ZDX A;  4O7D A;  1YKD A;  1K6R A;  1ERQ A;  2H0T A;  4NXF A;  5M19 A;  2KX6 A;  4HNB A;  3PAG A;  4E04 A;  3B47 A;  5HDD A;  4QPR A;  5AVF A;  1PWC A;  3T4T A;  4BD0 A;  1G5U A;  3CUE A;  5DTS A;  4S2I A;  3GQZ A;  1LL9 A;  4HIA A;  5FAO A;  4P6Z S;  2R9W A;  1YMS A;  3HVF A;  3LR0 A;  3IBJ A;  3FPW A;  2PYR A;  2WGI A;  5FDH A;  3BM6 A;  4Y15 A;  3RFB A;  4E3M A;  1FR1 A;  4L9E A;  1PWD A;  2YKF A;  1SDN A;  5I94 A;  4EQI A;  4S2M A;  2WKR A;  4BBV A;  5A90 A;  4PM5 A;  3E2L A;  4JBF A;  2Z6C A;  3IS2 A;  3B33 A;  3QNB A;  4Y0O A;  1BLH A;  2WKP A;  4UQI S;  4WBG A;  3HLD A;  4DJ3 A;  4IUH A;  4JF5 A;  2Y2J A;  2OWH A;  4EEP A;  3KYQ A;  3ZCZ A;  1L0E A;  3ZVT A;  2ZC4 B;  4OQG A;  3EQV A;  4DJ2 A;  5EUA A;  3AGE A;  1XXM A;  2XDM A;  4O0P A;  2O9A A;  5GHX A;  1YLZ A;  2L0W A;  2Y8H A;  2WYX A;  4QB8 A;  1LI0 A;  1SDE A;  2PHY A;  1J9M A;  2JKT M;  4Y0T A;  3C5A A;  2HP5 A;  2NUT C;  1K56 D;  2W3D A;  3DTM A;  4HES A;  5FSR A;  1XJ3 A;  1DJB A; 
#chains in the Genus database with same CATH homology
 4YFM A;  5M1A A;  1XGI A;  2ZMA A;  2WKE A;  3CZD A;  4WEL A;  4N1H A;  1TDG A;  2RCX A;  2UWX A;  3BEC A;  4B4X A;  2OV5 A;  3O3V A;  5EE8 A;  3VP4 A;  3FV7 A;  2H5S A;  2OLU A;  1RGY A;  4OLG A;  5D3O A;  1ES4 A;  3FKV A;  4OLD A;  1BT5 A;  2XD1 A;  2G2U A;  1GHP A;  1LLB A;  1I2W A;  5EVI A;  1NXY A;  3WRT A;  4WEJ A;  2Y2O A;  3IF6 B;  5FA7 A;  4GD8 A;  3S1Y A;  1O07 A;  2EX8 A;  1RP5 A;  3WWX A;  4WZ5 C;  3RXW A;  3VOY A;  2J9O A;  1K54 C;  2R9X A;  3BFE A;  3ZG0 A;  2HDU A;  3UE3 A;  5EVI D;  3QNC A;  1CK3 A;  3A3D A;  4CJN A;  3G34 A;  4KQR A;  3VFF A;  4ZJ3 A;  1Q2Q A;  3BYD A;  3P98 A;  3CMZ A;  3UY6 A;  4S2N C;  2XLN A;  4GNU A;  3TG9 A;  5CGW A;  4LV2 A;  2QZ6 A;  3V39 A;  2GDN A;  4ZTK A;  2DCF A;  3ZVW A;  2EX6 A;  1MWR A;  1MWU A;  3NDE A;  2DNS A;  2X71 A;  5E2F A;  1IYS A;  3IWI A;  5FQI A;  2Y2H A;  4GN2 A;  1WYC A;  2J8Y A;  2Y2K A;  5HFO A;  5FI6 A;  4R3J A;  4FH2 A;  5CHU A;  4DE2 A;  3Q7V A;  1BLC A;  4X68 A;  5JYO A;  5FI2 A;  5FAT A;  1E4D A;  4Q8I A;  1XPB A;  3MXR A;  1BUE A;  4KZ3 A;  4KZ8 A;  1XGJ A;  4DRT A;  1TEM A;  1IYO A;  3G31 A;  3IT9 A;  4LV3 A;  2VGJ A;  4OOL A;  5F82 A;  3OCL A;  3TSG A;  4JXV A;  5FQQ A;  1NYY A;  4P85 A;  2Y4A A;  4WMC A;  4X56 A;  3WS1 A;  4B4Z A;  4BJP A;  1WE4 A;  4KG5 A;  1YLT A;  4S2J A;  2BG1 A;  2PBY A;  3FZC A;  