4E42B

Structural basis for the recognition of mutant self by a tumor-specific, mhc class ii-restricted t cell receptor g4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
237
structure length
231
Chain Sequence
VTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPASRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T cell receptor G4 alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
rcsb
source organism Homo sapiens
total genus 52
structure length 231
sequence length 237
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e42B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e42B01
4OFIA 5IT2L 4FFVC 2O5YL 3CDGA 5JHLH 4L8DA 2AJXL 4QRTB 5KVGL 3AREC 2EYTA 3MRCB 1HQ4A 1CFVL 2GCYA 2GT9B 3MC0A 3MRKB 3O2DL 3QQ4A 1HYRC 2EH7H 3IRPX 1ZKAA 5IHUL 3DSFL 4FQXB 2YKLL 3O11B 3G08B 5IK3B 1YEJL 2FJFA 4LMQI 4OZFH 5GGRB 2IPTH 3IS1X 3TIEA 1BQHA 3L3JA 2O5ZL 4JRXE 4F2MB 1W0WB 3V6ZA 1LNUB 1FSKC 1UVQA 4WO4D 4HG4K 2BFVH 1F3JB 1DUZA 4YWGH 2OQJA 4MJIB 5HYSA 3VRIB 4DVBA 5B8CA 4LLDB 1J1XH 4H5SA 1UM6H 4QY8A 1L6XA 2BNQE 3RDTA 1CXEA 1EFQA 3N85H 3CC5B 4CVXB 2CLRA 4F7EA 1EO5A 3B8SA 5D1QB 5D93B 1A6WH 1N64L 4DWHA 4IM8A 4JDZA 4JO2H 5GGVY 4KU1A 1HN1A 1KN4H 3AY4A 4GBXC 3UPRA 4LVNB 5FKAB 4AMKH 2J2ZA 5EO1B 2X70B 3PQYD 5EOCL 3RNKA 4P9HH 3DX7B 1HSAA 5E24E 1YMHB 3O4OC 3MODL 3QCVL 3SJVB 4I9WD 1YC7A 5DD0H 1MAMH 3UO1H 2FSEA 2VMFA 5FUCC 1EJOH 1ROWA 4K7PH 1FZMB 5EPMA 3G9VA 3U48A 3G9AB 4KKAC 3ZYIA 5SX5H 4JHWL 5H94A 2EDXA 3T4AB 4XC1H 3ZDXE 2XG4A 2HAZA 5I8EA 2GFBA 5FO8A 1U8JA 4HJGB 2UZYB 4TSCH 4OGXH 4PJBE 5E2WH 3DURA 3N50A 1L7TH 3MROA 4DJMA 4YFDB 3NZHL 4N5EC 4R2GB 1XFPA 5HHXH 4PJDA 2AXFB 3ALXA 2E6PA 1PY9A 3GO1H 4LLVA 4V1DB 5HI3D 1RVFH 2CDFB 4OCRL 1CT8A 3B9EA 3C6LB 3MRQB 1B90A 5DQDL 4PRHD 1S7QA 4MNQB 1BAFL 3HNTL 1V8HA 1J86A 4OLUL 1UENA 3MR9B 2R15A 1FL5B 1S9VB 2D2OA 1MCBA 2CRYA 1ZHLA 1A6TB 3BN9C 5B22A 1WBXB 3NCFB 5E8NA 3UJJL 1SMAA 3WJJC 3BIAX 3ZTJG 5EO0A 3GUTA 4YZFF 5LWYL 3PWLA 4G9DB 1F13A 3W5MA 1X4ZA 2OSLA 2FX7L 1A7PH 2CXKA 4LRNH 5DYOA 3QO1B 4ELMA 2XKNA 4PRIE 2KPNA 4P2CG 5E8PA 3D2UD 2IH1B 1KTKE 1T3FB 4NO3B 2ID5A 1Y18B 5JLZA 1WWBX 2E7MA 2MQ3A 1F00I 1OTTD 1I4FB 4UILH 4FZ8L 4FOMA 4GXVL 3WFCH 5E8DH 4Z7NE 5HPMA 1KYOK 4XMKH 3SGEI 1PQZB 3B6SA 4NKDB 4ISVA 2Y25A 1RIVL 3HMXL 4U31A 1WZMA 5ITBL 1MCEA 1T0NB 3QG7L 5FYJH 1EPFA 1G7HA 5CGTA 1U8OA 5EG6C 1OAUH 3GMRA 4P46B 2HTKC 4TN9A 4Z7VE 3BDYH 4MJ5B 4XX1E 1D5XA 5HVWA 4LDOB 4G6FB 3VFNB 2DYPA 4PBXA 4PB0H 3C8HA 4R8WL 4S1QL 3ZLQC 2HJFA 5SV4A 2DQJL 3SDYH 5HHVL 4X9GA 5D7JB 1JHLH 3UBXB 1K8IA 4NC0B 4MVBD 4WDIA 2XXMB 3MSPA 2X44D 3IU3B 4XNUH 3FFCE 5DA4A 2R69H 3V8OA 4JQIH 5DFTA 3BKCH 3I02B 4Y8AA 3Q6FB 1LEGA 5CMAA 1R5IB 3VDAA 5FB8B 5DJ0B 3VRLE 1GC1L 3FB5A 1SJVA 3QFDA 4U1JA 4WFHE 1OSZA 3H7LA 4JGJA 3VFUA 3NFNB 3REWB 2EDOA 3B4NA 4TRPH 5BZDA 3DRQA 5H2BB 1I1YB 1B4RA 4QYOB 1U8LA 3BN3B 4M6OH 3UZQA 3CLEH 3QH3A 4RBPK 4P48A 5D7LE 5IHZB 4G6JH 4S10A 4LPVA 2FZ3B 4X7DC 3OKLB 2X7LA 5IFHL 4L4TB 3PWPE 1OP3H 1TDQA 1G0YR 3QWOA 5E5MB 5DSCB 3S4SB 3TO4C 4DFIA 3GFUA 1KXQE 4JFEB 1OLLA 4EI5C 3KGRA 1LE5A 4YHOH 1G7PA 4BFEA 1HHHA 5TDOA 1D5IH 1DLFL 3O2WH 1A5FH 2I27N 5AG8A 4N1CA 5KS9E 1MLCA 2CLZA 2R0WL 4UQ2B 4ACPA 1Q1JL 4NN6C 1LGVA 1VEMA 1HH9A 2VR4A 3WMSA 1SEQL 1U6AL 5IKCA 4Y4HA 4QRSA 1D5ZA 5ICZB 4YHPA 4NJ9H 1I9JH 5DXWA 1QKZL 3TT3H 4UV7H 2Z35B 1NBZA 3CFEA 2YD4A 1BGXL 2NX5E 3FOLB 3B9KD 1T7XA 4X83A 1MHHA 3QIWD 4XNXH 1A7OH 2DWEA 3RWIA 1EHNA 3QXDA 2VLRA 2GUOB 4ZYKA 2B2XL 3ROOB 1EHLH 5MHSE 3UTOA 3IDIA 3ETBF 3BZEB 3FL7A 3U0PB 2MPAL 3KPRD 2I07A 3CIQA 4ZFGL 3KVQA 4FXGB 1R3JB 1V3KA 4RNRB 4DGIL 4WNQA 3TNNA 5IF0A 4DFHA 3QUXA 4HIHA 2FEDD 3G5VB 2XPGA 4LPCA 3HC0B 1Q9OB 4U6XB 2D0GA 3E2HB 1K9TA 1G7LB 4GAGH 2FD6H 3MOBL 4X4YA 1FO0L 2FATL 3VD5A 1NUNB 1FBIH 4PG9A 3MBEB 4RZCB 1NGZA 4UAOC 3BH8B 3SKNB 2DJSA 4X80L 1KBGH 1SYVB 3PE9A 4NRZB 1MAJA 1AGEA 1UA6L 1HEZB 1N0LA 3HNVL 3VGBA 5KVDL 1B0RB 4UIMB 1MQ8A 3LOWA 2VR9A 5KSBB 1MH5B 5ABDE 2F74A 2J4WL 2APBA 4DUXA 2Q87A 1JGVL 1T4KB 3O6FB 1A1NA 2QSCL 2W0FB 3NFPB 3GJEA 3S5LB 3CNKA 3LZFL 5H35A 2C7UA 4NQCB 4QT5A 1AGBA 2Y5TA 1KNOB 4R4FL 3TIDA 1XGRA 2I5YL 4I13B 1BBJB 4D9QD 2DD8H 1HOCB 3H3PH 4XXCA 4NUGL 3V7MA 4R0LC 5DI8B 4WW2C 5I15H 1WBYA 5B38G 4HCRL 1FNGB 3TVMA 4HUVB 4XPTL 3I2CH 1DQQA 5C07E 4I2XA 4HT1L 4LVHB 1DSFL 1HINH 1XGUB 3HPLB 4XTRD 3SDXE 4OIIH 5D8JL 3O8XB 3BESR 4NO0D 5CIPB 4LRIA 4ZFOB 3RY5A 1IQDB 3K46A 4OI7A 3O3DA 3FQNB 3BVNA 3CFJA 4HH9B 5L88L 4NC1C 2D7MA 3MGOB 4DZ8A 3HZYA 1T1XB 5F7WC 1LO0L 4XBEL 2JE8A 4R97C 5IBUB 1AIFA 5HYQB 4CU6A 5K9JL 4ZO8A 5DJAA 2RR3A 1LK3L 3FJTA 3U36A 3B3IB 4Q6IC 2R8SL 3ARGD 4Z7OE 4L8BB 2BXZA 3ROLA 4QHLA 2BDNH 3BGMB 2YWYA 4OLWL 3VFVA 4DZBA 4U6HB 1OSPH 5D1XB 3KYAA 5GS2H 1QSFD 2ED9A 2P5EE 1A4JB 4WI6A 5F3HA 4FTVD 2DQTL 3GSNH 2QL1A 3IKCA 3ARTA 4TNVK 2EZ0D 3AS0A 4LVOC 4PJ9B 1RZIA 1CR9H 2NY5H 1P5UA 2NY6B 2OK0L 3ARFB 4YDIH 3WFHB 2JJSC 2XZAL 5FF6B 5AAWA 4H1LG 3NIGF 3FQTA 3NN8B 3ARZA 4DQOH 4P4RA 2H32A 1A14L 1YEDB 3QI9A 4O58H 4J3SA 2P5WB 2JIXD 1D5BB 4B7LA 1UCTA 2BC4B 4HX1B 4BM7A 4OCWL 1QBLH 4I3GA 5CGYD 3MUZ1 4OIBA 4LLUB 3EYFB 1MCDA 2VDPL 2G60H 