4E42B

Structural basis for the recognition of mutant self by a tumor-specific, mhc class ii-restricted t cell receptor g4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
237
structure length
231
Chain Sequence
VTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPASRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T cell receptor G4 alpha chain
total genus 52
structure length 231
sequence length 237
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e42B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e42B01
3TJEL 1K4CB 3CUPB 5EN2B 4Y5XC 4JY4B 4TUKH 4OZ4A 3L7FA 1OGAD 1Y18A 4KK8D 1FN4B 1M7IB 1R3LB 2DQDH 5DD3H 1IFHH 4FQHB 4P49A 1WTGT 4HEPG 3TIDB 2E8ZA 4DQOL 3I6LD 1FYHB 4LNVA 2SEBB 2WQ8A 1I1YB 4YHZL 1VADA 1A9BA 1OTSC 1M05B 4JFEE 3BGMB 1GXEA 3W39A 5DGRA 4RWYH 1RK1B 5CMAB 4FFWC 3NAAH 1F4YL 4C58B 4NQXA 4ZD3H 2X4UB 1T7YA 4WWKB 2VWEE 5GGVY 3UEZA 3P9MB 5FHBH 5D7LA 3BAEL 2ZUUA 2AK4D 1QSVA 1UWGH 3HZVA 2Y07H 1EFXB 4WUUA 1HQRA 1LILA 4XBPA 1DANU 1NDGA 1S9WA 3O2VH 3EOTL 2AJXH 5J13B 2DD8L 2DQCL 5BV7C 2V5YA 4LRIA 5C2UB 3OKKB 4H0HB 2JB6B 1MCWM 1A4KB 5D1QC 4AL8L 1S5IL 2VSDA 5D2LB 3IAQA 5CAYB 2P7TB 3H6JA 4KKAD 5E1HB 3CK0H 2YBRA 5TQ2L 1DLHB 4JLRA 1VESA 3U7WL 2CKBL 3K3QA 3O6MH 1AR2A 5GRUL 2CR6A 5DC4B 2NR6D 1LVEA 1OSPL 3KPNA 5IW3A 4U1HA 4XPGL 4JB9H 5MENE 2BVPB 4L3EB 2GUOA 1K2DA 3PV6B 4XB7A 5I8OL 3I02A 3OXRB 5J1SC 2APVA 5J12B 4XPBH 3IDGA 1MWAH 1DQJB 5CJOL 4PJBB 3HE7B 4IIQA 5ACLA 1I3RB 3MRRA 1C7TA 3T0WA 1HINL 2ICEB 1JN6A 1FFRA 2FDBP 4GRWH 1AH1A 2X4UA 3VFOB 3SDYH 4GXVH 5A3IC 4MNGA 2R1XB 2VXVH 4JHAH 5EZLA 3V0WH 1EHXA 1JZ4A 3VWKD 4UIMA 2NLJA 4ODHL 4PB0L 3U6RB 2G60L 2NYYD 2Z9TA 1DVFA 5EA0L 4DKFL 4G6ML 1M4KA 1U8PA 3OAZH 3GI8L 5DA4A 3EDDA 3H9ZA 4LLDB 4U1MA 1A6PA 4J8RB 5D7SL 1KEGH 3VDAA 1QVOB 1ZGLM 3OJMB 1DQJA 1U2HA 3H3KA 5GJSH 3WXVL 3VCLA 1BFVH 3CXHK 4QY8A 1KBGL 4WO4A 1B6DA 3GIVB 4OGXH 1T66D 1NSNL 4KJQD 4KROB 1IAMA 2HFFB 2IMMA 2D7QA 5AG8A 4NFBA 2R1XA 1D5MA 1CIDA 2VLJB 3E6HA 4AK1A 3UP1A 4CN1A 1CD1B 5EWIH 2DYPD 1FYTB 3HZYB 4MCYA 1QSEA 5SWSA 1DDHA 1TXKA 1CVSC 1Q9KA 2EO1A 3ARGC 1MFBL 4ODXA 2F9BT 4H20L 4YNYB 4CADA 2ZCLH 3AREB 3MJ8A 3DV6A 3O4LB 1X5XA 5KTEL 4PGBA 5ENWB 3VFWB 1JN6B 5DJCA 4N0UB 3BKYH 1KNOA 3BP6A 1T89C 1A0QL 2NR6C 1FZOA 3D25A 1LEIA 5FA4A 3VXTB 4XNYL 5IBLD 4LNRA 5BZDA 3OKLA 1FC2D 2QQNL 1V5JA 1NFDB 4OLVL 1MLCB 1WAAE 2FBJH 3QJFB 4AQ1B 3CFIC 1HXYA 5C2BH 2LE9A 1JUFB 2Y7QA 3CZFB 1J1XL 3TIEB 1FFNA 1CGVA 2BY1A 3QDJE 5FUOL 3BQUD 3O6FB 4OFIA 2XA3A 5CSZB 3B8SA 2PTVA 4GRMA 3RTQB 1KEGL 4PV9B 1IEAA 4JPWH 2XY2A 4NN6C 1C08B 4NJ9H 3FL7A 4JAMA 5J6HA 1NMCB 2VXVL 5JR1H 4M62H 3HUJA 3KPSD 3AS0A 5DD0L 1XCTA 5ESAB 5ABDE 1XIWA 2A77H 1G7QA 3CFEB 4XZUA 3L3OA 2ITDA 4L4VE 1J5OH 3TBSA 3DURB 3R0NA 3ZE0F 3W9DB 2R0ZL 2BNQB 3A6BL 3K1DA 2YK1L 3VWKC 2VDPL 4PJEE 3TP4A 3AB0C 4OLWH 1AQKL 2PYFB 4PJIB 5DURB 4P99A 2FATL 1DLFH 1GGIH 3SDCB 2X1XR 4WNQB 5KG9B 1HHKA 3DRTA 4H25A 5IV2A 4M61A 4TVPH 1V7NL 1T4KA 2Q6WB 1OVZA 4PJHA 1U91A 3SQOL 3GRWL 3KHQA 1TCRA 5EU7E 4LL9A 4UDTA 3MLSH 5IG7A 5D7JA 3U1SH 1JNHA 3MRHB 1N64L 3HG1D 1E4WH 4JM2F 2W91A 3NGBC 3JV5A 1TIUA 2FLRT 4NFDA 4CW1A 3T08A 4POZD 4ENEC 5GS1A 2IMNA 1GAFH 3MV9E 3KXFE 3VMPA 4P5MA 7FABL 4TRPL 1B9ZA 3ARGD 5E4EB 3P73A 5HI4C 3P0VH 4MX7A 4LVOB 3A67H 1BBJB 4JFED 1MCPH 1HHKB 4XVUC 1S5IH 1Q9LA 5DK2A 4KFZC 3O6FD 1CYGA 2I60H 2W0FA 2UZXB 3GIZL 4LPXA 3KYAA 1N5AA 2BHZA 3BMVA 3GB7A 1XGRB 2VDQH 4JQVC 1OL0A 5BMFL 4NRZB 5ISZB 3RL1A 3TGXA 5C0BD 5IFJA 4BH7B 1OGAE 4Q9RL 3QUMB 4JZOA 4MJIA 5K9OA 5B3JE 4HF5H 2BX5A 5CEYB 2AXHA 4RMRA 3GSQA 3DRTB 3F65A 3BPOC 1IAOB 1NUDA 1QYGH 4Z7WE 2A1WH 3EYVA 4H8WL 1TCMA 5D71H 1QSFA 3C6LA 4RQQB 2CDGB 5J89A 1LNUB 2A6IA 3MFFA 4B5EA 4C59B 1BBJA 3MRBB 3ZKXB 5DJXA 3S5LB 1DEEA 5ICZB 5HHOE 4XNQB 1I75A 5GRVL 4LLAA 5DQJB 3IJYA 1IFHL 2DMCA 1SYVA 3BP7A 1ES0B 1EO5A 2ATKA 1FNFA 1G9MH 1ZLUH 5DJDA 1LD9A 3T2OA 3NACL 2E7MA 3D0LA 3BIKB 5E2WL 5ADOL 3EDKA 3MROB 2L4OA 3AS2A 4HJJH 4IJ3C 4WEMB 4KJPC 4ORGA 5KS9F 5D96C 4YEFA 2NY4B 3AREC 2X1OA 3QNYB 1T3FB 2XN9D 3KXFB 3WFZA 4M7LH 1I8KA 1T7VA 2CRZA 4WHYH 2A9NH 3L3KB 2EXYD 4OGYL 5I1IH 2AKRA 3I6KB 4PB9L 4O58L 3WKMH 1F6FB 4JPIA 2P45B 5HYSB 5FF6B 4AM0A 5I19H 4X6DF 4EUPG 2G2RA 1ES0A 1I8LC 1I9IH 3CLEL 4Z7NF 1R3JB 3LEVL 3C5ZC 3PP3H 4G9FA 1F3DH 4P5TD 1RAMA 1PKQA 3CDCA 3SE8H 5E4EC 3DUUA 3KNBB 4XHJD 4Z5RA 2JKXA 3LKQB 4ZOAA 5ID0B 1OP5K 5ETUA 3IDYB 4URTB 5DJYB 5J56B 1J05B 3MLTB 5FYJD 3GIVA 3S5LA 4O02L 3T4YA 5CILL 3NCEB 1BOGA 3C6SB 4LPUA 2C1OA 2DQEH 3VXSB 1JVKA 2QKIB 1GGBH 2ENSA 3BGFC 1CFQA 3VFSB 4M3KB 4HIIA 1OTSD 1WT5A 4XCFH 3WNLA 2QHRL 3I85A 5DEGB 4ONFL 2P44B 1CFNB 3GBNL 2JK5B 1DSFH 2LU4A 1Z5LA 4OGAC 1FNAA 3BIKA 1R6VA 1FV1A 1ADQL 1G9ML 4MNQE 3EHBD 2NX5E 4FN0A 1EXUB 1MQKL 2CK2A 4NRYA 3SBWA 3WFBL 1RJLB 1B0WA 2Q8AL 2NPLX 4U05A 4YQXH 2W92A 2DRUA 3O0RH 5IM7B 1ZHBA 4FA8A 5HHNB 5C07E 3EOAA 1A6WH 3FZUC 3MLXH 1KCKA 4PRPB 1MI5A 1LGVA 3H42L 3TF7C 1Z9LA 3MRLB 4K9EC 1LO3L 3JWOC 3TVMB 2UWEB 3IDIB 4QRRB 4TSAH 5FCSH 4KI5D 1JF1A 5DRZA 2H32A 3D85B 3QDME 1NMAL 3C5JB 1NGYA 1DBAH 4PP1C 1CXEA 4F9PC 4N8VA 1VHPA 2ITDB 3UTPD 3TYFB 