1MKI A;  3FWL A;  2WGW A;  5AQ9 A;  3MKE A;  1ES2 A;  3FKW A;  4WMC D;  5DF7 A;  3W4P A;  5AQB A;  3UPP A;  3ZHH A;  2JBF A;  2Y2I A;  1K57 A;  1WYB A;  3GV9 A;  4KZ9 A;  1PI4 A;  3N4I A;  5FQJ A;  3B3X A;  4X53 A;  3W4O A;  3ZG9 B;  1MWT A;  1JWZ A;  4S2K A;  3LY3 A;  3ISG A;  3NC8 A;  3HLG A;  4KZ6 A;  1K4E A;  1I2S A;  3S4X A;  4FH4 A;  1SKF A;  1HD8 A;  3TOI A;  4LCM A;  2X02 A;  1SCW A;  5EVL A;  3O86 A;  3D4F A;  1ZG4 A;  3V50 A;  4ZJ1 A;  4IBX A;  2XEP A;  5TR7 A;  2ZM8 A;  4JXG A;  4EBN A;  4P87 A;  1FCM A;  1XX2 A;  4UAA A;  1FSY A;  3VFH A;  1LHY A;  3G2Z A;  3VP2 A;  2ZC6 B;  5FQK A;  1YLY A;  3A3E A;  3HRE A;  1YMX A;  4OQI A;  1YLJ A;  3MZF A;  3Q82 A;  3WS0 A;  4NK3 A;  3M2K A;  4KG2 A;  4MBF A;  2V2F F;  3HLC A;  3PBT A;  4HBT A;  4DE0 A;  3GTC A;  3MZE A;  1W8Y A;  5U47 A;  2G2W A;  1KDW A;  3GSG A;  1GA0 A;  5HAI A;  5HW3 A;  1G6A A;  3UPO A;  5CGX A;  3GRJ A;  4E6W A;  1L0D A;  3NIA A;  1AXB A;  2XK1 A;  1JTG A;  4KZ7 A;  4E3N A;  3IF6 C;  4QY6 A;  5CGS A;  3IHA A;  4K91 A;  1S6R A;  2Y91 A;  3W8K A;  4IED A;  4R23 A;  4FSF A;  3ZGA B;  4KG6 A;  3BFC A;  3IXD A;  3VP0 A;  3S22 A;  4BL3 A;  1ONG A;  1BLP A;  1MY8 A;  3BLS A;  2C6W B;  5EEC A;  2HP6 A;  4FCF A;  3IXH A;  4MEZ A;  4GB7 A;  4E3O A;  4GOG A;  2WKI A;  5GHY A;  2I72 A;  1MPL A;  1U60 A;  3G2Y A;  3A3I A;  1ERO A;  1DJA A;  3Q1F A;  1BTL A;  3VP1 A;  4OP8 A;  4E6X A;  3C7U A;  4E3J A;  1W7F A;  3VP3 A;  4A5R A;  2CC1 A;  1K38 A;  4KQQ A;  3MKF A;  1G68 A;  4C3Q A;  5CEB A;  2JCH A;  1KVL A;  5CEC A;  3GVB A;  3HL9 A;  4MNR A;  1CEG A;  5TGF A;  2WZX A;  1PIO A;  5EOO A;  3AGF A;  2IWC A;  1KDS A;  2HPB A;  5GLB A;  2JE5 A;  3IXG A;  5E2E A;  3ZDJ A;  2EXA A;  2ZLY A;  2XQZ A;  2Y55 A;  5CTN A;  5BOH A;  4GDB A;  2P9V B;  3NCK A;  2H0Y A;  3IWO A;  1OME A;  4HEF A;  4U3T A;  5E2H A;  3UDI A;  5J8X A;  1ES3 A;  3RXX A;  4OPQ A;  3O87 A;  3OPR A;  1MXO A;  4DF6 A;  1IEM A;  2EXB A;  2JC7 A;  2WGV A;  5EVI C;  4QU3 A;  2B5R A;  4MBK A;  3MFD A;  5A93 A;  4E3L A;  3DWK A;  4JXS A;  4WEK A;  1LI9 A;  5DTT A;  1K54 A;  4MLL A;  1HVB A;  3ITB A;  1KGE A;  2XD5 A;  1GCE A;  1ZKJ A;  4CPK A;  4F94 A;  1K4F A;  1ZC2 A;  4R4R A;  4S2N A;  1L0F A;  2ZJ9 A;  3IH8 A;  3ZFZ A;  4UA7 A;  1MWS A;  3RJU A;  1NYM A;  3G30 A;  4M3K A;  1LL5 A;  4N9L A;  4P6B A;  1KVM A;  1XKZ A;  2J9P A;  4DXB A;  2WAF A;  5HAR