4E3JA

Crystal structure of ampc beta-lactamase in complex with a designed 4-tetrazolyl benzene sulfonamide boronic acid inhibitor
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Fragment-guided design of subnanomolar beta-lactamase inhibitors active in vivo.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 115
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4e3jA00
2WADA 3IXDA 3Q7VB 3ZFZA 1YLJA 4FCFA 4GKUA 1YLPA 1HVBA 1Q2QA 5FAOA 1PIOA 4LENA 3TOIA 1M40A 5CGWA 2E8IA 2QPNA 1SCWA 5DF8A 3HLCA 4EV4A 2A49A 1N9BA 3FYZA 4OPQA 4OP5A 4HBUA 1I2SA 2Y2GA 3OZHA 2VGJA 1MPLA 1IEMA 4ZJ2A 5F82A 4D2OA 3GV9A 3IF6A 1E3UD 1KVLA 3UDIA 3MZEA 1C3BA 4PM9A 4QU3A 1PI5A 5FAQA 2EX2A 4ID4A 3W4PA 3LEZA 5GLDA 5F1GA 4S2PA 3W8KA 2OSUA 3IXBA 4H8RA 3ZG7B 1FCOA 4DDYA 1SHVA 4PMAA 1YLWA 3PBSA 2V1ZA 1PWCA 1SDEA 2RCXA 2XLNA 4UA9A 2QMIA 2C6WB 4S2OA 5FSRA 3VFFA 3RXWA 4GD6A 5TFQA 5FQMA 5EVIC 4E3IA 4RX2A 4DDSA 2ZQ9A 4WYYA 3PTEA 3P98A 4C6YA 5EOEA 3HLWA 4N9LA 5HX9A 3PAGA 1YQSA 1MWRA 1PI4A 4BLMA 3HREA 3Q7VA 3AGDA 5DVAA 1BULA 1IKGA 4FSFA 4P0MA 3GVBA 4KG2A 4KZ6A 5DTSA 4LV0A 2J9OA 2XR0A 4E3MA 1RCJA 2JBFA 4JKTA 5E2GA 1YMXA 1L0GA 3AGEA 3M2KA 2ZQ8A 3BLMA 3Q1FA 4X55A 5EPHA 5TGFA 3HL9A 3O87A 1K57C 1K6SA 1BT5A 2ZQDA 2J9PA 1XKZA 5A92A 1DJBA 4MBHA 4LV1A 1XX2A 3C4PA 2JC7A 3OCLA 3SOIA 4KQQA 3D4FA 1WYBA 4B4XA 2PU2A 1ZC2A 1ES2A 2P9VB 1LI0A 1M6KA 4JXGA 2PU4A 3UNWA 3ZG5A 4WELA 1FR6A 1FOFA 1L0FA 2V20A 1G6AA 1N4OA 1BLSA 1YLZA 3GQZA 1AXBA 3IXHA 3N6IA 4FH4A 1RP5A 3BEBA 4PM6A 4C75A 4P85A 2ZC3B 4GZBA 1KGGA 2Y91A 2WKIA 1IYQA 4E3OA 4JF4A 4K0WA 3C7UA 1HTZA 4OPZA 1ESUA 4UAAA 2XDMA 3JYIA 1LL5A 2G2UA 3A3FA 1XGJA 4PM8A 5GLCA 4U0XA 3HLDA 3O88A 1I2WA 3ZGAB 3FWLA 3GR2A 4O7DA 1ZKJA 3ZDJA 1VM1A 4QD4A 4XUZA 1E25A 3IWQA 3BRMA 2CC1A 4WZ4A 3G35A 3IT9A 4GN2A 2ZLYA 3VSKA 4E3LA 1FQGA 3ZNYA 2XD5A 1WYCA 3QHYA 4KQRA 4DE0A 5FATA 1CEGA 4QB8A 3IF6B 1ALQA 1XGIA 1GCEA 4N9KA 2WGIA 2X71A 2HP5A 1IELA 1W8YA 2ZC7A 3MZDA 2EX6A 2P9VA 3DWKA 3VP0A 5CGSA 5EVIA 5I94A 2WGWA 4R3BA 2A3UA 4IVKA 4E3JA 4JBFA 5AQBA 5M1AA 3N8RA 3OPHA 2Y2KA 1MXOA 4WEKA 2ZM0A 3G30A 2DNSA 4S2KA 3SS5A 1IYPA 3HBRA 4GD8A 2PBYA 3E2KA 1NYMA 1NJ4A 1DY6A 2HP6A 5CTNA 1ERQA 1L0DA 2J7VA 3NDEA 4E3NA 2Z2LB 3ZNTA 4QHCA 1NY0A 3AGFA 3UDXA 5CECA 4IBRA 4Y7PA 3RJUA 5CEDA 3BECA 5HW3A 1S0WA 3A3DA 4RX3A 4B88A 4RYEA 3MKEA 3N7WA 5E43A 3P09A 2VGKA 3FKVA 3G2YA 4LV2A 3M6BA 5CRFA 3OPLA 4OP8A 5EOOA 3WS1A 1BTLA 5JYOA 2XF3A 3Q7ZA 5AQ7A 1K56D 3C7VA 5HAIA 5D3OA 3IF5A 4KZ9A 1J9MA 5DF7A 4X69A 1ES3A 2Y2LA 5U47A 3WS0A 4N1HA 2HDUA 2XGNA 1BUEA 1W5DA 3RXXA 3DTMA 1FCNA 5CERA 3V3RA 5FQJA 4FH2A 3S4XA 3TG9A 2ZC5B 3A3JA 4WZ5C 1TVFA 3VP1A 3ZG8B 4F94A 4R23A 4JPMA 4P6BA 2EXAA 1MWUA 4OQHA 5GHYA 2ZQCA 3LO7A 3WRTA 2C5WB 4E6XA 2X01A 1LHYA 3ZHHA 4EUZA 1MWTA 2Y59A 5HL1A 4QY5A 4UA7A 3SH8A 3IQAA 5KSHA 2HDRA 2EX9A 1K6RA 3LY3A 1K54C 4KQOA 3HLFA 4N1XA 4OVDA 2OLUA 5AQ9A 5M18A 2WAFA 2IWCA 1GHPA 5FI7A 1GHMA 2EFUA 1ONGA 2QZ6A 4FD8A 1Q2PA 4ZDXA 4KZAA 4OQIA 3GMWA 3WS5A 1IKIA 2R9WA 3IXGA 3PBRA 4C3QA 1FSYA 4KZ8A 2ZJ9A 5L2FA 2ZQ7A 1HD8A 1BLCA 3VP2A 5FASA 3BLSA 5HAPA 4WEJA 4HBTA 4N92A 4KZ3A 4R0QA 4KZ7A 4BENA 3DW0A 4GB7A 4R3JA 1K55A 2Y2JA 3SS4A 4YFMA 1PWDA 1ZG6A 1I5QA 4JXSA 4MNRA 3BYDA 2OV5A 4DXCA 2I72A 1CK3A 1YLTA 4ZJ3A 2ZQAA 1CEFA 3BM6A 3EQUA 1QMEA 4K0XA 2WAEA 4KG5A 5CHJA 5EECA 3ZG9B 4GDNA 5EVIB 1JTGA 1NZUA 3G34A 4Q8IA 1H5XA 2V2FF 1EWZA 2WGWB 3HUMA 4MBFA 4Y0OA 5E2EA 1JWVA 1FCMA 1GA0A 1H8YA 1KVMA 1TDGA 5CEBA 4RVAA 5HAQA 4QJGA 3OCNA 4KENB 4S2LA 3IHAA 4ZAMA 1OMEA 3GRJA 1JWPA 1HZOA 3BFDA 3HLEA 3NDGA 3ZG0A 4BD1A 3M2JA 4DRTA 1ESIA 3UPOA 2UWXA 3WS4A 3FZCA 4XXRA 1CI8A 3BFEA 3V50A 2ZMAA 4CJNA 2Q9MA 3MFDA 4MEZA 3W4QA 2EX8A 4S2NC 3V5MA 2ZC6B 1BZAA 3ITAA 3MXSA 4XUXA 1G68A 3WRZA 1PYYA 4JF6A 1K4EA 1GA9A 2J8YA 5J8XA 3SH7A 5KSCA 2H0TA 3QNBA 4OOYA 3A3EA 1BLHA 1TEMA 1MBLA 3UE1A 4OPRA 1JWZA 1YLYA 2B5RA 4HEFA 4PM5A 2ZM8A 3VOYA 4R1GA 5HFOA 3NIAA 1H8ZA 4L0LA 1XA1A 1W8QA 1Z6FA 1DJAA 2WZZA 1FR1A 3OPRA 4IEDA 3VFHA 3VMAA 4WZ5A 1XXMA 5FQ9A 1XPBA 3QNCA 3WWXA 4OLDA 1NRFA 4A5RA 5JYPA 4ZTKA 5BOHA 3DWZA 4Y0UA 4X56A 1GHIA 4UHUA 5GLAA 1K54A 5CGXA 4R4SA 3HLGA 5AQAA 1ONHA 3WS2A 2BLSA 3VOZA 2Y2OA 3LY4A 2FFFB 2Y2NA 5CHMA 2XQZA 2WKHA 3Q07A 3IWIA 3Q82A 4PM7A 1O07A 4IVIA 3G31A 3C4OA 4UA6A 5E2FA 5FDHA 4KG6A 1QMFA 4M3KA 3VSLA 4DE3A 5A93A 4LV3A 4EBLA 1K57A 1LI9A 5F1FA 3CG5A 3UE0A 1L0EA 2ZD8A 3HLBA 3EQVA 3ISGA 4K91A 5E2HA 1KGFA 2ZM2A 2HP9A 2IWBA 3HUNA 3UPPA 5GL9A 5EVID 5FI2A 4LCMA 4P87A 1ES4A 1CI9A 2Z2MB 2Q9NA 3CZDA 5FAPA 5TR7A 4EBPA 3OPPA 4Y0TA 1XP4A 1KE0A 4X6TA 3V39A 1RGZA 5IHVA 1EI5A 3CMZA 2WKEA 1IYSA 2WYXA 5DF9A 1KE4A 4E3KA 5F83A 2H0YA 3MBZA 1S6RA 4NK3A 1FSWA 5GHZA 1YT4A 3BFCA 4S2NA 5A91A 1MWSA 1K4FA 1LLBA 4OONA 4B4ZA 3NCKA 2WK0A 3CJMA 5GLBA 3IH8A 1MY8A 3FKWA 4GOGA 2HDQA 3N8LA 4YINA 3NC8A 4PPRA 1MKIA 4RA7A 4WMCA 3O86A 4JXVA 3SH9A 4BL3A 3UPNA 1KE3A 2GDNA 4U3TA 3E2LA 4OOLA 3BFFA 1U60A 5EUAA 3N4IA 5FQQA 3UDFA 2DRWA 1PZOA 4S2JA 3VP4A 4NETA 4EWFA 4OOMA 4E6WA 4OPYA 3S1YA 3LCEA 4EBNA 4DKIA 1DJCA 3GSGA 3UN7A 5FQIA 2HDSA 1K25A 2HPBA 4WM9A 3PBNA 1ERMA 3W4OA 2G2WA 2JE5A 4JLFA 1JTDA 1Y54A 4CPKA 5M19A 2ZC4B 3B3XA 3G32A 3PBTA 2EFXA 1YM1A 1PW1A 4OQ0A 4S2IA 1PWGA 2XK1A 3ITBA 4KZ5A 4OH0A 1ZG4A 3O3VA 3Q81A 2Y2QA 2XH9A 3IH9A 5HARA 1ES5A 4WMCD 1NXYA 4X68A 2X02A 5A90A 3M6HA 5KMWA 2OLVA 1L2SA 5EE8A 1W7FA 2Y2MA 3G4PA 3PBQA 4DE2A 3A3IA 1PZPA 4U0TA 3FV7A 2FFYA 1EROA 3PBOA 5FQKA 3SS3A 3HUOA 1NZOA 3IF6C 1JVJA 4HESA 2XEPA 2XFSA 3PAEA 1KDWA 2P74A 1SDNA 2EXBA 3NI9A 3S22A 4JXWA 3UE3A 1XA7A 4BQMA 5G18A 5CTMA 3VP3A 5CHUA 1RGYA 3UY6A 2RL3A 1O7EA 4ZBEA 2H5SA 2Y55A 4R4RA 4LCLA 5FI6A 4KZ4A 4DF6A 3N8SA 2XD1A 1TDLA 4MBKA 3IWOA 4GNUA 2R9XA 4WBGA 3C5AA 1NYYA 4X53A 4BL2A 4IBXA 2WUQA 4DXBA 2Y2PA 5DTTA 1BLPA 4S2MA 2Y2HA 4OQGA 1BSGA 2XFTA 1VQQA 3BFGA 3HVFA 3NBLA 4Z9QA 1WE4A 1LL9A 4OKPA 2WZXA 2IWDA 3TSGA 4MLLA 4EQIA 4OLGA 1YMSA 1W79A 3I7JA 2JCHA 3GTCA 4GDBA 3G2ZA 3OC2A 1K55C 1K56A 1E3UA 5EVLA 3V3SA 2BG1A 3UO9A 1KDSA 3ZVWA 1PW8A 4KZBA 5FA7A 5KZHA 5DTKA 1E4DA 4JF5A 1KGEA 1SKFA 2DCFA 4QY6A 2H10A 2Y2IA 4BJPA 2Y4AA 3ZVTA 3MXRA 3IHBA 1IYOA 3NY4A 3MKFA 1K38A 4BD0A 3ZCZA 3MZFA 2WGVA 4ZJ1A 5CXWA 5GHXA 4DE1A
chains in the Genus database with same CATH superfamily