2NNAB 2VB5A 3ETBF 3BPNC 3WNOA 2O5XH 3LOWA 5KSVA 1IKNA 4MZ2A 3W11C 2R2BB 4AEEA 4LSUH 3C6SA 3SGDH 4R7DB 4LARL 3WMSA 2ADJB 3QEUB 4LF3A 5DF0A 3VXRB 3ZHKA 4XGZB 1FAIH 5ALBH 1VFMA 4H25B 2GSIA 3IKCB 2F54E 2X41A 4TRPH 1T5XB 1NEZB 4U7KA 2DDQH 1OB1B 3L3IA 3NCBB 3SDXE 3RGHA 3FQNA 3ECBB 3P11L 5JHDE 2ICEA 3GNML 3L3DB 1DE4A 5F9JA 4WW1B 4DEPB 1Q0XH 2Y4SA 4JJ5B 3THMH 3BSZL 1N3NA 4AQOA 3SDDB 4LIQE 5I76A 3RBGA 2K1MA 3REWB 4NP4H 1CL7I 5GRWA 2E9IA 4JM4H 1I1AB 3O4OB 4K2UH 2UVFA 1ND0B 1MI5B 1DVFB 4KTEH 3DV4B 3FRPG 3ULVD 4E0RA 1ZS8B 3NCMA 4Z7VF 5D93B 4OCRH 5D1QD 4WI5A 1IGJB 3QEQE 4OZGF 4LLUB 3ZTNL 1XF5B 4UB0L 4G8GE 4J3WA 3VFNB 1KB5H 1CLZH 3MBEC 3BESR 3WHE1 3QAZB 5FM8A 2PKDA 4NRZA 2VLMD 4KMTL 1CGTA 2A77L 2EO9A 2HG5A 1PFCA 3EZ8A 3PDOA 3RI5K 5FDWA 2VDNL 2Z92A 4HJGA 5EBWB 3QQ9C 1CLYL 4L4TD 2HVJB 4NO5A 1CD1A 5HHXL 4EVNB 2ED8A 1MEXH 1NANI 1X5JA 4HS3A 4MDIA 3F7YA 3BP5A 5J1AA 1QRKA 3VW3L 5BRZB 1S5HA 1O5DT 4P46C 3VXME 4GG6F 3EYVB 3T0DA 4E0RB 2Z35B 5IBLC 3QQNA 5T3XL 1PG7W 3U0PB 4BQBA 5D6DC 1AXSA 4S1SL 2QL1A 4QXUH 1OHQA 4MSWA 5KAQG 1T7WA 1I1FB 5T1KD 5F9OH 5CLWA 1M1SA 2X6MA 3H9HB 4LCCB 5ACZA 5C07A 5I16B 2ATKB 5MHSE 2OI9B 1MRFH 1KXVC 1ZSDB 1W72A 1DUZA 1HHIA 1LEKA 3BPCB 3RWDB 1HILA 5D72H 5JIKA 4OAWB 1FAIL 1YA5A 5ALBL 5C6TH 4ODWA 3X17A 5I6XC 1R5VA 1UCBH 2BNUB 5J57B 1QRND 3PQYB 3LH2L 4O4YH 4XP4H 5T3XE 1IEAB 2E9BA 3SDXB 1IM9A 5D1ZA 5SX4I 3W2DL 4OT1L 2Q7NA 1Z0MA 1UZ8B 1NCCH 1VCAA 3OKEB 4UQ2A 5IMLA 5CIPA 1QZ1A 1WSST 4X7FC 3QIWA 4GO6B 4JZJA 5E2WH 4CJ1A 1WVZA 5GJSL 5BO1H 2AP2A 2VLLA 3VRJB 4UV7H 3C60D 1L7IL 1ONQB 2HLFD 3ZKNC 1FPTH 4OZIB 2PCPA 3CH8A 3RL2B 3QEHB 4X6CA 3RKPA 2Z93A 4UIMB 2RIKA 3BDBA 3EO1A 5CHNA 2Z8RA 3MRCB 2XRAL 5HPOA 3PIQB 3X3GL 1ZLVK 5IF0B 3AC0A 2NMSA 1JHLH 4X4XA 4XMPH 1R5VB 1BFSA 3TESA 2KH2B 3QIBA 5IEKA 4H8WH 1M7DA 4LCCC 3P40A 5E56A 4F33A 3E1F1 1WWWX 4JJHA 2GSGA 3IB4A 4ZOEA 2FGZA 3BPOB 1ACZA 3MXWH 1B0GA 2YWYA 2D7OA 2X4RB 5SWZB 1LP9B 1NCDH 3QPXH 4IMKC 3OKDB 2VL5B 3OGCB 2UWEE 1I8IB 4K94C 3QRGL 4ZUVB 2HWZL 4D9QD 1S9XA 1PYWA 1NGWB 5I8OH 4IRSD 4PP2B 1XR8A 3OQ3B 4G43B 4YGVB 5CEZL 3GIZH 2R4SL 1OAXH 5H37G 1H9VA 1OGTB 3QNZB 3ARBD 3W81A 3TZVC 4L8CB 2YD2A 4M7KH 3C5ZA 3RZCA 5GS0H 1BEYL 1YYLH 5HY9B 4HKJA 3NH7H 3N1MC 1WBYB 4TOYH 5F89B 1C16A 1BQHG 3G6AB 4LCWE 4PJ8A 3ZMRA 1EPFA 1JFQH 3LKNB 5FYKE 4EQ2A 4L4TA 3QB7C 3C8HA 1MRFL 3OJ2C 5HJ3B 5EO9A 4Q2ZB 1TETL 4ODSL 3BP7B 4EUPA 4OCSH 1FO0L 1V3JA 2HTLC 4U1JB 4QRRA 1YMHA 3UJTL 1I7RA 2X4RA 5SWZA 5DVLA 2XACC 4U6VH 1HHHB 1N64H 1T1ZA 4MQTB 1HH6A 1WIPA 4UINL 3ZDZE 4YWGH 3K46A 5B21A 1VEOA 4IHOA 5F8QC 4ERSH 1K4CA 2J5LB 1BJ1H 3HPLA 1MIEL 4JO1L 3P4MB 4NQDB 4ZYKB 1P69B 2OR7A 3RU8L 2NTFA 3O8XD 5DRNB 5FB8B 1AXIB 5FAAA 3MBXL 3RVWC 5DGQA 1FIEA 3X14B 1U8MA 2YZ8A 1IL1A 3V4UL 3KPRD 3MOAL 4FQJL 4XCNB 3F7VA 2DBLL 1YN7A 2IH3A 4F7TB 1MH5B 3TBWB 1MVUA 4WHCA 1G9NC 4JFDE 4A2MA 4CU8A 2C9AA 4ZO9A 1JGUL 1HOCB 5E8PA 3GJEB 2ZJSL 4N1HB 3ES6A 1A22B 2A74B 4JREC 4N5UA 2Z4QA 4CN6A 4YFLI 5SWZE 3WYRA 3O3DA 3M8OL 2LVCA 3F58L 3U0WL 1EH9A 4L4VD 4YE4L 4LHUA 1OAZH 5F7FA 2AKRB 1AHWB 5FGCE 4CAGA 4MXQD 4GG8B 4QXWA 1KLUB 1RZJC 2EC9U 4OI9A 3JTTB 1A6ZB 1INQA 2BMKA 3BWAB 5FK9A 2DM3A 2DL2A 3WIIL 4JANA 1UM4H 4MNGE 1H3TA 1WBXA 4YHKL 1NDMA 3MRMA 3MRQB 3WNKA 4OBRA 3PHQA 3PABB 3KPQB 4UIKL 3QUXA 2CKBA 3VGBA 1NCNA 2FHCA 3NABL 4NDMB 1EV2E 3LN9A 4L9LA 1L6XA 3RNQB 3C9NA 4U6XB 4U1HB 5GZOC 4FFVC 4PJGB 43CAB 5TDPB 5I8EA 1E28A 3L95A 3GBLA 4TNVK 1ZLSH 4OB5H 1G6RA 4HMDA 1A5FH 2Q20A 2VLJD 3IKKA 4GAYA 1EDQA 3HR5A 3BHBB 1MHPH 1P2CB 1QA9A 1D5XB 1KTLB 1OWRM 5CEZE 5E08H 4KJPD 2G5RA 4CGTA 2DJSA 2YD3A 4MQXD 2Y23A 4L5FH 1WT5C 4M93B 3VGGA 1ORSB 5JHDA 1H8SA 2ICWJ 5FFLA 3QWOA 1AHWC 1D5ZB 4BQCA 3MLSL 3NIDF 4BFGA 4ZXBC 3ALPA 3MRBA 5DMJB 3BOVA 3QXAB 4WY7H 5E2VL 2Z31B 4GRLA 2VR5A 1J0IA 1T1XB 3QFJA 1XGPB 4DGIL 3M17A 3WIHA 3GKWL 2DLFL 4P5TC 3VD5A 1U8QA 3DGCR 4AJ0A 4JFXA 4KK5D 3JVGA 1OSZB 4YDVB 3CDFA 3VE0B 1CD0A 3K8LA 4MVBC 3RWHA 1IGML 1BGXL 3VCLB 2LAAA 5FUZH 1CE1L 3HN3A 5C0EA 4NOBA 2FYYB 4WW1A 4KI5E 4YHNA 1GGTA 3BP6B 4HSQA 5DD0H 1G6VK 4AZ8A 4KK9C 3MNZA 2NXYB 2WBWB 3QO0B 4PGDB 4Z0BH 5E00A 3UZEA 1XF3A 3PWUB 3DLQR 4MS8C 1A7PH 3HRPA 2WLZA 2F58L 4DGYH 2B1AH 3HC3H 5EO1A 5GRUH 3KLHD 1YC7A 5LGJB 2X4NA 5K9QG 3T04D 2VAAB 3SO3B 2A83B 3WEXA 3WD5L 2V2TB 4HUXA 4ZO6A 1FZJB 5DTFB 3VXMB 5BS0B 3FFCD 4HG4J 5ICXA 1F3RB 4P57B 4MNQA 1KUMA 3JXAA 2YN5A 1E27A 3H3BC 1XIWB 3MLRL 3SKMB 2G9HB 5JW3L 4KHXH 2X4QB 5JIIA 4LFHG 3AS3A 4N90D 3G6DL 4HUWB 1BVLA 3SE3C 4X5WA 5MP6H 4DAGH 2BC4A 4LQFL 3VFSA 5C71A 1K2DB 3DJ9A 2EIEA 3LH2H 4XP4L 4FHBD 5INDB 4GBXB 2OP4L 4HMEA 3WIIH 2YMXL 4HK3J 3WV0A 1F2XK 4HWEL 5C0JA 3L6FB 2YZ1A 4GKZB 5DVMA 3U36A 1X5LA 4HJJL 5A1AA 3ALWA 2CRYA 5DHVH 2V7HB 1LK3L 1U3HA 2J8UE 1VPOH 2GYSA 4RMVA 3LKPA 4K7PX 4Z7QF 3NACH 5CP7B 4HWBL 4ZNEE 5LGHH 2HYMA 4J4PC 5HJ3A 5M95B 4KJWC 5CZXD 4S1SH 5DQDL 3KG5A 1HKLL 4RGNC 1FFQA 4WFFD 1OAUL 1NGPL 1JGVH 4NPYB 5DYOA 1S78C 3GRWA 1G1YA 4FQXA 1QFWH 2W65B 1U8PB 1X5AA 5IWLC 5I74B 3GMOB 5E8DL 5CLTA 4YGAB 3ZO0A 4WWID 3H0TA 5BOPA 5EORL 1CLYH 4P5KA 1CGXA 2M1KA 2VDNH 1QLEH 3GO1H 4RX4D 1U8NA 4JG0L 4WUUE 