5I75C 1MCIA 4LSQL 4O2EB 1S5IH 3RL2A 4JFYB 2EKSB 1IAOA 4X0KB 1RJZB 1QBBA 2R1WB 1S7XA 2VE6B 2E9BA 2CKBH 5E2VL 3C8DA 3O45A 2VZ1A 4DKFL 2BERA 1A9BA 3BGFB 3C09B 1DBKL 3D18B 4OCYH 1FZKA 3LIZL 5L2KA 1DFBH 1J8HE 1ZLWH 1F11B 2ZJSH 1JWSA 3UEZA 3RL1A 4KJYB 3OXSA 3QG6A 2EDWA 2AK4B 2L7JA 1DLHA 1NFDE 3KPPB 1ZGLP 1S5HA 1C12A 4U1NB 5F88A 3ARBA 4ZFFA 1M05B 3LS5L 1YEKL 3QXAA 4P57A 4XCFL 1NAMA 5ILTH 1IFHH 5FECA 3E6FA 3T3PF 5GHWL 1E4KA 4JFFE 4ELME 1IAKA 3MLRH 2GJZA 5DJ6A 1GGCH 2VDKL 4Q2ZA 4HEPG 3PDOB 2MWCA 3JV0A 3V0AC 4I0PB 1PD6A 1W72H 1A6ZB 2FLBT 4ODTL 3DSNA 4TNWF 4PR5A 2ADIA 5JNYB 5DLMH 1JPSL 1I1CA 3EDDA 2UUDK 3C2SA 4YPGB 2ERJC 4O5LL 1HZHH 5DRZA 2P43B 1HCVA 2CKBB 3C8KB 2VLJD 3G6DH 1MWAL 1A4KB 1JWUB 3IJYB 4JDTH 1BVLB 4MAYC 1B4JL 5I66A 4PJGF 5HDOA 2F8XC 3THML 5HTSA 3LV3B 5KANG 3EGSA 4BFIA 3LKRA 2NY2C 6CGTA 25C8H 3LN5B 3VXPB 4NQED 4BSJA 3S8WA 1NCCL 3HC3H 5TE4H 4GS7C 2A74A 3KR3L 5IVXE 2ARJB 4XP4H 4OF0A 5F1NA 2W9EH 4BK4A 4NCDA 4MNGE 3Q0HA 5BJTA 2MKWA 1QPXA 4PJCB 3QDME 1G7QA 5DZOA 1QPPA 3BHBB 4OKVB 1JN6A 2H2SD 4DKEL 4YHKL 3IU4L 2P7TB 3ABZA 4LARH 3JWNC 3KPOB 2XZQL 2XA3A 3MRIA 2YPLA 1MHPH 1RK1A 2CK0H 1I3RB 3OG4B 1PG7X 3EOTL 4D0DB 1XZ0B 3HA0A 4GRLA 1EDQA 1EMTH 3SDDB 1W72B 4U1KB 1I85A 1WFNA 1ZSDB 5D9SA 2YN3A 1C5BH 3QUZB 1HXYA 4OGYH 2R9HC 3D0LB 1IKNA 2D03H 5JW3L 2HWZL 5DJ2B 2F9BT 2Q86A 3FQWA 4UINL 1CDUA 4Z9KB 4CDGC 1R5VB 3F7YA 5IB1B 1PSKL 4GKOA 4MA8H 1NGXB 5DRXB 5AUMA 1VFBA 2IALB 4X7EC 3CVIL 5DVKA 1MFBL 3P11H 4NKQB 3PJSA 4OCLC 5EWIH 4E41E 5KAQG 1T66C 1PKQE 4XWGL 5JQHC 3SHSA 2FBJL 2F54A 2R1XA 3TZVB 5IW6A 1EZVX 5JIKA 4U1GC 3S6CA 1CBVH 5D2NB 2Z93A 3FFDA 3T04D 4K7PX 3CPLA 3VFOB 4K94H 3ECBA 3U4BL 1T21A 2DAVA 1MJ7H 1AGCA 3DPBA 3JVGC 2CO7B 3K3QA 4LEOA 4P2QB 1BM3L 1KT2A 4MQTB 3PL6C 1OB1B 4L9LB 2EE6A 1RULH 3ULUE 2F19H 4XVSL 1A21A 4KK9D 3QUMA 3V4VL 3TA3B 1DP0A 4U33A 1NCDH 1MUJB 4Y7MA 4OUOA 4Z0BH 4MCYB 2WQRA 5EU7C 1OAYH 1ZA6A 4YDJA 3HFML 3ZHLA 1JF1A 1QRNE 1UH2A 2XACC 5F6IB 4TULL 3ARUA 5DQJA 1T2QH 1I3GL 5KVFL 5CINL 4IHOB 4CNIB 1WZKA 3FT2B 4R26H 2YS4A 5I16A 3IDNB 5CKGA 1R5WB 5A2JH 3C60B 4C56B 3OKOA 1CFSB 2J88L 4LCWE 1N26A 4YBLB 1BBDL 1WICA 3F5WB 1KEGL 3OKMA 3SE8H 5EC2A 7FABL 4FQJL 1Q9WB 2JCCB 4WU5A 3AXLB 2HN7A 4KTYA 2ZUSA 3U7AA 4RX4A 4KKBC 2UY7A 4WFEE 4GG8A 2HVKA 2DM3A 3C5ZC 5F9AC 5T3ZD 3KYNB 3DWTA 3BX7C 3CSBA 3CCHA 3RHWK 4WUUD 5C70A 1EHAA 1WAAF 1WC7A 5E99H 5MI0B 3ULUL 2CR3A 4PJAA 1H3PL 3B5HA 2Z4QB 5D7IB 1F58H 5C0BE 2LU3A 5JW5A 2Q8BH 2AABL 2YRLA 4XPHH 3O3AB 1E27A 2A6IB 2D31A 2BVTA 3BIBX 4EOWH 2BHYA 5TJWK 3MBXH 4L8CA 5SWSA 2NXZD 1UWEL 3P4NA 3DMMC 4I2XE 1YNKL 4Z6AT 1KOAA 4PP2B 1P1ZB 2R2BB 2Y07L 3SGDH 4WO4B 3U4EB 3L3HA 1M7IA 5FGBA 1NCBL 2R0KL 1MCJA 4TVPD 4AIZA 4XPGL 1I1AA 1NGPL 1RFDH 4AL8L 3OJVC 5E4EB 4ZUWB 1SJXA 3K81A 4HJ0C 4RAHA 1U92A 3RVXC 4FZEL 4N0FA 4XH2B 5LAXA 2E3VA 3QQNA 1NC4B 1JL8A 2R56L 1E4WL 2EXWD 2P8PB 3MRBB 2G9HB 4JG1L 4FABL 2FWOB 5JW4M 3VFGH 3T0ED 5BS0A 4WI8A 2BJMH 5EU6D 4ZAKD 5A16B 1U8NB 1PAMA 2OXGA 1RURH 5JO5A 3MRMA 3NCCB 2DQDH 1YN6B 2AEPH 2DTML 1RY7B 1DDHA 4YHNB 5MP6L 1MVUA 2MHAB 4GAYA 4MS8D 4HBQA 3T08A 3QHZL 32C2B 2BMKB 1OF2A 2NZ9D 5KSUA 4J3VA 3RWJB 1SY6L 2NQCA 1EEZA 3TH4T 5DD3L 1DBMH 4NN7B 1I1FB 1LO5A 4I0KA 3WFEH 3FO0L 1X7QA 3O4OB 3NAAH 4RAUA 3SCMA 5EN2A 4MAUL 3NOIA 2ATKB 1LHZA 3DI2B 3LHPL 5IWLA 3KXFD 2ITDA 5HDBF 4JPIA 4PRHB 5CJBA 4FQLH 4HQQL 2DQEH 4KI5E 3KPSD 4LLQB 1U8PA 1FNFA 1Y6NR 2JCCF 3SQBA 1RUMH 2DKUA 1BQLL 2EDJA 2V7NA 3TCLB 4QGYA 5GIRB 1UEYA 1FCCA 5DMGD 1U2CA 2YA2A 5IQ9B 3L7FA 1GC1C 4MSWB 4HG4J 1QA9A 1A6UH 5HI5D 5MENE 5KSAB 4NRXB 2W59A 2R2HA 2FX8H 3DXAD 1LEKA 3ULVF 2NY0D 1X6NA 3GSWA 3KDMA 5IOPB 4OZGB 5D7IF 3QHFL 3QQ3B 3I6GA 1YPZE 2Z92B 1YEGH 3CXHJ 3GI8H 3WE6A 5CJXC 1JMXA 1JNNL 1MI5A 1QLEL 5MEQA 3K2UL 4OD1L 3LQAC 4IRSD 3RIFF 1XH3A 3I75A 4P2OD 1WISA 4K2UH 4K7FB 1FYTD 1TZGL 2XG5A 4P2RD 4FQPA 4QHMA 4HWNA 5D72L 5F9OH 4LQ1A 4LP5A 2NYYD 4LCIH 5JOFA 4PRPE 1S7WA 5FYKH 1CE1H 1EO8L 2B4CH 2FEEL 3BAEL 4ZUSA 1S7SB 1UJ3A 3QNZA 1CTOA 3QIBC 3VFPB 1A3QA 4RQQA 4EI6B 1S7UB 3JTTB 5CD5C 5JXAL 1QR1B 2ICCA 5C6PB 3ESUF 3PWUB 3TLRA 2K7PA 2MQCA 1L7IH 5C0IA 3VD7A 5JXEA 1YJDL 1B6DA 1G9NL 3UYPA 3A0OA 3DETC 1EGJL 3QJFB 3D6GA 1AR1D 3RU8H 4FN0A 4JKWA 3T0VA 1E4XH 3OV6A 4YFLI 3LPFA 4LL9A 1Q0YH 3QCUL 3PV6A 3MOQA 2C5DC 3DYOA 1T6VN 2DLHA 3HG1E 5C09A 5BRZD 1QQDB 4WWKC 3C08L 3QDJE 3KLHC 4UUJA 5LGJA 2QV2A 4HLZG 3A6BH 1FFPA 5FM4A 3ARDC 4MNHA 4X6DF 5E1HB 1QZ1A 4J7RA 3MRDB 1WCBB 3OZ9H 2VQTA 3GSXB 4OZFA 5GGQH 5MERA 4CW1A 1FN4A 4EN3D 3IFOA 1NAML 1OCWH 5FK9B 2DLFL 3ZYJA 3DI3B 3WHE1 2QQNH 1N59A 2OZ4L 2ICEA 4KVCL 5BZWA 2ICES 5JPMB 4Z76B 5E9DA 1XF2A 3S35H 3P9LB 3MQIA 1WEJH 5CEYB 1CQYA 1YEFH 3P0GB 3QAZC 4NFCA 4G6MH 4PY8J 1MCNA 4LKXB 1BZ9B 4PS4L 3WKML 4OT1L 1LO2H 2YPLE 3E8UH 3QEQA 4K9EH 5SWZD 5T1LD 2HFGL 4Z0XB 4HWBH 3IFNL 3QZWG 2R0LH 4M9PA 4G8GA 4N0UA 1CXLA 3WFZA 4NQDE 1N7MH 4UV4H 3EFFA 1CD1B 3KWWB 5TQ0L 3VXMA 5CBAB 5C0RL 4AENA 3TO4B 4OZGF 3G6JA 1E6JH 3HE7D 5E5RB 5CJOL 2LV4A 5JIHA 5IP4A 5TE6L 3CD4A 1MFEL 1QRKA 2EDTA 3HS0A 4FQCH 1F2XK 4GUPB 1MCPL 4F7PB 2Z8SA 3CFDB 4NN6B 3BXNB 2V6HA 1DUYB 5E2UL 1ND0A 2OR7A 