4E42B

Structural basis for the recognition of mutant self by a tumor-specific, mhc class ii-restricted t cell receptor g4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
237
structure length
231
Chain Sequence
VTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSETQYFGPGTRLLVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPASRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor G4 alpha chain
publication title Structural basis for the recognition of mutant self by a tumor-specific, MHC class II-restricted T cell receptor G4
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 52
structure length 231
sequence length 237
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e42B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4e42B01
4Y1AB 1NCAH 5JMOC 3ESVF 5DJDA 1E4XL 1MH5A 4QHKI 3BWAA 3Q48A 4PGEA 4R7DB 1L7IL 1K2DA 1JGLL 4R4NC 3WUWG 3ZE1E 1JPSH 4MMXC 5AZEH 4GLRH 4OF8A 2QV2A 2DBLL 3EW3B 1IAOA 2H9GB 3GSRB 2R4RH 4J6RL 5T3XL 1FGNL 4PY8I 1TIUA 4P2OD 1I8KA 3PP4H 1ZHBB 4ODUA 4X98A 1DBBH 1IC7L 3PQYB 5CD5D 5DJ0B 3IXAA 4OZIE 5I17A 1QD0A 1SBSH 2HMIC 3BESR 1A1NB 3RVTD 1Z5LA 4BFGA 1MCWW 4ODVL 1YNKH 2Z91A 1JUFB 2O5YH 2EYSA 5DSCB 3KYKH 3X12B 4AEHL 1CFNB 5L8KB 1DQDL 4PB0L 2GJZA 2E7BA 2B4CC 4NRXA 5E9DB 3FT4B 5HGDA 5HJ3B 3ARWA 1S9WA 3MRGB 1IZJA 4WWKB 2FX7H 4U1SB 1JPGB 1JFQH 3MTRA 4XMPL 4ZTOH 1QBAA 4F33B 4JFDB 3OR7A 1KLUA 1P5UA 4WHTB 3VRIA 5I1CL 4MB4A 3MFFA 3VXSD 3DX6A 4LCUA 3WCYA 4F8TA 3ARBC 4HGKC 4G42B 4R97B 2ENSA 1F2QA 1HKLL 3LKRA 3O6KL 3HZYB 1EHAA 3SDAC 5K9QG 4P2RE 1DQJB 3BEVA 3DXAA 4AENB 4Y4HA 3QUYC 3M1BA 5FYJD 3PABA 3NCBB 4P9MH 2PTVA 3KPOA 4F58H 1WQVT 4Y2DC 4XWGH 4DTGH 1YECH 5J13C 3BP5B 3I02B 2BVQB 1G7IB 2NY2B 1OOAA 2HVJB 4JHAH 1SJEA 1EMTH 4CVXA 5GXBB 3QG7L 1I1RA 4JGMA 4N8VG 2LVEA 5T1KA 4M1CD 1RU9L 4KMTH 2CDEB 3AC0A 4KVCH 3KJ6H 2JJSC 4J2XA 3X3FL 4BH7B 4DN3L 3HI6L 2QLVB 5F6IC 3X13B 1EXUA 1PSKH 3QWOA 3F7RA 2WUBL 4JO3L 2XT1B 1PKQE 5IB2B 1OW0C 3I6GA 5I0ZA 1WT5A 1RUKL 1MAML 