5DMKB 5KOVC 1IEBA 2I24N 3AY4A 5I16A 3MZTA 1A7BA 1EZVX 2ARJA 1RZJL 3M07A 3FONB 3VFMB 4AIOA 4CMHC 5IGXH 5DD5L 1E6OL 3H3PL 5I1JL 1KLFA 1MWAL 2PYEE 3DXAA 3RUGB 4LBEA 4P46D 1MCIA 4DWHA 1LE9A 4J3XA 3TPKA 3ZTNH 4LSQL 1U8HB 2HT2C 1UH3A 3CSPA 3D69A 4J3OC 4MAYA 4TTDD 5DZNA 2IQAA 3K8MA 5LXGH 2D0GA 1CICC 5FGSA 4NZUL 3QAZC 4F7MB 3DX6A 1Q9LB 4POYA 5E7BA 3CZFA 1ZLVH 1MCPL 1IC4L 4J3TA 12E8H 2VAJA 3DVGB 1FNGA 2VLKD 4MJ6B 3WIFA 1H3WM 5C07D 2H3NA 2NY6B 2IANE 3IS0X 1XF2A 5DS8A 5B8CA 2DMKA 3ZZ1A 3PGDA 4ZS6C 4OCSL 3NCYP 2QSCL 2V9TA 1K5NA 1WZ1L 2R4SH 4XVSL 4OZHE 4GG6E 2FNBA 4GS7C 4JZJC 2I07A 1AY1H 3ZSTA 4QXGL 5IMOB 3GI9H 1LE9B 2AXJA 5FKPA 4TOYL 3NH7L 5CSZA 3T8XA 2CQVA 3QO1B 4XTRD 3X13B 1AR1D 1RUPH 1VACB 1FGNL 4LOUD 3TH3T 3O4LD 2D31A 3LSOA 4GJTB 4M5ZH 1F2QA 3DX7B 2J6EA 4MD0A 3O9WB 4QHKI 2VE6A 4C56A 3TLRA 4HFUL 2FATH 4L3CA 4PG9B 5I8EB 4S2SB 4ZTOL 4NOFA 5C0BE 1AI1H 3IS1X 3QDHA 5EBGA 4Z77B 2BP3A 1S7QB 3BE1L 1FIGL 3HAEA 3N06B 3MRDB 5C0AA 4EOWL 5BXFA 1D9KD 5FM5M 1K5NB 2ZOKB 4EXPX 3ARGA 1B4JL 5DFTA 5ESQA 2Y1VA 1AC0A 5C0GA 2I9LB 1HE7A 4KV5E 1NJ9B 4RFEA 4TUKL 1KN4L 2Z35A 4PTUA 5HDQL 3RWIB 4N5ED 2BVTA 3OL2A 4OCYL 4PRBB 5CWSB 4P2RE 2CDFA 3ME0A 3KXFD 2P46B 2PW1A 2BNQD 5ISZD 3GJFK 2HN7A 2DN7A 5JXEA 1BOGB 1NCTA 4YHOH 1WC7B 1OTTC 2ESVB 3L5XH 3T77B 2XQBL 2E7LC 1J18A 3UTTB 3S37L 3FN3A 2VE6B 2UV3A 3TZVA 5C08D 1FPTL 1LE5B 1FGNH 5I17A 4R4FL 4GSDL 3HZKB 5EU4B 4YDIL 1Q9OB 3FO2A 5IK3A 1I3GH 3H9SB 1HHHA 3DUUB 2Q8BH 3H7BB 3ROOA 3DETD 3ARFD 4PJXE 2I27N 2FX8L 4JQXC 5B38G 4NZRL 1FORH 1YUHA 4HS6B 3VXSE 2R4RL 4ZAKC 3QXUA 4HKXA 1UZ8A 1BLNB 3MZGB 1KC5H 4XPAH 4G9FE 1C5BL 4C56B 3V7AG 1J8KA 1BZ7A 2ATPB 2AXFA 5DFWH 2OZ4H 1YY9C 3FHQA 4EN3D 4G8EB 3EOAB 1UQSB 4PJBE 4POZC 3LKSB 1L4IA 4MAYD 2UYLB 1YEGH 4F57H 4WEBH 1IC7H 3DYOA 3DGGA 3GSRA 3GSQB 4M6MH 2Z31C 4UBDD 2PO6D 3DYMA 1YC8A 1JP5A 4YXLL 2XZQH 4KDTC 1FSKC 4MNQB 3S6CA 2JCCE 3IDYC 2CKBB 3U9UA 4OZHB 3WKNA 2X4QA 2YSSA 4M1CC 4M7LT 5F70A 3VG9B 4TSBH 2NY7H 3DI3B 1UCTA 4QOKA 2QBWA 3T77A 5CJXC 3H9YA 1CFTB 1G9NH 1BQSA 1QLEL 3MA7A 4C4KO 3AS1A 1VFAB 3RVXD 3X3FL 3QCUL 1BQLL 3CNKA 4HZLB 4D3CL 3EYFB 4YO0A 3PWLB 3PJSB 1U8KB 3TO4D 1S9VB 3RVTC 4JN2B 4U1LB 1Q9WB 5D96B 4APQC 5T5FL 4HC1H 2IBZY 1DE4B 5CGTA 2NYYC 2P7TA 1MF2L 3V7AE 1MJ8L 1ZA3B 1H15B 4OCMC 4QHLA 4KMQA 3OMZA 1KEML 3WBDA 3C60A 2EDTA 5CP3H 5EFIA 2DQIL 3UDWC 5IGXL 3ULUF 4HWEH 1FFNB 3NTCL 1F4WL 1F4XL 5CBEA 1QEWB 2AQ1A 4JFFA 3SY0B 1YJDL 4G8IA 1SM3H 4PJCF 3IVKB 4LDOB 4J12A 1YEDB 4WFED 1T0MA 3CH1A 4NHCL 4DOHB 1CCZA 2YC1B 1N3NB 1OD9A 3CSGA 1OP5H 1PY9A 5DMIH 2XTJD 4G6FD 5GS0C 2HFEB 2YKLH 1RZGB 4N9GA 2BNQA 5GSRB 5F7KC 3U7YL 2IADA 2X4SB 2VLKB 3MLRH 3LN4A 1OOAA 4XVUD 2WM0A 3WDHA 5HGAA 3QNXA 1CFQB 5MEND 1XF4B 1UWGL 5AZ2L 3EKCA 4K8RH 2F74A 5B38B 5ACMA 3UPRB 1CK0H 4DK3A 3OWEA 1FG2A 3NTCH 4IRZH 1JYVA 1CLOH 4M61B 5EZIH 5ERWB 3W0WA 4EBQH 4WUKH 2FJHA 1UZ6E 4WI9A 4PRHD 4WFFE 4DN3L 1N5YH 3WFEH 4PJ5B 3GSVA 1MQ8A 1YQVL 5DLML 4Z0BL 3D2UD 3PDOB 3LQAL 2W38A 1UM6L 4DQOH 1NAMH 3ZDYE 5ACZB 4FQQA 3VXSD 3QG6A 3D2UA 2GFBA 3VRLF 4NO0D 2BVOB 4P2QB 5GHWL 4PGEA 1A6ZA 5SWSE 3LEXA 1G7IB 3SEPA 2ICWA 1E4JA 4M93C 4HKZB 1BAFH 1ZE3C 2RCSH 2NY2D 3MTRA 1MWAB 3S35L 4NIKB 3C5SB 3F7QA 3GSWB 3CH1B 3TC9A 1IM9B 3SQBA 3GHEL 1FNHA 4ZQKA 1GGBL 2R23A 4HIEA 3MLVL 4NBZB 4YEEA 2GCYA 4PRDA 4UV4H 4U49A 2A0LC 3VFWA 3MV7E 5T1KB 3HNTH 3DMMA 2OM5A 4HIJA 1EAPA 2R2EB 4JJ5A 3EAKA 4JGJA 1JK8A 4XH2A 3O11B 3WJLA 1ZHNB 4WU5A 3QPQC 2PYEA 4Z76A 4Y4KC 5HVWA 1INEL 5J11C 1EVUA 3WDJA 4LLQA 1EFXA 5C0ND 4WUUB 5CILH 2GK0B 4WEBL 4YK4C 3QEGL 5KZCD 2Y7QB 1EMTH 5BQ7B 4IRSB 4M6AA 4I0KA 3OKEA 1NBVH 1G84A 1L0QA 4DZ8B 1E4XH 2JJWA 3MCLH 3KS0H 3EDFA 4KGJA 5EU3A 3B83A 1T2QH 4LDEB 2OJZH 5DJ8B 2ZOLB 3VXTA 4M7LL 3GKWH 4ZQKB 4KKNA 5D1XC 1BAFL 1D5ZA 2ZUSA 4QTIH 4Y5XA 5LAXB 3D2UB 5KTEH 4N90E 5GRJL 4IMLA 1FORL 1FFOA 2MHAA 3ZT6A 4OCWH 3AM8A 1FH5L 4W6WB 2FJFB 3P77B 2ZG3A 4I18B 4NKMA 1XR9A 5BV7H 2YXMA 3WSQH 4MDJB 4OLUH 3IGAA 1EJOL 5I1EH 4YHOL 1E6JL 1U91B 4E5XA 3O2DA 4KVNH 2AK1H 1RIVH 1FE8H 2IAMC 1T83C 5EBLB 4CN4A 5HDBE 2VMFA 4LSVH 2EIZB 1UADC 2VISA 1WCBA 1NBQA 3V0VA 1RY7B 1NAMA 2HVJA 2YPLA 4Z76B 2EE6A 4NNPL 3O4OC 3MO1B 1GGUA 5HYJA 1MRCL 2OTWB 2M2DA 3HE7D 4X7CC 1QSZA 1HYSC 4W70A 4PY7A 1LHZA 5GGTL 1UM5H 4RFOL 5E03A 3PL6A 4Q9RH 3ARDB 1P7QB 2G5BB 5E8OB 4PJ9A 4YBLC 3U9PH 1WBYA 2IQ9H 1CDCA 4ZS6D 4HUXB 5JOPD 4GRWF 3D1MC 4XCEA 3MRHA 1ZKAA 3KLDA 5DMGC 4LK4A 3EYQD 4JHAL 2XPGA 4U1NA 3RU8H 5HYQA 3LSOB 1XT5A 2GIYA 4YUEL 1FVCA 2W0FB 4QOKB 5KJRH 3TO2B 2VDOL 3BZ4A 1NCUA 1ZHKA 2BSSA 3A67L 5DJ2B 3C8DA 2I07B 1S8DA 4LKXA 3RWDA 1NFKA 1YNKH 2GJ6B 4POUB 3CXDH 4PJ8C 1GCFA 1FFPB 3WS6C 3MRFB 3I6LE 2QSCH 1EIBA 3ILQC 4H1LA 1NBZB 3DV6B 4PRNA 1MJ7H 2JTDA 1H3GA 1IAIH 4JZJB 5F1OB 1KXQE 4EXKA 1RZIB 2V9QA 1AXTH 1U2CA 2CDFB 2UVEA 4XI5D 3N9GL 1NKOA 1FRGL 2GT9A 2WANA 1FVCB 2C3GA 4PBXA 1MCEA 2MPAH 3TWCL 3L3GA 4GW4B 4A6YH 4NQEE 4K9EH 3T1FA 1DVFC 2QADD 3MLWL 3QQ3B 1HOCA 2AEQH 4LLVA 4HWZB 4X6FB 4V1DB 1OQOA 5DYOB 3ZYZA 1FLRL 4I77L 4QHNB 5D6DA 3HI5L 5BCAA 3KPQA 2D4FA 2Q3ZA 3BX7C 1S9XB 4WWKD 1JJUA 5HYSG 2HP4A 3JZ7A 5DWUL 2XZQL 2ARWA 