5HD3A 1YLPA 1Q2QA 5FAOA 1NLZA 1PIOA 2JKRM 1MKMA 4HBUA 2M7VA 2Y2GA 2XA7M 4EU0A 3GV9A 1E3UD 3DTEA 1F98A 4K08A 5F1GA 3D9YA 4PMAA 4YNRA 2P04A 1PWCA 4S2OA 3RXWA 5FQMA 5EVIC 1H8MA 4F3LB 3PTEA 4HP4A 3FG8A 5EOEA 5HX9A 1PI4A 4BLMA 1STZA 5DVAA 4KZ6A 5HL6A 4LV0A 4E3MA 1RCJA 1YMXA 3AGEA 5EPHA 4D60A 1P97A 1K6SA 1BT5A 3UMEA 3MSHA 2DMWA 2ZQDA 5A92A 1DJBA 5HWWA 4R70A 2JC7A 1W63M 2OOLA 4HP9A 2J3WA 2P9VB 1LI0A 1M6KA 1FOFA 1L0FA 1YLZA 1S4RA 1T1CA 4FH4A 1PRQA 3C2WA 4YOFA 4L9FA 2ZC3B 1KGGA 1OTBA 2WKIA 4E3OA 1ESUA 3A3FA 4GW9A 5GLCA 4U0XA 2M1CA 3ZGAB 3FWLA 3ZDJA 1VM1A 4QD4A 4XUZA 4G3KA 3BRMA 2E8JA 2PAVP 3IT9A 4WZ4A 4GN2A 3VSKA 5FDSA 4E3LA 3T4JA 4DMZA 4KQRA 5FATA 1XGIA 2WGIA 2X71A 2HP5A 1IELA 4GLQA 3DWKA 5CGSA 3MR0A 4R3BA 4NG2A 2KDKA 4PAUA 3N8RA 3OPHA 4WEKA 3G30A 2DNSA 4IJGA 3VOLA 1YSPA 2PBYA 2V1BA 4LGWA 2HP6A 3T4LA 2J7VA 3L7HA 5CECA 2V9AA 4FOFA 5J3WA 4ME4A 1GSXA 4RX3A 5HPIA 3A0SA 3N7WA 3CPTA 3FKVA 4LV2A 2KX6A 3M6BA 3OPLA 2JN7A 1BUEA 1W5DA 1YKDA 1W63Q 3S4XA 3VP1A 4F94A 4JPMA 3KYEA 4EUZA 1MWTA 4QY5A 3SH8A 3OLOA 2VGLM 4WUJA 3LR5A 4R38A 5C5KA 5FI7A 1GHMA 2EFUA 2QZ6A 1XFQA 1Q2PA 3PYPA 4C3QA 2QKPA 4P6ZS 5HAPA 4WEJA 4R0QA 4KZ7A 3DW0A 1K55A 2OV5A 3BYDA 3MFXA 2I72A 4ZJ3A 3EEAA 4B9OA 2WAEA 5CHJA 1K0KA 4Q8IA 4R3AA 4MBFA 1JWVA 1FCMA 1H8YA 1KVMA 5TBMB 4QJGA 4NXFA 4S2LA 4ZAMA 3CWFA 3GRJA 1JWPA 1ESIA 3UPOA 3WS4A 1YAXA 1CI8A 2ZMAA 2Q9MA 2EX8A 1BZAA 3ITAA 4JF6A 1DP9A 3T1XA 5KSCA 4OOYA 1G5UA 1LT0A 1JWZA 2P7JA 2ZM8A 4R1GA 3NIAA 1XA1A 1W8QA 4Q0HA 4WZ5A 1ZHHB 1XPBA 1IOUA 4A5RA 4ZTKA 4IUHA 1YPRA 1GHIA 4UHUA 4G3VA 5CGXA 1H3QA 3WS2A 4NKPA 2FFFB 2XQZA 3Q07A 3Q82A 3G31A 1S1ZA 3D72A 3CUEA 4MN7A 4CLCC 3QP4A 5A93A 1NWZA 5F1FA 4I3JA 4LLOB 4IUKA 1KGFA 2W1TA 3HUNA 2Z2MB 1XP4A 2PR5A 4EW7A 1EI5A 3FPVA 1VETA 2WYXA 5DF9A 5EM1A 3C38A 1FIKA 1K4FA 3CJMA 4Y15A 3IH8A 3FKWA 1S1YA 4EEPA 2J80A 2W3EA 4ETZA 4BL3A 3UPNA 4MCWA 2GDNA 3BFFA 1U60A 5G4ZA 3LCEA 3T4TA 3UN7A 2HDSA 2PT7A 2HPBA 3PBNA 2JE5A 2ZC4B 4HQAA 1T1BA 1PW1A 4OQ0A 4NXEA 1PWGA 2XK1A 3U2AA 4OH0A 2OWJA 1ZG4A 4WMCD 1HLUP 5G4YA 5A90A 3C30A 2V1AA 1PZPA 2VV8A 1EROA 3SS3A 1NZOA 2GNXA 1JVJA 1MC0A 1KDWA 2P74A 1SDNA 2EXBA 2OAP1 4JXWA 4ESPA 1XA7A 3H7WA 5J7EA 3MJQA 3F1PA 2RL3A 1SKOA 4KQDA 4LCLA 3N8SA 2FH5A 2XD1A 1OTAA 3IWOA 2R9XA 4WBGA 1NYYA 2Y2HA 4OQGA 1BSGA 4EEUA 2PHYA 4Z9QA 5KIZA 2WZXA 2PD8A 4CLCE 3NULA 3I7JA 4GDBA 3HJKA 3V3SA 2BG1A 1KDSA 3EWKA 4M4XA 4NEED 1E4DA 1L3LA 1KGEA 2JKRI 1SKFA 3KSFA 5CX7A 4BJPA 1ACFA 3KSGA 5L8MA 4WN5A 3IHBA 4X1MA 1IYOA 2D02A 1TS8A 3W4QA 1T18A 3ZFZA 4FCFA 5EV0A 1HVBA 3G6OA 3T4OA 3TOIA 1M40A 5CGWA 2E8IA 1SCWA 3HLCA 4EV4A 3OZHA 4GHIA 2VGJA 4ZJ2A 3IF6A 2MJ6A 2IA2A 3UDIA 1PI5A 2EX2A 4ID4A 4S2PA 3W8KA 2OSUA 3IXBA 3MQQA 5HDCA 2V1ZA 5HDDA 4UA9A 2C6WB 4H6JA 3KSHA 4E3IA 4HIAA 4RX2A 4DDSA 4WYYA 1S67L 1V9YA 3P98A 4C6YA 2HJEA 3HLWA 2QWSA 3PAGA 4Z1WA 1BULA 4MN6A 2VLGA 5DTSA 2I9VA 2J9OA 1N9OA 2JBFA 2ZQ8A 4CLCA 4EERA 3O87A 3R7WB 1K57C 3RFBA 1XKZA 2J3TC 4MBHA 4MMNA 2INWA 2O9AA 4I38A 3OCLA 1TS0A 3SOIA 3D4FA 4GJ4A 4WELA 1N4OA 3IXHA 1AXBA 4ETXA 4EQ1A 1IYQA 4K0WA 3C7UA 4PM8A 3O88A 4CQHA 3GR2A 3UE6A 1F9IA 3IWQA 2NUPC 1FQGA 3IS2A 1A0KA 2XD5A 4DE0A 1CEGA 4QB8A 1ALQA 1J3WA 2Z6CA 3VP0A 2EX6A 5I94A 2PD7A 2FZ0A 2A3UA 4JBFA 1F5MA 3SS5A 3HBRA 4XT2B 5CTNA 3NDEA 4E3NA 3NOUC 3K2NA 5F6AA 1NY0A 3UDXA 4Y7PA 4GS9A 5HW3A 3IBJA 1S0WA 3DBAA 2VK3A 3MKEA 3P09A 2VGKA 3ZYTA 3G2YA 3WS1A 5JYOA 2XF3A 4LPZA 3V67A 4KZ9A 3MQOA 2Y2LA 4HJ3A 4BMWA 1SZVA 3NECA 1FCNA 5CERA 1G6OA 5FQJA 4FH2A 3ZG8B 4WZ5C 1KOUA 4R23A 5DFYA 2EXAA 3F1OA 4JGQA 4E6XA 2X01A 3ZHHA 3UB9A 4P6ZM 2HDRA 4Y3IA 3LY3A 1PFLA 4KQOA 4N1XA 4OVDA 3E98A 4FD8A 4ZDXA 4KZAA 3IXGA 2VV6A 3MMHA 3CUEC 1FSYA 4KZ8A 3LICA 4HBTA 4BENA 4R3JA 4GB7A 3CHWP 1I5QA 2ZOIA 4JXSA 4EESA 1YLTA 2ZQAA 1CEFA 3BM6A 3EQUA 1QMEA 3ZG9B 5EECA 5EVIB 1NZUA 1H5XA 2V2FF 2WGWB 3HUMA 5E2EA 3BFDA 3NDGA 3ZG0A 4BD1A 4O01A 2OWHA 2UWXA 4I3IA 4XXRA 4X1LA 5AVEA 3FC7A 4XUXA 1G68A 3WRZA 2A24B 1PYYA 4MDZA 1V9ZA 4QPRA 1LSXA 3SH7A 2H0TA 3QNBA 3NOTC 1TEMA 2B02A 4GCZA 4PM5A 3VOYA 2W1TB 5HFOA 4L0LA 1H8ZA 4IEDA 3VMAA 1DJAA 3VFHA 5DFXA 3UB6A 2W3FA 1XXMA 2L4RA 5FQ9A 1NRFA 2W1RA 5GLAA 1K54A 3E4QA 3HLGA 3GECA 1ONHA 3VOZA 1XJ2A 2Y2OA 2WKHA 5AVFA 3VE4A 3C4OA 4JGPA 1N9LA 4KG6A 2LB9A 3H82B 3VSLA 1TS6A 4LV3A 4EBLA 1K57A 2EA9A 2PDRA 2ZMVA 1L0EA 3CAXA 2K7SA 2ZM2A 2WKRA 3MXQA 2JKGA 4PKYG 2JKTM 1CI9A 1UWNX 2Q9NA 5TR7A 4EBPA 1KE0A 3V39A 5EM0A 3CMZA 4WF0A 2L0WA 4E3KA 1IYSA 5F83A 2PYPA 1S6RA 3BFCA 3KO6A 1LLBA 4O8GA 4B4ZA 2WK0A 2VZWA 2HDQA 3N8LA 3O86A 4JXVA 4OOLA 5EUAA 4YWZA 3TJZC 4EWFA 4OPYA 1DJCA 4ARZB 4BBUA 4WM9A 3H7WB 1ERMA 2G2WA 4JLFA 1JTDA 1Y54A 4CPKA 5M19A 3F1NA 1SKOB 3PBTA 1YM1A 2A2LA 2O99A 3O3VA 3Q81A 3IH9A 1NXYA 3B47A 3M6HA 1L2SA 2Y2MA 3BQ8A 3G4PA 4DE2A 3A3IA 4U0TA 3TW8A 5K5BA 2M7UA 2Y79A 3IF6C 5L09A 3NI9A 3S22A 3UE3A 5TJJA 2NUTC 3EOIA 5CTMA 3VP3A 5CHUA 1RGYA 3UY6A 4KUOA 4ZBEA 1LSVA 1XFNA 4DXBA 3LIBA 4S2MA 3ULFA 3T4KA 3RTYA 3BFGA 1OT6A 1P9RA 4DJ3A 1E3UA 1PW8A 4KZBA 5FA7A 5DTKA 5F68A 4II7A 4HI4A 3T1SA 2DCFA 3TE8A 4QY6A 2H10A 2Y2IA 3BY9A 2Y4AA 3MXRA 4H6JB 3DAVA 1OTEA 3MKFA 1K38A 4EUVA 3R4KA 2WGVA 4ZJ1A 5GHXA 1VB6A 2QJ5A 5FL3A 5J4EA 1YLJA 4LENA 2VV7A 2QPNA 2A49A 2HZ5A 4OPQA 4CLCB 1MPLA 5F82A 3UMDA 1KVLA 1EW0A 4PM9A 1C3BA 5FAQA 3W4PA 5L10A 1FCOA 4DDYA 2PRFA 1SHVA 3OBFA 3JVVA 3PBSA 4I5SA 3VFFA 3MF0A 4GD6A 2W27A 3CITA 1PNEA 2ZQ9A 2V8FA 4N9LA 3A0VA 3HREA 3Q7VA 3AGDA 4JGOA 3GVBA 3K3DA 4KG2A 1VHMA 4WL9A 4UQIS 2V8CA 3UB7A 2Q0OA 4JKTA 5E2GA 3M2KA 3BLMA 4O0PA 4X55A 5TGFA 2J9PA 5AJGA 1XX2A 3C4PA 2PU2A 1ES2A 1T1AA 2PU4A 3ZG5A 1FR6A 4HHDA 4HY8A 1BLSA 3N6IA 1RP5A 3P7NA 4C75A 4FUWA 4Q0IA 2VA0A 3NJAA 4OPZA 4UAAA 1WA9A 3JYIA 1LL5A 1XGJA 1T19A 3HLDA 4GS9B 1E25A 1D1JA 2PBDP 2CC1A 2ZLYA 1WYCA 4ZRRA 3VE3A 2K2NA 5EFWA 5HSQA 1GCEA 4N9KA 1W8YA 2R78A 4E3JA 2XROA 2Y2KA 5A8BA 1MXOA 4S2KA 5HD5A 4GD8A 1DP6A 3T12B 1NYMA 3LIAA 1NJ4A 3LYXA 1L0DA 2O9CA 3E4PA 2Z2LB 4DN0A 2W3DA 3ZNTA 4QHCA 5FEGA 4HNBA 4IBRA 5CEDA 3BECA 3A3DA 4B88A 2VEAA 5E43A 2JHEA 2KOIA 5CRFA 2EWWA 4OP8A 5EOOA 5AQ7A 3Q7ZA 1K56D 5HAIA 3IF5A 3QP5A 5DF7A 4X69A 3IX3A 4N1HA 2HDUA 2XGNA 4PHTA 3DTMA 3E4OA 3T50A 3TG9A 2ZC5B 4P6BA 3SZTA 4OQHA 1YSQA 3LO7A 2C5WB 2L1MA 5HL1A 5KSHA 1K54C 2V0WA 3UB8A 3HLFA 5AQ9A 2WAFA 1GHPA 1ONGA 2WKPA 2O0YA 2R9WA 1NLYA 3PBRA 2JKFA 2ZMFA 5L2FA 2ZQ7A 1HD8A 1BLCA 3VP2A 3BLSA 4KZ3A 4BWIA 2Y2JA 3SS4A 1PWDA 4DXCA 1CK3A 3GDIA 5JYPA 1TD5A 3G34A 4RQ9A 4Y0OA 4L9GA 1TDGA 4RVAA 3OCNA 1CJFA 2AVXA 3IHAA 4HOIA 1OMEA 1HZOA 3HLEA 4DRTA 3FZCA 1UGUA 1S4SA 1K4EA 1GA9A 1P0ZA 3UE1A 4QWOA 3CPTB 4BBVA 1LSWA 2W3HA 2GZAA 3OPRA 1TF1A 3DTIA 1D06A 3JPUA 2BTFP 3WWXA 1XJ4A 1S66L 5BOHA 4X56A 3KYQA 4R4SA 3KX0X 5AQAA 2BLSA 5HWTA 2H28A 3LY4A 5CHMA 3IWIA 1O07A 3QP1A 4IVIA 3S7QA 4Y2FA 1VEUA 4DE3A 1OTIA 3LEQA 1OPXA 3UE0A 2ZD8A 3EQVA 2XRNA 4K91A 5E2HA 3T1QB 3LGOA 2IWBA 3UPPA 3ZQ5A 1XJ3A 5GL9A 2WKQA 5EVID 1ZTUA 1ES4A 3EGDC 4Y0TA 3B33A 4X6TA 1RGZA 1AWIA 1KE4A 1GSWA 2H0YA 4NK3A 1FSWA 1YT4A 2HV1A 4S2NA 5A91A 4OONA 3H9WA 3NCKA 1OTDA 1MY8A 4YINA 2W0NA 3NC8A 4PPRA 3IX4A 2YKFA 4WMCA 1KE3A 4U3TA 3E2LA 3N4IA 2DRWA 1PZOA 3VP4A 5IT5A 4NETA 4OOMA 5F5YA 3S1YA 4EBNA 2UV0E 3GSGA 5FQIA 1K25A 2Y8HA 4HJ6A 3E0YA 1FILA 2B95A 3B3XA 4PKYA 3IX8A 4KZ5A 1P9WA 4IHQA 4DJ2A 1ES5A 3HCYA 4KUKA 2X02A 1JNUA 2G7UA 5KMWA 3SW1A 2OLVA 2QYBA 3LI8A 1W7FA 3PBQA 2FFYA 3PBOA 2VJWA 4HESA 3PAEA 2GJ3A 5IU1A 4BQMA 5G18A 2H5SA 2OAQ1 4GNUA 1Y28A 1VETB 3C5AA 4BL2A 4IBXA 2WUQA 2Y2PA 3L9KA 