A;  1YQS A;  4OQ0 A;  3P09 A;  4RVA A;  4RYE A;  5EOE A;  1E25 A;  2ZQC A;  1ERM A;  2OSU A;  3IWQ A;  1YM1 A;  2Y59 A;  1PW1 A;  1CI9 A;  1KE4 A;  2Y2N A;  2C5W B;  5DVA A;  1PZP A;  3UDF A;  3QHY A;  1GHM A;  4OKP A;  2WUQ A;  4OP5 A;  5GHZ A;  3SH7 A;  1W8Q A;  3OPP A;  3PBR A;  4FD8 A;  5DF9 A;  2ZC5 B;  3G4P A;  2FFY A;  2HDS A;  3HLF A;  4KZA A;  5CER A;  2Q9N A;  4LCL A;  5EVI B;  2EX9 A;  4D2O A;  4RX3 A;  2Q9M A;  4LV1 A;  4Y7P A;  3PAE A;  3IXB A;  1KE0 A;  4JKT A;  2ZM2 A;  3O88 A;  4U0X A;  1BLS A;  2V20 A;  1L0G A;  2WAE A;  2QPN A;  4EV4 A;  3VSL A;  4C75 A;  1L2S A;  5FAP A;  4BD1 A;  4GD6 A;  1H8Z A;  2XFS A;  3NBL A;  4R4S A;  4DE1 A;  1O7E A;  5GLD A;  2E8I A;  1PYY A;  3IH9 A;  3PBQ A;  4WYY A;  2XF3 A;  1ESU A;  5FAQ A;  3OC2 A;  1EI5 A;  1PW8 A;  1ONH A;  1RCJ A;  2Y2L A;  3UE1 A;  5IHV A;  1QME A;  3V3S A;  3ZNT A;  1N4O A;  1PZO A;  4BQM A;  5G18 A;  2Z2M B;  1M40 A;  4BL2 A;  4ZJ2 A;  2XR0 A;  3LY4 A;  3EQU A;  1IYP A;  4E3K A;  5AQ7 A;  3LEZ A;  2ZM0 A;  4OON A;  3BFG A;  1K55 A;  3Q7V B;  3UDX A;  3N8S A;  4WZ4 A;  3V3R A;  1E3U A;  1NY0 A;  2WAD A;  1TVF A;  4GZB A;  3UNW A;  1JWV A;  1NJ4 A;  3IF5 A;  5DF8 A;  3A3F A;  4OVD A;  3C4P A;  4LV0 A;  2XFT A;  3I7J A;  3NDG A;  4MBH A;  3BFF A;  3OZH A;  1E3U D;  4N1X A;  1Y54 A;  3G35 A;  4EBL A;  5CXW A;  3SS3 A;  4H8R A;  4BEN A;  1IEL A;  3M6H A;  3OPL A;  2IWD A;  2PU2 A;  3Q07 A;  5F1G A;  2VGK A;  3ZG7 B;  4QHC A;  3LO7 A;  3GR2 A;  2PU4 A;  3SS5 A;  1FSW A;  3BFD A;  4RX2 A;  4S2L A;  1CEF A;  4JF6 A;  3CJM A;  4QY5 A;  5GLC A;  3FYZ A;  1HTZ A;  5HAQ A;  1FCO A;  1YLW A;  4QJG A;  1FCN A;  1XA7 A;  3Q7Z A;  1FR6 A;  2HP9 A;  4KEN B;  4XUZ A;  3ZG5 A;  4DDY A;  2ZQA A;  2ZQ8 A;  4UA6 A;  4OQH A;  1VM1 A;  3IF6 A;  4U0T A;  2ZD8 A;  1HZO A;  2WK0 A;  1SHV A;  3VMA A;  3N8L A;  2HDR A;  5CRF A;  3SOI A;  1GHI A;  5KSC A;  3MBZ A;  1FOF A;  5CTM A;  4EBP A;  5A92 A;  1KE3 A;  4OPR A;  2V1Z A;  3C4O A;  1K56 A;  3HUO A;  3WS5 A;  1S0W A;  4C6Y A;  2DRW A;  3UN7 A;  1FQG A;  1PWG A;  4N9K A;  2FFF B;  2A49 A;  2Y2G A;  1NZU A;  5FI7 A;  2ZQ7 A;  3CG5 A;  4NET A;  5E43 A;  4X6T A;  3Q81 A;  5F83 A;  4PM7 A;  5JYP A;  1VQQ A;  2Y2M A;  3M6B A;  1BZA A;  1XA1 A;  2BLS A;  5KSH A;  4Z9Q A;  4DDS A;  4E3I A;  3BRM A;  4BLM A;  3JYI A;  1JTD A;  5HAP A;  1W79 A;  1I5Q A;  4K0X A;  4XUX A;  1DY6 A;  3UE0 