1CD8A 1KTDB 4PUBH 2UY6A 4OTXL 4QXTA 4M02A 2AEQL 4JDZB 5ICZA 3N50A 4WWKA 1AE6L 4L4VB 2B8OT 4Y19B 5A2JH 1J1PL 2AGJL 1GVIA 4K8RC 4L3AA 1I9JL 2AXFB 4Y5YC 4MD5B 4KZDL 3UJJH 3MGTB 1BM3H 3QFDB 1D3CA 2D7TH 3LQZB 4LVOC 1T0PB 5HHOD 4OF7A 3QIUB 4NQCE 5INCA 1RUAL 4P23B 4GG6A 1O0VA 1PYWB 4GKNB 3SJVE 3NPZB 1ZHLA 4L9LB 3LN5B 5I1DB 1HKLH 4F7MA 1QBML 1YMHB 3OZ9L 4XC1L 5FEBA 1J0KA 1S7XB 1PKQB 2EEAA 4YIQA 2NX5A 5MI0B 1FVEB 5EUKB 5FOBB 2Q7YB 5IQ7H 1DBJH 4UDTB 2OQJB 3CFKA 1KLGA 5HGBB 5FUOH 4S1DD 3L9RA 2IFFH 3SO5A 4KVNL 4PGCB 5E9DB 3WLWC 3PP4H 1NCCL 4JO2L 4L8DB 5F97E 3PGDB 1ZVSB 1X5YA 3I50H 5FO9A 4S11A 4H88L 3LQMA 1KIRA 3PNWB 2EIBA 4NUGH 5I18H 4U1GB 5DJAB 1CS6A 1JPFB 4MJID 1U9KA 4XNZB 5D70H 5CJBA 4RSVA 3BT2H 3T0BA 1F3JA 3HG1E 3IT8D 1ZEAH 1BQUA 1CDIA 3BKYL 5A2IH 3F7RA 3OAYH 2R2HA 5ID0A 2EDHA 3ARBB 4XCCL 2M8XA 4QRPD 1HCVA 3WJJA 3SE4C 1VACA 2P48B 3Q6GL 4MAUL 2X9YA 4OZGB 3SJVB 3CX2A 1JTOA 2MFNA 5F93C 4BKLB 1JV5B 2A9ML 3KYOB 1B4RA 2XV6B 3O11A 2HH0L 5FOBA 2AERT 3GB7B 4LPTA 1TNNA 4QXUL 4LCWD 3L3HB 2CMRL 2AEPL 1HN1A 2X9XA 4ZOCA 3LQZA 4X6CF 4ONGH 3CUPA 2Y5EA 4YDVA 5EN2A 4NQEB 4Y19D 3IFOB 4QT5B 3JTTA 1K6QH 1BOYA 5FGCB 1FJ1A 4KH2A 3SE9L 3BZDA 3DVIA 3PWNB 3PWPA 3TNMB 1GSMA 1EXUA 5E2TH 3EO9L 5AEAA 2A6JB 1RUPL 3IETA 2K7QA 3SCMB 3G5VB 1UCBL 3TCXA 5EULV 3HI6L 3K81A 3R06B 1VGKB 5CWSA 3LRSA 1CXIA 4Y5XB 4QRTA 4NQDD 3UX9B 2OXGA 4FFVD 4G80A 2P1YA 5DSCA 3BZEB 3LAFA 4OKDA 4PRID 4LVNC 5BZWA 5T3ZE 5I1KH 3FOLA 2L7UA 3NZHH 5JW4M 1REIA 2DLGA 5IBTH 4PY8I 5E9DD 4TSCH 2PO6C 1YEDA 4OJFL 4R2GD 3SDYL 4DGIH 5ICYB 4MDJA 3KWWA 1Z3GH 3KPRE 1T5WB 3IFOA 1XEDA 3B2VL 4JEGB 1KACB 4QT5A 3D0LB 5C0JB 1A9BB 3MGOA 3QUKB 4KTEL 4F7PB 2X89D 4JY6B 3TYFA 4DUVA 1NC2D 2UUDH 3P9LB 1A4KA 4YHIB 3HA0A 4Q7DA 2YD9A 1OT2A 3WN5C 4XXDA 2QTEA 1FZOB 1RIUH 1T66C 1D5BB 1UM6H 4XVJH 4QCIA 1KCUL 4LASL 1JRHH 2YPLB 3GSXB 5TDOB 1BD2A 3ZL4H 3I6KA 2UZYB 5C3TA 2IWGA 5CZVH 3NZ8B 3O8XC 3DBXA 2DD8H 2W0KA 1RZFH 4AENB 1U8OB 2HT3D 3FQNB 3TNMA 1G7PA 1QFHA 4MNHA 4Z6AT 3VI4E 2XG5A 4IIQC 1AD0B 4Y4KB 1F45A 4ZD3L 2ED7A 3JV6B 3MRIA 1TJHL 3QG6B 2AJXL 3SGKC 1A7RH 4GQPH 4C57C 4EDXA 1ZLUK 3D39D 1RUKH 1EAPB 4I3GA 4Z7VA 1HIMH 2GJ6A 2AJZA 4HWBH 4HIIB 1MCCA 2HTKD 3ARRA 1B2WL 2EYSA 5KANI 3MNWB 3Q1SL 4XPFL 2QADB 1F4YH 4C56E 2DWDB 2J4WH 5CUSH 3IJSA 4XNMB 3VXMD 1ZT1B 2XTJC 2C1PA 5EZOH 4DZ8A 1JNLL 4XBEL 3I3EA 4HKJB 1QLRA 5M7QA 3FT4B 1BZ9A 4DVRH 5CINL 4P48A 1GZPB 2CPCA 3M8OH 2C4FU 3MRGA 4XNXL 1WFUA 4H8WC 3MV7A 4Z7UB 2IEPA 4GKSB 4YDKL 5D6CB 1RUMH 4IRJD 1JGUH 2I25N 3LV3A 5E8NB 1OW0C 1ADQH 5T1MA 3RVWD 3TYGL 3I75B 4MXQC 3MREB 3SO3C 1CDJA 3AAZA 5AUMA 5DMGD 4C54A 4PJHB 2CUHA 3VJ6B 4CNIA 4XWOD 1SMOA 5D7JB 2X1WL 4MNHB 5DRZB 2MCG1 3U7AA 4XVJL 4ZSOA 1U36A 3HPLB 3IFLH 3BZFA 4M6OH 1B88A 4P4RB 3IJSB 4MD0B 4Z7WB 2VZVA 4Q0XL 5D7LD 5DK0A 2NXYD 2PYED 2FSEB 5GGQH 4YWGL 4D2NA 3LN4B 1EEQA 1A7OL 2FJGA 2ZPKH 3LMJH 3ZL4L 5LQBH 4LASH 4YBLB 4AG4L 1YN6A 4U6VL 4W6YB 3V7MA 3CU1A 4U3HA 1GZQA 2VXTL 4ZG1A 4NZJA 1EAJA 5I1KL 5B8CC 1FHGA 1R5IB 3ARFB 5AZEL 1WJ3A 8FABA 1A2YA 3O3UN 1UKTA 3DTXB 3DX9B 3DYPA 1OB1A 3B43A 3OGOE 4K23H 3ISWA 2A0LD 4AEHL 4W4OA 4JVPA 3QCUH 2C7UB 1C5BH 4NKOB 4Y89A 1KC5L 1JPGB 3TCLB 1NLDH 3EO9H 4P46B 3QPQD 5DQ9B 3RL2A 2DQEL 2ZCKL 3DXAD 4HK3N 3QJFA 5EIVA 4G8FA 43C9B 2OXHA 1GC1L 2FX8H 1T83A 2XZAH 1MCLA 5HDLA 1U3HC 3MREA 4PD4J 3CVIH 3MACL 3H7BA 4ONGL 4HKZA 3TT1L 2O5ZL 5IT2L 3BUYB 4NQED 4JPKH 4M3JA 2IG2H 5MHSD 1FFPA 2B2XL 1MSPA 3O4LE 1U95B 4G8GB 1W0VA 1YEKH 3I9GH 4LSRL 1DEEB 5E2TL 4UNUA 5J0BA 1QR1A 1P9MA 3ZT5A 4OGZA 3FB5A 4CDHA 1FGVL 5IVXE 3RZCB 1IKNC 3NFSL 3IDXH 1K6QL 1MI5D 2JCCA 4XCCH 1S7SA 4Z7VE 2LFGA 3MXVH 2DQJH 3CLFL 1UQSA 1AO7B 5E4IA 1ED3B 3OKMA 1BBDL 1JHKL 1LO5A 2R39A 3RVUC 1UWXK 4N0CC 2APTA 1MRDH 3MLPA 1DQQB 1KB9J 1MUJA 1ORSA 1GGYA 1UJ3A 2VC2H 5F3BB 4KZEH 5FKPB 2OL3H 1SMAA 3UTZA 4X98B 3VRIA 2YD4A 3U48A 1D5IL 4IS6A 1D7FA 1INDH 1KG0B 3AU1A 4QRSA 1IRAY 3ZKXC 1QBBA 1T04A 5DK2B 3DO7A 1YEFL 3PQYE 2YUZA 3VXSA 1UYWL 1NCAH 1TVBB 4ODVH 4ZPTA 5DC9B 5EH1A 3DGGB 3VFTB 5CEXB 5TE4L 5IVXB 1J1OL 5FB8A 5DMYA 1S7SB 4BSVB 4ZS7H 3QFDA 5IWLA 5DRXA 5IJKA 2OSLA 5SWSD 2IFGA 3T65A 4HGWB 1AC6A 3DSNA 3UJJL 5F1KC 1DQLH 3FT3B 5F8RC 1KCSH 2ZOKA 3KR3L 3AVEA 1SBSL 2J4WL 1U95A 2JJUA 4HW6A 3G04B 4JFQA 3ES6B 4JR9H 4OFYA 2V2WB 5JQ6H 5EUKA 1EHLL 2KZWA 3MOAH 1BIIB 2ESVD 2OK0H 1A8JH 5T3XH 2P5EA 3KPLB 2BVQB 2D03L 1TQCB 2B5IC 2PW1B 3NFNA 2Y9RT 3D85D 1FL6A 4PLJD 3MJ6A 4NGHH 5EOCL 5L6YH 1AE6H 1K9TA 1JPFA 1C1EL 3V5DB 1CBVH 2R1YA 1AD9A 2A74A 2W0LA 5IFAH 2X4OB 4P59L 3P4OB 4R3SB 5D2LE 2XZZA 3O3EB 3ZKND 1I4FA 4LGSB 4PJ9B 3ESVF 3MV9B 3SPVA 5CCKH 5BJTA 1ZT4B 5DD5H 2EXWD 3TA3A 3WUWB 3C60B 1RZGA 4N9GB 4BUGA 1EBAA 2OLDA 1F6AA 1GGCH 3MV01 4NHUA 5IESL 1NGXB 4PJ8D 1N59B 4KKLD 3ULUH 4EN3A 4RZCB 4XMKL 4LF3B 2VKXA 4JRYE 5E95B 4KV5F 5CKGA 3OKOB 5IK3B 2IALB 2FH6A 1WBZA 3BVNB 4NQEA 3EFFB 2YRPA 1J1XH 1VADB 2EKSB 2XXCB 3AMLA 2CD0A 2FB4H 1J1OH 1JTTA 5HHMD 4DW2L 2I9TB 1KIUA 4FQ1H 2YA2A 1X4XA 3NN8A 1A7NH 5DD6B 2F53D 5D7JD 3T09A 3KNBA 1UC6A 3GMLB 3MLUL 5C0CA 5I76B 3LRSB 4FQQB 2XZCL 5IHUL 2B5IB 1NCBL 2YSSB 2VDPH 3D39E 5EPMB 