4UV7H 1MI5B 4N5EC 4U2ZA 4KJPC 3G6JE 1BVKB 4GRWE 1X4YA 3BKCL 3HI1B 3I3DA 5LBSL 5HPOA 3RGVB 1IM3A 2APVA 1FZKA 1LD9B 3MYZA 1FVCB 3CDCA 4RGOH 1ZA3B 5EU5A 1JZ4A 1TDQA 3MODL 1U8OB 5DK0B 3PE9A 4IMLA 1Q8MA 4N0FA 3ARPA 4S1RL 4WY7L 1CD9B 4PJCF 4XNZB 1OSPH 1KOAA 3U0PA 4G8GB 3IJSA 5T5FH 3RVWC 5MENB 5JHDA 3CMOH 1LILA 4NFBA 3BMVA 4RFEB 1P1ZB 3NPSB 1BM3H 4TSCH 1T5WB 3MV8B 2CLRB 3LRSA 4QRPA 5E2WL 2DB8A 5DRZA 4PB9L 3VI4F 1ORQA 1V3JA 3EIFA 2OTUA 3L5IA 4LPUA 4QGTA 4TPRH 5J8OA 3VMPA 3OBAA 1YMME 3VFSA 2GHWB 1LEGA 4LSPH 4ZQKA 4FXGA 4XVTH 4XMKL 2FZ3A 1FNGA 3WIFB 2ESVE 1FORL 4J4PA 1XR9B 4RMSA 2EDOA 2VZTA 1U8NA 1FL5B 1F4XH 3WHXA 5HYFA 2YK1L 3MLYH 4RIRA 3LEYL 4PTTA 2MCPH 4G9FD 3F7YB 1GGIL 2VLJA 2GJ6D 4JFOB 3UTTA 3T1FB 4AMKL 3QRFM 1M1SA 3RUGA 2GJJA 5J4MA 3K8LA 4NBXB 4XI5C 4BFIA 2FNBA 3DECA 3F58H 3QCTH 1U3YA 1RUML 2DJ4A 4KGJA 1KB9K 4HIIA 1NGQH 1NUFA 4UB0L 5I8OH 1W2KT 3B3IA 2HH0L 4TSBH 3CFCH 4YXKL 4ENED 4LLQA 2IPTL 4LCYA 5DWUL 5E6YA 3LHPL 4IRSB 4NT6A 5CZVL 2R1YA 3CCHA 3BPNC 3RX8A 4OZIB 3VJ6B 5EU6A 3QHZH 4PG2A 1T03H 5ESVB 2UYLB 3DV6B 4X6CF 4DQOL 3BRDA 2J6EA 3QXVA 4YDKH 1KCVH 35C8H 3TA3B 4P5TA 4TUJB 3IGAB 3V4PL 4B41A 1CLOL 4O9HL 3RWHA 2X7LA 4GMTH 1OCWH 4CMMB 1TZIB 1MIEL 4NJAH 1LP9E 2X44D 3BT2H 4KRPB 1H5BB 2WWMC 3U7YH 3HZKB 3UEZA 4GAYB 2R0WL 4H20H 5FDWA 1CVSC 3BRGC 3AXLA 1T21B 3PGDA 3TV3L 1SJHA 5I75B 3BFOA 4FABH 1IGML 2DMBA 4PJAF 1Q9WB 3QWRD 5FK9B 4OV5A 3ARDC 5DJXB 5IHZB 1JZ8A 3NGBC 1EHLH 2NLJA 2RCSL 1JGVL 3A6BL 1MAJA 1OQXA 5KJRL 4AIZA 3MGAA 3AY4A 1X5KA 1TQBC 3FRPA 2H1PL 2GY5A 4JY6A 1JZ2A 2DLTA 4DKEL 4NO2B 1A3LL 3MC0A 2EDDA 1F4HA 1WWCA 5ID1B 3GK8L 3QI9A 3J8F7 3D9AL 4P2RD 4ZTPL 2HFFA 4TULL 4QRSA 2BFVL 1N26A 5I1GH 1PJ9A 1JIBA 4JG1L 1MJUL 1LK2B 2IH3A 3IFOB 2F15A 3WFBH 4UT9L 4ZSOB 4U1IA 1X4ZA 5C6TL 5FYLH 5IFHL 2N4IA 4I4WB 5A43C 3WDHA 3PHOA 3IDJB 4PGDB 5I30L 1NCBL 1CL7I 3T77B 4ETQB 3HR5A 1O7VA 4N0UB 3IS0X 3S5LB 1M05A 1WSST 2AJYL 4XVUD 1YEHH 3S88H 4ZPTA 3V4UL 4NUGH 3V8OA 2E3VA 4KKAC 3QEHA 3FT3A 2QHRL 1PKQB 5DJCA 