2ZL1A 5DTTA 3R7WA 1VQQA 3HVFA 1WE4A 1LL9A 4OKPA 3S7NA 3TSGA 4MLLA 4EQIA 3T4QA 4LFUA 1YMSA 3UB5P 3GTCA 1K56A 5EVLA 2PYRA 3UO9A 3ZVWA 5KZHA 2PR6A 4AFIA 1X0OA 4BD0A 3ZCZA 3LR4A 1CQAA 2HJ9C 5HZHA 2WADA 3RH8B 3IXDA 3Q7VB 4GKUA 5F69A 3S7PA 5DF8A 1N9BA 3FYZA 4OP5A 1I2SA 1IEMA 2W3GA 4D2OA 5MC7A 4NXGA 3MZEA 4QU3A 3U4LP 3LEZA 5GLDA 3OOVA 4H8RA 3ZG7B 1YLWA 3NHQA 2RCXA 1SDEA 2XLNA 2QMIA 5FSRA 2HF6A 2YKHA 2XA7S 2ZBBA 5TFQA 4UQIM 4XT2A 2BASA 3F1PB 3LI9A 2V0UA 1YQSA 1MWRA 3C8CA 1IKGA 1TS7A 4FSFA 4P0MA 2ACGA 1IFQA 2XR0A 4WLAA 3T4SA 1L0GA 3Q1FA 3HL9A 3BWLA 3BY8A 4LV1A 4Y5FA 2VKSA 4KQQA 4B4XA 1WYBA 1ZC2A 4JXGA 3UNWA 1NRJA 3W2ZA 2V20A 1G6AA 3GQZA 4EXOA 3BEBA 4PM6A 4P85A 4F3LA 4GZBA 4Y13A 2Y91A 4JF4A 1F2KA 1HTZA 4LRXC 2XDMA 2G2UA 3D3OA 2ZOHA 5HWVA 4HH2A 4CLCD 1I2WA 4O7DA 1ZKJA 3G35A 4I39A 3ZNYA 4GHIB 3QHYA 3IF6B 1Y4OA 2ZC7A 3MZDA 2P9VA 3NOPC 5EVIA 3BQAA 2WGWA 4IVKA 5AQBA 5M1AA 3MQ0A 2ZM0A 3QP8A 5IS1A 1IYPA 3B42A 3E2KA 4LRYC 1DY6A 1ERQA 4MN5A 1DRMA 3AGFA 2A24A 3RJUA 2Z6DA 4RYEA 5DKLA 1D7EA 3K3CA 3MS6A 1BTLA 3C7VA 5D3OA 1J9MA 5HDSA 1ES3A 5U47A 3WS0A 3JVUA 3RXXA 3CLOA 1OJGA 3V3RA 3A3JA 1TVFA 5GHYA 1MWUA 2ZQCA 3KYZA 2P08A 3LIEA 3WRTA 1LHYA 2Y59A 1Z09A 4UA7A 3CI6A 3IQAA 3LFVA 2EX9A 1K6RA 3LR3A 2OLUA 5M18A 2QJ7A 2IWCA 3H82A 2HGVA 3BW6A 4OQIA 3GMWA 3WS5A 1IKIA 2QHKA 4NXBA 2ZJ9A 5FASA 4G3WA 2VGLS 4N92A 3P01A 3IS2B 4I3AA 4YFMA 1ZG6A 4Y17A 4MNRA 2GX5A 3EEHA 1UWPX 3DTKA 4K0XA 4KG5A 3HJIA 4GDNA 1JTGA 1EWZA 5L07A 1GA0A 5CEBA 5HAQA 4KENB 1BYWA 3M2JA 1N9NA 2KLIA 4L9EA 3ICYA 5DJTA 3BFEA 3V50A 4CJNA 3MFDA 4MEZA 1OT9A 4S2NC 3V5MA 2ZC6B 3MXSA 5HPFA 1VEUB 4Q0JA 2J8YA 5J8XA 3A3EA 4X25A 1BLHA 1MBLA 4OPRA 1YLYA 2B5RA 4ARZA 4HEFA 4JGRA 1GSVA 2WZZA 1Z6FA 1FR1A 3KSIA 3QNCA 5LBRA 1G28A 4OLDA 1CF0A 2XSSA 3A0RA 3DWZA 4Y0UA 5TBMA 3F1OB 2Y2NA 4PM7A 4UA6A 5E2FA 5FDHA 1QMFA 4M3KA 1LI9A 1OJ5A 1MZUA 3CG5A 3HLBA 3ISGA 1XJ6A 2HP9A 5DKKA 5FI2A 4LCMA 4FTXA 4P87A 5DJUA 3CZDA 5FAPA 3OPPA 5IHVA 2WKEA 4EETB 3MBZA 5GHZA 4HJ4A 3IBRA 1MWSA 3QP2A 5GLBA 4GOGA 1MKIA 4RA7A 2J3TD 3SH9A 5FQQA 3UDFA 4S2JA 4E6WA 2EWVA 4DKIA 3PXPA 2CMNA 3W4OA 2O9BA 3S7OA 3G32A 2EFXA 2LB5A 3VV4A 2K31A 4S2IA 3ITBA 2B18A 2ZL1B 3TRCA 2Y2QA 2XH9A 4BBTA 5HARA 3EGXC 1ODVA 4X68A 1H0MA 1DP8A 3PHYA 4B93A 5EE8A 5EVEA 5FEFA 3FV7A 3LR0A 5FQKA 3HUOA 2XEPA 2XFSA 5I5LA 1O7EA 3PR6A 2Y55A 4R4RA 5FI6A 4KZ4A 4DF6A 1TDLA 4MBKA 3FPWA 4X53A 4E04A 3LIDA 4LRZE 3BJNA 1BLPA 2XFTA 2D01A 3NBLA 4UEYA 2IWDA 2JKTI 4OLGA 2VX8A 1W79A 2JCHA 3G2ZA 3OC2A 1K55C 3QP6A 4JF5A 3LIFA 3T1RA 4HH3A 1LL8A 3LUQA 3ZVTA 4R6LA 3NY4A 3O5YA 3MZFA 3F1NB 5CXWA 4DE1A
chains in the Genus database with same CATH topology
2WADA 3IXDA 3Q7VB 3ZFZA 1YLJA 4FCFA 4GKUA 1YLPA 1HVBA 1Q2QA 5FAOA 1PIOA 4LENA 3TOIA 1M40A 5CGWA 2E8IA 2QPNA 1SCWA 5DF8A 3HLCA 4EV4A 2A49A 1N9BA 3FYZA 4OPQA 4OP5A 4HBUA 1I2SA 2Y2GA 3OZHA 2VGJA 1MPLA 1IEMA 4ZJ2A 5F82A 4D2OA 3GV9A 3IF6A 1E3UD 1KVLA 3UDIA 3MZEA 1C3BA 4PM9A 4QU3A 1PI5A 5FAQA 2EX2A 4ID4A 3W4PA 3LEZA 5GLDA 5F1GA 4S2PA 3W8KA 2OSUA 3IXBA 4H8RA 3ZG7B 1FCOA 4DDYA 1SHVA 4PMAA 1YLWA 3PBSA 2V1ZA 1PWCA 1SDEA 2RCXA 2XLNA 4UA9A 2QMIA 2C6WB 4S2OA 5FSRA 3VFFA 3RXWA 4GD6A 5TFQA 5FQMA 5EVIC 4E3IA 4RX2A 4DDSA 2ZQ9A 4WYYA 3PTEA 3P98A 4C6YA 5EOEA 3HLWA 4N9LA 5HX9A 3PAGA 1YQSA 1MWRA 1PI4A 4BLMA 3HREA 3Q7VA 3AGDA 5DVAA 1BULA 1IKGA 4FSFA 4P0MA 3GVBA 4KG2A 4KZ6A 5DTSA 4LV0A 2J9OA 2XR0A 4E3MA 1RCJA 2JBFA 4JKTA 5E2GA 1YMXA 1L0GA 3AGEA 3M2KA 2ZQ8A 3BLMA 3Q1FA 4X55A 5EPHA 5TGFA 3HL9A 3O87A 1K57C 1K6SA 1BT5A 2ZQDA 2J9PA 1XKZA 5A92A 1DJBA 4MBHA 4LV1A 1XX2A 3C4PA 2JC7A 3OCLA 3SOIA 4KQQA 3D4FA 1WYBA 4B4XA 2PU2A 1ZC2A 1ES2A 2P9VB 1LI0A 1M6KA 4JXGA 2PU4A 3UNWA 3ZG5A 4WELA 1FR6A 1FOFA 1L0FA 2V20A 1G6AA 1N4OA 1BLSA 1YLZA 3GQZA 1AXBA 3IXHA 3N6IA 4FH4A 1RP5A 3BEBA 4PM6A 4C75A 4P85A 2ZC3B 4GZBA 1KGGA 2Y91A 2WKIA 1IYQA 4E3OA 4JF4A 4K0WA 3C7UA 1HTZA 4OPZA 1ESUA 4UAAA 2XDMA 3JYIA 1LL5A 2G2UA 3A3FA 1XGJA 4PM8A 5GLCA 4U0XA 3HLDA 3O88A 1I2WA 3ZGAB 3FWLA 3GR2A 4O7DA 1ZKJA 3ZDJA 1VM1A 4QD4A 4XUZA 1E25A 3IWQA 3BRMA 2CC1A 4WZ4A 3G35A 3IT9A 4GN2A 2ZLYA 3VSKA 4E3LA 1FQGA 3ZNYA 2XD5A 1WYCA 3QHYA 4KQRA 4DE0A 5FATA 1CEGA 4QB8A 3IF6B 1ALQA 1XGIA 1GCEA 4N9KA 2WGIA 2X71A 2HP5A 1IELA 1W8YA 2ZC7A 3MZDA 2EX6A 2P9VA 3DWKA 3VP0A 5CGSA 5EVIA 5I94A 2WGWA 4R3BA 2A3UA 4IVKA 4E3JA 4JBFA 5AQBA 5M1AA 3N8RA 3OPHA 2Y2KA 1MXOA 4WEKA 2ZM0A 3G30A 2DNSA 4S2KA 3SS5A 1IYPA 3HBRA 4GD8A 2PBYA 3E2KA 1NYMA 1NJ4A 1DY6A 2HP6A 5CTNA 1ERQA 1L0DA 2J7VA 3NDEA 4E3NA 2Z2LB 3ZNTA 4QHCA 1NY0A 3AGFA 3UDXA 5CECA 4IBRA 4Y7PA 3RJUA 5CEDA 3BECA 5HW3A 1S0WA 3A3DA 4RX3A 4B88A 4RYEA 3MKEA 3N7WA 5E43A 3P09A 2VGKA 3FKVA 3G2YA 4LV2A 3M6BA 5CRFA 3OPLA 4OP8A 5EOOA 3WS1A 1BTLA 5JYOA 2XF3A 3Q7ZA 5AQ7A 1K56D 3C7VA 5HAIA 5D3OA 3IF5A 4KZ9A 1J9MA 5DF7A 4X69A 1ES3A 2Y2LA 5U47A 3WS0A 4N1HA 2HDUA 2XGNA 1BUEA 1W5DA 3RXXA 3DTMA 1FCNA 5CERA 3V3RA 5FQJA 4FH2A 3S4XA 3TG9A 2ZC5B 3A3JA 4WZ5C 1TVFA 3VP1A 3ZG8B 4F94A 4R23A 4JPMA 4P6BA 2EXAA 1MWUA 4OQHA 5GHYA 2ZQCA 3LO7A 3WRTA 2C5WB 4E6XA 2X01A 1LHYA 3ZHHA 4EUZA 1MWTA 2Y59A 5HL1A 4QY5A 4UA7A 3SH8A 3IQAA 5KSHA 2HDRA 2EX9A 1K6RA 3LY3A 1K54C 4KQOA 3HLFA 4N1XA 4OVDA 2OLUA 5AQ9A 5M18A 2WAFA 2IWCA 1GHPA 5FI7A 1GHMA 2EFUA 1ONGA 2QZ6A 4FD8A 1Q2PA 4ZDXA 4KZAA 4OQIA 3GMWA 3WS5A 1IKIA 2R9WA 3IXGA 3PBRA 4C3QA 1FSYA 4KZ8A 2ZJ9A 5L2FA 2ZQ7A 1HD8A 1BLCA 3VP2A 5FASA 3BLSA 5HAPA 4WEJA 4HBTA 4N92A 4KZ3A 4R0QA 4KZ7A 4BENA 3DW0A 4GB7A 4R3JA 1K55A 2Y2JA 3SS4A 4YFMA 1PWDA 1ZG6A 1I5QA 4JXSA 4MNRA 3BYDA 2OV5A 4DXCA 2I72A 1CK3A 1YLTA 4ZJ3A 2ZQAA 1CEFA 3BM6A 3EQUA 1QMEA 4K0XA 2WAEA 4KG5A 5CHJA 5EECA 3ZG9B 4GDNA 5EVIB 1JTGA 1NZUA 3G34A 4Q8IA 1H5XA 2V2FF 1EWZA 2WGWB 3HUMA 4MBFA 4Y0OA 5E2EA 1JWVA 1FCMA 1GA0A 1H8YA 1KVMA 1TDGA 5CEBA 4RVAA 5HAQA 4QJGA 3OCNA 4KENB 4S2LA 3IHAA 4ZAMA 1OMEA 3GRJA 1JWPA 1HZOA 3BFDA 3HLEA 3NDGA 3ZG0A 4BD1A 3M2JA 4DRTA 1ESIA 3UPOA 2UWXA 3WS4A 3FZCA 4XXRA 1CI8A 3BFEA 3V50A 2ZMAA 4CJNA 2Q9MA 3MFDA 4MEZA 3W4QA 2EX8A 4S2NC 3V5MA 2ZC6B 1BZAA 3ITAA 3MXSA 4XUXA 1G68A 3WRZA 1PYYA 4JF6A 1K4EA 1GA9A 2J8YA 5J8XA 3SH7A 5KSCA 2H0TA 3QNBA 4OOYA 3A3EA 1BLHA 1TEMA 1MBLA 3UE1A 4OPRA 1JWZA 1YLYA 2B5RA 4HEFA 4PM5A 2ZM8A 3VOYA 4R1GA 5HFOA 3NIAA 1H8ZA 4L0LA 1XA1A 1W8QA 1Z6FA 1DJAA 2WZZA 1FR1A 3OPRA 4IEDA 3VFHA 3VMAA 4WZ5A 1XXMA 5FQ9A 1XPBA 3QNCA 3WWXA 4OLDA 1NRFA 4A5RA 5JYPA 4ZTKA 5BOHA 3DWZA 4Y0UA 4X56A 1GHIA 4UHUA 5GLAA 1K54A 5CGXA 4R4SA 3HLGA 5AQAA 1ONHA 3WS2A 2BLSA 3VOZA 2Y2OA 3LY4A 2FFFB 2Y2NA 5CHMA 2XQZA 2WKHA 3Q07A 3IWIA 3Q82A 4PM7A 1O07A 4IVIA 3G31A 3C4OA 4UA6A 5E2FA 5FDHA 4KG6A 1QMFA 4M3KA 3VSLA 4DE3A 5A93A 4LV3A 4EBLA 1K57A 1LI9A 5F1FA 3CG5A 3UE0A 1L0EA 2ZD8A 3HLBA 3EQVA 3ISGA 4K91A 5E2HA 1KGFA 2ZM2A 2HP9A 2IWBA 3HUNA 3UPPA 5GL9A 5EVID 5FI2A 4LCMA 4P87A 1ES4A 1CI9A 2Z2MB 2Q9NA 3CZDA 5FAPA 5TR7A 4EBPA 3OPPA 4Y0TA 1XP4A 1KE0A 4X6TA 3V39A 1RGZA 5IHVA 