5HGDB 2WBKA 4PS4H 1JGEA 4HGMA 1RZJH 4H20H 4GQ9L 1QA9B 2C3WA 1ZVHA 3ZYIA 3NCJH 4EUPB 4LLYB 3PWPB 3GZKA 2F54B 1J10A 3ILPB 1D9KC 5IOPB 5FYKL 1YNTA 3ULSB 3TO4A 3JVGC 2R1YB 2IALA 3IETB 1IM3A 1TJIL 3PUCA 1B0RA 5IIEA 3CLFH 1RUQH 4NCDA 3O81A 3MJGX 5T3ZD 4PJ5D 1NSNH 3ARFC 5D7IF 3S9DB 1UWEH 4N5EC 5FGRA 2X42A 1I1AA 5D7LE 5D7IE 1D6VL 2BVOA 4P2QA 5GZNC 2E7LA 5IROA 4L4VA 4LSRH 2ZSWB 3FRUA 4TULH 3MNZB 2Z92B 4OFDA 3BD3A 4QCIB 4E41B 3S4SB 3D69B 4MAYB 15C8L 4P2QD 3U46A 35C8L 1QR4A 1TJGH 1JZ3A 1A3LL 2OTPA 1HI6B 4LDLB 4U3CA 3IDGB 3PJSA 4L4JA 5TFSH 3DHJA 3RWHB 1CTOA 3ROLB 4WGWB 4PRDB 5CJXA 4JFFB 5FHAH 4HULB 1QP1A 4ZUUA 3U30B 2NY1D 2VLJE 1RJLA 2QR0A 3WL9A 3MUGA 3I6GA 2V5MA 5DHYB 3MUY1 1X3DA 4NKOA 3B6SA 4HJGB 4YFLF 1F00I 1IGCH 3UMTA 5D72L 1ZT7A 4HIXH 2CGRL 4MDIB 3QZWA 5EPMA 1IGIL 3QBTB 4BYHA 5HTSA 2ADIA 5E9DA 4PTTA 3T2NH 2NZIA 1EO7A 4RFNB 1W0YT 3KPSE 1A6UH 3V0AC 5TE6H 4QNPE 5MEOA 4JGUA 2V2TA 1FZMB 5C08E 4JRXA 1FAKT 4Y4KA 2DLHA 1E4XI 4DKFH 4P2RD 4LCIL 5KSVB 3VW3H 4JFFE 2XFXB 4K94H 1BVLB 1U8JB 1HHIB 1LEKB 2PN5A 3UTSE 1EBPA 5HI3D 5BZDB 3QDGB 2AGJH 4V2CB 5FV2A 2ZUWA 2YA0A 4KC3B 2BXZA 2V5SA 1KYOK 3MJ7B 4PTTB 4HIHB 1JWUB 2WUBH 3EOTH 1L6ZA 4WW2A 4HH8A 4YNYA 3WKML 3KDMB 3P9WB 3VRIB 4LLWA 4ISVA 4UT6L 2QHLA 2A6IB 3MFFB 2A6DB 1MAJA 2F19L 4OF6A 4BZ1L 2D9CA 2DI7A 2KUTA 3KGRA 2HVKB 4FTVE 1WCBB 5GS0D 4XVTH 1Q0YH 1ORQA 2P42B 3EYUH 4JLRB 1GIGL 1YMMD 3DMMD 1F58H 4RWYL 4OUUB 1P9MC 5JTWA 3EO1B 3FB8B 5E70A 1CLOL 3HLAB 4PJ7F 4JDTL 5I6XB 1A3LH 4MAYC 1KT2A 5E0QA 4DGVH 1MAML 1QKZH 4X7TA 4CVWA 2KZ1B 1HEZA 2H9GB 5KVDL 1YUHB 4HS6A 5E99L 1FL3B 1YQVH 5DLMH 3BIAX 1N5YL 4X7SL 3BEVB 1XCTB 5ESAA 1KCLA 1IVLA 4OLZH 1IAIM 2D0FA 2RAMA 3TJEH 2J88H 2Z31D 2R0KL 4UBDC 3GSNB 5C70A 3E6FA 1OAZL 4NQDE 3LDBC 5FYKD 1I85C 4W68A 1S8DB 4OB5L 3CCHB 5I74C 4D0CB 3O6FC 3B9VA 1MJJA 3MYZA 4HH9B 1ORQB 1WV7T 4ZFZA 4L29A 4IM8A 4IDJH 5ALCL 3VG9C 4C83A 3QIUD 4LU5L 4Z7WF 4EI5D 2HFGL 2DYPA 3F62A 3OR6A 2WINA 4NO3A 3HE6A 4FMFA 3KDMA 1RJCA 5CP3A 4P3CH 2FHBA 1INDL 1N2RA 1ZT4A 4FXGA 5F3HB 2XN9A 1MY5A 2HFGH 3BQUC 5B8CB 3CDYA 1A7NL 2C1OB 3X12B 4JY5L 4UQ2B 3T2QA 2D7PA 5CSGA 2XWBA 4HC1A 5J6GB 3GKZA 3PGCB 3TH2T 5DRNA 1NEZG 3GSNA 1A6WL 4HZLA 2Z0BA 2O26U 4XNZC 1WAAA 1EEYB 3BEWA 5BRZE 4HH9A 4P5TA 2ESVE 3ZKSD 1I8MB 3OB0H 3WFBH 2NY2C 1KTDA 4JO3L 4M4RA 2Z93B 4QXTB 2ICCA 3MJ9H 4U0RB 4D94A 4PR5A 1IGTB 1OF2A 1DQML 2I9LA 3FAWA 4I3SL 1UJ3B 1E4WL 1FVEA 4LSPH 1QPPA 5C0CB 2C3VB 3AM8C 4XX1E 3OBAA 5KN5A 6FABH 1FSKB 3CVIL 1SEBB 1KFAH 1S7QA 1Z9SA 3CX5K 4NQVA 2E7HA 1NL0L 1LO5B 4ZDHA 3IJYB 3AMKA 4TVPL 4BFIA 3TA3C 3BH9A 5FKAB 1T80A 2OX5A 3FO0H 4ODBD 5J6GA 5L6YL 4G9DB 1I7ZA 4G8IB 4MJIE 2H6PA 1JUFA 5JLZB 2BNQE 2NXZB 4MWFB 3IFPA 4N0FB 3OPZH 5LVEA 4Y5YA 1P53A 2IF7A 4TUJA 3SDAC 2BDNH 3QUXC 4U2YA 3TN0D 1A4JA 4MQ7B 1S7UA 3SGEH 5HHVL 3PWPE 4PR5B 4JR9L 2NY1B 3N85L 2W9LA 5L88H 3UCRA 4Q9CA 4JFPA 5AYQA 1A1NA 3OAZK 3SKUD 1JNNL 3QHZL 3BKML 4HJ0C 1TVHB 2PR4H 3RY4A 4DUXA 3FONA 3VFMA 1K85A 4Q74A 1CWVA 4PJ9C 3NA4A 1Q9OA 1RFDL 4GBXC 2OSLB 5GGQL 4ZFOB 1ETZB 5J12C 1JPSH 4OSUH 3MA9L 4Y5VA 5GS2H 3BH9B 1QBLH 3ZE2F 4ZUTB 4YHLL 3B5GA 5CMAA 5IV2B 1UYWH 1YYML 4ZUUB 3RWFB 2H6PB 3TBTB 4E41E 4L1HA 1IGYA 1NFDE 1JV5A 4ZUSA 2YBRB 4Z7QE 43CAA 3SDDA 4CVZA 1JL8A 1N8ZB 4OCYH 3UTSA 4G7VL 5K59F 1AQDA 4PLJC 3QZWB 2AV7B 1A4JB 3QCTL 1F6AB 3MV7D 5GGRB 1R5WA 1Y6NR 3VU2A 1PAMA 3T0EA 4IRJA 3S37H 3W2DH 5IW1B 4WHYG 1XZ0A 3PV6A 1IGCL 2H26B 4PIRF 3QUMH 3V52L 4U6YB 1E4KC 3MA9H 1FIGH 2IAND 4MMZC 3WFEL 5ESVB 2P8MA 1MCOH 5H2BB 4F7EA 4GMTH 2EKSA 2XQYG 1KIQB 2EZ0D 3NFSH 5JMRA 1T1WB 2E27L 3UBXA 4JM2B 2J6EH 3A6OA 5KSAA 1Q72L 2RR3A 1A1NB 4R96B 1N4XL 4M1GH 1KJMA 1OGAB 5DRWB 1KXTB 3BP4B 4NRXB 4MJ5B 5E94B 3DSFH 5ISZA 4PJDE 2WUCL 1IJ9A 2AI0H 2X2YA 4YXHH 1YZZA 1QG3A 1VERA 5BO1L 4XAKE 3INUH 4JZOB 4MJIB 5K9OB 1UKSA 3CAFA 3U7YH 1GC1H 3SKOA 5EA0H 1H0DA 5D7IB 1RULH 1QEWA 1W2KT 2A83A 2JJVA 1CG9B 1YNTB 3ULSA 3W9EB 3O9WD 1FRGH 2LTQB 4QRPA 5ESVA 5IIEB 4PTUB 3P0VL 1TQCC 2YEZB 2ZG1A 3GI9L 1F4XH 2VXQL 4GQ9H 4ETQA 2XNAA 4PGCA 1ITBB 1FNLA 1PY4A 4GBXD 3T4AA 5BVJB 3T0EB 4TTDC 4AENA 1WIOA 1KJ2H 4Y4HA 1BECA 4Y0GA 3S36X 1RV6X 5LBSL 5K59E 3QH3B 2JB5H 1JF1B 4MCYB 5DK3A 4Q6IB 2Z8SA 2CIKA 2VL4A 3EYOA 1T1YA 3ROOB 4OIIL 3HE7C 3GDBA 4OIAA 3GHBL 3ARBA 1CL7L 1WITA 2LVEA 3TN0A 5KS9A 2GJZB 3O6ML 3SGJA 2VQTA 3L5WA 4KTDL 5D9SB 4XX1G 1BLNA 3D18A 5GS2D 3VWKA 3K4DA 2R56H 4BM7A 5T3ZL 3X3FH 1MFNA 4OZIA 2VZ3A 4OLWL 4HUUB 1RIHH 1MHCA 4F8TA 4CMMA 1P4IL 4B53A 5FYJH 1A6TA 3H3PH 5I1JH 4K8RD 3U4BL 4RGOL 4WW2F 3UBXI 5IVOA 3G6JB 5BZWB 4X8JA 3H9SE 4L3EA 4JG0H 4BK4A 1J8HB 1CT8A 4YXHL 2JJTC 2OL3B 2F5AH 4JFHD 5GGVH 3RIAF 3FN0L 4C56D 1CBVL 1N4XH 4G6JH 2VLRA 4JHWH 1U8IA 4Z7WA 2E27H 1DQDL 3KPOB 1ZGLA 5AWNL 2FEEL 3D48R 2XFXA 2GTWA 5HDOA 4K71C 1NGXA 1G7HA 3F7PC 1CR9H 4Q9QL 5T1LA 4PRAA 3DSFL 1HCFX 4Q58C 4S0SD 3VJ6A 1A64A 2WSKA 4CNIB 2GI7A 2DOCA 2VH5H 2IANA 4G3YL 4Z95L 5EOTA 1HIML 4Q6IA 4HDIB 1MCDA 2ADGA 1I1RA 1RUKL 2EE3A 2V9RA 1U8NB 3KLAB 1P4BL 4UT9L 2EDEA 1F58L 2EIDA 4KJYB 5JXED 2R29L 3MV8E 1V05A 1K4DA 2NXZC 4JZNB 4D9RE 5D1XA 1MHEB 3V52H 3WHE0 4Z78B 4EI5C 