3TNNB 5EU4A 5DQDH 3TO2A 1B9ZA 5AAMA 4PD4J 1QBML 3OWEA 2LTQB 1CDCA 1OPGH 4YPJA 3C5SB 2Z93A 5FA4A 5EB9A 1KIPB 4KUCF 3JV4A 3DUUB 4PFEA 1X44A 3STLA 1HWGB 4IJ3C 2YN5A 1P6FA 1FFNB 4Y5YB 3D69B 5KTEH 4FMKA 4YBLB 3LKNB 1DLHB 3GZKA 4U6VL 2YZ1A 1CU4L 2X4UB 1OTSD 2DI7A 5JW4R 4XBPA 2W0KA 3LEXA 1KJ2H 1BQHG 3QNZB 3L5HA 4E41E 5H94A 2CIIA 4PJEF 1DLFL 5FCSH 2OTPA 4DGIH 1T4KB 2P47B 3K2MC 4WU5B 2EYRA 2AVGA 5CEYA 1SEQH 3CC5B 4HWBH 3EHBC 4XPBL 3DMMD 2VXQH 5DF0A 3T2NL 3O6LL 4HULB 3R06B 4MSWB 2Q6WA 1CFTB 3TVMB 3QUZA 4V1DA 3BKMH 2IPUG 1MCHA 1KJ3H 4XNQA 4D94A 4HBQA 1PYWA 4Z7NF 3HPLB 3QSKB 3BH8B 2FB4L 4E42B 5L88L 2XY2A 1S7UB 1YMMD 4PV8B 1U36A 4LSTL 5KSAD 5FGBA 4NN5B 3QFJE 1NH6A 1UA6H 4AIXA 2HA1A 1BFOA 2ESVD 2OR8A 4LHQB 2NZ9D 5FXCH 3ZE0E 3KYNA 1AXSB 4HUWA 3VA2C 4ZPVB 3UJTL 3NFPA 5JW3H 1I9RL 1OD9A 5F88A 1SY6A 3NACL 3MJ7B 1FVDB 2VLLA 3PWNA 4L8BA 1H8OA 1I3GH 1MWAB 4ZXBA 2R23B 4HIJB 4UOJA 5FOBB 3S35L 4HW6A 2A1WH 5F9DC 2NY5H 3S9DB 3NVQA 4JO2L 3VRLE 4XRCA 4LLVA 2IEPA 4PJ7E 1HQRB 1NDGA 5E03A 4Y4HC 5C08E 4Y19E 4XNMB 3VXMA 2IFFH 2XFXA 3O4LB 1T5XB 4I0PB 4FQIH 3M45A 4XT1C 1J0HA 2ADFL 4G3YL 4XX1E 1MFEL 3MLUL 4N0CC 5F44A 4ALAL 5GS1A 4KTEH 2HLFC 2VR4A 4LHUB 4OLWL 3F6LA 1YEKH 3BGFC 3LMJL 1MFBL 5T1DL 1B2WL 3OAUH 2XYCA 3M17A 1DANU 2B1HH 2O5XL 2Z8SA 4L4TD 1UWEL 3CSYA 1V3LA 4PBVC 4K8RD 5EU3B 2XWJA 4XNXL 3I75A 2VOTA 3W9EA 1IRAY 4RGNC 3IU4H 1WZ1H 5C09E 4XPGL 3MV11 2CD0A 1E27B 3U6RB 1YY8A 3ULSB 2HTKD 5LG1A 2NYYC 2NX5E 1FFQA 4YK4C 2ZCLL 2FX8H 3CLEH 1JWMA 1ES0B 1OSZB 4JZOB 1FNEB 1U8PA 4RMWA 5KS9F 3TIDB 5F3BB 1T6WA 1UQSA 4M7KH 1EGJH 3AMKA 3SO3C 1NPUA 3QPQD 3LV3A 2F53E 4HXAH 3TN0A 3JV6B 5I1KL 5L7XL 2BNQA 4PJIA 1RZJH 1J9CT 3N1GC 1D5IH 5HYIA 2EE9A 2XZZA 2GTZA 2WIIB 2YMXH 4Y4FC 1K4CB 1TQCC 2D7TH 4JFPA 2XPGA 4OJFH 1TJHH 5HDOA 5BZDA 4HBCH 1INDH 4ODSL 5DK3A 1G6RL 3QEQD 4NKMB 2J8UE 3QB7C 5KANI 4L3EE 5F8RC 3ARXA 1E4WL 4LLWA 1LE5B 3AUVA 3OB0K 4IDJL 4PJDA 4EDXB 4MD5B 3GSNA 3HUJF 2VUYA 3G5VA 1QSEE 2MHAA 4FQLH 1U3HB 3IFLH 4M7ZB 3JUYA 1MNUH 