1EI5A 3CMZA 2WKEA 1IYSA 2WYXA 5DF9A 1KE4A 4E3KA 5F83A 2H0YA 3MBZA 1S6RA 4NK3A 1FSWA 5GHZA 1YT4A 3BFCA 4S2NA 5A91A 1MWSA 1K4FA 1LLBA 4OONA 4B4ZA 3NCKA 2WK0A 3CJMA 5GLBA 3IH8A 1MY8A 3FKWA 4GOGA 2HDQA 3N8LA 4YINA 3NC8A 4PPRA 1MKIA 4RA7A 4WMCA 3O86A 4JXVA 3SH9A 4BL3A 3UPNA 1KE3A 2GDNA 4U3TA 3E2LA 4OOLA 3BFFA 1U60A 5EUAA 3N4IA 5FQQA 3UDFA 2DRWA 1PZOA 4S2JA 3VP4A 4NETA 4EWFA 4OOMA 4E6WA 4OPYA 3S1YA 3LCEA 4EBNA 4DKIA 1DJCA 3GSGA 3UN7A 5FQIA 2HDSA 1K25A 2HPBA 4WM9A 3PBNA 1ERMA 3W4OA 2G2WA 2JE5A 4JLFA 1JTDA 1Y54A 4CPKA 5M19A 2ZC4B 3B3XA 3G32A 3PBTA 2EFXA 1YM1A 1PW1A 4OQ0A 4S2IA 1PWGA 2XK1A 3ITBA 4KZ5A 4OH0A 1ZG4A 3O3VA 3Q81A 2Y2QA 2XH9A 3IH9A 5HARA 1ES5A 4WMCD 1NXYA 4X68A 2X02A 5A90A 3M6HA 5KMWA 2OLVA 1L2SA 5EE8A 1W7FA 2Y2MA 3G4PA 3PBQA 4DE2A 3A3IA 1PZPA 4U0TA 3FV7A 2FFYA 1EROA 3PBOA 5FQKA 3SS3A 3HUOA 1NZOA 3IF6C 1JVJA 4HESA 2XEPA 2XFSA 3PAEA 1KDWA 2P74A 1SDNA 2EXBA 3NI9A 3S22A 4JXWA 3UE3A 1XA7A 4BQMA 5G18A 5CTMA 3VP3A 5CHUA 1RGYA 3UY6A 2RL3A 1O7EA 4ZBEA 2H5SA 2Y55A 4R4RA 4LCLA 5FI6A 4KZ4A 4DF6A 3N8SA 2XD1A 1TDLA 4MBKA 3IWOA 4GNUA 2R9XA 4WBGA 3C5AA 1NYYA 4X53A 4BL2A 4IBXA 2WUQA 4DXBA 2Y2PA 5DTTA 1BLPA 4S2MA 2Y2HA 4OQGA 1BSGA 2XFTA 1VQQA 3BFGA 3HVFA 3NBLA 4Z9QA 1WE4A 1LL9A 4OKPA 2WZXA 2IWDA 3TSGA 4MLLA 4EQIA 4OLGA 1YMSA 1W79A 3I7JA 2JCHA 3GTCA 4GDBA 3G2ZA 3OC2A 1K55C 1K56A 1E3UA 5EVLA 3V3SA 2BG1A 3UO9A 1KDSA 3ZVWA 1PW8A 4KZBA 5FA7A 5KZHA 5DTKA 1E4DA 4JF5A 1KGEA 1SKFA 2DCFA 4QY6A 2H10A 2Y2IA 4BJPA 2Y4AA 3ZVTA 3MXRA 3IHBA 1IYOA 3NY4A 3MKFA 1K38A 4BD0A 3ZCZA 3MZFA 2WGVA 4ZJ1A 5CXWA 5GHXA 4DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAD A;  3IXD A;  3Q7V B;  3ZFZ A;  1YLJ A;  4FCF A;  4GKU A;  1YLP A;  1HVB A;  1Q2Q A;  5FAO A;  1PIO A;  4LEN A;  3TOI A;  1M40 A;  5CGW A;  2E8I A;  2QPN A;  1SCW A;  5DF8 A;  3HLC A;  4EV4 A;  2A49 A;  1N9B A;  3FYZ A;  4OPQ A;  4OP5 A;  4HBU A;  1I2S A;  2Y2G A;  3OZH A;  2VGJ A;  1MPL A;  1IEM A;  4ZJ2 A;  5F82 A;  4D2O A;  3GV9 A;  3IF6 A;  1E3U D;  1KVL A;  3UDI A;  3MZE A;  1C3B A;  4PM9 A;  4QU3 A;  1PI5 A;  5FAQ A;  2EX2 A;  4ID4 A;  3W4P A;  3LEZ A;  5GLD A;  5F1G A;  4S2P A;  3W8K A;  2OSU A;  3IXB A;  4H8R A;  3ZG7 B;  1FCO A;  4DDY A;  1SHV A;  4PMA A;  1YLW A;  3PBS A;  2V1Z A;  1PWC A;  1SDE A;  2RCX A;  2XLN A;  4UA9 A;  2QMI A;  2C6W B;  4S2O A;  5FSR A;  3VFF A;  3RXW A;  4GD6 A;  5TFQ A;  5FQM A;  5EVI C;  4E3I A;  4RX2 A;  4DDS A;  2ZQ9 A;  4WYY A;  3PTE A;  3P98 A;  4C6Y A;  5EOE A;  3HLW A;  4N9L A;  5HX9 A;  3PAG A;  1YQS A;  1MWR A;  1PI4 A;  4BLM A;  3HRE A;  3Q7V A;  3AGD A;  5DVA A;  1BUL A;  1IKG A;  4FSF A;  4P0M A;  3GVB A;  4KG2 A;  4KZ6 A;  5DTS A;  4LV0 A;  2J9O A;  2XR0 A;  4E3M A;  1RCJ A;  2JBF A;  4JKT A;  5E2G A;  1YMX A;  1L0G A;  3AGE A;  3M2K A;  2ZQ8 A;  3BLM A;  3Q1F A;  4X55 A;  5EPH A;  5TGF A;  3HL9 A;  3O87 A;  1K57 C;  1K6S A;  1BT5 A;  2ZQD A;  2J9P A;  1XKZ A;  5A92 A;  1DJB A;  4MBH A;  4LV1 A;  1XX2 A;  3C4P A;  2JC7 A;  3OCL A;  3SOI A;  4KQQ A;  3D4F A;  1WYB A;  4B4X A;  2PU2 A;  1ZC2 A;  1ES2 A;  2P9V B;  1LI0 A;  1M6K A;  4JXG A;  2PU4 A;  3UNW A;  3ZG5 A;  4WEL A;  1FR6 A;  1FOF A;  1L0F A;  2V20 A;  1G6A A;  1N4O A;  1BLS A;  1YLZ A;  3GQZ A;  1AXB A;  3IXH A;  3N6I A;  4FH4 A;  1RP5 A;  3BEB A;  4PM6 A;  4C75 A;  4P85 A;  2ZC3 B;  4GZB A;  1KGG A;  2Y91 A;  2WKI A;  1IYQ A;  4E3O A;  4JF4 A;  4K0W A;  3C7U A;  1HTZ A;  4OPZ A;  1ESU A;  4UAA A;  2XDM A;  3JYI A;  1LL5 A;  2G2U A;  3A3F A;  1XGJ A;  4PM8 A;  5GLC A;  4U0X A;  3HLD A;  3O88 A;  1I2W A;  3ZGA B;  3FWL A;  3GR2 A;  4O7D A;  1ZKJ A;  3ZDJ A;  1VM1 A;  4QD4 A;  4XUZ A;  1E25 A;  3IWQ A;  3BRM A;  2CC1 A;  4WZ4 A;  3G35 A;  3IT9 A;  4GN2 A;  2ZLY A;  3VSK A;  4E3L A;  1FQG A;  3ZNY A;  2XD5 A;  1WYC A;  3QHY A;  4KQR A;  4DE0 A;  5FAT A;  1CEG A;  4QB8 A;  3IF6 B;  1ALQ A;  1XGI A;  1GCE A;  4N9K A;  2WGI A;  2X71 A;  2HP5 A;  1IEL A;  1W8Y A;  2ZC7 A;  3MZD A;  2EX6 A;  2P9V A;  3DWK A;  3VP0 A;  5CGS A;  5EVI A;  5I94 A;  2WGW A;  4R3B A;  2A3U A;  4IVK A;  4E3J A;  4JBF A;  5AQB A;  5M1A A;  3N8R A;  3OPH A;  2Y2K A;  1MXO A;  4WEK A;  2ZM0 A;  3G30 A;  2DNS A;  4S2K A;  3SS5 A;  1IYP A;  3HBR A;  4GD8 A;  2PBY A;  3E2K A;  1NYM A;  1NJ4 A;  1DY6 A;  2HP6 A;  5CTN A;  1ERQ A;  1L0D A;  2J7V A;  3NDE A;  4E3N A;  2Z2L B;  3ZNT A;  4QHC A;  1NY0 A;  3AGF A;  3UDX A;  5CEC A;  4IBR A;  4Y7P A;  3RJU A;  5CED A;  3BEC A;  5HW3 A;  1S0W A;  3A3D A;  4RX3 A;  4B88 A;  4RYE A;  3MKE A;  3N7W A;  5E43 A;  3P09 A;  2VGK A;  3FKV A;  3G2Y A;  4LV2 A;  3M6B A;  5CRF A;  3OPL A;  4OP8 A;  5EOO A;  3WS1 A;  1BTL A;  5JYO A;  2XF3 A;  3Q7Z A;  5AQ7 A;  1K56 D;  3C7V A;  5HAI A;  5D3O A;  3IF5 A;  4KZ9 A;  1J9M A;  5DF7 A;  4X69 A;  1ES3 A;  2Y2L A;  5U47 A;  3WS0 A;  4N1H A;  2HDU A;  2XGN A;  1BUE A;  1W5D A;  3RXX A;  3DTM A;  1FCN A;  5CER A;  3V3R A;  5FQJ A;  4FH2 A;  3S4X A;  3TG9 A;  2ZC5 B;  3A3J A;  4WZ5 C;  1TVF A;  3VP1 A;  3ZG8 B;  4F94 A;  4R23 A;  4JPM A;  4P6B A;  2EXA A;  1MWU A;  4OQH A;  5GHY A;  2ZQC A;  3LO7 A;  3WRT A;  2C5W B;  4E6X A;  2X01 A;  1LHY A;  3ZHH A;  4EUZ A;  1MWT A;  2Y59 A;  5HL1 A;  4QY5 A;  4UA7 A;  3SH8 A;  3IQA A;  5KSH A;  2HDR A;  2EX9 A;  1K6R A;  3LY3 A;  1K54 C;  4KQO A;  3HLF A;  4N1X A;  4OVD A;  2OLU A;  5AQ9 A;  5M18 A;  2WAF A;  2IWC A;  1GHP A;  5FI7 A;  1GHM A;  2EFU A;  1ONG A;  2QZ6 A;  4FD8 A;  1Q2P A;  4ZDX A;  4KZA A;  4OQI A;  3GMW A;  3WS5 A;  1IKI A;  2R9W A;  3IXG A;  3PBR A;  4C3Q A;  1FSY A;  4KZ8 A;  2ZJ9 A;  5L2F A;  2ZQ7 A;  1HD8 A;  1BLC A;  3VP2 A;  5FAS A;  3BLS A;  5HAP A;  4WEJ A;  4HBT A;  4N92 A;  4KZ3 A;  4R0Q A;  4KZ7 A;  4BEN A;  3DW0 A;  4GB7 A;  4R3J A;  1K55 A;  2Y2J A;  3SS4 A;  4YFM A;  1PWD A;  1ZG6 A;  1I5Q A;  4JXS A;  4MNR A;  3BYD A;  2OV5 A;  4DXC A;  2I72 A;  1CK3 A;  1YLT A;  4ZJ3 A;  2ZQA A;  1CEF A;  3BM6 A;  3EQU A;  1QME A;  4K0X A;  2WAE A;  4KG5 A;  5CHJ A;  5EEC A;  3ZG9 B;  4GDN A;  5EVI B;  1JTG A;  1NZU A;  3G34 A;  4Q8I A;  1H5X A;  2V2F F;  1EWZ A;  2WGW B;  3HUM A;  4MBF A;  4Y0O A;  5E2E A;  1JWV A;  1FCM A;  1GA0 A;  1H8Y A;  1KVM A;  1TDG A;  5CEB A;  4RVA A;  5HAQ A;  4QJG A;  3OCN A;  4KEN B;  4S2L A;  3IHA A;  4ZAM A;  1OME A;  3GRJ A;  1JWP A;  1HZO A;  3BFD A;  3HLE A;  3NDG A;  3ZG0 A;  4BD1 A;  3M2J A;  4DRT A;  1ESI A;  3UPO A;  2UWX A;  3WS4 A;  3FZC A;  4XXR A;  1CI8 A;  3BFE A;  3V50 A;  2ZMA A;  4CJN A;  2Q9M A;  3MFD A;  4MEZ A;  3W4Q A;  2EX8 A;  4S2N C;  3V5M A;  2ZC6 B;  1BZA A;  3ITA A;  3MXS A;  4XUX A;  1G68 A;  3WRZ A;  1PYY A;  4JF6 A;  1K4E A;  1GA9 A;  2J8Y A;  5J8X A;  3SH7 A;  5KSC A;  2H0T A;  3QNB A;  4OOY A;  3A3E A;  1BLH A;  1TEM A;  1MBL A;  3UE1 A;  4OPR A;  1JWZ A;  1YLY A;  