1JYWA 4P3DB 2F19H 2K9UA 5C9JA 2YS4A 2V2XB 4EVNA 1MQKH 1SEQH 1E4XL 3MCLL 4U7SA 1LK2B 3FO9B 4PRIE 5SX4H 1UEMA 4IRSA 4OD1H 4TPRH 1T1ZB 5CBAA 2IPKA 4OAWA 1R24A 3SHSA 4LLYA 4BZYA 1DBAL 5JW5A 1V7MH 1NBYA 1P84K 4KK6C 5HDQH 4LEXH 5KVFH 5D7SH 3UZQA 3VXMA 5D2NE 32C2A 1RJZB 1BX2A 2XYCA 4OZGE 1J8HD 1YYMH 3O45B 5L88L 4OBSA 1Q1JL 4KVCL 3GMPA 3MRIB 1EUUA 3KPOA 5KAQF 1TFHA 2MCPH 1AJ7H 4ODHH 3R1GH 4PB0H 1FL5A 3ILQD 4MA7H 3MLVH 4R0LC 3B2VH 1SHMA 4F80A 1K8DB 2YR3A 1MJJB 3ARDC 3OKMB 4IOIB 4KJQC 2Q76A 4R4BB 5DO2D 3G6JE 3VXRA 3P77A 1I1CA 4X6CB 3CIQA 4UDUA 3BQUB 4ONHB 1IAOA 4NQCA 2OCFD 1KTRL 5LGKA 5HHVH 4OTXH 5TF1H 4APQA 1MFAL 3OKNA 2YWZA 1JF5A 3B2UC 1OAQH 5DJ6A 1KG0A 2V7HA 3CFKB 5HGBA 5IUSA 1X7QA 1HSAB 1YMMA 2VQ1A 4LKCA 4WENB 3SCMC 1WWAX 2A9NL 4JAMB 4FQPA 4HV8B 4LSPL 1DEDA 1OWWA 4X4YB 4H26A 3LIZH 4F33B 2D3VA 4RAUB 1S3KL 1FN4A 4IOSD 1V3LA 3UTTA 5J4MA 4JB9L 3MJ9L 1T6WA 2HT2D 5CEXA 4QTHB 5JO5B 5DK0B 1NL0H 4UU9B 3WFDH 4X0KB 3KJ6L 5F1NA 4L8BA 3DUSB 4NZTL 4M43H 1ZS8A 1MWAA 3HR6A 2EEBA 1JF6A 1I7TA 2HT3C 1JTPA 4NCC2 4KPHH 32C2B 3E0GA 1RJYA 4BQ9A 3L3JB 4H1LB 4U6TA 3TJHC 1UXWA 3E2HC 1EA9C 3HZVB 2BSSB 3QXVA 5EU4A 1WEJH 2XKSA 4HIJB 4P3CL 3DXAB 4PB9H 1ADQA 4XBPB 1MNUH 1KSRA 3BT2L 2H45A 4HT1H 4G6AD 3HE6D 3C6LD 1F6LL 3T1FB 3BP5B 1XMWA 5J1AB 1SVZA 2GK0A 3QNZA 1TPXB 2OTUB 5MEPA 1GPOH 4GFTB 2PXYA 3B3IA 1UGNA 2JLLA 5ID1A 1WCQA 2YD1A 1EERB 3VH8A 5FXCH 2J88L 2P5EB 4M5YL 4YZFE 5DSCB 3MODL 4LCUA 2DQFB 4FFZL 1JGVL 4L8SC 5BVJA 3BRFA 3KLSA 4OZFB 4NNPH 4NC1C 2AS5M 4QLRA 4X7SH 5I75C 2GUOB 4X9BA 4KKBC 4N9OB 2MQCA 4IMLB 3VFPB 1M71A 1S7VA 3IU3B 4LSVL 3D0VB 4Z7UF 4XPHL 1ROWA 1UB5B 5E6YA 3F58H 3FB6A 4R3SA 1BQHA 4IJ3B 3SKNB 1WUNT 5DJYA 4OD2A 4N1EA 5TGBA 2QQKH 3RWCA 5DJZB 3VGAB 4BZ2H 4HWNA 3VXUE 3RWGA 1N59A 1QFOA 1XF1A 1ZV5A 3R8QA 3S96B 5ILTH 2BVYA 4XC3L 3V4UH 1XIWD 2W07A 5EIQA 3Q3GA 4YR6A 3NCYS 4UINH 5IB5A 2P24B 4YH6A 4FZ8H 2BSTA 4I9WE 2VJXA 3VXRD 4I2XA 4OM0H 5BXFB 4ODTL 4KQ3H 3BWAA 1FV1B 3MRLA 1T03L 1XGTA 4K9EL 3G5ZA 1IC5L 3MO1A 5I17B 1WBXB 4ODSH 2VZUA 1VB9A 3BUTA 2A38A 5D1QA 5MEPB 2MNUA 5HHMB 4W4OC 1I7UA 5IMMA 3MMEB 1U58B 3QDJD 2DI9A 3C09B 4X4XB 4OD2B 1QO3B 3EDEA 2ARJQ 5CS7A 5JIHA 4M9OA 4PJIE 4L8SB 3GJFB 4YAQB 5I66A 3L9RB 2H2PC 2X4SA 3UPCA 4Y8DC 2FL5A 3NFPA 5HYEA 4Z7VB 1YEEH 4DKAA 4HS8H 5DUMH 2P5ED 3BP4A 4NRXA 3Q5OA 4PRPD 5C0CE 2BVEA 3LB6D 4RGMC 5EOTB 5GRVK 5D7KE 2MQ0A 1HQRB 2EH7L 4QRRE 4ELMF 4P4KB 4DKEL 1C5DB 4EIZC 4PRHB 3PHQB 5EU6E 3T65B 4YDIH 1FJ1B 4KRNA 2VDML 4NM8L 1GOFA 4YXKH 3G08B 1T22B 4O2FB 2CXKA 1F4AA 4HIXL 2WBJB 4RAVB 3WL9B 4HUNB 3TA3D 3JWNC 1I8KB 1XF4A 2JJTA 5H37H 2NY6C 1X5FA 4DN4H 2ATPA 3MGAA 3JWOH 5C7XH 3TV3H 2W60B 4F7CA 4FQIH 3R1GL 3DIFB 5H94B 5K33A 2ADIB 3QXAA 4UZGA 3MRKB 2R0ZH 1QSED 5EO9B 5CBAB 3CMGA 1MRCH 4Y4FD 2JIXB 3GSRB 4LSSH 4I4WB 2V17H 4YJZL 4PJCB 2VITB 3RVUD 2VDLL 5DFVC 4X6FA 4FZEL 3MUGB 4JPWL 1XF5A 3IFPB 4N0FA 4FQ2H 4WV1B 4J1UB 4UTAL 1T5WA 3HNSL 2R23B 2Y36L 1JHLL 5DT1H 1U3HD 1ZT7B 3KYMA 1GL4B 1UJTA 3GJFA 4YAQA 1WZKA 4JKPH 5T1DL 4WTXA 5DT1L 3U83A 4WUUD 1MCQA 2FR4B 2C4FT 2WIMA 3MA7B 1T1XA 3QFJB 5TDNA 1PKQE 2P8PB 1Q94A 5GGVL 1A3QA 4K3EL 1BD2B 1KULA 4FQXD 5GZOD 5JA9A 3O3BA 5EFIB 4OF3A 4OCWL 3T0VA 2JK5A 1AY1L 2E7CA 5D1ZC 2VWEC 2WW8A 4JN2A 5B39G 1P4BH 1YJDC 4QO1A 3V9FA 2WBJC 4LLDA 2XZCH 3QHFH 1YY8B 5J7CC 4EJ1C 1BVZA 4J23A 5EZLB 1XH3A 3ARWA 5A2KH 1IEHA 5DEFA 5EIIA 1RPQA 2Q86B 2FLBT 5GGSB 5FGBA 1FVDA 5L8JB 3VFUB 2R2BA 1JZ2A 2HRLA 3GHBH 3MLZL 1ZVSA 1SYSA 3G6JA 3VXRE 4LCWA 4X5WB 5DR5H 3RAJL 4HX1B 1HILB 5JOEA 3P73B 4YE4H 5F9OL 1HHJB 4PJCA 4JHWL 3OHXB 4XMLH 3N1PC 3FQWA 4RDQG 3CFBB 1QVOA 4HUMB 3V6OA 1S78D 3BEVA 3GI8H 3H9HA 4LCCA 5DUBA 5JZ7C 2YXFA 3EGSB 4N0CD 4YHYB 4X7EC 5JHDD 4EDWL 4QHUB 4OZGA 1MI5E 2NY4C 4CDGC 4OZIF 5L9DL 1FCGA 5D2NB 1PG7H 3FQUA 2IH1A 1KB5A 4P9HC 1QOKA 2V5RA 4JQIL 1AO7A 3IJHA 4DJMA 3CMOL 4KZDH 3QEUA 4I48B 4ZFZB 4PRIA 3WNMA 1EEUA 3MNWA 5IESH 4GXUN 5DFVD 2HA1A 1HXYB 4QRRD 1HINH 2F5BH 3LHPL 4RGNE 5IMKB 3PQYD 3MLYL 3UO1L 1PEZA 1UJ3C 3O4LA 3U30C 1S9YB 2OK0L 1DBBH 2R15A 1NAML 3VH8B 5IFAL 1JGLL 1GHFL 4UOW1 1RSFA 3BSZH 4JRYA 3RWEA 4NQTA 4X6CE 4P2RA 1JHTB 4ZFFB 1IILE 1HH9B 4Y8AA 4DOHE 1KJ2L 2R9HD 1A14L 2MPAL 4XBEH 5T1LD 3TWCH 5FYLE 4RDQF 1OLZA 3VFUA 1QRNA 3FO9A 2O5YH 5GS1C 1AGEA 2NY3B 4AY0A 5DRXB 5F96H 3PIQA 3CFDA 2DBJA 1MFEH 5KSUA 2J8HA 3PL6B 4OKVA 1N7ML 1KENL 4PGJA 2FIRT 3VXOB 1FZMA 2FH8A 2VOTA 4WNQA 5KG9A 3Q48A 4JN1H 1BF8A 2QSTA 3P11H 3SE4A 2FX7L 3H7LA 1RULL 5D1XD 4FQCL 1LO2L 5FYJE 4MNQD 3S96A 2FYYA 1AXSB 3BH8B 1X7QB 1YMMB 1TZGL 2Q8BL 3DMMB 4LKCB 2Y07L 3D18B 2P5WE 4BA8A 2E9JA 4I5BA 3VXQA 4X7DC 3DXAE 3BQUA 4ONHA 2J6EL 1P84J 3U6RA 5IHZB 1OGTA 3I3BA 4F3FB 5D1QB 4Y88A 4X5LA 4O5LL 3MRJA 4JREB 1J8HA 1UH2A 3HHRB 4HPOH 1TZIB 3O2DH 4FQ2L 1NEUA 3AB0B 4O9HL 1HSAA 2WV3A 4MGXA 1KYOJ 4XNUL 5EUOB 4ENED 5A3ID 3BKMH 4ZPVA 3BIBX 4WVRA 4KKBD 3ZYOA 4RA0C 3PGFL 4RAUA 3OAYK 4J6RL 4YPJA 4ZTPH 4NWUL 3STLB 4PPTA 4CUCA 5AG9A 3B9AA 3MUZ1 4KPHL 1TDQA 2P5EE 3CU7A 4LQ1A 3QDGE 1IGMH 3TV3L 5DEGA 3VRJA 4RNRB 5GSVB 5D2LF 5C0AB 1D5MB 2VLJA 4OJFH 2PO6A 2LU3A 4OLYH 2EDQA 3D9AL 1MPAL 3HRZB 