A;  1W5D A;  4PM6 A;  3HLW A;  1YT4 A;  1NRF A;  4WZ5 A;  3V5M A;  2Y2Q A;  5TFQ A;  5GLA A;  3IHB A;  4IBR A;  2ZC7 A;  3ITA A;  3WS2 A;  2ZC3 B;  1IKI A;  1M6K A;  3SS4 A;  4ZDX A;  4O7D A;  4KZ5 A;  1K6S A;  3E2K A;  4PM8 A;  2IWB A;  1K6R A;  2QMI A;  5KZH A;  1ERQ A;  2H0T A;  3MZD A;  5M19 A;  4ID4 A;  4YIN A;  4OOY A;  3PAG A;  4XXR A;  3DW0 A;  1Q2P A;  2WZZ A;  2J7V A;  1PWC A;  4X55 A;  1ESI A;  1PI5 A;  3WS4 A;  3AGD A;  3WRZ A;  5DTS A;  4BD0 A;  1RGZ A;  3VSK A;  3GMW A;  4LEN A;  4S2I A;  3GQZ A;  4EWF A;  1BSG A;  3HLB A;  4KZ4 A;  1LL9 A;  4QD4 A;  1MBL A;  1ES5 A;  5FAO A;  1DJC A;  3HUN A;  2R9W A;  4HBU A;  1YMS A;  4OPY A;  3HVF A;  3SH8 A;  1C3B A;  2WGI A;  5FDH A;  3BM6 A;  1GA9 A;  4DE3 A;  4IVI A;  4E3M A;  5HL1 A;  1FR1 A;  3OCN A;  3MXS A;  1PWD A;  1K57 C;  1K25 A;  1SDN A;  2Z2L B;  4JXW A;  5I94 A;  3DWZ A;  4EQI A;  4S2M A;  4PM9 A;  5A90 A;  4PM5 A;  4P0M A;  3E2L A;  4UA9 A;  5M18 A;  4JBF A;  5FQM A;  2ZQD A;  4JLF A;  3UPN A;  3VOZ A;  2XH9 A;  4OPZ A;  3PBN A;  4DKI A;  3QNB A;  1IKG A;  2P74 A;  1BLH A;  1NZO A;  3BLM A;  4Y0O A;  3SH9 A;  4WBG A;  1XP4 A;  3HLD A;  3NY4 A;  4ZAM A;  4OOM A;  4B88 A;  5F1F A;  2EX2 A;  5L2F A;  1K55 C;  3LCE A;  3BEB A;  5FQ9 A;  3IQA A;  4Y0U A;  3G32 A;  4DXC A;  1JWP A;  2X01 A;  3N8R A;  4L0L A;  3PTE A;  4JF5 A;  2WGW B;  5CHM A;  1ZG6 A;  1KGF A;  4JF4 A;  2Y2J A;  3N7W A;  2XGN A;  2ZQ9 A;  5HX9 A;  4PPR A;  2OLV A;  4WM9 A;  3ZCZ A;  1KGG A;  1L0E A;  5DTK A;  3W4Q A;  3ZVT A;  5FAS A;  2ZC4 B;  3ZNY A;  3A3J A;  3C7V A;  4N92 A;  2HDQ A;  4OQG A;  3EQV A;  4S2P A;  3ZG8 B;  3HLE A;  4JPM A;  3PBS A;  5CED A;  3N6I A;  5EUA A;  3AGE A;  1ALQ A;  1XXM A;  2XDM A;  2Y2P A;  4GKU A;  5E2G A;  4GDN A;  2P9V A;  1EWZ A;  3UO9 A;  4R1G A;  2A3U A;  5GHX A;  4X69 A;  2RL3 A;  1YLZ A;  4R3B A;  5CHJ A;  4QB8 A;  3M2J A;  1QMF A;  2WYX A;  4R0Q A;  4S2O A;  4ZBE A;  1LI0 A;  5KMW A;  1SDE A;  1J9M A;  5AQA A;  1BUL A;  2H10 A;  1H5X A;  5GL9 A;  4Y0T A;  3C5A A;  1Z6F A;  4K0W A;  2EFX A;  4PMA A;  2HP5 A;  4RA7 A;  3OPH A;  1K56 D;  2EFU A;  3DTM A;  4HES A;  4IVK A;  1IYQ A;  4KQO A;  1CI8 A;  1H8Y A;  1YLP A;  5FSR A;  1JVJ A;  4KZB A;  3NI9 A;  5A91 A;  4EUZ A;  3HUM A;  2WKH A;  4OH0 A;  4UHU A;  5EPH A;  1DJB A;  3PBO A;  1N9B A;  3HBR A;  1TDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...