2B5R A;  4HEF A;  4PM5 A;  2ZM8 A;  3VOY A;  4R1G A;  5HFO A;  3NIA A;  1H8Z A;  4L0L A;  1XA1 A;  1W8Q A;  1Z6F A;  1DJA A;  2WZZ A;  1FR1 A;  3OPR A;  4IED A;  3VFH A;  3VMA A;  4WZ5 A;  1XXM A;  5FQ9 A;  1XPB A;  3QNC A;  3WWX A;  4OLD A;  1NRF A;  4A5R A;  5JYP A;  4ZTK A;  5BOH A;  3DWZ A;  4Y0U A;  4X56 A;  1GHI A;  4UHU A;  5GLA A;  1K54 A;  5CGX A;  4R4S A;  3HLG A;  5AQA A;  1ONH A;  3WS2 A;  2BLS A;  3VOZ A;  2Y2O A;  3LY4 A;  2FFF B;  2Y2N A;  5CHM A;  2XQZ A;  2WKH A;  3Q07 A;  3IWI A;  3Q82 A;  4PM7 A;  1O07 A;  4IVI A;  3G31 A;  3C4O A;  4UA6 A;  5E2F A;  5FDH A;  4KG6 A;  1QMF A;  4M3K A;  3VSL A;  4DE3 A;  5A93 A;  4LV3 A;  4EBL A;  1K57 A;  1LI9 A;  5F1F A;  3CG5 A;  3UE0 A;  1L0E A;  2ZD8 A;  3HLB A;  3EQV A;  3ISG A;  4K91 A;  5E2H A;  1KGF A;  2ZM2 A;  2HP9 A;  2IWB A;  3HUN A;  3UPP A;  5GL9 A;  5EVI D;  5FI2 A;  4LCM A;  4P87 A;  1ES4 A;  1CI9 A;  2Z2M B;  2Q9N A;  3CZD A;  5FAP A;  5TR7 A;  4EBP A;  3OPP A;  4Y0T A;  1XP4 A;  1KE0 A;  4X6T A;  3V39 A;  1RGZ A;  5IHV A;  1EI5 A;  3CMZ A;  2WKE A;  1IYS A;  2WYX A;  5DF9 A;  1KE4 A;  4E3K A;  5F83 A;  2H0Y A;  3MBZ A;  1S6R A;  4NK3 A;  1FSW A;  5GHZ A;  1YT4 A;  3BFC A;  4S2N A;  5A91 A;  1MWS A;  1K4F A;  1LLB A;  4OON A;  4B4Z A;  3NCK A;  2WK0 A;  3CJM A;  5GLB A;  3IH8 A;  1MY8 A;  3FKW A;  4GOG A;  2HDQ A;  3N8L A;  4YIN A;  3NC8 A;  4PPR A;  1MKI A;  4RA7 A;  4WMC A;  3O86 A;  4JXV A;  3SH9 A;  4BL3 A;  3UPN A;  1KE3 A;  2GDN A;  4U3T A;  3E2L A;  4OOL A;  3BFF A;  1U60 A;  5EUA A;  3N4I A;  5FQQ A;  3UDF A;  2DRW A;  1PZO A;  4S2J A;  3VP4 A;  4NET A;  4EWF A;  4OOM A;  4E6W A;  4OPY A;  3S1Y A;  3LCE A;  4EBN A;  4DKI A;  1DJC A;  3GSG A;  3UN7 A;  5FQI A;  2HDS A;  1K25 A;  2HPB A;  4WM9 A;  3PBN A;  1ERM A;  3W4O A;  2G2W A;  2JE5 A;  4JLF A;  1JTD A;  1Y54 A;  4CPK A;  5M19 A;  2ZC4 B;  3B3X A;  3G32 A;  3PBT A;  2EFX A;  1YM1 A;  1PW1 A;  4OQ0 A;  4S2I A;  1PWG A;  2XK1 A;  3ITB A;  4KZ5 A;  4OH0 A;  1ZG4 A;  3O3V A;  3Q81 A;  2Y2Q A;  2XH9 A;  3IH9 A;  5HAR A;  1ES5 A;  4WMC D;  1NXY A;  4X68 A;  2X02 A;  5A90 A;  3M6H A;  5KMW A;  2OLV A;  1L2S A;  5EE8 A;  1W7F A;  2Y2M A;  3G4P A;  3PBQ A;  4DE2 A;  3A3I A;  1PZP A;  4U0T A;  3FV7 A;  2FFY A;  1ERO A;  3PBO A;  5FQK A;  3SS3 A;  3HUO A;  1NZO A;  3IF6 C;  1JVJ A;  4HES A;  2XEP A;  2XFS A;  3PAE A;  1KDW A;  2P74 A;  1SDN A;  2EXB A;  3NI9 A;  3S22 A;  4JXW A;  3UE3 A;  1XA7 A;  4BQM A;  5G18 A;  5CTM A;  3VP3 A;  5CHU A;  1RGY A;  3UY6 A;  2RL3 A;  1O7E A;  4ZBE A;  2H5S A;  2Y55 A;  4R4R A;  4LCL A;  5FI6 A;  4KZ4 A;  4DF6 A;  3N8S A;  2XD1 A;  1TDL A;  4MBK A;  3IWO A;  4GNU A;  2R9X A;  4WBG A;  3C5A A;  1NYY A;  4X53 A;  4BL2 A;  4IBX A;  2WUQ A;  4DXB A;  2Y2P A;  5DTT A;  1BLP A;  4S2M A;  2Y2H A;  4OQG A;  1BSG A;  2XFT A;  1VQQ A;  3BFG A;  3HVF A;  3NBL A;  4Z9Q A;  1WE4 A;  1LL9 A;  4OKP A;  2WZX A;  2IWD A;  3TSG A;  4MLL A;  4EQI A;  4OLG A;  1YMS A;  1W79 A;  3I7J A;  2JCH A;  3GTC A;  4GDB A;  3G2Z A;  3OC2 A;  1K55 C;  1K56 A;  1E3U A;  5EVL A;  3V3S A;  2BG1 A;  3UO9 A;  1KDS A;  3ZVW A;  1PW8 A;  4KZB A;  5FA7 A;  5KZH A;  5DTK A;  1E4D A;  4JF5 A;  1KGE A;  1SKF A;  2DCF A;  4QY6 A;  2H10 A;  2Y2I A;  4BJP A;  2Y4A A;  3ZVT A;  3MXR A;  3IHB A;  1IYO A;  3NY4 A;  3MKF A;  1K38 A;  4BD0 A;  3ZCZ A;  3MZF A;  2WGV A;  4ZJ1 A;  5CXW A;  5GHX A;  4DE1 A; 
#chains in the Genus database with same CATH topology
 5HD3 A;  1YLP A;  1Q2Q A;  5FAO A;  1NLZ A;  1PIO A;  2JKR M;  1MKM A;  4HBU A;  2M7V A;  2Y2G A;  2XA7 M;  4EU0 A;  3GV9 A;  1E3U D;  3DTE A;  1F98 A;  4K08 A;  5F1G A;  3D9Y A;  4PMA A;  4YNR A;  2P04 A;  1PWC A;  4S2O A;  3RXW A;  5FQM A;  5EVI C;  1H8M A;  4F3L B;  3PTE A;  4HP4 A;  3FG8 A;  5EOE A;  5HX9 A;  1PI4 A;  4BLM A;  1STZ A;  5DVA A;  4KZ6 A;  5HL6 A;  4LV0 A;  4E3M A;  1RCJ A;  1YMX A;  3AGE A;  5EPH A;  4D60 A;  1P97 A;  1K6S A;  1BT5 A;  3UME A;  3MSH A;  2DMW A;  2ZQD A;  5A92 A;  1DJB A;  5HWW A;  4R70 A;  2JC7 A;  1W63 M;  2OOL A;  4HP9 A;  2J3W A;  2P9V B;  1LI0 A;  1M6K A;  1FOF A;  1L0F A;  1YLZ A;  1S4R A;  1T1C A;  4FH4 A;  1PRQ A;  3C2W A;  4YOF A;  4L9F A;  2ZC3 B;  1KGG A;  1OTB A;  2WKI A;  4E3O A;  1ESU A;  3A3F A;  4GW9 A;  5GLC A;  4U0X A;  2M1C A;  3ZGA B;  3FWL A;  3ZDJ A;  1VM1 A;  4QD4 A;  4XUZ A;  4G3K A;  3BRM A;  2E8J A;  2PAV P;  3IT9 A;  4WZ4 A;  4GN2 A;  3VSK A;  5FDS A;  4E3L A;  3T4J A;  4DMZ A;  4KQR A;  5FAT A;  1XGI A;  2WGI A;  2X71 A;  2HP5 A;  1IEL A;  4GLQ A;  3DWK A;  5CGS A;  3MR0 A;  4R3B A;  4NG2 A;  2KDK A;  4PAU A;  3N8R A;  3OPH A;  4WEK A;  3G30 A;  2DNS A;  4IJG A;  3VOL A;  1YSP A;  2PBY A;  2V1B A;  4LGW A;  2HP6 A;  3T4L A;  2J7V A;  3L7H A;  5CEC A;  2V9A A;  4FOF A;  5J3W A;  4ME4 A;  1GSX A;  4RX3 A;  5HPI A;  3A0S A;  3N7W A;  3CPT A;  3FKV A;  4LV2 A;  2KX6 A;  3M6B A;  3OPL A;  2JN7 A;  1BUE A;  1W5D A;  1YKD A;  1W63 Q;  3S4X A;  3VP1 A;  4F94 A;  4JPM A;  3KYE A;  4EUZ A;  1MWT A;  4QY5 A;  3SH8 A;  3OLO A;  2VGL M;  4WUJ A;  3LR5 A;  4R38 A;  5C5K A;  5FI7 A;  1GHM A;  2EFU A;  2QZ6 A;  1XFQ A;  1Q2P A;  3PYP A;  4C3Q A;  2QKP A;  4P6Z S;  5HAP A;  4WEJ A;  4R0Q A;  4KZ7 A;  3DW0 A;  1K55 A;  2OV5 A;  3BYD A;  3MFX A;  2I72 A;  4ZJ3 A;  3EEA A;  4B9O A;  2WAE A;  5CHJ A;  1K0K A;  4Q8I A;  4R3A A;  4MBF A;  1JWV A;  1FCM A;  1H8Y A;  1KVM A;  5TBM B;  4QJG A;  4NXF A;  4S2L A;  4ZAM A;  3CWF A;  3GRJ A;  1JWP A;  1ESI A;  3UPO A;  3WS4 A;  1YAX A;  1CI8 A;  2ZMA A;  2Q9M A;  2EX8 A;  1BZA A;  3ITA A;  4JF6 A;  1DP9 A;  3T1X A;  5KSC A;  4OOY A;  1G5U A;  1LT0 A;  1JWZ A;  2P7J A;  2ZM8 A;  4R1G A;  3NIA A;  1XA1 A;  1W8Q A;  4Q0H A;  4WZ5 A;  1ZHH B;  1XPB A;  1IOU A;  4A5R A;  4ZTK A;  4IUH A;  1YPR A;  1GHI A;  4UHU A;  4G3V A;  5CGX A;  1H3Q A;  3WS2 A;  4NKP A;  2FFF B;  2XQZ A;  3Q07 A;  3Q82 A;  3G31 A;  1S1Z A;  3D72 A;  3CUE A;  4MN7 A;  4CLC C;  3QP4 A;  5A93 A;  1NWZ A;  5F1F A;  4I3J A;  4LLO B;  4IUK A;  1KGF A;  2W1T A;  3HUN A;  2Z2M B;  1XP4 A;  2PR5 A;  4EW7 A;  1EI5 A;  3FPV A;  1VET A;  2WYX A;  5DF9 A;  5EM1 A;  3C38 A;  1FIK A;  1K4F A;  3CJM A;  4Y15 A;  3IH8 A;  3FKW A;  1S1Y A;  4EEP A;  2J80 A;  2W3E A;  4ETZ A;  4BL3 A;  3UPN A;  4MCW A;  2GDN A;  3BFF A;  1U60 A;  5G4Z A;  3LCE A;  3T4T A;  3UN7 A;  2HDS A;  2PT7 A;  2HPB A;  3PBN A;  2JE5 A;  2ZC4 B;  4HQA A;  1T1B A;  1PW1 A;  4OQ0 A;  4NXE A;  1PWG A;  2XK1 A;  3U2A A;  4OH0 A;  2OWJ A;  1ZG4 A;  4WMC D;  1HLU P;  5G4Y A;  5A90 A;  3C30 A;  2V1A A;  1PZP A;  2VV8 A;  1ERO A;  3SS3 A;  1NZO A;  2GNX A;  1JVJ A;  1MC0 A;  1KDW A;  2P74 A;  1SDN A;  2EXB A;  2OAP 1;  4JXW A;  4ESP A;  1XA7 A;  3H7W A;  5J7E A;  3MJQ A;  3F1P A;  2RL3 A;  1SKO