3VXOA 4NYLA 4PBWD 3NIFE 5SWQB 1E6JH 2NXZD 1XR9B 3ULUE 1EJOH 5I1EL 1XFPA 4K3DH 5CHNB 4WHTB 3ZLQC 3BISA 3G5YA 1VEPA 4GW1B 3VD3A 5FCUH 1NJ9A 4RFEB 2IG2L 4M9PA 1H15A 1YPZB 3WLWD 5JDSB 1T21A 3VD7A 4O00A 4ZPVB 2DQFA 5FDYA 2CJUL 5SWZD 4UQ3B 4W6XB 3SE8L 3F7VB 4L5FL 5DUML 2PCPB 1EEZA 4MZ3A 5MERB 4FABL 1VDGA 4PJ7E 1YEHH 1YEGL 5ISZE 4LKXB 4OLYL 1RD6A 4ZUSB 4BELD 4AEIL 1I85A 1AP2B 1KPRA 3I2CH 1TZHB 2OZ4L 1LNUA 1M05A 1BFTA 1OCWH 1AHWA 1M6OB 4KXZI 4WCYL 1ZLWH 1V3MA 1J9CT 1R5WB 3MV8A 3QJHA 5C0BA 1P5VA 3PF2A 1H3XA 1YMME 3Q6GH 1XZ0B 1OGAA 4E41A 3KYNA 4QHMA 4CKVX 1JCKA 1T21B 2VDRH 2D7MA 2SEBA 2DIJA 1HI6A 3HMXA 3HNTL 2QSVA 4K7FA 3IKCA 5ILTL 5KVGL 1I3GL 4F58L 2R2HB 1KPVA 3NVQA 3B2UD 4NO0B 5EC2B 3WDIA 1JWMB 3GGWA 2PXYD 4HLZH 5EBMA 4B50A 1JZ6A 4LEOA 3REVB 1YEJL 3WN5B 1WGOA 4GOSA 4XNXH 5D7LB 3MMEA 3AXLA 4N8PA 3L5HA 3L95B 1E4KA 2C5DC 1EO8L 4WTWA 3L3HA 2Z91A 5TF0A 2P24A 1J88A 2EECA 1KJ3H 2G75A 2N56A 3WHXA 3LEXB 2HKFH 1A7QH 1TVHA 1WQVT 3S3PA 1K3ZA 3DVNB 3BRDA 2P43B 3QH3A 3W0WD 4F37F 1CIUA 1N7MH 2N7BA 1CFSA 3BE1H 2DTMH 3G5VA 2BSRB 1U58A 5INCB 4YFDB 4PGZA 1S9VA 2H1PL 3O6LH 5E6ID 4NWTH 5EZOL 4F9PA 4X6DB 5DJ0A 4XP5H 3TBTA 1MCWW 2VIRA 5TH2A 3WN5A 4A2LA 4MNGB 3FB5B 5HPMA 3VWKB 3WXWH 3BDYL 4NO5B 2AABH 2DLEA 1WK0A 3C6LC 1MNUL 5IFJB 1QFUH 2J12B 3F6LA 4NJAH 3FFDB 2X05A 3KHOA 1IL1B 1LEGB 3VGAC 2WZPD 7FABH 4PREA 4H0IA 4Z0XA 2YKLL 4Y2DB 4XVSH 3B9EA 2EE9A 3TVMA 5IBUG 3ARVA 4A6YL 1ODAA 1NMAH 5DD6A 3QWQB 2ZOLA 4NN7B 5EU5B 5F3BA 5KVDH 3PXHA 1QSFB 2BFVL 4CVZB 1WZLA 4I8DA 3B9KD 4X5XB 1MFDH 4RWHA 5D5ME 4IOFC 3OB0K 2VERN 4Y1AB 1T1WA 4M7KL 2COQA 3GSOA 3H42H 3RNKB 4X6DE 1R0AH 2ZNWA 4PRPA 1EK3A 4L8DA 5F7MC 2IBGA 2FCBA 4NZUH 3O0RL 3SGJC 1KF9B 1CT8B 1JYXA 5B38A 4RMSA 2EYSB 3QRGH 3D85A 1AQKH 1I3VA 1CI5A 3U79A 1E27B 3Q2CA 1M7XA 5K9JH 1IQWH 1F13A 4KDWA 1BGXH 2HFEA 2WUBL 5HVHB 2GHWB 1P7QD 3EO0B 4JFDA 4M62L 1SY6A 2HRPL 5IW6B 3MV7B 5TDPA 3V0VB 1A1MB 5TDNB 2WAHA 4PV8A 2V2XA 4GBXA 2OJEA 3VXQB 3GK8L 2BVQA 4GUPB 1KJ2B 4I2XB 1X5ZA 5AUMB 1UB6B 4BJLA 5DQDH 1F90H 2CK0H 4K3HA 3OHXA 5GIRB 3CD4A 3OSKA 5SX5K 3WO4C 5I8KL 4D9LL 5CP7A 1S9KC 3UTTE 3GMNA 1Q72H 3MV9A 5EZJA 2NY6D 1HNFA 3RJQB 3LB6C 3ZKMD 1UWEL 5E8NA 4N0YL 4XAWL 3QXDA 3RDTD 2X44D 2R2CA 1TNMA 3VI3F 1LDSA 3T4YB 1DN0B 3L7EA 2X7LA 1GJIA 2CMRH 3U4AA 2BJMH 3IJHB 1FNEA 3P4NA 3LPGA 1GOHA 1FLTX 3HRZA 2OJEB 3DWTA 4GAJH 4QRUB 4X99B 4YPGA 3DX6B 4I0PA 3EYOB 4PJ9D 4PJAB 5DUBB 5BS0D 2WP3T 1I3RA 3MRRB 4JRXE 4PS4L 1T20A 1P5UA 3GBMH 4ISVB 4R2GB 5JW3H 4NM4L 1WWCA 4UIKH 2NCMA 1OAKH 5L7XL 1OQXA 4N1CA 2QQLL 2P47B 1IQDB 3JV4B 3UXFA 4HWUA 4G5ZH 5F7YC 4ETYA 1AD0A 2Q87A 1UFUA 2ICWI 5I18L 2C4XA 3CDGB 1BFOB 1OM3L 1D6VH 1NBVL 2ADFH 2NLJB 3KAAA 1XCQB 1DN0A 1RUAH 1CGUA 5F1NB 4F8QA 4G8GD 4TNWK 4TNWF 4R9HA 4HJ0D 2BNUA 1KN4H 2P5WB 3V4VH 2MKWA 3O3AA 4IHOB 4HDIA 2F5AL 3TFKD 4JDZA 4GXVL 3ULVE 4R97C 1MHHA 1GGCL 2F8VA 1WF5A 2DM4A 1XGRA 2DBLH 1UXWB 2ILLA 2YPLE 5DJCB 3U4BH 4PRHE 1HXMB 3QHTC 4Q97A 3CFDB 1NLBL 1SJHB 2EIZA 4L8BB 3MBXH 2VISB 1PD6A 3HAEB 1RURH 4MHHG 4Z78A 5IB3B 4GKNA 3NA9L 1NFIB 3RGVA 3HZYA 1OW0A 2RCSL 4C83B 3HUJE 5ANMA 1MIEH 4JO1H 2DWDA 5GHWH 3FB7A 3IGAB 3UYRH 4JVUA 4ODTH 1IQWL 2Z4QB 1PQZA 3KLAA 4K2UL 2ZUQC 1DBKH 4YXKL 1R0AL 3MCG1 3PWJB 1MCSA 1BPVA 2Q7YA 1IT9L 2CKBH 4JPVH 2VDKH 5DI8B 1TITA 1CF8L 4I77H 2EH7H 3ARQA 3W11D 2VLLB 3WFHA 4FFWD 5C86A 3EDJA 1DQMH 2GSGB 4AL8H 2ZG2A 1DL7H 2NY5H 3ZDXF 3KPRA 3TBSB 3TZVB 2EZ0C 1SBSH 1KCSL 3KR3H 4WU7B 4TNVF 2FSEA 4Y4FA 4PJHF 3H9SA 4L3EE 1SYSB 1K8DA 3LRHA 1EFXD 4JCLA 4NJAL 3QDMD 3GSNL 1QBAA 5ELIA 2PO6B 1C12A 1OLLA 3EFDH 3MRPB 4P5KB 5B39A 2AJ3B 1EVTC 1QSEE 2VABA 3TBYA 3QG7H 4QNPF 5LXGL 1RZ8A 2IJ0C 3DURA 4NKDB 1U3JA 1YNKL 1KJVB 3KPMB 4AIZA 4Y1AD 3BKCH 5DS8B 1EZVY 2AQ2A 2BVUA 1SM3L 1J5OL 1X6NA 4RGNB 6CGTA 3WCYA 4MD4A 4LU5H 1HYRC 3V2AR 3MOBL 1A7QL 1LO3H 4MQSB 3RIAK 5FIEA 3VXNB 5I1GL 4G8FB 2BCKA 5BRZA 3W9EA 4JFOA 4LGRB 1A47A 2QQKL 4NN5B 2Y25A 3TFKC 5JLZA 3MBED 1PQZB 3KXFA 3V4VL 5IMMB 2H2SC 1FG9C 3MCKB 3FO1B 4PRNB 1KEMH 3VDBA 5EU3B 3QO1A 1C16B 5DUPL 4FG6C 1FQ9C 5L8KB 4H1LG 5DZOA 3ARZA 3DX7A 4LP4A 1RMFH 4OCLC 1JE6A 1OPGH 1YDPA 4CMHB 4EN3B 1Z0NA 4NKDA 4QHMB 1CDUA 4G9FB 4RRPG 1ZSDA 2YPLD 3V6FA 3W5NA 2MHAB 1BJMA 5I1HH 5I15H 4LHUG 1JIBA 4NT6A 2QHRH 4R26H 5KW9L 1KN2H 3W82A 4NC1E 1TTGA 1P1ZA 1MFBH 2EXWC 2O61B 3P4MA 5HYIA 3EYUL 4XTRC 4LEOB 3ZE1F 5JXAL 3F5WB 2EDWA 1CFTA 1PSKH 4A6YB 2AAVA 3RWIA 4RZCA 3RVVC 5IB4B 2JCCB 1T2QL 4F9LA 5CJQH 3PWUA 4HEME 3QIBC 4AIZB 2B1HH 3MRKA 1CD9B 4NCC1 2AK4A 5TF1L 4OGXL 3QHZH 4F7TA 1U92A 1MH5A 3TBWA 1J0JA 4I4WA 5CFHA 1RVFH 4BH8A 1QNZH 2OTWA 4K71B 1FDLH 5DA0B 4PY8J 4OZFH 1CN4A 2NX5B 2B2XH 4HGKC 4F7EB 2GTZB 3QQ4A 3EOYG 4YC2C 2VKWA 4HKBA 2AXGB 1RHHB 2MCPL 3OJVC 3RWCB 2FHFA 5A16A 4E41D 4OIBA 5M94B 3W0WE 3DO7B 5I75B 5GS3A 3SOBH 3QXTA 2ZKHL 3GHEH 4RFNC 4XP6H 3MOQA 4FFYL 2BXYA 4FNLH 3ULVC 2HTLD 1MPAH 3V5HB 4PJEF 3CSYA 1VKXA 1MCNA 3MRNA 3KPLA 2ORBH 2VL5A 3OKDA 1A1OA 4RNRA 5GSVA 3HAEH 5K9QI 2APWA 3BHBA 4QRPE 4GSDH 4HCRH 1ACYL 5H8DA 1GOGA 5FCUL 1R3JA 4U3XA 2JB6A 1IBGH 3LKOA 4BH8B 3G5XB 3IDJB 5C0RH 3G04A 4K07A 1FO0A 4AH2B 4WHTA 