1RZ7L 2AXGB 3EJJX 2IAMC 3KLDA 3VWJC 4D9LH 5JW4R 3DVGB 4LOUD 4UNUA 1AJ7H 5ADPL 4NZUL 4RBPH 3KYMA 4QOKE 5HDLA 3ESVF 5K33A 4ZTOL 5F7FA 4IDJH 2A9ML 1CL7H 2EO1A 1KUMA 3WNMA 3BPCB 3BPOB 1XF5B 5EZLA 2X05A 1IEAA 2C3HA 3ZT7A 4JHAL 2D3VA 5JZ7D 3HAEH 3WEXB 2JJVA 5EA0L 1CFQA 5ACZA 4MD5A 3G5XA 4RRPA 1FIGH 1YN7A 4N9OB 5IBLD 1T20A 3VG0L 3HI6H 5DJYA 5I1JL 1NEUA 3W39A 5L7XH 1ZV5A 4U0QB 3INUH 4LSUL 5IHBA 1K85A 3TNMB 3CK0L 2HRPH 1JZ7A 2R2EB 5CJ5A 5CCKL 3HN3A 2XZCH 4EEEA 2PR4L 4I0CC 4YUEH 3O2VL 5CEXB 1S7VA 3AS2A 1QFWL 3L6FB 2V7HA 3GSRA 5D2LA 5E5UB 4PJHF 1MRFL 5C08E 4E0RB 3DGCR 4Y8DC 4PJFE 4YE4L 2VDOL 4DN3L 1QEWA 3UYOD 4WFGE 4RGND 5AWNH 1QVOB 1PYWA 3VWKD 4ALAL 4RGOH 4NGHH 2FIKB 5KOMC 2ZUWA 3S97C 4Z7WB 3QRGL 5K93A 3U7YH 2Q3ZA 4HIJB 4N0CD 4H1LH 4PLKD 4NO0B 4KK5D 4XVJH 4IJ3B 5FYKU 1QHPA 4WUKH 5ERWA 2A0LC 5ISZA 3W11C 3KPQB 3QUML 3D39D 3VGAB 4OF6A 2VWEE 2IQAA 1D9KA 3MRGB 5ACLA 3HAEB 4KUCD 1KJVB 4Y4KD 1TJHH 2EDQA 3VI3E 4ETQA 2ED7A 3VJ6A 4EDXA 1KCSH 1XIWA 3QO0A 2VITB 3I3EA 3UTSD 1SBSH 1BLNB 1JNHA 5CGMA 2OCFD 4GLRH 1QACA 3CLFL 1QSEA 5L2JB 1TCRB 2DM2A 1FC1A 3KYOB 1S3KL 5EOTB 4KAQL 1QSFB 1NAKH 5DURB 1P6FA 4R97B 3SKUD 1XGPA 1CU4L 3UTTB 5LBSH 4TPRH 1QFWI 5EBMA 3C5JB 1HQRA 4AQOA 4CVWA 4UOW0 5B3NA 1JCKA 2DJUA 1VGEL 3BOVA 5HJ3A 4X98A 4XNMA 4Q6IB 4L29A 2DDQH 1AFVH 1AD0A 4KPHL 1PGRB 2HH0L 4Y1AA 2R29H 5TDPA 2Y36L 3RDTD 1JYVA 4YC2C 4BH8B 2Y06H 4O2FA 3V52H 5IR1B 1JGUH 4K3EL 3STLA 1MEXH 3LKOB 2P8MA 4XVTH 4F9PA 3VXOA 4PV8A 2GTWA 1B0GB 3MO1A 2EYRA 5KVEH 5F8RC 1OW0A 3GRWH 4QTIH 3VMNA 2MFNA 3MLSH 3VXSB 4LAQH 2LAAA 3FHQA 3GMNB 4QRUB 1GIGH 2Y9RT 3U46A 1MIML 3BPLC 3GI9H 1NL0L 2ESVE 4XB7A 2WUCH 3BQUD 4P23C 3RWFB 3RVWC 1V5JA 4PGEB 4S2SB 4CADA 4OFYA 3BD3A 3BWUC 2ZPKH 5D7KD 3RJDA 2YPKB 1U8QA 3VH8B 2MNUA 1FV1A 1NQBA 3GHBH 2HG5B 4NUJB 3BN9D 1CGTA 4QXTA 1B3JA 1DZBA 2AI0L 3WFDH 5C6WH 1REIA 1HHGB 1H3XA 3WUWG 2BXYA 5CILL 1URLA 2BRQA 4WHCA 1T1ZB 4Y2DA 4Y19B 4JRYB 3D3VE 5DVNA 1O7VA 1FNSH 1NEZA 4Z7WF 2ZCLH 4ORGA 4LDLB 1Q9LA 3MNVA 3VD3A 1LVEA 1WZLA 4PBVC 1M71A 3MA7A 1NGYB 4RISH 1BECA 1ACYH 1C08A 4ONHB 1G7MB 4HH8A 3GM8A 4WW2F 3ZKXC 1T22B 4U7SA 3ARVA 5DVLA 3ET9F 5L6YL 5FKPA 5DJ8B 3MLYL 4JJ5A 5J9PA 3V79C 3ILPB 3PABA 3H9SA 5I71B 1BD2D 4Y5YC 4DAGL 4MJIE 2D7PA 1KCRL 4Y4FD 3CSYB 4JN2B 5CJQL 4NO5A 3L3GA 2OJZH 2CPCA 3U2SA 1F3RB 4PRNA 5JA8B 1PLGH 4OI9A 3HKFA 2Z9TA 3MLVH 4F7MB 5D1ZA 4OZIA 3RA7H 3VFSA 4I1NB 3MCKA 1KLUB 1JF5A 4Y16A 4PGCA 1U8HA 4L3AA 3OKDB 3SJVE 5INCB 5TDNB 1FRGH 2HFEB 2EIBA 2FGZA 3B8YA 4JQVA 5E4IA 2ERJB 4M3KB 2EIZB 4YR6A 4JE4B 3WHXA 4QRPB 3V5HB 1A2YB 2DRUA 5GGUA 3B2VH 4MAYB 3S34H 3MA9L 4ODVH 4PJIB 1KACB 4F58L 3TYFA 1O7SA 4U6VL 1YMMB 4ODSL 2FJGA 4GS7B 3NZ8A 4RFNC 2X4QB 5EORL 4L4VE 2C26A 1ZEAH 3DROA 4JPVL 4YEFA 4V1DE 3EO1A 5MP6H 2WIIA 4NPYB 5IT2H 3OMZA 3QHTC 4MNQE 1RHFA 3ZHDA 5D5MB 2AJXH 3ZHKA 4PFEA 5KTEL 3ZT6A 1HKLL 3H9HB 1CFVH 3MGTA 3Q1SL 1VHPA 2ILLA 3H0TB 3IJHB 5E9DE 5EBLA 1NCTA 5IHUH 3DSFH 4MQSB 2YKLH 2IFGA 3DBXB 4PY7B 5DHVH 5A2LH 1U93A 1YEJH 5F1SA 2V2TA 1DEEB 3QUKA 4N0YH 2E6QA 4MGXA 4N1HB 3O4LA 3CFBA 4JZJA 4A6YH 3OHXA 4G8GE 5D6DA 5T3ZH 3K4ZA 1ZVSB 4WEBL 4FS0A 5HHOD 4XBGA 3MLWH 3PHOB 1D3CA 2D4DA 2VZUA 5JPNA 1EH9A 5E7BA 4GFTB 1N8ZB 3ULUC 2FECL 3QQ9C 1AC6A 5L0QB 5FOBA 2B20A 1B0WA 4Y4HD 3P9WB 4M43L 4IIQC 2BCKB 4G9FD 3CH1B 2VDRH 3V6FB 1VESA 4Q0XH 2DQGH 2IPTL 1A9EA 1OGAA 3L5HA 1PG7L 2AQ2A 4PTTB 4TUKL 3G5YA 2CIIB 3QCVH 4YWGL 3QXVA 4J2XA 2V17H 5HY9B 3IF1B 2XWJB 2YD1A 2VLRD 1ZWIB 2J8OA 5I19H 3BPNC 2DF3A 4JHWH 3TBWB 4WWID 3SGEH 4I77H 3D0VA 3N85L 3DHJA 2BNUA 3PIQB 3TBSB 1XF3A 1A6WL 2QSVA 3MV9A 2YXFA 35C8H 4U1IB 1DN2A 1DTUA 5DEGB 3MV8B 4GW5B 2D9CA 3V6OE 1U3ZA 2Z8VC 5I2IB 3FMGH 5GRYA 2SEBB 1TCMA 2HJLB 4Z5RA 3QFJB 4AMKL 3L3DB 1CVRA 4EJ1C 3QUXD 5DHVB 3BE1H 4P9HL 3CDCA 3IETB 1CVSC 1NC2A 1RJLB 4HUNB 3VXNA 3UPCA 5M94B 5IJKA 4BH7B 3MJ9A 5DD0L 2I9TB 3QEUB 1MAML 4IEFB 4J3WA 3RY6C 5FDWB 3BEWA 4A6YB 1PG7W 3HCVA 1EJOL 4K7PL 2V5YA 1G6RA 5DQDH 1ERNA 3DX6B 3MYJB 4WI9A 1DE4B 2QKIB 3MJ8A 3HNTH 3T65A 4XC1L 5DEFB 4ETYA 4WUUB 5B39A 1CGSH 5DK2A 2Z31D 4X4XB 4XXCC 5GS1C 5C2BL 3Q5YA 4UIKL 5ENWA 2RQ8A 4HHAB 5D2LE 2VH5L 3D85D 2BNRD 5EC1B 3UJJH 3H3KA 3L3IB 5F7NC 3HE6C 4PJEA 1HHIB 1ZLVK 5HHXL 2AP2A 3DV6B 3V7AE 3MNWA 2VZTA 2V9RA 4LSDA 1CFNB 1RVFL 4JFEE 5D5MF 3SKOA 4H26B 2NY4D 5FYJE 4RSVA 3W0WD 2X4PA 4UDTB 3PG2A 1DEDA 3Q48A 3SKJL 2DQFA 2N4IA 4NYLB 3RWGA 1Z5LB 4GXVH 2BY1A 1I3UA 3MRFA 4YGVA 3TVMD 1QLRB 2ORBL 2EDRA 1HHJB 2O61B 1AP2A 4ZPVB 2NW3B 3WUZA 2Y72A 4ZDHB 2W91A 4JRXB 5J6HB 1IC1A 4PUBL 2CDGB 5ITBH 1A7PL 4LRNL 1IAIL 2V5MA 3WSQL 4LFHG 5GGTH 2VDQH 2HJKB 3FQXA 3DMMB 4R90L 4CAGA 2X9YA 3M8OL 1U8KB 2Z91B 2ENYA 3P4OB 5EU6B 4WI3A 3JV6A 2YEZB 3VI4E 5EUOF 4R4NC 4R8WH 1TLKA 5I1DB 3ZKMD 2D4FA 4UILL 3JWOC 4LFHD 4HS8H 1F6LL 2DQJH 5HHVH 1BQUA 5T3XD 3WFCL 5E8DL 3SO3C 1AI1L 4XMKL 4XWOD 1XGQB 2HYMA 3T3MF 3BW9B 1BPVA 4F15C 1CLCA 3RBSA 1TZIB 3DUSA 5FYJL 4O51A 3EYVB 1WTLA 3PWJB 1Z2KA 3OB8A 1OAUL 3BDYL 1TQBB 1CGWA 4R4BB 4YNYA 2AJVL 4LHQB 3HNSH 4PJXA 4G8FA 1EFXA 1MHEB 4Y1AE 4KVNL 2MCG1 4YPJA 3MOAH 4KI5C 1YDPB 5EIIB 5IJVA 2B7DT 5IMMA 1JHLL 2XICA 4KKLC 