A;  4KQD A;  4LCL A;  3N8S A;  2FH5 A;  2XD1 A;  1OTA A;  3IWO A;  2R9X A;  4WBG A;  1NYY A;  2Y2H A;  4OQG A;  1BSG A;  4EEU A;  2PHY A;  4Z9Q A;  5KIZ A;  2WZX A;  2PD8 A;  4CLC E;  3NUL A;  3I7J A;  4GDB A;  3HJK A;  3V3S A;  2BG1 A;  1KDS A;  3EWK A;  4M4X A;  4NEE D;  1E4D A;  1L3L A;  1KGE A;  2JKR I;  1SKF A;  3KSF A;  5CX7 A;  4BJP A;  1ACF A;  3KSG A;  5L8M A;  4WN5 A;  3IHB A;  4X1M A;  1IYO A;  2D02 A;  1TS8 A;  3W4Q A;  1T18 A;  3ZFZ A;  4FCF A;  5EV0 A;  1HVB A;  3G6O A;  3T4O A;  3TOI A;  1M40 A;  5CGW A;  2E8I A;  1SCW A;  3HLC A;  4EV4 A;  3OZH A;  4GHI A;  2VGJ A;  4ZJ2 A;  3IF6 A;  2MJ6 A;  2IA2 A;  3UDI A;  1PI5 A;  2EX2 A;  4ID4 A;  4S2P A;  3W8K A;  2OSU A;  3IXB A;  3MQQ A;  5HDC A;  2V1Z A;  5HDD A;  4UA9 A;  2C6W B;  4H6J A;  3KSH A;  4E3I A;  4HIA A;  4RX2 A;  4DDS A;  4WYY A;  1S67 L;  1V9Y A;  3P98 A;  4C6Y A;  2HJE A;  3HLW A;  2QWS A;  3PAG A;  4Z1W A;  1BUL A;  4MN6 A;  2VLG A;  5DTS A;  2I9V A;  2J9O A;  1N9O A;  2JBF A;  2ZQ8 A;  4CLC A;  4EER A;  3O87 A;  3R7W B;  1K57 C;  3RFB A;  1XKZ A;  2J3T C;  4MBH A;  4MMN A;  2INW A;  2O9A A;  4I38 A;  3OCL A;  1TS0 A;  3SOI A;  3D4F A;  4GJ4 A;  4WEL A;  1N4O A;  3IXH A;  1AXB A;  4ETX A;  4EQ1 A;  1IYQ A;  4K0W A;  3C7U A;  4PM8 A;  3O88 A;  4CQH A;  3GR2 A;  3UE6 A;  1F9I A;  3IWQ A;  2NUP C;  1FQG A;  3IS2 A;  1A0K A;  2XD5 A;  4DE0 A;  1CEG A;  4QB8 A;  1ALQ A;  1J3W A;  2Z6C A;  3VP0 A;  2EX6 A;  5I94 A;  2PD7 A;  2FZ0 A;  2A3U A;  4JBF A;  1F5M A;  3SS5 A;  3HBR A;  4XT2 B;  5CTN A;  3NDE A;  4E3N A;  3NOU C;  3K2N A;  5F6A A;  1NY0 A;  3UDX A;  4Y7P A;  4GS9 A;  5HW3 A;  3IBJ A;  1S0W A;  3DBA A;  2VK3 A;  3MKE A;  3P09 A;  2VGK A;  3ZYT A;  3G2Y A;  3WS1 A;  5JYO A;  2XF3 A;  4LPZ A;  3V67 A;  4KZ9 A;  3MQO A;  2Y2L A;  4HJ3 A;  4BMW A;  1SZV A;  3NEC A;  1FCN A;  5CER A;  1G6O A;  5FQJ A;  4FH2 A;  3ZG8 B;  4WZ5 C;  1KOU A;  4R23 A;  5DFY A;  2EXA A;  3F1O A;  4JGQ A;  4E6X A;  2X01 A;  3ZHH A;  3UB9 A;  4P6Z M;  2HDR A;  4Y3I A;  3LY3 A;  1PFL A;  4KQO A;  4N1X A;  4OVD A;  3E98 A;  4FD8 A;  4ZDX A;  4KZA A;  3IXG A;  2VV6 A;  3MMH A;  3CUE C;  1FSY A;  4KZ8 A;  3LIC A;  4HBT A;  4BEN A;  4R3J A;  4GB7 A;  3CHW P;  1I5Q A;  2ZOI A;  4JXS A;  4EES A;  1YLT A;  2ZQA A;  1CEF A;  3BM6 A;  3EQU A;  1QME A;  3ZG9 B;  5EEC A;  5EVI B;  1NZU A;  1H5X A;  2V2F F;  2WGW B;  3HUM A;  5E2E A;  3BFD A;  3NDG A;  3ZG0 A;  4BD1 A;  4O01 A;  2OWH A;  2UWX A;  4I3I A;  4XXR A;  4X1L A;  5AVE A;  3FC7 A;  4XUX A;  1G68 A;  3WRZ A;  2A24 B;  1PYY A;  4MDZ A;  1V9Z A;  4QPR A;  1LSX A;  3SH7 A;  2H0T A;  3QNB A;  3NOT C;  1TEM A;  2B02 A;  4GCZ A;  4PM5 A;  3VOY A;  2W1T B;  5HFO A;  4L0L A;  1H8Z A;  4IED A;  3VMA A;  1DJA A;  3VFH A;  5DFX A;  3UB6 A;  2W3F A;  1XXM A;  2L4R A;  5FQ9 A;  1NRF A;  2W1R A;  5GLA A;  1K54 A;  3E4Q A;  3HLG A;  3GEC A;  1ONH A;  3VOZ A;  1XJ2 A;  2Y2O A;  2WKH A;  5AVF A;  3VE4 A;  3C4O A;  4JGP A;  1N9L A;  4KG6 A;  2LB9 A;  3H82 B;  3VSL A;  1TS6 A;  4LV3 A;  4EBL A;  1K57 A;  2EA9 A;  2PDR A;  2ZMV A;  1L0E A;  3CAX A;  2K7S A;  2ZM2 A;  2WKR A;  3MXQ A;  2JKG A;  4PKY G;  2JKT M;  1CI9 A;  1UWN X;  2Q9N A;  5TR7 A;  4EBP A;  1KE0 A;  3V39 A;  5EM0 A;  3CMZ A;  4WF0 A;  2L0W A;  4E3K A;  1IYS A;  5F83 A;  2PYP A;  1S6R A;  3BFC A;  3KO6 A;  1LLB A;  4O8G A;  4B4Z A;  2WK0 A;  2VZW A;  2HDQ A;  3N8L A;  3O86 A;  4JXV A;  4OOL A;  5EUA A;  4YWZ A;  3TJZ C;  4EWF A;  4OPY A;  1DJC A;  4ARZ B;  4BBU A;  4WM9 A;  3H7W B;  1ERM A;  2G2W A;  4JLF A;  1JTD A;  1Y54 A;  4CPK A;  5M19 A;  3F1N A;  1SKO B;  3PBT A;  1YM1 A;  2A2L A;  2O99 A;  3O3V A;  3Q81 A;  3IH9 A;  1NXY A;  3B47 A;  3M6H A;  1L2S A;  2Y2M A;  3BQ8 A;  3G4P A;  4DE2 A;  3A3I A;  4U0T A;  3TW8 A;  5K5B A;  2M7U A;  2Y79 A;  3IF6 C;  5L09 A;  3NI9 A;  3S22 A;  3UE3 A;  5TJJ A;  2NUT C;  3EOI A;  5CTM A;  3VP3 A;  5CHU A;  1RGY A;  3UY6 A;  4KUO A;  4ZBE A;  1LSV A;  1XFN A;  4DXB A;  3LIB A;  4S2M A;  3ULF A;  3T4K A;  3RTY A;  3BFG A;  1OT6 A;  1P9R A;  4DJ3 A;  1E3U A;  1PW8 A;  4KZB A;  5FA7 A;  5DTK A;  5F68 A;  4II7 A;  4HI4 A;  3T1S A;  2DCF A;  3TE8 A;  4QY6 A;  2H10 A;  2Y2I A;  3BY9 A;  2Y4A A;  3MXR A;  4H6J B;  3DAV A;  1OTE A;  3MKF A;  1K38 A;  4EUV A;  3R4K A;  2WGV A;  4ZJ1 A;  5GHX A;  1VB6 A;  2QJ5 A;  5FL3 A;  5J4E A;  1YLJ A;  4LEN A;  2VV7 A;  2QPN A;  2A49 A;  2HZ5 A;  4OPQ A;  4CLC B;  1MPL A;  5F82 A;  3UMD A;  1KVL A;  1EW0 A;  4PM9 A;  1C3B A;  5FAQ A;  3W4P A;  5L10 A;  1FCO A;  4DDY A;  2PRF A;  1SHV A;  3OBF A;  3JVV A;  3PBS A;  4I5S A;  3VFF A;  3MF0 A;  4GD6 A;  2W27 A;  3CIT A;  1PNE A;  2ZQ9 A;  2V8F A;  4N9L A;  3A0V A;  3HRE A;  3Q7V A;  3AGD A;  4JGO A;  3GVB A;  3K3D A;  4KG2 A;  1VHM A;  4WL9 A;  4UQI S;  2V8C A;  3UB7 A;  2Q0O A;  4JKT A;  5E2G A;  3M2K A;  3BLM A;  4O0P A;  4X55 A;  5TGF A;  2J9P A;  5AJG A;  1XX2 A;  3C4P A;  2PU2 A;  1ES2 A;  1T1A A;  2PU4 A;  3ZG5 A;  1FR6 A;  4HHD A;  4HY8 A;  1BLS A;  3N6I A;  1RP5 A;  3P7N A;  4C75 A;  4FUW A;  4Q0I A;  2VA0 A;  3NJA A;  4OPZ A;  4UAA A;  1WA9 A;  3JYI A;  1LL5 A;  1XGJ A;  1T19 A;  3HLD A;  4GS9 B;  1E25 A;  1D1J A;  2PBD P;  2CC1 A;  2ZLY A;  1WYC A;  4ZRR A;  3VE3 A;  2K2N A;  5EFW A;  5HSQ A;  1GCE A;  4N9K A;  1W8Y A;  2R78 A;  4E3J A;  2XRO A;  2Y2K A;  5A8B A;  1MXO A;  4S2K A;  5HD5 A;  4GD8 A;  1DP6 A;  3T12 B;  1NYM A;  3LIA A;  1NJ4 A;  3LYX A;  1L0D A;  2O9C A;  3E4P A;  2Z2L B;  4DN0 A;  2W3D A;  3ZNT A;  4QHC A;  5FEG A;  4HNB A;  4IBR A;  5CED A;  3BEC A;  3A3D A;  4B88 A;  2VEA A;  5E43 A;  2JHE A;  2KOI A;  5CRF A;  2EWW A;  4OP8 A;  5EOO A;  5AQ7 A;  3Q7Z A;  1K56 D;  5HAI A;  3IF5 A;  3QP5 A;  5DF7 A;  4X69 A;  3IX3 A;  4N1H A;  2HDU A;  2XGN A;  4PHT A;  3DTM A;  3E4O A;  3T50 A;  3TG9 A;  2ZC5 B;  4P6B A;  3SZT A;  4OQH A;  1YSQ A;  3LO7 A;  2C5W B;  2L1M A;  5HL1 A;  5KSH A;  1K54 C;  2V0W A;  3UB8 A;  3HLF A;  5AQ9 A;  2WAF A;  1GHP A;  1ONG A;  2WKP A;  2O0Y A;  2R9W A;  1NLY A;  3PBR A;  2JKF A;  2ZMF A;  5L2F A;  2ZQ7 A;  1HD8 A;  1BLC A;  3VP2 A;  3BLS A;  4KZ3 A;  4BWI A;  2Y2J A;  3SS4 A;  1PWD A;  4DXC A;  1CK3 A;  3GDI A;  5JYP A;  1TD5 A;  3G34 A;  4RQ9 A;  4Y0O A;  4L9G A;  1TDG A;  4RVA A;  3OCN A;  1CJF A;  2AVX A;  3IHA A;  4HOI A;  1OME A;  1HZO A;  3HLE A;  4DRT A;  3FZC A;  1UGU A;  1S4S A;  1K4E A;  1GA9 A;  1P0Z A;  3UE1 A;  4QWO A;  3CPT B;  4BBV A;  1LSW A;  2W3H A;  2GZA A;  3OPR A;  1TF1 A;  3DTI A;  1D06 A;  3JPU A;  2BTF P;  3WWX A;  1XJ4 A;  1S66 L;  5BOH A;  4X56 A;  3KYQ A;  4R4S A;  3KX0 X;  5AQA A;  2BLS A;  5HWT A;  2H28 A;  3LY4 A;  5CHM A;  3IWI A;  1O07 A;  3QP1 A;  4IVI A;  3S7Q A;  4Y2F A;  1VEU A;  4DE3 A;  1OTI A;  3LEQ A;  1OPX A;  