3LKPB 2FWOA 3DMMC 3FRUB 3RBSA 1L7TH 5DEFB 4P3DA 2NZ9C 4ZFOL 5JNYA 1QO3A 3O2DL 1G6RB 4XGZA 4Y1AA 4HXAL 3HNVH 3KPPA 5MENB 4NKQB 1C8PA 4WY7L 4LSTL 3QFJE 2FZ3B 1G6RH 3SDXF 3AAZB 4EN3C 3NPSC 3FOLB 4J6RH 5HHOA 1Y0LB 1B2WH 1KV3A 4MB4A 1F11A 4NBXB 2BFVH 4K8RL 2WLYA 2OS7A 4WV1C 5LG1A 2UY7A 1V7ML 2VQUA 4MJ2A 3O3EA 4I1NB 4V2BA 3R06A 4AEFA 3BYTA 3P3YA 1QRNE 3P0GB 4OD1L 4BSWA 1G0YR 3ZTJG 4U1SA 4LMQE 2FO4A 4PJFA 4YHIA 1RI8A 3KPNB 4HBQA 5D9SA 3MSPA 1U8JA 5IBUB 3IRZA 4IOIA 4D9QE 1I8MA 5B3NA 4B0MM 3VGDA 3BW9A 1O7SA 3NCJL 3HPJA 4ZO7A 2NY2B 4U0RC 1L0YA 1VSCA 1UWXH 4JHBA 3TN0B 4WFGD 4LLWB 5CZVL 5DMIL 2W9DL 4CU6A 5I8CB 4JN1L 2VXSL 5F7EL 5F7UA 3EJJX 3S37X 3GMLA 5I9QB 4LPCA 1WZMA 4HUVA 5F88B 3QCVL 3QIUC 3SKMA 4P46A 3FAXA 3UTSB 1IT9H 1KB9K 4F7CB 3MLYH 5HHPA 3NCCB 2FZ3A 3IXAA 1A7RL 4HLZG 5IKCA 1TJHH 4R7DA 2FR4A 1Z3GL 5E6ZA 4H1LH 1KIRB 4KHTL 1Q0YL 3S36H 1A3RH 4P4KD 3P4NB 1KIPA 1GH7A 3ELAT 2DQHH 3NA9H 1MAKA 3T0AA 4BZ1H 3MRPA 1F5WA 4JRWA 4OV6F 3S35X 3NZHL 3JUYA 1I1YA 1MF2H 2CLRA 4JRYB 3RWEB 3ARDD 1T2XA 5GGUA 5JORA 1G9NL 3PABA 1RJYB 2DM2A 4UT6H 3OJDA 2YK1H 1IBGL 3MBEB 4PJ5E 2PNDA 5H35A 3MV8D 4ZNEA 1MCHA 3LS4L 3MRGB 4GMSH 5HPMB 2E7BA 5T1LB 4NJ9L 5F72S 5DRWA 4EUPH 3CMOH 2PW2B 1K3IA 3MYJB 3PWVB 3QUZA 4M03A 3STZB 4Y16B 3UPRA 2R8SH 5D1ZB 1QFWL 4IRSC 1TMCB 4F57L 2W9EL 4PG2C 4YK4B 4Y1AE 3WUWG 4WI2A 2IGFL 5C2BL 4JQVA 3QEQB 1IZJA 4RQQA 2G5BA 1KPUB 4R0LB 4PRBA 3BDXA 3D3VA 4M6NH 4QRSB 5C09E 1J7VR 4O51A 2FEDD 2XPGB 5HYQB 3CFBA 5GRYA 1MFCL 1A0QH 3WLBA 4OCXH 3OJDB 1U93B 5JW4R 1FO0H 2IAMD 4GKSA 1HZHH 5EU6B 5CGYD 1N0XL 1P7KA 2VN7A 4XBGA 4YBQC 4H0GA 4U33A 1FZKB 5I1IL 4NN7C 1KCRH 1XGPA 1HWHB 5HVGB 5D70L 3C5SA 3QUZB 4BK5A 2GAZB 3QIBB 3ZDYF 3WIHL 4DAGL 5MP6L 3P0YL 3DRQA 2O61A 3O45A 2DQUL 1BVKB 2Q1EA 2DJUA 5CEZH 3SE9H 2F53A 1KELH 2NX5D 3JSSA 2IFFL 3PGCA 2DLTA 3S4SG 2A6DA 3T0ED 2YD8A 1EFQA 5JDSA 4Z18A 2HG5B 3KYKL 2AI0L 1IZKA 1D5BA 4HV8A 5HDBF 2CH8A 3VGEA 1I8IA 2EEDA 3MXWL 4MA1B 3BFOA 2JCCF 2FRGP 3PL6D 4MA3B 1VGEH 3TT3H 2N7AA 3QQ3A 4LLVB 2VUYA 3E2HB 1FFOB 1IGTA 2F53E 1AD9B 1A6AA 1JPSL 1UKQA 1QFPA 4HXAH 4OKVB 5A2FA 3QQ4B 4HXBL 5D1ZD 3FOMB 1KPUA 3MXVL 4MJ6A 4JG1H 5CIPH 2NY0D 2UUDK 4JFZH 1FC1A 4OFYD 2OR8A 3C5ZD 5F1SA 1J1PH 5A16B 1SEBA 4NQVB 3QEQD 4CL7A 5L2KA 2CDEA 4UQ3A 3TCLA 3MOBH 5EU6A 3N1QC 1YEKL 3EBAA 3KPRB 4JO2H 4P3WA 5FYJU 3N1FC 4HCRL 1QD0A 3BH8A 5E5MB 4JPKL 1DSFL 4U7MA 1KJVA 1W72H 3KPMA 4P4KA 1TZGH 2H8PB 3VG0H 3QIWC 3KJ4B 4DN4L 4FTVA 4R7NB 2CLVB 1JMXA 3K0WA 2H9GA 1S7TA 3FFCB 4QRUA 2KL6A 1S7UB 1YEEL 4F15C 3CFCL 1BJ1J 3OR6B 3TN0C 4RAVA 4HFWB 3ZE0E 1OSPH 1QBLL 1CXKA 4Y4FC 3ULVL 3QIBD 4NC2B 1R3HB 2ZSVB 2OQJA 4TUOA 4PBVC 4LAJH 5HI5C 4D0CA 2O5YL 1ONQA 1DFBH 1QPXA 2DAVA 1WZ1H 1G1CA 1JWMA 3GGWB 2JIXA 3JTSA 4H5SB 1ZHLB 1XGQB 2VXTH 5HYJB 4NSKB 3U0TA 2H2PD 3UAJD 1MUJB 1IKFH 2PXYB 2BNRB 3HFML 3VWJB 4OI8A 2VO5A 1CFVH 4B41A 4IMKA 3HI5H 3SQOH 4UAOB 3PDDA 1ZLSL 2FGWL 4LIQH 2K7PA 3EHBC 1EJ6A 1KIQA 2J5LC 2C26A 1C08A 4GG8A 1P1ZB 5E7FA 5FYLH 4P4RA 2M26A 4Y2OA 1G9MC 4A6YA 3DETC 3B4NA 3VFTA 5HHXH 3HG1A 4TTGA 5IJVA 1KFAL 3U46B 1FL5B 4JQIH 1NAKH 5E8DH 4ZFGH 4L3ED 2BSTB 3HKFA 5GPRA 1NGWA 5IQ9B 2G2RB 1EEZB 2VZ1A 4O2EA 1EGJA 5D8JH 2GITA 1AR1C 3MRFA 1XGQA 2A6KA 3RVVD 1OPGL 4MCZB 5F9JB 2HT4C 3PHOB 1CU4H 4J4PD 4WFHE 4QRPB 2VZTA 1WFOA 3OG4B 3RPIA 3SDAA 3B5TA 3L3KA 4PJDF 1RZIA 5IG7B 1RHHA 4U1KA 4TQEL 1NGQL 5F1IB 2AK1L 3E3QE 1EGJL 5GRZA 1NGPH 3LKSA 3BRGC 2FBJL 2V7NB 4HZAA 1XGTB 3OKKA 3Q1SH 5GS1B 5J06A 1X5KA 4FFZH 4M1DL 2LQRA 3Q0HA 4ZXBA 2CIKB 2QQLH 1LO0H 4Y5VC 4LQFH 3DO3A 3P4OA 4XCNA 4EI6B 3HE7A 4IIQB 4O2EB 3G6DH 3L1OL 5IVNA 2GQHA 4QTIL 4PJ7A 3T4AB 2I60L 5D5MB 3ARSA 3TVMC 4GW5B 4YX2L 4Y19A 3QDGA 1EHAA 5JNYB 3FQRB 1KGCE 2BNRE 2Z91B 1VFUA 3HFMH 4YO0B 4AEIH 2GK2A 2CUMA 5L0QB 3O8XB 1PGRB 1EMTL 3LD8B 3FQXA 5FO9B 3QEGH 4KGLA 4KHXL 4O2CA 1GAFL 4FQHA 1NCWH 2E9WA 1HDMB 2F54A 1CE6A 1NUGA 3DVNA 1NANH 1S7XA 1MREL 3PHOA 4AYFA 4IBLT 4HUKB 5HSFA 3WLBB 4J2XA 2O5ZH 3VD9A 1N8ZA 4NZTH 3KJ6H 3V5KB 4LCIH 5HHNA 3SGEI 2JF1A 2W60A 5DJXB 5CZXC 3UPAA 2F58H 2IC2A 4DGYL 4NQXB 3QI9B 1H3PH 5HD8D 1INQB 5TH2B 3G9AB 3CFCH 1MOEA 3QQ9D 5CBEB 2VAAA 5F6HI 1BHGA 3V0WL 2XWTA 5C0AE 4P23D 3IXTB 3GSUB 4DUWA 1A6UL 1NLBH 3BD5A 3C5JA 2BSRA 3B9DA 2RQ8A 1MFAH 4QEGA 4AT6A 5HVHC 4FQLH 5ENWA 2MJWA 2XIDA 4X83A 3KPSB 5JW4Q 4PG2A 4GAFB 4HUWA 2GJ6E 3GBNH 4HKXB 3UTTD 3BYYA 4KUCF 5DD1L 1G7HB 5C08B 4XNUH 3RVXC 4KROD 3T2PA 1HQ4B 4P0DA 3BW9B 1RU9L 4YPGB 5E08L 1CICB 3ZDXE 1MVFA 4GAYB 4O02H 3X3GH 2GSIB 1ND0A 4WUKL 4D9RD 4NKIL 5ERWA 3W0WB 4KVCH 3MRJB 3ROLA 3U7WH 1Q1JH 1SEQL 4M6OL 4FXKA 5JHLL 3IFLL 3H0TB 1IAKB 2DS4A 5J9PA 1DZBA 1OTTD 4GH7B 5ECJE 5EU5A 3IAPA 5FA4B 2B0SL 1BX2B 1F42A 3OTTA 3ARBC 5L7XH 4OZHA 2NZ9D 1NCWL 3REWA 1KTKE 4JFDD 2GFBB 4KQ3L 4L8SA 5I66B 2XNAB 5F7LB 3AROA 4JDVA 5C0CD 4YHNB 4XXDB 3ZSSA 1TJIH 2AJUL 1BZQK 4G3YH 1A1MA 1HHJA 2MOVA 4WRLA 3I02B 3OXRA 3LQAH 3D6GA 3PWVA 3MYJA 4J3SA 1NFIA 2BOBB 5FYKH 3RGVB 4LLUA 4EZMA 4ZOBA 2WP3O 4XP5L 4H88H 2APFA 2OI9C 1R3IH 1MIML 2Y6SC 4QHKJ 1QFWI 2X4NB 3LVEA 5BW7C 2HLAB 3NABH 5CUSL 3ZHLA 2DQIH 1KBGH 4M4PA 4RMQA 3B9KB