4PJBB 3VXQB 1N3NB 2Y6SC 1Q72H 1YJDC 3QB7C 4PJ7A 1JGEA 1SJHB 3ILQC 3BKCL 5IFHH 5KSBE 4YXKH 5CD3A 3JTSA 3KNBA 5HYJA 4IS6A 2A6JA 1KIPA 3FO2A 1A7NL 1TPXB 5DR5L 4FNLH 3BRDA 4NQCE 3BZ4A 1NBVH 1BWWA 1PZ5B 5ELIA 4K3JL 5CEZD 5HSFA 1Q1JH 3EKCA 3QXTA 3RIAF 5EO9A 1SEQH 4L8SB 3RUGA 3LPWA 5GS3A 4OKDA 4G6JL 2Q6WB 1EZVY 2IANA 4YO0B 4HIEB 2NMSA 4K7PY 4LHUG 3SQOL 1QP1A 4JM2A 2PTTB 3S88L 3TESA 4ZUVA 3TN0A 4IRSB 4O9HH 2GK0B 4KHXL 2YN5A 5L2KD 4P2OB 1E4KC 4L3EA 1VDGA 3RNQB 7CGTA 2CIKB 4YHOL 5DT1H 4Z77A 4B5EA 1I8KA 1D5IL 3U9UA 1A5FL 3F7QA 5GSVA 2W60A 3UTPD 4G5ZH 4X7SH 1T6WA 3RWEB 2BVOA 2J7LA 1PVHA 5LXGL 1EJ6A 4Z78B 4GOSA 3GHEH 4LU5L 1AXSA 1PY4A 3ARWA 1RIUL 5IEHA 3TT3L 4UV7L 1PZUB 1EUUA 3WDJA 3NFSL 3PQYA 3CFCH 3DX9B 4AH2B 2UZIH 4K55A 3I6KA 2H8PB 3NCEB 1A7OL 1I7UA 3MRNA 1HI6A 4QWWC 4MQXC 5EU4A 3MOBH 4XI5D 4DGYH 2X89D 2FATH 4NJAH 4Z7VB 1EHLL 2K1MA 3RVTD 2A9NH 4JY5H 3VG9C 5F70A 4PREB 1FGVL 4UU9B 1UA6H 1R24A 3HNVH 4WGWB 5KVDH 1KELL 1QHOA 5SX4I 1H0DB 4UQ3B 5DHXB 2J4WH 1AGDB 4OCXH 1ZT1B 3O6MH 1A7QH 1JGVH 4EN3B 2P5WE 1NGQL 3M1BA 4ZPTB 4GAGL 3NACH 1FJ1A 3SE9L 2QSCH 3QNXA 2PO6D 2CLVB 3X11A 3UCRA 4R4FH 3SDAC 2CDEB 5BVJB 5JUEH 2I5YH 3MJ7A 1TJGH 4CJ1A 2NY3C 4GKSA 1OY3B 2HT2C 3RY4A 2Q1EA 1OGTA 2ADGB 1ZA3A 3EJZD 4PJBF 1KBGL 2UWEE 2FO4B 3MLTA 5EFIB 5FA4B 3QDGA 4XPTH 3I9GL 1ZANH 1YC8A 4KKNA 3VE0B 1I85C 1F8TH 4KV5E 4X9FA 1T5XA 1DSFH 1MRCL 2HMIC 2EE3A 5IMOB 4MLSA 3PWPB 2A6KA 5J4MA 2WBWB 4XPAH 1IKNC 1L0YA 3EYUL 3IDXH 5IW3A 1TVHA 1W8NA 3D2UA 3G6AB 4P5KA 4G42A 3WIHA 5C0ND 5BW7A 1NDMA 5KS9B 1LO0H 2DD8L 4XBEH 2KUTA 5T33H 1J18A 4XZUA 2X1WL 2VXVL 3QAZB 4GRLD 4MQ7B 3V4PL 5K9JH 1F5WA 1RZGB 3PHQA 2VO5A 1T0MB 2F5BH 1J12A 1HINL 4P3WA 3N9GL 3QNYB 2HTLD 1IC5L 1TFHA 4UT6L 5I1AB 3T0AA 4HKXB 4BA8A 4ONGH 4OLWH 4N8VA 4E42A 4C57C 1FFOA 1N6UA 3D48R 4FXLA 4JFOA 2DQTH 3DVFA 1F4XH 2WWMD 1ORSB 4Z7QF 5DMKA 4J3UA 1EUTA 1J87A 5CBEA 4Z7NF 3ZE2E 2OK0H 4FQ2L 3E1F1 2F54D 3CZJA 3RGVD 2XZAH 4EBQL 4Y2OA 3RWCA 4R7DA 2PW2A 1XCTA 1A14H 1ETZA 3G5ZB 2IPUG 2GSGB 4Z7VF 2BDNL 4U1LB 1OSPL 2C1OA 2ZWLT 2YD2A 3HR5B 4OCWH 1LE9B 5E8EB 4MJ6B 4GW4B 3UAJC 5A3IC 1JPTH 4KFZC 3JSSA 3GSNL 3MJGX 4LSQH 4QCIA 1CR9L 2GTZB 2NY5L 5DJCB 5J3HC 4HULB 5J06A 3VGDA 2GITA 4X6EA 1CI5A 4X7FC 5GJTL 2NTFB 5DC0A 4DKFH 4F8QA 4YXHH 3GSVB 3JXAA 3FB6B 1G7IA 1M7DB 3L5XL 1TMCB 4TUOB 4PJCE 2DIBA 2CGRH 2FL5B 3P30L 3VRLF 4M5ZH 2F8OA 1DBKH 4G8IA 4O58L 3VWKB 1VEPA 1A1OA 1JPGB 3O9WD 3HI1A 5E00B 1MPAH 1FE8L 5DD1L 1QBLL 1LK2B 1VFAB 4LGPB 2G60L 3U6RA 2JK5B 1GPOH 2VWEC 4L4JA 1NLDL 1S5IL 1CLOH 3WV0A 2C4FU 4TYUA 1FFQA 3LS5H 1WGOA 3MCLL 3ZZ1A 2Q76A 4ZFZB 5E94B 4RX4D 2ZZUT 4RIRA 3RTQC 5GS0L 5K9QI 3B9KA 2H9GB 3GGWA 3QIWA 4OCYL 1P4LB 3SDXB 3SY0A 3CX5K 3VFRA 2ZJSL 5FGBC 2BNQD 4NQSA 4NOBA 5KS9F 2VDKH 3TJHC 3L95A 4AEIL 1FG9C 3RZCA 2K9UA 4YAQA 4XPBH 1HQ4B 2Y7QA 3QQ4B 5TF0A 3KPRA 5C8JA 3EZ8A 1JPFA 1C1EH 1QYGL 1MCOL 4GRMA 1EEQA 5IVZA 4LCCA 5D2NE 1U0QA 4NQVA 5SWSD 2FJFB 3MRPA 3DARA 4O5LH 1IFHL 3TIEB 2DIAA 1BQHB 3L3JB 3MJ9L 3QUYD 5J13C 3V6ZB 1A6VH 1UVQB 3W82A 1MCKA 2EDDA 1ZXQA 4P2QE 5DJDA 5C6TH 3KYKL 3NIFE 2OQJB 1CICA 2VL5A 5HYSB 1UXWA 4MLIA 1GGCL 4DVBB 3AM8C 2NY1C 1KIQA 4QY8B 5K59E 1P53A 1BP3B 4EUPG 2YUVA 2W65A 4F7EB 2CLRB 2Y5EA 3KR3H 3CFKA 4Y5XA 4JDZB 4ZUTB 4CN4A 2VXUH 2X40A 3EHBD 1FG2A 4NNXA 4IRZH 1HZHL 2CMRL 5BO1H 1FZOA 3RNKB 3G6DL 5BS0D 5ITFA 2ZUXA 2WIMA 1HSAB 3IDUA 4JDTL 3NVQA 2XTJE 5FYLL 4B7IA 2B0SH 1S7TA 2FSEB 2APFA 4GO6B 3IU4H 5CSZA 5AYQA 5EPMB 2B5IB 2XZQH 2RHEA 4BELD 5H94B 5C3TA 3HC3L 3TFKC 5I8EB 3EOTH 4X8JA 5FO8B 4TTDC 4XP4L 1K3IA 3RKDC 1U8JB 2JCCE 3SE3C 2DLTA 1W0WA 5MEPA 3DURB 3VMPA 4ORZC 4JFXA 1ITCA 3MXVL 1F3JA 3MROB 4PJ7E 4WCYH 2VNCA 3WJLA 5B38A 1K3ZA 3CZFB 2VLKD 1Q0XL 1ZLUH 3BPLB 4J23A 1GGBH 3BKJH 3RKPA 4LLVB 4WV1A 4UINH 1CT8B 1MWAB 4GKNA 4HWZA 3PGFH 3BMWA 2E8YA 4FQXC 5D1QA 3U83A 2C4XA 3BDXA 4KRPD 1S7QB 1MFBH 4Q7DA 3QIUC 1ES0A 1FHGA 4OFVA 5CZXC 1MHPL 1Z6JT 4XWGH 1T7ZA 1VSCA 1PFCA 1EMTL 1ZHLB 3DX7A 4HWEH 3MACL 4XMLH 3AVEA 5E8NB 1YNTA 2FCBA 1YMHA 4JKKA 4H0GA 4QTHA 5EO0B 3EYSL 3SDXF 3BT2H 3GM0A 5ESQA 3PWLB 5HHMD 4FQ1H 4M00A 2OSLB 5DYOB 3LRSA 4RMWA 4ELMB 2XKNB 2VC2L 4JQXC 5D93C 5E8PB 1GOGA 4MA8L 1XGTA 4FTVA 1T03H 1XEDA 3P11L 4XVSH 3V6BR 5EWIL 1AQDA 3V4VH 5CD5D 3Q6GL 3B2UD 4GRWH 1MI5D 4P5TC 3BZDA 2OJEA 2VTFA 3FFCD 4XP1L 4ODUA 3ZKXB 3QEGH 1BIHA 5HPMB 1CBVL 3BFOA 3DETD 4K94L 4Z7OF 1ZHKB 2JB5H 1OAKH 2Z8RA 3IVKA 4N90D 1HYSC 1L0QA 1MJ7L 4TULH 3C6LA 1T04A 2JIXA 4LSVL 4I9WE 1I3GH 1G7HB 4M1DH 5CINH 1U8OB 3GMRB 3RPKA 1LO4L 1RULL 1D5XB 4GMSL 3VFWA 2J88H 2DYPB 2F19L 4OB5H 4BZYA 2IEPA 3ARDD 2FX9L 4EXPX 5JXED 1BBDH 2HJFB 1KEGH 4R2GC 1NCDL 1R0AH 2J5LB 4OFPA 1K8IB 2XOTA 3OAZH 4WDIB 2DBLL 3K1KC 3TPUA 2WZPD 5I1IH 1XCQA 1OAYL 3QDMB 4M1CC 2DQIL 2IH1A 1LEGB 5CMAB 1N5AA 3NMEA 5A2FA 5SWQA 1CZ8L 1T2QL 3FB5B 3QFDB 4U1JB 5C09D 3VFMA 1OSZB 1VPOL 2X41A 2L0DA 3VFUB 4PRHE 3UJIH 3LD8B 4P3CH 1AO7A 3DRQB 4YHLL 4LLAA 1C5CH 1U8LB 3SE8L 2AKRA 4NKDA 3QH3B 4POYA 4F8TA 1AHWA 4GRWB 5DGRA 4Y5VC 2NX5D 1C5DB 2GW5A 4P9HC 1R3IL 2CK2A 2X7LB 3OPZH 4X6FA 2XRAL 1GGTA 3K74B 1C7TA 3VFNA 3QWOB 5I76A 4U2ZA 1KCVH 5E99L 