3UE0 A;  2ZD8 A;  3EQV A;  2XRN A;  4K91 A;  5E2H A;  3T1Q B;  3LGO A;  2IWB A;  3UPP A;  3ZQ5 A;  1XJ3 A;  5GL9 A;  2WKQ A;  5EVI D;  1ZTU A;  1ES4 A;  3EGD C;  4Y0T A;  3B33 A;  4X6T A;  1RGZ A;  1AWI A;  1KE4 A;  1GSW A;  2H0Y A;  4NK3 A;  1FSW A;  1YT4 A;  2HV1 A;  4S2N A;  5A91 A;  4OON A;  3H9W A;  3NCK A;  1OTD A;  1MY8 A;  4YIN A;  2W0N A;  3NC8 A;  4PPR A;  3IX4 A;  2YKF A;  4WMC A;  1KE3 A;  4U3T A;  3E2L A;  3N4I A;  2DRW A;  1PZO A;  3VP4 A;  5IT5 A;  4NET A;  4OOM A;  5F5Y A;  3S1Y A;  4EBN A;  2UV0 E;  3GSG A;  5FQI A;  1K25 A;  2Y8H A;  4HJ6 A;  3E0Y A;  1FIL A;  2B95 A;  3B3X A;  4PKY A;  3IX8 A;  4KZ5 A;  1P9W A;  4IHQ A;  4DJ2 A;  1ES5 A;  3HCY A;  4KUK A;  2X02 A;  1JNU A;  2G7U A;  5KMW A;  3SW1 A;  2OLV A;  2QYB A;  3LI8 A;  1W7F A;  3PBQ A;  2FFY A;  3PBO A;  2VJW A;  4HES A;  3PAE A;  2GJ3 A;  5IU1 A;  4BQM A;  5G18 A;  2H5S A;  2OAQ 1;  4GNU A;  1Y28 A;  1VET B;  3C5A A;  4BL2 A;  4IBX A;  2WUQ A;  2Y2P A;  3L9K A;  2ZL1 A;  5DTT A;  3R7W A;  1VQQ A;  3HVF A;  1WE4 A;  1LL9 A;  4OKP A;  3S7N A;  3TSG A;  4MLL A;  4EQI A;  3T4Q A;  4LFU A;  1YMS A;  3UB5 P;  3GTC A;  1K56 A;  5EVL A;  2PYR A;  3UO9 A;  3ZVW A;  5KZH A;  2PR6 A;  4AFI A;  1X0O A;  4BD0 A;  3ZCZ A;  3LR4 A;  1CQA A;  2HJ9 C;  5HZH A;  2WAD A;  3RH8 B;  3IXD A;  3Q7V B;  4GKU A;  5F69 A;  3S7P A;  5DF8 A;  1N9B A;  3FYZ A;  4OP5 A;  1I2S A;  1IEM A;  2W3G A;  4D2O A;  5MC7 A;  4NXG A;  3MZE A;  4QU3 A;  3U4L P;  3LEZ A;  5GLD A;  3OOV A;  4H8R A;  3ZG7 B;  1YLW A;  3NHQ A;  2RCX A;  1SDE A;  2XLN A;  2QMI A;  5FSR A;  2HF6 A;  2YKH A;  2XA7 S;  2ZBB A;  5TFQ A;  4UQI M;  4XT2 A;  2BAS A;  3F1P B;  3LI9 A;  2V0U A;  1YQS A;  1MWR A;  3C8C A;  1IKG A;  1TS7 A;  4FSF A;  4P0M A;  2ACG A;  1IFQ A;  2XR0 A;  4WLA A;  3T4S A;  1L0G A;  3Q1F A;  3HL9 A;  3BWL A;  3BY8 A;  4LV1 A;  4Y5F A;  2VKS A;  4KQQ A;  4B4X A;  1WYB A;  1ZC2 A;  4JXG A;  3UNW A;  1NRJ A;  3W2Z A;  2V20 A;  1G6A A;  3GQZ A;  4EXO A;  3BEB A;  4PM6 A;  4P85 A;  4F3L A;  4GZB A;  4Y13 A;  2Y91 A;  4JF4 A;  1F2K A;  1HTZ A;  4LRX C;  2XDM A;  2G2U A;  3D3O A;  2ZOH A;  5HWV A;  4HH2 A;  4CLC D;  1I2W A;  4O7D A;  1ZKJ A;  3G35 A;  4I39 A;  3ZNY A;  4GHI B;  3QHY A;  3IF6 B;  1Y4O A;  2ZC7 A;  3MZD A;  2P9V A;  3NOP C;  5EVI A;  3BQA A;  2WGW A;  4IVK A;  5AQB A;  5M1A A;  3MQ0 A;  2ZM0 A;  3QP8 A;  5IS1 A;  1IYP A;  3B42 A;  3E2K A;  4LRY C;  1DY6 A;  1ERQ A;  4MN5 A;  1DRM A;  3AGF A;  2A24 A;  3RJU A;  2Z6D A;  4RYE A;  5DKL A;  1D7E A;  3K3C A;  3MS6 A;  1BTL A;  3C7V A;  5D3O A;  1J9M A;  5HDS A;  1ES3 A;  5U47 A;  3WS0 A;  3JVU A;  3RXX A;  3CLO A;  1OJG A;  3V3R A;  3A3J A;  1TVF A;  5GHY A;  1MWU A;  2ZQC A;  3KYZ A;  2P08 A;  3LIE A;  3WRT A;  1LHY A;  2Y59 A;  1Z09 A;  4UA7 A;  3CI6 A;  3IQA A;  3LFV A;  2EX9 A;  1K6R A;  3LR3 A;  2OLU A;  5M18 A;  2QJ7 A;  2IWC A;  3H82 A;  2HGV A;  3BW6 A;  4OQI A;  3GMW A;  3WS5 A;  1IKI A;  2QHK A;  4NXB A;  2ZJ9 A;  5FAS A;  4G3W A;  2VGL S;  4N92 A;  3P01 A;  3IS2 B;  4I3A A;  4YFM A;  1ZG6 A;  4Y17 A;  4MNR A;  2GX5 A;  3EEH A;  1UWP X;  3DTK A;  4K0X A;  4KG5 A;  3HJI A;  4GDN A;  1JTG A;  1EWZ A;  5L07 A;  1GA0 A;  5CEB A;  5HAQ A;  4KEN B;  1BYW A;  3M2J A;  1N9N A;  2KLI A;  4L9E A;  3ICY A;  5DJT A;  3BFE A;  3V50 A;  4CJN A;  3MFD A;  4MEZ A;  1OT9 A;  4S2N C;  3V5M A;  2ZC6 B;  3MXS A;  5HPF A;  1VEU B;  4Q0J A;  2J8Y A;  5J8X A;  3A3E A;  4X25 A;  1BLH A;  1MBL A;  4OPR A;  1YLY A;  2B5R A;  4ARZ A;  4HEF A;  4JGR A;  1GSV A;  2WZZ A;  1Z6F A;  1FR1 A;  3KSI A;  3QNC A;  5LBR A;  1G28 A;  4OLD A;  1CF0 A;  2XSS A;  3A0R A;  3DWZ A;  4Y0U A;  5TBM A;  3F1O B;  2Y2N A;  4PM7 A;  4UA6 A;  5E2F A;  5FDH A;  1QMF A;  4M3K A;  1LI9 A;  1OJ5 A;  1MZU A;  3CG5 A;  3HLB A;  3ISG A;  1XJ6 A;  2HP9 A;  5DKK A;  5FI2 A;  4LCM A;  4FTX A;  4P87 A;  5DJU A;  3CZD A;  5FAP A;  3OPP A;  5IHV A;  2WKE A;  4EET B;  3MBZ A;  5GHZ A;  4HJ4 A;  3IBR A;  1MWS A;  3QP2 A;  5GLB A;  4GOG A;  1MKI A;  4RA7 A;  2J3T D;  3SH9 A;  5FQQ A;  3UDF A;  4S2J A;  4E6W A;  2EWV A;  4DKI A;  3PXP A;  2CMN A;  3W4O A;  2O9B A;  3S7O A;  3G32 A;  2EFX A;  2LB5 A;  3VV4 A;  2K31 A;  4S2I A;  3ITB A;  2B18 A;  2ZL1 B;  3TRC A;  2Y2Q A;  2XH9 A;  4BBT A;  5HAR A;  3EGX C;  1ODV A;  4X68 A;  1H0M A;  1DP8 A;  3PHY A;  4B93 A;  5EE8 A;  5EVE A;  5FEF A;  3FV7 A;  3LR0 A;  5FQK A;  3HUO A;  2XEP A;  2XFS A;  5I5L A;  1O7E A;  3PR6 A;  2Y55 A;  4R4R A;  5FI6 A;  4KZ4 A;  4DF6 A;  1TDL A;  4MBK A;  3FPW A;  4X53 A;  4E04 A;  3LID A;  4LRZ E;  3BJN A;  1BLP A;  2XFT A;  2D01 A;  3NBL A;  4UEY A;  2IWD A;  2JKT I;  4OLG A;  2VX8 A;  1W79 A;  2JCH A;  3G2Z A;  3OC2 A;  1K55 C;  3QP6 A;  4JF5 A;  3LIF A;  3T1R A;  4HH3 A;  1LL8 A;  3LUQ A;  3ZVT A;  4R6L A;  3NY4 A;  3O5Y A;  3MZF A;  3F1N B;  5CXW A;  4DE1 A; 
#chains in the Genus database with same CATH homology
 2WAD A;  3IXD A;  3Q7V B;  3ZFZ A;  1YLJ A;  4FCF A;  4GKU A;  1YLP A;  1HVB A;  1Q2Q A;  5FAO A;  1PIO A;  4LEN A;  3TOI A;  1M40 A;  5CGW A;  2E8I A;  2QPN A;  1SCW A;  5DF8 A;  3HLC A;  4EV4 A;  2A49 A;  1N9B A;  3FYZ A;  4OPQ A;  4OP5 A;  4HBU A;  1I2S A;  2Y2G A;  3OZH A;  2VGJ A;  1MPL A;  1IEM A;  4ZJ2 A;  5F82 A;  4D2O A;  3GV9 A;  3IF6 A;  1E3U D;  1KVL A;  3UDI A;  3MZE A;  1C3B A;  4PM9 A;  4QU3 A;  1PI5 A;  5FAQ A;  2EX2 A;  4ID4 A;  3W4P A;  3LEZ A;  5GLD A;  5F1G A;  4S2P A;  3W8K A;  2OSU A;  3IXB A;  4H8R A;  3ZG7 B;  1FCO A;  4DDY A;  1SHV A;  4PMA A;  1YLW A;  3PBS A;  2V1Z A;  1PWC A;  1SDE A;  2RCX A;  2XLN A;  4UA9 A;  2QMI A;  2C6W B;  4S2O A;  5FSR A;  3VFF A;  3RXW A;  4GD6 A;  5TFQ A;  5FQM A;  5EVI C;  4E3I A;  4RX2 A;  4DDS A;  2ZQ9 A;  4WYY A;  3PTE A;  3P98 A;  4C6Y A;  5EOE A;  3HLW A;  4N9L A;  5HX9 A;  3PAG A;  1YQS A;  1MWR A;  1PI4 A;  4BLM A;  3HRE A;  3Q7V A;  3AGD A;  5DVA A;  1BUL A;  1IKG A;  4FSF A;  4P0M A;  3GVB A;  4KG2 A;  4KZ6 A;  5DTS A;  4LV0 A;  2J9O A;  2XR0 A;  4E3M A;  1RCJ A;  2JBF A;  4JKT A;  5E2G A;  1YMX A;  1L0G A;  3AGE A;  3M2K A;  2ZQ8 A;  3BLM A;  3Q1F A;  4X55 A;  5EPH A;  5TGF A;  3HL9 A;  3O87 A;  1K57 C;  1K6S A;  1BT5 A;  2ZQD A;  2J9P A;  1XKZ A;  5A92 A;  1DJB A;  4MBH A;  4LV1 A;  1XX2 A;  3C4P A;  2JC7 A;  3OCL A;  3SOI A;  4KQQ A;  3D4F A;  1WYB A;  4B4X A;  2PU2 A;  1ZC2 A;  1ES2 A;  2P9V B;  1LI0 A;  1M6K A;  4JXG A;  2PU4 A;  3UNW A;  3ZG5 A;  4WEL A;  1FR6 A;  1FOF A;  1L0F A;  2V20 A;  1G6A A;  1N4O A;  1BLS A;  1YLZ A;  3GQZ A;  1AXB A;  3IXH A;  3N6I A;  4FH4 A;  1RP5 A;  3BEB A;  4PM6 A;  4C75 A;  4P85 A;  2ZC3 B;  4GZB A;  1KGG A;  2Y91 A;  2WKI A;  1IYQ A;  4E3O A;  4JF4 A;  4K0W A;  3C7U A;  1HTZ A;  4OPZ A;  1ESU A;  4UAA A;  2XDM A;  3JYI A;  1LL5 A;  