4FXLA 2AJ3B 5ABDE 1I1AD 1R3IL 5GRWA 5DYOA 3UAJC 5SWSE 1BZ7A 2IBBA 1BVLA 1MCOH 3WS3A 4HAFA 3HC0B 2M8XA 3RVVC 3OJMB 1F4YH 3FOLB 3PGFH 4GG6E 4GKZA 1RIVH 3BPLB 4XNYH 3VFTA 4LL9A 3BE1H 4L4VA 4ZNEE 3EAKA 3DHMA 1H0DB 2ZNXA 2J4WL 4L8DB 2I60L 1K3IA 3S35X 2XKUA 3MRHA 3MOAH 4JQIL 4PY7B 2AABH 2YPVL 3MRPB 3SKNB 5JORA 4PRBA 4MJIA 1GGUA 5IBLD 2MNUA 3N1QC 2BC4A 1EFXB 1MCFA 1SYSA 2OR7A 2QQQA 2HVKB 2IAMC 3WIHH 2K7QA 4DVRL 3L9RA 4OZHF 2GAZA 5GGQH 3RTQA 2OJEA 3BOVA 1P2CA 3V0AC 3VWKD 3WDIA 3QIBB 3O3EB 3E6HA 4MD0A 4X5XB 1MFAH 4Z95H 1JP5A 1IBGL 2HRPL 4X7DC 3CX5J 2DM3A 2XN9D 5IVNA 1VDGA 3CIQA 1JJUA 5FO9A 1DEEA 1NDMB 3DBXA 3G04B 3CPLB 3OKLA 1JL8A 4E41B 2BVOA 5J11C 5I1LA 2D7MA 1J1XL 1U92B 1OLZA 3ARSA 4ZUVB 1T7ZA 3GJEB 1HNFA 4Y4KD 5EFIA 3T0ED 3EFDL 5EWIL 4WUKL 4C83B 5K33A 3RWEB 2NTFA 1NMCB 1HCVA 1JRHI 3H7LA 4X7TB 1WEJH 4PG2C 2BMKB 3PV6B 2KZWA 2EDFA 2KH2B 1JNLL 4UINL 1A14H 2GUOA 1JHKH 1TXKA 4Z7OF 1YJDH 2OZ4L 1FBIL 4I18C 1RFDH 4FP8L 4DKDC 2IBGA 3BP7A 4YHZL 5D6DA 1IL1A 3SGEI 5JDSB 3RPIB 3HS0B 1E4XH 1H3GA 1K6QL 1A8JH 1DVFC 1D9KB 4BSWA 1T1ZB 5D1QC 5C8JA 3FFCD 2PO6A 2NY1B 4EI5A 5FB8A 2DBLH 2W0FA 5FCUH 4J6RH 3DX8B 5T3XH 5GGVY 3QFJD 4Q58C 1QBLL 5H8DA 1CLCA 3O6MH 3U48A 4V2BA 5D7LE 1RD6A 2X4PB 3EYQD 4OGAC 1RZFH 1Q9KB 1AGDA 4EVNA 3QQ4B 3R0MA 5FM8A 4D9LL 2YBRB 1RZKL 4OLVL 3QA3B 4KI5C 3T0VA 3CX5K 4G8FA 3WXVL 4KRNA 4F80A 4PRHA 1OM3H 4NSKB 1D6VH 5HYJE 1AGEA 4P3WA 1BREA 4ZD3H 4XP4L 4PB0H 1IKFH 3RDTD 3CFDA 4WFFE 2OYPA 1KG0A 4NC2B 3OQ3B 2E9IA 5C08D 3CD4A 5DHXB 1U8QA 2CLZB 2YOCA 4XMPH 3X14B 1H9VA 3QHFL 4JZJA 4PGBA 3RBSA 3BQUA 4HH9A 4U1MB 5C0CB 2DYPA 1NC2D 3S3JA 4C56E 2QADD 3VXRE 5F96H 2ZOKA 5HVFB 4AEFA 3S96A 3C8DA 3INUL 3O2DL 1JWSB 4H88L 1GGYA 1Q9OA 4MDIA 3DV4B 4JDTL 4KKLD 3GMPA 5C09D 4D0BA 1EEQA 2Q8AH 4PV9B 2F53B 1NBYB 3EYFB 4FQXA 5D7JB 2OI9C 1RK1A 4Z76B 3FONB 3ET9F 5E8PB 4XAKE 2KKQA 4N8CL 3MRNA 3FO9B 3MA7A 3RIFK 5DRNA 3RKDC 3UROR 3LKQB 4L9LA 4N9OB 4UAOC 3KPTA 3U9PL 5D7IB 3RZCB 2J8UB 2PYFA 4QWWD 4L3EB 1RJCA 2LAAA 1HQ4B 1YPZB 