1KCUH 1G7PB 4QHKI 2FHBA 1HHHB 4PJ8C 2A73A 5TDOB 1NFDF 1F58L 1OP5K 5D7JA 5F72S 1MLCB 2CLZB 1OTUC 4FZEH 1W0VA 4XPHL 5F7EH 1G1YA 1PKQB 3DECA 3QPXH 4J4PC 5L8KB 3GZKA 4OF3A 3LB6D 1HH9B 3C6SA 1TVBA 4Y4HB 3RWDA 3FB8A 1D5ZB 4YHPB 4CMMA 3GDBA 4FABH 2IAMD 4KJWC 3VWJD 1DQLL 2VLJA 4P46C 1NBZB 3CFEB 3Q5TA 5ANMA 1UXSA 3VXMD 1LDPH 4P3DA 5DF0A 4ELMF 3WS6A 1RK0A 1MHHB 5E7FA 3RWIB 3QXDB 4PGBB 5GGSA 2DTMH 1RFDL 4F57H 4NQEA 1KEML 1A3LL 3V6OC 3IDIB 4I3RL 3FZUC 2H26A 3CDYA 2QQKL 1X4XA 1XGYH 5I1LA 3FCTA 1H8SA 4JN1H 1YQVL 2W0LA 4WNQB 3TNNB 5IF0B 1KN2L 3FO0H 3QUXB 4HIHB 2XPGB 1M4KA 2BVQA 4MAUH 4DUWA 2DQDL 4X4YB 3ALPA 1FH5L 3RVUC 1UGNA 3WKNA 5FGCB 4PG9B 1QFWM 1NGZB 3RWHA 5C0AD 4KUZH 5ICZA 5IVXF 1YQ2A 5FIEA 1S9YA 1BQLH 4ZS6D 1AGEB 3FOLA 1VADB 2XNAA 5B4MC 3WFEL 1E28A 4WENB 4NNPL 3PNWB 4XHQA 2DTSA 3NAAL 1DQDL 2X9XA 3L5WA 4X8XA 1G7JB 2EDKA 1VACA 1N6QL 1A1NB 3QHFH 3S3SA 3GJEB 5E6ID 2AVGA 5H35B 1FFNA 2C7UB 2HA1A 4QT5B 1AGBB 2Y5TB 5FYKE 3TIDB 3U0PA 1T83C 3UROR 1XGRB 3I84A 5C0BB 1YA5A 5ID1A 2DQEL 5IVNA 1JNNH 2W0KA 3JV5A 1QLEH 2EXYD 1WBYB 4JG0H 4OD1H 1CFTA 3G5VA 3TVMB 4QRRA 5F6HI 1LP9A 4U6XA 3TT1H 1DQQB 2H32H 3B9DA 4I2XB 2P8LA 4Q9RH 5ICXA 5D72H 2VUOA 4K07A 1KENH 3RI5K 1J1PH 2FX8L 2NZIA 2AJYH 3BAEH 3BH8A 5CEZH 5ISZD 1HILB 3O3DB 1A3RH 1A7BA 3ZMRA 5LQBH 3CFJB 1K4DA 5IEKA 5JXAH 1YEGL 1BFTA 3GI8L 5F96H 3N1PC 4Z7UE 4DZ8B 3HZYB 3WFBH 2QJDA 1P9MA 1U3HD 3H2WA 1D9KD 1GH7A 4X6CA 1ZT4A 1AIFB 2MJWA 1WUNT 1G9NH 4WW1A 3C5SA 3LQMA 4M4PA 5DJAB 3TF7C 1A64A 2N7BA 1XIWD 1T4KA 4U1SA 3EYQC 1IC4H 3U36B 3S5LA 5F9OL 3JV4A 5EB9A 2D7TL 3ROLB 4LCIL 4QHLB 2B4CL 4U0RB 3VFVB 1QSED 3C08H 1HOCA 1ZLVH 4DZBB 2WUBL 3ULUF 2QHRH 3BJLA 4YK4C 5F3HB 1DN0A 3ZL4L 1P84K 3SGKC 1NJ9A 1OW0C 1RZIB 3UTZA 4MDJA 4F37F 3SO3B 1IVLA 1NAMH 1OM3L 3RU8L 3QPQD 2IMNA 1EBPA 2NW2A 4F15B 3FQTB 3KAAA 4AYFA 1Q0YL 1UG9A 4HUUA 2H32B 4P4RB 2GJ6A 5T5FH 5F44A 3QI9B 5TFSH 4OUUA 2X4TB 2J1KA 4RDQF 1H15A 4WU7A 5D6CA 3V5KA 3FT4A 4CRPA 4EVNA 3A6BL 3PWVA 2E7LC 1Y0LA 5L9DH 4D9QE 4IRJD 1DBAH 4OT1H 3WKMH 1KB9K 4KROD 4GAJH 4URTB 3OZ9L 5GRXG 4LVHC 5I1EL 5C0FA 2HFGH 3RL2B 3IFNH 1NMAH 3X12A 4HGWA 3NCYP 2ADFH 1S7XB 3O45B 4Y2DC 2P48B 1A9BB 1B2WL 4NP4H 3RPIA 4NO2A 3AU1A 2OS7A 4JFFD 4WI5A 4C83A 3WLWD 4U6HA 5J7CC 1IC7L 4P4KC 1TTGA 5MENB 4KGJA 3RX7A 3R06A 4PJGA 4OFYD 5L2KB 3KPLA 4BSVA 5CJOH 3S35L 1MNUH 1WEJL 1CS6A 1JWSB 5TE6H 4BUHA 1F4WL 5KJRL 4PJ9A 3ZDYE 1MOEA 3RL1B 3OXSB 1AKJA 1MCPH 5ICYA 1XR9A 2QADB 2XQYK 3WO4B 1JGLL 1DLHB 5E2UH 3E8UL 1S5HB 4HWBL 5F88B 1JTTA 4NZTL 3ARBB 4AJ0A 2VXTL 1SM3L 4Z18A 3QXAB 5EBWA 3T0EA 1AY1H 3NPZB 5D1XC 4NZUH 2PTVA 1NAMB 2XTLA 1ORQA 5FECB 4HX1A 2AV1A 3E6FB 2CRIA 4R9HA 2ZUUA 1JHKL 1QSFE 1IAKB 2GJZB 4JHAH 5DJ6B 3HHRB 5D1ZC 1WT5C 1KIRA 4PD4K 4FQCL 4JFYA 1ITBB 3NGBC 2R1WA 4P5MB 3NH7H 4JPKL 2VE6A 3QA3A 4JEGB 4PR5B 2ADIB 3VGFA 5IIEA 3H9SD 4D9LL 4PJ5A 4XCNB 1VKXB 3NA9H 3CK0H 1KGCD 4KK8C 1F11A 5DRZB 5HD8D 3P40A 4P49A 4OLVH 4JANA 5CWSA 3GMLA 4IDJL 2KQMA 1B88A 5I66B 1QFWH 1Z0NA 4M6ML 3RGHA 3T2PA 1OTSD 4JZOA 3EGSB 3LQZA 4UI2A 4BFIB 1ED3B 5B3JF 1MRFH 3MUY1 3KPSA 3TBTA 1M05A 5HHQA 3GMPA 4XMPL 3C09C 2A74B 1FIGL 4Y16D 4YE4H 3VXSE 4DN3H 3VG9B 2YBRA 4HGMA 5F1NB 4ALAH 5F1OB 1X5FA 5L7XL 1KC5H 4FQHB 3INUL 4UBDC 5DQ9A 3ZYZA 1MJJA 2PXYA 3FQRA 4I18A 5BJTB 4XHJC 5BV7H 3OJMB 1G7QB 1QNZH 2XZCL 4FFWD 5K9QG 1U36A 3DXAA 5E6YA 4YUEL 2V5TA 3S96B 2DWDA 1JN6B 5KBNC 4E41D 3S36H 4KI5F 1RUQH 2NY3B 3MRIB 3MFFB 1JK8A 1U95B 2NY5C 5F1KC 1OLZA 2Q7YA 2YPLB 1RK1B 2WV3A 4GRLB 1YY9D 2E7CA 1WIOA 4JRYE 4RGOL 4NGHL 5D6DC 4NBYB 4YX2L 3GSOA 5GISH 1KIUA 5GXBB 4OV5A 4Q6YA 4APQA 1S9WB 3BMVA 5TH2A 1JP5A 1SJEA 4JY4A 3FB7A 3LN5A 3MFGB 3T0BA 4WUKL 1YPZF 1S3KH 2Q86B 5K9KA 3FQWB 4KAQH 3F7YB 5T1KD 1NFKA 3HLAA 3AS3A 5AUMB 1VFBB 3BZFA 3PHSA 3PJSB 1DBJH 3O4LD 5F8QC 1JZ4A 1G0DA 2F54B 2R1XB 4RDQG 3AAZA 5C0CD 8FABB 5IW6B 3MRJA 3BHBA 1QRND 3ORJA 5GS0C 5IQ7H 1KCSL 2Z93B 3FFDB 5TGBA 3CPLB 1DR9A 3ECBB 2VLJE 1QFHA 4KPHH 3W9DA 3CFIC 1AGCB 1WAAA 3VCLA 1QBMH 4IMKA 3PV7A 4LEOB 4LCWD 1KT2B 3JUZA 4ESKA 4K3EH 4KJPD 4W4NA 1N0XH 5IMKB 3IGAA 2C1PA 4NQEE 4HSQA 1PDKA 3QUMB 5LBSL 1OGAD 4TPRL 5F3BB 4WFED 2YA0A 5AZ2H 1MFCH 4QRQA 5F89A 1NL0H 1BREA 1ZA6B 2CJUL 4YDJB 4G6AC 5HBBA 2MMXA 3GMMA 2ARWA 2GY7B 3HPJB 5FO9A 5DQJB 2KZWA 4PJIE 2APXA 3V52L 1JGUL 3NCYS 1YYLL 3MV9D 4ZXBA 4XVTL 2M26A 3E0GA 3SDDC 1H8OA 3FTGA 3OKOB 4H8WH 3WIFA 4YDVA 5HYIA 5KVEL 3GRWL 5SWZA 3QUZC 5T1LA 3X3GH 4LAQL 4CMHB 3HE6D 5CILH 3OKMB 1UH3A 1FNHA 1GIGL 1TETH 5EC2B 3TYGH 4WU5B 2JJWA 4LKCA 5DTFA 3GI9L 1LDSA 3U7WH 4GG8B 1UJTA 3QZWA 3GJFA 3QJHB 4KMQA 1WC7B 2E9IA 4KJQD 1T89A 3VXUA 3KPMA 3GHBL 1AC0A 1IGMH 4G7YL 2H3NA 4NT6B 4M7JH 2JB6A 5JW5B 3NPSC 4MCYA 5TF1H 1E27B 1UT9A 2D31B 2R4RH 4FQQA 4DAGH 4ZD3L 1LP9E 1KCRH 2DM7A 5SWSB 3P4NB 1IAIM 2ZCLL 1CDIA 4KDTA 2R0ZH 4X5XA 5JHDD 4L9LC 4WHYG 3FT2A 3MRHA 5DVOA 5FYLD 4G43B 4XVUD 1JUFA 2I60L 2DOCA 3K1DA 2J12B 1CFSA 3L3HB 4RISL 4G3YL 2XFXA 2ATPA 5C0DA 2YUXA 1I1AB 3LDBC 1ZHNA 3GIVB 4UDUA 3BEVA 1UQSA 1U92B 4CVZA 4CN6A 4N0FB 3I85A 5LAXB 2QSTA 4X6CE 3T3ME 1DVFA 3P77A 5F6IC 2LQRA 4F3FA 2NPLX 4KRMB 3EFDH 3EO9H 2FGWL 3EDEA 