2G2U A;  3A3F A;  1XGJ A;  4PM8 A;  5GLC A;  4U0X A;  3HLD A;  3O88 A;  1I2W A;  3ZGA B;  3FWL A;  3GR2 A;  4O7D A;  1ZKJ A;  3ZDJ A;  1VM1 A;  4QD4 A;  4XUZ A;  1E25 A;  3IWQ A;  3BRM A;  2CC1 A;  4WZ4 A;  3G35 A;  3IT9 A;  4GN2 A;  2ZLY A;  3VSK A;  4E3L A;  1FQG A;  3ZNY A;  2XD5 A;  1WYC A;  3QHY A;  4KQR A;  4DE0 A;  5FAT A;  1CEG A;  4QB8 A;  3IF6 B;  1ALQ A;  1XGI A;  1GCE A;  4N9K A;  2WGI A;  2X71 A;  2HP5 A;  1IEL A;  1W8Y A;  2ZC7 A;  3MZD A;  2EX6 A;  2P9V A;  3DWK A;  3VP0 A;  5CGS A;  5EVI A;  5I94 A;  2WGW A;  4R3B A;  2A3U A;  4IVK A;  4E3J A;  4JBF A;  5AQB A;  5M1A A;  3N8R A;  3OPH A;  2Y2K A;  1MXO A;  4WEK A;  2ZM0 A;  3G30 A;  2DNS A;  4S2K A;  3SS5 A;  1IYP A;  3HBR A;  4GD8 A;  2PBY A;  3E2K A;  1NYM A;  1NJ4 A;  1DY6 A;  2HP6 A;  5CTN A;  1ERQ A;  1L0D A;  2J7V A;  3NDE A;  4E3N A;  2Z2L B;  3ZNT A;  4QHC A;  1NY0 A;  3AGF A;  3UDX A;  5CEC A;  4IBR A;  4Y7P A;  3RJU A;  5CED A;  3BEC A;  5HW3 A;  1S0W A;  3A3D A;  4RX3 A;  4B88 A;  4RYE A;  3MKE A;  3N7W A;  5E43 A;  3P09 A;  2VGK A;  3FKV A;  3G2Y A;  4LV2 A;  3M6B A;  5CRF A;  3OPL A;  4OP8 A;  5EOO A;  3WS1 A;  1BTL A;  5JYO A;  2XF3 A;  3Q7Z A;  5AQ7 A;  1K56 D;  3C7V A;  5HAI A;  5D3O A;  3IF5 A;  4KZ9 A;  1J9M A;  5DF7 A;  4X69 A;  1ES3 A;  2Y2L A;  5U47 A;  3WS0 A;  4N1H A;  2HDU A;  2XGN A;  1BUE A;  1W5D A;  3RXX A;  3DTM A;  1FCN A;  5CER A;  3V3R A;  5FQJ A;  4FH2 A;  3S4X A;  3TG9 A;  2ZC5 B;  3A3J A;  4WZ5 C;  1TVF A;  3VP1 A;  3ZG8 B;  4F94 A;  4R23 A;  4JPM A;  4P6B A;  2EXA A;  1MWU A;  4OQH A;  5GHY A;  2ZQC A;  3LO7 A;  3WRT A;  2C5W B;  4E6X A;  2X01 A;  1LHY A;  3ZHH A;  4EUZ A;  1MWT A;  2Y59 A;  5HL1 A;  4QY5 A;  4UA7 A;  3SH8 A;  3IQA A;  5KSH A;  2HDR A;  2EX9 A;  1K6R A;  3LY3 A;  1K54 C;  4KQO A;  3HLF A;  4N1X A;  4OVD A;  2OLU A;  5AQ9 A;  5M18 A;  2WAF A;  2IWC A;  1GHP A;  5FI7 A;  1GHM A;  2EFU A;  1ONG A;  2QZ6 A;  4FD8 A;  1Q2P A;  4ZDX A;  4KZA A;  4OQI A;  3GMW A;  3WS5 A;  1IKI A;  2R9W A;  3IXG A;  3PBR A;  4C3Q A;  1FSY A;  4KZ8 A;  2ZJ9 A;  5L2F A;  2ZQ7 A;  1HD8 A;  1BLC A;  3VP2 A;  5FAS A;  3BLS A;  5HAP A;  4WEJ A;  4HBT A;  4N92 A;  4KZ3 A;  4R0Q A;  4KZ7 A;  4BEN A;  3DW0 A;  4GB7 A;  4R3J A;  1K55 A;  2Y2J A;  3SS4 A;  4YFM A;  1PWD A;  1ZG6 A;  1I5Q A;  4JXS A;  4MNR A;  3BYD A;  2OV5 A;  4DXC A;  2I72 A;  1CK3 A;  1YLT A;  4ZJ3 A;  2ZQA A;  1CEF A;  3BM6 A;  3EQU A;  1QME A;  4K0X A;  2WAE A;  4KG5 A;  5CHJ A;  5EEC A;  3ZG9 B;  4GDN A;  5EVI B;  1JTG A;  1NZU A;  3G34 A;  4Q8I A;  1H5X A;  2V2F F;  1EWZ A;  2WGW B;  3HUM A;  4MBF A;  4Y0O A;  5E2E A;  1JWV A;  1FCM A;  1GA0 A;  1H8Y A;  1KVM A;  1TDG A;  5CEB A;  4RVA A;  5HAQ A;  4QJG A;  3OCN A;  4KEN B;  4S2L A;  3IHA A;  4ZAM A;  1OME A;  3GRJ A;  1JWP A;  1HZO A;  3BFD A;  3HLE A;  3NDG A;  3ZG0 A;  4BD1 A;  3M2J A;  4DRT A;  1ESI A;  3UPO A;  2UWX A;  3WS4 A;  3FZC A;  4XXR A;  1CI8 A;  3BFE A;  3V50 A;  2ZMA A;  4CJN A;  2Q9M A;  3MFD A;  4MEZ A;  3W4Q A;  2EX8 A;  4S2N C;  3V5M A;  2ZC6 B;  1BZA A;  3ITA A;  3MXS A;  4XUX A;  1G68 A;  3WRZ A;  1PYY A;  4JF6 A;  1K4E A;  1GA9 A;  2J8Y A;  5J8X A;  3SH7 A;  5KSC A;  2H0T A;  3QNB A;  4OOY A;  3A3E A;  1BLH A;  1TEM A;  1MBL A;  3UE1 A;  4OPR A;  1JWZ A;  1YLY A;  2B5R A;  4HEF A;  4PM5 A;  2ZM8 A;  3VOY A;  4R1G A;  5HFO A;  3NIA A;  1H8Z A;  4L0L A;  1XA1 A;  1W8Q A;  1Z6F A;  1DJA A;  2WZZ A;  1FR1 A;  3OPR A;  4IED A;  3VFH A;  3VMA A;  4WZ5 A;  1XXM A;  5FQ9 A;  1XPB A;  3QNC A;  3WWX A;  4OLD A;  1NRF A;  4A5R A;  5JYP A;  4ZTK A;  5BOH A;  3DWZ A;  4Y0U A;  4X56 A;  1GHI A;  4UHU A;  5GLA A;  1K54 A;  5CGX A;  4R4S A;  3HLG A;  5AQA A;  1ONH A;  3WS2 A;  2BLS A;  3VOZ A;  2Y2O A;  3LY4 A;  2FFF B;  2Y2N A;  5CHM A;  2XQZ A;  2WKH A;  3Q07 A;  3IWI A;  3Q82 A;  4PM7 A;  1O07 A;  4IVI A;  3G31 A;  3C4O A;  4UA6 A;  5E2F A;  5FDH A;  4KG6 A;  1QMF A;  4M3K A;  3VSL A;  4DE3 A;  5A93 A;  4LV3 A;  4EBL A;  1K57 A;  1LI9 A;  5F1F A;  3CG5 A;  3UE0 A;  1L0E A;  2ZD8 A;  3HLB A;  3EQV A;  3ISG A;  4K91 A;  5E2H A;  1KGF A;  2ZM2 A;  2HP9 A;  2IWB A;  3HUN A;  3UPP A;  5GL9 A;  5EVI D;  5FI2 A;  4LCM A;  4P87 A;  1ES4 A;  1CI9 A;  2Z2M B;  2Q9N A;  3CZD A;  5FAP A;  5TR7 A;  4EBP A;  3OPP A;  4Y0T A;  1XP4 A;  1KE0 A;  4X6T A;  3V39 A;  1RGZ A;  5IHV A;  1EI5 A;  3CMZ A;  2WKE A;  1IYS A;  2WYX A;  5DF9 A;  1KE4 A;  4E3K A;  5F83 A;  2H0Y A;  3MBZ A;  1S6R A;  4NK3 A;  1FSW A;  5GHZ A;  1YT4 A;  3BFC A;  4S2N A;  5A91 A;  1MWS A;  1K4F A;  1LLB A;  4OON A;  4B4Z A;  3NCK A;  2WK0 A;  3CJM A;  5GLB A;  3IH8 A;  1MY8 A;  3FKW A;  4GOG A;  2HDQ A;  3N8L A;  4YIN A;  3NC8 A;  4PPR A;  1MKI A;  4RA7 A;  4WMC A;  3O86 A;  4JXV A;  3SH9 A;  4BL3 A;  3UPN A;  1KE3 A;  2GDN A;  4U3T A;  3E2L A;  4OOL A;  3BFF A;  1U60 A;  5EUA A;  3N4I A;  5FQQ A;  3UDF A;  2DRW A;  1PZO A;  4S2J A;  3VP4 A;  4NET A;  4EWF A;  4OOM A;  4E6W A;  4OPY A;  3S1Y A;  3LCE A;  4EBN A;  4DKI A;  1DJC A;  3GSG A;  3UN7 A;  5FQI A;  2HDS A;  1K25 A;  2HPB A;  4WM9 A;  3PBN A;  1ERM A;  3W4O A;  2G2W A;  2JE5 A;  4JLF A;  1JTD A;  1Y54 A;  4CPK A;  5M19 A;  2ZC4 B;  3B3X A;  3G32 A;  3PBT A;  2EFX A;  1YM1 A;  1PW1 A;  4OQ0 A;  4S2I A;  1PWG A;  2XK1 A;  3ITB A;  4KZ5 A;  4OH0 A;  1ZG4 A;  3O3V A;  3Q81 A;  2Y2Q A;  2XH9 A;  3IH9 A;  5HAR A;  1ES5 A;  4WMC D;  1NXY A;  4X68 A;  2X02 A;  5A90 A;  3M6H A;  5KMW A;  2OLV A;  1L2S A;  5EE8 A;  1W7F A;  2Y2M A;  3G4P A;  3PBQ A;  4DE2 A;  3A3I A;  1PZP A;  4U0T A;  3FV7 A;  2FFY A;  1ERO A;  3PBO A;  5FQK A;  3SS3 A;  3HUO A;  1NZO A;  3IF6 C;  1JVJ A;  4HES A;  2XEP A;  2XFS A;  3PAE A;  1KDW A;  2P74 A;  1SDN A;  2EXB A;  3NI9 A;  3S22 A;  4JXW A;  3UE3 A;  1XA7 A;  4BQM A;  5G18 A;  5CTM A;  3VP3 A;  5CHU A;  1RGY A;  3UY6 A;  2RL3 A;  1O7E A;  4ZBE A;  2H5S A;  2Y55 A;  4R4R A;  4LCL A;  5FI6 A;  4KZ4 A;  4DF6 A;  3N8S A;  2XD1 A;  1TDL A;  4MBK A;  3IWO A;  4GNU A;  2R9X A;  4WBG A;  3C5A A;  1NYY A;  4X53 A;  4BL2 A;  4IBX A;  2WUQ A;  4DXB A;  2Y2P A;  5DTT A;  1BLP A;  4S2M A;  2Y2H A;  4OQG A;  1BSG A;  2XFT A;  1VQQ A;  3BFG A;  3HVF A;  3NBL A;  4Z9Q A;  1WE4 A;  1LL9 A;  4OKP A;  2WZX A;  2IWD A;  3TSG A;  4MLL A;  4EQI A;  4OLG A;  1YMS A;  1W79 A;  3I7J A;  2JCH A;  3GTC A;  4GDB A;  3G2Z A;  3OC2 A;  1K55 C;  1K56 A;  1E3U A;  5EVL A;  3V3S A;  2BG1 A;  3UO9 A;  1KDS A;  3ZVW A;  1PW8 A;  4KZB A;  5FA7 A;  5KZH A;  5DTK A;  1E4D A;  4JF5 A;  1KGE A;  1SKF A;  2DCF A;  4QY6 A;  2H10 A;  2Y2I A;  4BJP A;  2Y4A A;  3ZVT A;  3MXR A;  3IHB A;  1IYO A;  3NY4 A;  3MKF A;  1K38 A;  4BD0 A;  3ZCZ A;  3MZF A;  2WGV A;  4ZJ1 A;  5CXW A;  5GHX A;  4DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...