2IJ0C 1NBQA 3OJ2C 2XTJC 5IMLA 2OJZL 5BS0B 4MZ3A 4JGMA 3DJ9A 4L3CA 2MCPH 4N8CH 5D7IA 5JO5B 3MRMB 4S0SD 4YBLC 5K9OB 2WM0A 4GXUN 2NY1B 4F58H 5EU5A 5FUZL 4J6RL 2A6IA 1Z3GL 4U6VH 4ODSH 1OAQL 4S1DC 2VOTA 1MVUB 4GAYB 2Y6SD 2GSIA 3U0TA 3KLAB 1OF2B 3LRHA 5KG9A 5KSUB 1MREH 3WL9A 4K94C 1I7ZA 1EEZB 3U4EA 5KANI 3L1OL 2ESVB 4RFOH 1LO5B 5T3ZE 1HH6A 1X3DA 3CX5J 2XN9A 1X7QB 2VABA 3B2VL 4RAUB 4WUUE 3SCMB 1MQKL 5EN2B 5KTEH 4ODVL 3AREA 3CXDH 3D39A 3TP4A 3VD9A 1QFOA 2J6EH 4KRPB 1CXIA 4PJFF 1JI2A 4Y4KA 1GGYA 1U8PB 3AFLA 1ZEAL 2FWOA 3NCJL 1EVTC 4GKZA 2ZSWA 4WO4C 5HYJD 2EDEA 2V7NB 1H9VA 3OAUH 2W9DH 4MZ2A 4WEBH 1U8NA 1U58B 3UTSA 4PB9H 3L7FB 3WNLA 4PRPD 5E4EC 1QA9B 1BVKA 4OD3L 1FL3A 2R2HB 1LEKB 4GW1A 3GBLA 3GSWB 3KDMB 4X6DA 1WFTA 4M43H 4H20H 3I6GB 3QIUB 1WCQA 5DUBA 2IAND 1S9XA 4JREC 3WE6B 4FXKA 4GBXA 4N0YL 1PG7H 3VI3F 5MEQB 4JM2D 3EOBA 4DEPB 5GGSY 4A6YL 3NABH 4TUKH 3TN0D 1XH3B 3F6LA 5T3ZL 2PCPA 3I75B 1MJ8H 4L3ED 4BQBA 3T0EE 1FZJA 2L4OA 2A6DA 2F5AH 4QHMB 3MLWL 5EU6E 2BY0A 3IXTA 3FKUS 4AG4H 1JRHI 2DN7A 2XQBH 5JOFB 3BUTA 1S7WB 4LLQA 4U1MB 4ZUSB 1UJ3B 3QNZB 3DOSA 1BX2A 2ZCHH 4RQQB 2VDRL 1I7TA 3V2AR 3BGAA 1S78D 4NN7C 4Q0XL 2DQGL 4P5TB 3TCLA 1CQKA 4MXWH 1TTFA 5HHPA 4FMKA 5HI3C 2V17L 3BQUA 2C9AA 4OZGA 4E9LA 5I19L 4TVPL 2BVPA 4XCYA 4NKOA 4I77L 1ZVHA 3PV6B 4KMTL 5C09B 5C2BH 1ACZA 3KXFE 35C8L 4W4OC 4S1RH 4UIKH 5LGJB 2VH5H 4LPXA 1FFPB 3FMGL 4K3GA 4MNHB 1VGKA 1MELA 2WINA 3WJJA 1ZMYA 4L4VB 4U6YA 3BE1L 4NQDD 2A2QT 4K7FA 3NA4A 4OZFB 1J10A 4PTUA 5KSAC 5MERB 4CW1B 4GQ9H 3IFOB 4HIXL 4JB9L 5BOZG 3WUWA 4QHUA 4QGTA 1FP5A 2ICEB 3SKJH 3DXAE 1OTTC 5BZWB 1CGSL 3WNNA 3PWUA 5E9DB 1XF2B 1QOKA 3R1GH 3QDGD 2VKWA 2ORBH 1EAJA 1KTDA 4M3JA 4J1UA 3SDCD 3QEQB 4PUBH 1BD2A 1NLBH 3O0RL 4Y5VB 1RZJH 1IAIH 4Y4FA 3WCYA 3WSQH 4G8GB 4QOKD 1FYTE 3F7VA 4NKIL 3M8OH 4P2RE 4R90H 4WY7L 3RFZC 5J1SC 1UB5A 4WI4A 1NBYA 3VXMB 2CUHA 4D94A 5DUMH 4ZO9A 4PP1D 1FGNL 1NMCC 5BXFA 4DW2H 4PJ8B 3BKMH 2JJUA 4PJHA 4Z7QE 4KI1A 2J8UA 2V9QA 1AI1H 4MVBC 4OF5A 5I1HH 3CH8A 1BMGA 4N8VG 1AQKL 3OX8A 2AEWA 3LN4A 2DM4A 1J5OL 4EDWH 2P4AB 5DK3A 1ADQH 1ND0B 3WYRA 5GGTL 2VDQL 2B1AL 2ZUYA 5JPMA 1CK0L 3IAPA 2AJVH 2WWKO 3KYMB 1IL1A 4JPWL 4JFDD 2YWZA 2YUZA 4LEXL 4KVNH 5HGBA 3QEHB 5BRZE 1ZT7A 2PYEA 1BZ9A 3Q5OA 4HS8L 5GRVK 4XCEB 5EZLB 1IEAB 4NM4L 4Z0XA 3IFLH 3V0WL 2O26U 2IBGA 1CFQB 4WFGD 5ACZB 5F71A 3N1MC 3G5XB 1V3LA 4OCSH 1YN7B 1T20B 4NKMA 3IDMA 3WNKA 5DJYB 1OP5H 4CVUA 2LU7A 5INDA 2QR0A 4LLYA 5I17B 1A7NH 2DQCL 5DR5H 1CXKA 4M8VA 4EI5A 1NCNA 3OR7A 4D9RD 1LEIA 3HNSL 3D9AH 3FRUA 1HSBA 4K3JH 3LKSA 2B4CC 3LVEA 3MOAL 5SX4H 3VFTA 2VDNH 3BXNA 4OM0L 1DUYA 4P9ML 1S7VB 3T1FA 3OXRA 3TBVA 4AT6A 3WLBA 2V7HB 3GSRB 3T77B 5D2LB 1Q72L 2YZ1A 3SQOH 2HT4D 5SWZE 1SBBA 3JZ7A 4HF5H 4YXKL 3S88H 1QEWB 2QLVB 2WBJD 1PYWB 4KHXH 3QIWC 3T2NH 3D1MC 1J05A 3I3DA 1CCZA 4FNLL 5HHOA 1NBVL 1PBYA 1X5AA 5DJZA 1OD9A 1CDBA 1S7RB 3TJHD 2P45B 5J11C 3HR6A 5LXGH 5I74C 5ERWB 3QYCA 4G9FA 1CLZL 2I26N 4LU5H 4HKJA 1LD9A 1RIUH 4LLMB 4LCCC 3NFSH 3MV7A 2IQAB 2KL6A 5ESAA 2FEDC 3TEUA 1FVEA 4O9HL 1SYSA 3W9EA 3VA2C 4ETQB 3K80A 2F53D 3VJ6B 5DT1L 4EDXB 1XIWB 3BPOC 3QO0B 3HZMA 3EAKA 4PG2C 3SN6N 5CEXA 3P4LA 1JNHB 4G5ZL 4HDIA 4X7SL 2KKQA 5DC9B 5KZCB 3RZCD 1J1OH 5GZOD 3TPKA 4ZS7H 1QSEB 4ELKA 3DNKA 2EDHA 1FGVH 2BOCA 3MRLA 3GHEL 4XXDA 4JKLA 4K8RD 1QVOA 3ZKND 4K9EC 1KELH 5DJXA 3KG5A 3MUJA 4X99B 5IG7A 3CFCL 4X9IA 3IDJA 4Z95L 4BQCA 4ZNEA 2EC9T 5FHAH 5EBMB 2UZIL 4NN5B 5FO7A 1GZPA 4DVRL 1HQRB 4Z7WA 4G7VH 1NGQH 3SE9H 1CICD 4DGYL 4ZUUB 2BX5A 4NJAL 5HJ3B 4X98B 3S36X 4XNMB 4L29B 1NKRA 3TC9A 1AD0B 3LS4H 2G75B 4Y1AB 5TDPB 2A9NL 2Z31A 1RHHA 4JY5L 1MRDH 2VYRE 4R0LA 4LSTH 4WW2A 2AV7A 3VXRA 3GKWL 3GEWB 2VSCA 3CMOL 4YK4B 3STLB 3I9GH 3D85A 2BNRA 2P8MB 5B21A 3VXOB 2WNGA 1KULA 4PV8B 2GTWB 3SPVA 3H42H 3MO1B 1JNLL 4KROB 1MRCH 4JHBA 3GSQA 5F7LB 4HMCA 4OCXL 4RGNE 2VITA 5T1MA 3O6ML 1A7QL 2EDYA 3C9NA 4NCC2 3EYUH 3NACL 4IJ3C 1MJUH 3W0WA 4DOHE 2P46B 3SOBH 4YBQC 1INDH 1UZ8A 3VGAC 1X5YA 2QBWA 5JUEL 3OF6A 1TJGL 5GSRA 4FQXD 3TH3T 1N5YH 4CADB 4D0CA 2G5BB 1U8QB 5D2LF 2VXVH 1FV1B 3D39E 3V4PH 5E08H 3BP6B 1ZANL 1YUHB 3IFPB 3UTTA 3CUPB 1FAKT 3C5JA 4QXTB 1F8TL 5JIIA 3GIZH 3N9GH 2HRLA 1IC5H 2NTSP 4UT6H 3DX8A 3ARGC 5JMOC 4XPAL 5FYJU 1I8LA 4KXZH 1S8DA 3IDXL 4Y2DB 5C2UB 3QRFM 1NEZB 2CUIA 1X5XA 3EO0A 3U1SH 4ORGB 1Q9LB 4P4KB 4TUJB 5D1QD 2EEBA 1RZKL 5T33L 4R7NA 2EZ0C 4RFEA 5AD0A 4FQ2H 1C08B 1JZ5A 4EBQH 5E95B 3DVNB 2E6JA 2F5BL 1E6OL 5DFVD 5FKPB 4JJ5B 5J9PB 2BHUA 3H9SB 5IM7B 1HYSD 4OBRA 15C8H 3KJ4C 1P7QA 4ONGL 4JKPH 4POZD 2A83A 2FH6A 1CE6A 4NQTA 3VI4F 3DUUB 3DGGA 4NO5B 3L3GB 5CGYC 4DKAA 3F58L 1F4XL 4EQ2A 1IZKA 3ARQA 3IRZA 3PXHA 3U2SB 4PRNB 2H6PA 2B39A 3ARYA 1ZE3C 3OKYA 2V9TA 4RGMC 1CDYA 5D1ZB 4OZIB 5I8OH 4R2GD 3VFSB 1KCLA 5FM8A 3NGBB 2HLAA 3MCKB 5GJTH 4KMLB 1KB9J 1UADC 3L5XH 2XWBA 2WSKA 5ADOL 4V1DD 2A38A 3P30H 4F33A 3L5JA 1CDHA 1U8HB 4PGCB 3C6LD 3GSUA 3MYZA 4MNQD 4C59B 4TSBH 2X4OA 1MCQA 5D7SL 3TWCL 1FE8H 2PETA 3K4DA 5DD1H 1KB5H 1M7XA 4UTBL 1RIHL 1JPTL 1G7MA 1EV2E 5GGUB 5D7KE 1NLDH 2D0HA 3M17B 2UWEB 5FA3A 2BSTB 3TYFB 4W6XB 3ILPA 4YXHL 4JFPA 3UP1A 3ZSSA 2LABA 1IKFH 1JHTB 2FJGB 3MCLH 4U7KA 3NZ8B 5KSBF 3U0WH 1WQVT 1T2JA 4C4KT 1OAZL 2CGRL 5GS0H 1H3UA 4N1EA 3IAGC 1I8IA 4M5ZL 3DO3A 4PJDE 3DROB 4AY0A 5FCUL 4JLRA 3BDBA 4BKLB 4LHUA 4ODXA 3DYPA 1MPAL 4YHIA 2WIIB 1JZ6A 1AH1A 4AEIH 1GYAA 1DQMH 1BOYA 1GPOL 1AO7D 2GI7A 3MGTB 1CLOL 1OTUD 1V7ML 3GSNB 4PRDA 5EBLB 4JY6A 1QYGH 3EBAA 4N0RA 1MCOH 4Q74A 5I71C 4FFYH 1PEWA 1U93B 3WIIL 4IBLT 4GSDH 3QUKB 3MMEA 3FO1A 4XP9H 5FXCH 3MJ9H 2FO1A 3CFBB 4JZJB 1BFOA 1IQWL 1BD2E 1GRWA 3UBXG 3OHXB 3KYKH 3V5HA 3LSOA 4XBPA 1G6RH 2X89A 1W8OA 5KN5A 3E6HA 3LEVH 3LAFA 3O3EA 4XBGB 4NRYA 5JPNB 5FFLA 5D7JD 4XPBL 3WD5H 2VDLH 1FIEA 1C1EL 5FOBB 4O2CA 2J8UE 4HZLA 3HB3D 4IOIA 2XKUA 2CMRH 1CGYA 1A9EB 1A6VL 2IQ9H 5C6TL 2N1KA 5DMJB 3T4YA 1JV5B 2PO6A 5FYLH 4HS3A 3H9HA 3O6KL 4IOFD 3PP4H 3V7AG 2R4SL 3OAYK 3S4SG 3D0VB 4NWTH 2BNUB 1XF3B 3L9RA 4G8EB 4OZHA 4L4TD 2VXUL 3MXVH 4IRZL 4Z5RB 1JI1A 3CAFA 5BO1L 2OLDA 1ZVSA 4M5YH 4E5XB 1Q0XH 4TNWK 3FOMA 1NC2B 4OJFH 3MLUH 3VXNB 4YHZH 4BK5A 3EOAB 4HUMB 3QULA 2B0SL 3BEWB 4K3HA 5EUOA 3HCVB 1G6RB 4KQ3H 4YHYC 1A0QH 1D6VH 4KTDH 1MFNA 3D25A 3T65B 4QXGH 4NBZB 2UWEF 5B39B 5HGAA 4MA1B 3V6FA 4MCZA 5DK2B 1CGXA 5JORA 3H7BB 4GRWE 3BYTA 4KV5F 3MACH 5DEZA 5ENWB 4OCMC 5T5NF 3UZVB 4MB5A 5L8JB 4HUWA 3EYSH 4WCYL 4PJEB 1G9MH 4UT9H 5C92A 2ZSVA 1TZHA 3MNWB 1GGBL 3BKJL 3T2QA 1FPTH 2Q8AH 3TBWA 3JVGA 2XKSA 4PRBA 3VXTA 3UTQA 1J9CT 2VC2H 1HE7A 3K8KA 3PDDA 2X4RA 5L0QC 3PGFL 4R3SB 2X4PB 3PL6A 4KK9C 2VISA 3Q6GH 1KPRA 5DRWA 3O2DA 2ICWA 2DQFB 4XP1H 3L3DA 3RWGB 3RGVA 1WBZA 4HWEL 4YGVB 4XMLL 4QRRD 3D69A 4UMGA 3NPSB 1AP2B 3ZYOA 3BT2L 5BQ7A 2WQ8A 1QG3A 4FQ1L 4PLOB 1KPUA 4LSVH 3MBED 4JCLA 3PF2A 1EAPA 2AJUL 3H6JA 3FQXB 5BMFH 2VLRE 1LO4H 3HZVA 1DQJA 3P73A 4GMSH 4X4XA 1T03L 2AK1H 3JV6B 1R3KA 1RV6X 2FX9H 1A47A 3ZE2F 1BIIA 4QHKJ 3L3IA 3S5LG 3LDBB 1WWAX 1U8IA 5I0DA 2DBLH 3DV6A 3QEGL 3W81A 4HKBA 3EDJA 2RFXB 3R8BB 2JB5L 5FV1L 1OAKL 1OOAA 1K2DA 2DQIH 3O6FD 3C5ZA 2YC1A 4V2CB 5GZNC 4ZODA 4NQCD 1CZ8H 1ZS8A 3DUSB 3O9WA 4O51B 4M1DL 4I48A 2XTJB 1BJ1H 1VPOH 2DI8A 2FLRT 4JO3H 5FGCE 4YNYB 3FRPG 1RUKH 4G8FB 1EFXB 4OB5L 1CFBA 4NSKA 4YHLH 2DQUH 1K5NA 3HZKA 1HHJA 1R0AL 4HUXB 4D3CL 5IJVB 5DRNB 5IMMB 5FM5O 2BNRE 4JRXA 1CDJA 3WXVL 4PJCF 3QSKB 2VQ1A 2DMKA 5GRUH 5I1IL 1BJ1J 1R3IH 3F65A 3WDIA 2EEDA 2FDBP 4PJ7B 3O8XD 5E1AA 1ZGLA 1IM9B 4UOW1 5IBUG 3RX8A 1Q38A 2DLGA 1U8KA 2XRAH 4HJJH 5CD3B 3JTSB 3KNBB 2GJ6D 4JHZA 5HYJB 4IS6B 2ZUQC 2BNQA 1IGIL 1KIPB 3FO2B 3UJIL 3BZ4B 4OFDA 4P3CL 4JRWA 1E4XI 1XR8A 4W81A 4HXAH 3O3UN 1Y6MR 1C5CL 5EO9B 1SEBA 2EXWC 3RUGB 3IXAB 4ODWA 5AZEH 2IANB 1TZIA 4HGKC 1D6EA 4D0BA 1DQLH 3PWJA 3QUYA 3OPZL 3T0EC 1QO3A 4JM2B 4ZAKC 3TN0B 3LKQA 1TJIH 4X6BA 2F58H 1KCVL 1MHEA 4L3EB 1KCUL 4HS6B 4IMLA 2DL9A 1KEMH 3U9UB 2OL3A 4PJ9D 1A3LH 2H2PD 3FO9B 2FH8A 2W60B 1AKJD 5C0GB 2NY6D 4I3RH 3ARFD 1N3NA 2MOVA 4MS8C 2QQKH 5F7EL 2BVOB 4XT1C 3QPXL 3AGVA 2NZ9C 2YMXH 4QLRA 3EJYD 1YQVH 2YRPA 4EUPA 4JREB 1AXSB 5J12C 1GGIL 1T2XA 5IEHB 2BSSA 1KN2H 3PQYB 3HMXA 1TQBC 1YEHH 5I1KH 1D5MA 5D4QA 3NIFF 1LDPL 3FT3B 5F6HJ 4J8RA 3LKNA 3ZTJH 3JUYA 3TV3H 3WIHH 2DB8A 3I6KB 1I7UB 3MRNB 1HI6B 1ZLSH 5EU4B 4EIZC 5K59F 1MHCA 1FH5H 2W38A 4XP6H 4F57L 5T5NG 4DGVH 5C7XL 5F9JA 3ZSTA 4OF7A 1WIUA 3UXFA 5B3JE 4XAWL 1XGYL 3SE4C 4KHTL 3WS3A 1XT5A 4ONOA 2DS4A 4JN1L 4DKDC 1R24B 4NHUA 3P9MA 4PJ5D 2VXQL 2ZG1A 1TPXC 3KHQA 4OD2A 4X4MA 4PRIA 2VLKA 4I18C 5I0ZA 4JVPA 4NNPH 1DQDH 43CAB 2P47B 1UB6A 3M1BB 1EEUA 2NY0C 1FJ1B 1U41A 2AK4D 1N6QH 1MF2L 3QNXB 4L8SC 4LQFL 3PDGA 3X11B 4RMTA 2MQ0A 5CEZE 2ITCA 4F7TA 5DHYB 3MJ7B 4KUZL 3FN0H 4GKSB 5T3XL 3GBMH 3F7PC 5CJXA 4LNRA 1OGTB 1ZA3B 2X6MA 4JFHD 4ZO7A 3PUCA 3GJFK 5J1AA 3MLTB 4IRSC 3QDGB 4PJ7F 4AH2A 4P2OC 1L6ZA 2PXYD 2QTEA 4J3OC 3MLXH 4ODHH 1T5XB 1WIPA 1YEEH 4F9LC 1XMWA 2A6KB 4Q58C 1MCRA 2AJZA 5L2KE 2G2RA 2NYYC 1TVHB 3D2UB 4ODBD 4I0PD 4P5KB 4G42B 2YXMA 4B50A 1FNEA 5IESL 3QIBA 4D8PA 2X1OA 3UTPE 1NDMB 3TH2T 3F8UB 4M7ZB 3RUGF 3FFCA 2AJ3B 4JG0L 4XZUB 5C1MB 2DIJA 2NNAB 1H5BC 3TT1L 1J11A 4NHCH 2OMNA 1FLRL 3PHQB 2GK2A 1MLBA 4Q9RL 4BQ8A 4AM0B 1KENL 1YY8A 4YIQA 2D7TH 4HMEA 1J1PL 4APQD 1GSMA 5CP3H 5JDSA 2AJYL 5CHNA 5CEZL 1DQTA 2WUBH 4E42B 4WWKA 1A3RL 5LQBL 2DJ4A 2LE9A 4WHTA 3ZL4H 5F96L 5D7LA 3ARDA 4JFOB 2J6EA 5F7HA 3WFBL 1XF1A 1NMCB 1JE6A 2JKXA 5DMKB 2E7BA 1X5KA 5CBEB 5J0BA 3STZA 3LCYA 4EN3C 1FC2D 1WF5A 1OM3H 4JVWA 3RWCB 1G84A 4R7DB 1IC4L 2PW2B 2DLIA 1XCTB 4QF1A 4HZAA 2NLJA 4G6AD 3RIFK 3BRFA 4MA7H 1FO0A 2E8ZA 2C1OB 2QHRL 4XPFL 1P4BH 5AYUL 4FG6D 2A77H 2BSED 3SDDD 4YXLH 4NWUH 2OP4H 5CSBA 5I1EH 4K8RH 3QUZD 2IPKA 2NX5A 2GITB 4OZHE 4X6EB 1IGJB 4JCMA 3X13A 1G7IB 1B2WH 5JA9A 4HK0A 2UYLA 1IC7H 1IGTA 2YD5A 4G8IB 5T5FL 5TFSL 4DK3A 2HLFD 3HE7C 3HUJA 3DO7B 3IDYB 3HI1B 1RUPL 1F4WH 5JQ6L 5KJRH 4ZXBD 5L9DL 4XCCH 3H9YA 1DBAL 3S7GA 1JGLH 3DTXA 3TZVD 3U6RB 2ENSA 4OGAD 4GAJL 1VEOA 1NMAL 3C87A 4NZTH 4RMRA 1KYOJ 2VXTH 2ADFL 1SM3H 1JZ3A 2IAMA 2M2DA 5JDJA 3VWJA 4TQEL 1SVZA 3BUYB 1E4JA 4NP4L 2Q76B 4P2QD 4RIRB 1IEHA 4QNPE 3B9KB 5F7DA 1NANH 1GHFL 3GGWB 3QIWB 4KK6D 3SY0B 2KH2B 2BK8A 3VFRB 4QHNA 1MNUL 1JHKH 1H3VA 4ENED 1OT2A 4NQSB 5JZ7C 3TA3D 3VXUD 5CLTA 3L95B 5J11B 5IB4A 4JPKH 3IYLW 4Z7UB 1W2KT 5TPWL 4YAQB 2NTFA 4HXBH 5I74B 1I8MA 4FQIL 5IBLC 5A43C 2VKXA 1VA9A 3KPRB 2F54E 5C8JB 1JPFB 2RBLA 4KTEL 4GRMB 2X09A 5IVZB 4LCCB 3VD4A 4M02A 4NQVB 3IJSA 1AY1L 4P2YA 3MRPB 1MFAH 1CD9B 5E00A 1NDGB 4HFUH 2X4SA 3C60D 5ID0A 4LCYA 3L3KA 4C56D 5DJDB 4AIOA 1CICB 2VL5B 1NFIA 2IADA 3ZDZE 4M6MH 1UXWB 1VERA 5C0AA 5C9JA 4RMVA 4G80A 2WLZA 3NH7L 2GKIA 2NXYD 4XMPH 5TE7L 2W65B 4EXKA 2UV3A 2FR4A 4JFQA 5I9QC 5C07A 1JWMA 5FM5M 4YJZL 3CFKB 1DVFD 4RGNC 4Y5XB 4MXQC 3VWKC 1MFDH 3SDXA 5E56A 5DUPH 1BEYH 3NA9L 1FG2B 3EYOA 4Q97A 4NNXB 1JZ2A 4KKCD 2VZOA 2VIRA 4OLVL 5ITFB 5DDHA 3DRTA 2NY7L 4CBPA 3ULVD 4JM4H 4N0CC 5BOPA 4PLKC 4KK5C 3SKMA 2D7OA 5I8CA 5FUOL 1F45A 5E6IA 4XAKD 1S7TB 5CSZB 5DS8A 1XF4A 2GAZA 4LLWA 1WJ3A 4M61A 4K23H 2DKSA 3BRGC 2IGFH 5EZOH 1AE6H 1K6QL 4Y4KC 4X8JB 2ZOKB 4WGVB 1KC5L 1ADQA 4GQPH 5MEPB 3RBGA 5HGHB 1NCUA 4JFXB 2HT3D 4YX2H 4G6KH 5I8KL 5BV7L 4NDMA 1QNZL 5B38B 4FFVD 1AGFA 2XN9D 3MREA 2P5EA 2DMBA 4U4BA 4DUVA 3ARED 4WV1B 2E7HA 3CXHK 4DTGH 3HRZA 4GKNB 4D2NA 4PJAE 4HWZB 3S36L 1FL6B 1SVCP 1RUQL 1NC4D 3MV01 3OGCA 4LPTA 1U3HA 1ES0B 4ZUTA 2P42B 2UZXB 4JR9L 1UM4H 3O6LH 5IW1A 5SWSE 4LF3A 1YNTB 3JBG7 3MRRA 5GISL 4QTHB 1CF8H 4H25A 3TO2A 4XNZC 3ARGB 4ZQKB 5ESQB 5B8CC 1MSPA 1SQ2N 4OFKA 4ZOEA 3RDTC 1WFUA 3IB4A 3QT2A 3LRSB 2BOBB 1FORL 4P59H 4Z7UF 3OJDA 1XGTB 4FTVB 3V95A 3QP3A 3AY4C 3PWNA 1DBJL 1AQDB 2AJSH 2ED8A 4GBXD 4HC1H 2ZOLA 2OJEB 4AZ8A 2KBGA 1TENA 1KJ2A 4ODUB 1P2CA 1R3HA 2ICWI 3CZFA 2VAAA 5IQ7L 1VFOA 1KFAH 1J8HA 1JNJA 5BS0E 2CJUH 3BQUC 3IVKB 3BISA 1MWAA 2B5IC 4P23A 3O3BB 4KKAD 1QBML 3KJ4B 4ZOBA 1T04B 4MJ2A 2JIXB 4S11A 1FCGA 1BOGA 2VR5A 4WJ5A 1NFDA 1YYLH 1N0XL 2OI9B 4H1LB 1EXUA 3B9VA 4MB4A 3VFWB 4IRJA 2VQUA 3K8LA 4RGMB 2VERN 4N5ED 2RJMA 4OLZH 3E3QC 2I9LA 5C0JA 3FQUA 5AZ2L 1MFCL 3TPUB 4B0MM 2BSRB 5KSAD 1XCQB 4JFFA 1QSVA 4X4ME 2VLKE 4UNVA 3T0DA 3SBWA 1N5AB 3F12A 2EH8H 5SWQB 3BKYL 2AXHA 5DD6A 1V3MA 3VFMB 2UVEA 2OL3L 1V05A 4DCQA 4G7YH 4XGZA 5JOPD 4H8WL 3IDGB 5ESVA 1AO7B 4K71B 1F2QA 1NSNL 3X3GL 5CP7A 1FVDA 2OTUA 4W68A 4PLJC 3ZE0E 1ZHKA 2AKRB 1TETL 2HVJA 1UZ6E 3TYGL 1AHWB 2PYFB 4ZD3H 3P0VH 2AAVA 4Y5YA 3NIDE 4Y4FC 4GXUM 5HVHC 3U7WL 2FHCA 1EERB 3FONB 5DMIH 5HHME 3V9FA 2I60H 4X6FB 4MA3B 5I76B 4LASH 2K7QA 3L7EA 4CGTA 3AMLA 3B5GA 3OBAA 4G3YH 3ZDYF 1QBAA 1IGML 4ERSL 2BP3A 4M7JL 5IVXA 2A73B 2ARJQ 5HYEA 5MEOA 1RZFH 1T0PB 4KDVA 5EZJA 2VRAA 1MI5E 1W0VB 4MNGA 5TF1L 2R4RL 5E8OA 3C6SB 3QDMA 1TVBB 3BYYA 3RWDB 5DC4B 3FB8B 5ETUA 2WWKT 1KJ3L 4CMMB 1GOFA 2FGWH 4HEME 4PYGA 3GMOA 2R0ZL 4L5FH 4N90E 2VLJB 5ANMB 1UXSB 2HTKD 3WN5A 4P3DB 4MDIA 5DZNA 1RK0B 2YSSA 1YNLL 2GJJA 3F7RA 5HI4C 5GGSB 5FUZH 2J5LC 4J6RH 1P7KA 1Z3GH 1RZ8A 1OAQH 4NQEB 4MB3A 4JFZH 2FYYA 3REVA 2H26B 1C5DA 1YECL 3NCBB 3LQAL 5I1LB 3FCTB 3U30C 3PXJA 3EFDL 3EO9L 1JRHH 3L1OH 1G6VK 2EDLA 4JJHA 4OAWA 4LPUA 1LMKA 2AS5M 3LD8C 1CDCA 2XWTA 3BP7A 1MQKH 4N8CL 1UKSA 1CG9A 2BVQB 2MCPL 5C09E 5FYKD 3AC0A 2PYED 5LCVL 4E41A 4FP8H 1PKQA 4F80A 3F62A 3BD5A 3RWHB 4RAVA 1I9IL 3CVHA 2P44B 3NCJH 1RJYA 1S9YB 4HKZA 2YZ8A 2WW8A 1MREL 1FDLL 1JIBA 4V2BA 3TO4D 3V4UH 4RFOL 2XNAB 4EI5D 1OT1A 4PGBA 1E28B 3GB7A 2UUDH 4OD3H 3DIFB 4MD0B 3MZGB 3L5WB 3CXDL 4R96B 1NPUA 3KJ6L 3HUJE 1VACB 5T1KA 4PGDA 4YHYB 2J6EL 1FFNB 4Y4HC 1GCFA 4MWFA 4LPYA 4IIQA 5ID1B 5A40E 4ZOAA 1T1WA 1IBGH 3QEQE 4M6AA 2EECA 2NR6C 5C0CA 2Q3AA 1V7NH 3JWDL 1CFTB 1QRNA 4HUKB 4Y0GA 4N0UE 5CIPH 4QRRB 3OAYH 1LP9B 3OAUL 2W9DL 3TCXA 2R1YA 1JJUA 3K4AA 5IB3A 2LTQB 5FHBL 4PB9L 4EIGB 1M1SA 3VXME 4I5BA 2X4NA 2P8LB 5ICXB 1KB5A 3QWRD 1Q94A 3G6JE 4M1GH 4LCWA 4OLXH 2P24A 4H20L 1K4DB 5IEKB 5JMRA 3LMJH 2YPVL 3OKNA 4HIIA 4J3TA 5HGDA 4HW6A 1INQB 3MV7D 3FN3A 1VADA 2VJXA 1C16A 3QUXC 4X6CB 1ZT4B 3NABL 4MX7A 4WW1B 5T1DH 3C5SB 3PNWA 4C54A 4F7CA 3OKKA 4HFWA 4W6WB 5IV2A 1MJ8L 1TQCB 4OTXL 4UT7H 3BSZH 3N06B 3RY6A 2F5AL 1G7JA 2ADJA 4U1SB 4TVPH 3JV4B 3OGOE 4AG4L 1KSRA 4KMTH 5C0BA 2JF1A 2XQBL 3BO8A 2Z31C 3V5DB 2VZVA 3AS1A 5GS1A 2ZCHL 5C0AE 1DN0B 2IWGA 4N9GA 1J0YA 4X5WA 4PRAA 1NJ9B 5IFJA 3HE6A 3OKEA 4WEMB 1SY6A 4MXWL 3UTZB 4MDJB 4XC3H 4WFFD 2DKMA 1F90H 2G5RA 4TNVF 3S37H 2XT1B 4HIXH 4JB9H 2NY4C 3HAEG 1DL7L 2NW2B 4PJIF 1HILA 4YBQD 4HUUB 4CU8A 4QEGA 3ULSA 2GJ6B 5J56B 1F6AA 4OUUB 3UJTH 1H15B 4WU7B 5D6CB 1M6OA 3V5KB 1Z9OA 3VXRD 3LEXB 3FT4B 4S1RL 3OL2A 3QCTL 1RD6A 3WXWL 3TVMC 4EVNB 2RCSH 3KS0H 3PWVB 4ZTPH 3G04A 1Y0LB 1A22B 4NFBA 2AEQH 4U3CA 1OL0A 1T5WA 3PGDA 5C0FB 2HKHH 2H1PH 1TTUA 2B8OT 3O0RH 3X12B 4HGWB 2RB8A 2NXZB 4GQ9L 1I8LC 3WNPA 1P7HL 4NKIH 4LRIC 1JYWA 5H37G 4WY7H 5JHDA 3RPIB 4NO2B 3AU1B 4C83B 4HPOH 1PJ9A 3KS0J 2VB5A 3OF6D 3LEYH 1DJSA 5DURD 1FGNH 2QSQA 2ZUQB 3UYRH 3R06B 4PJGB 1Q9KA 3ZKMC 3KPLB 4BSVB 4FA8A 5ISZE 3N0PB 1HNFA 2IH3B 5CFHA 1WTGT 3PGCA 3R1GL 4P0DA 3UTTD 1AKJB 1AQKH 1QLFA 5ICYB 4BSWA 1UEMA 3CSGA 4XWOC 1J5OH 1XR9B 1IT9L 3P3YA 1LP9F 1NLBL 3WNOA 2HFFA 3GMQA 1FQ9C 1RZJL 4YFEA 5KAQF 3TBYB 1R6VA 1ZK9A 1C8PA 5EBWB 4U0RC 4AEFA 3D5OF 2B1AH 2X4TA 1IGFH 1K4CA 1CK0H 3T0EB 4OSUL 4ZAKB 1JGDA 4JPWH 5GRJL 1OAXL 1GZQA 1ORQB 1K8DA 4LEXH 5DUML 5EUKA 1IM3A 2AV1B 3O41A 5IBTL 4LK4A 1QSEE 1FVCB 4DW2L 5FGRA 3BKML <