4R26L 4X6FA 3W39B 3QG7H 1W8NA 5D8JH 3S4SG 2HWZH 4GW5B 2G5BA 1VFMA 5DI8B 4WO4C 2JKXA 1DSFL 1WZLA 1ZK9A 2OR9L 1IGIH 4P48A 4PJ8A 2ZP0T 1BF8A 1HHJA 3H42H 3UBXB 2HT2C 5C7XL 3VI4E 1IM9B 4X6EA 5IBUG 5EN2A 2FATL 1BJ8A 4UTBH 1FL3B 4PJFE 4XP6H 4XCYB 3QCUL 4NWTL 1QSED 3O3AB 3DOSA 5IKCB 5IVXA 5TDNA 1RZKC 1H3TA 2JK5A 1J8HE 3QJFB 5KSUB 4PTUB 2BCKB 5I1HL 4KK5D 4WEMB 1YN6B 4FFYL 4X7FC 4OB5H 5F1NB 5SWSD 3VG9C 5ACZB 3QUXD 2VERN 4UDUB 3H3KA 5I1EH 5J9PB 3UXFA 5ALBL 3RA7H 4ZYKA 4QNPE 1FFPA 1F97A 2AXGB 1X5XA 3ILQD 4UIMB 1P7QA 1C5DA 3BN9D 1TVDA 2Z8VC 5F9WC 3KR3L 2YD9A 1UKTA 3EYVB 3QNXA 5EC1B 5IMKB 4JFYA 4OKVA 5HHOA 4HIEA 4A6YA 5BXFB 5DJAB 3RUGF 4QT5A 1ZLWH 5E2WH 3DIFB 5BRZB 3O9WC 1REIA 4PB9H 4OCWL 5JXAH 4P2QA 1T3FB 4JFEE 4W4NA 1AO7A 3KHQA 4GH7B 5ANMB 1QNZL 2VB5A 3QJHB 1S7RA 3ULUF 4P5MA 2DICA 3NAAL 5TDPA 4MNGE 3EO0B 5EZIL 4QOKB 5KSBB 3QQ3A 1I8IB 4KJWD 3ARGA 3TT1L 1JV5B 1PBYA 4OQTH 3V5DB 2XZQL 3QISA 2NR6C 3GSOA 5FYLD 1JGEB 1RZ7L 1RZGA 3EJZC 4X6CE 5EOTB 5AYQA 5IB5A 5K9JL 4XCNB 3UDWA 3C5JB 1GHFH 3LEYH 4XCFH 3MJ9A 2DQEL 2AJVH 4PJBE 1U8MA 1XGTA 3NOIA 1RZ8B 2YPLB 3UTSA 3C08L 3V2AR 3S3SA 1HOCA 3IF1B 5HI3C 2IPKB 1Q9LA 2YR3A 5DRWB 4AL8H 2V2XB 4R96B 2NMSA 5DMGD 3SDDA 1WZMA 5B3JE 1DZBA 1QVOA 1QPXA 5M7QA 1RUMH 3QDGB 4KHXL 4JRXE 4GS7C 3EOBA 5J0BA 5I73C 4HS6A 5D1XC 3RWDB 3G5YB 3TO4B 1UWGL 2YEZA 4AT6A 1NANH 2VXUH 4DGYL 4YDJB 3LS4L 3VW3H 2FHFA 4LASL 2QSQA 3LN9A 5DWUH 4Z7UF 3LHPH 5D7KE 3PWVB 3EOAB 3HE7A 2PN5A 4M62H 4C57C 5EPMB 4L29A 2AV1A 1A9EA 4H1LH 4DFIA 3WN5B 5E6IC 4YDVA 2GEEA 5EZJB 1R5IB 1BLNA 4C59B 3WXWH 1I7UB 5D4QA 3V4PH 3TM6A 3HB3C 5HYJB 4KI5F 2PXYA 5D7LD 4HPOH 1N3NB 1ZEAH 1U2CA 1AQKH 3D3VE 3WBDA 5K9KA 5E5MA 2X2YA 1AKJA 3P77A 1H15A 4I2XE 4I77H 4NYLA 4UILL 4KDVA 4YNYA 4ORGB 4PUBH 3MYJB 4YEEA 1OTUD 5A16A 1G9NL 4HDIB 3X11A 2F74B 4WFFD 4IOSD 3PHQA 3CH8A 3HKFA 5ID0B 1HN1A 2RCSH 3A6BH 4NHUB 3SDCB 2ZUVA 3MBED 4HV8B 4QRUB 5E1AA 3ZKMC 4OCYL 5TPWL 4H8WC 4NWUL 2YA2A 3H9SD 1N8ZA 3NCEB 5FUZL 3V0VA 8CGTA 4JANB 3B2UC 3VA6A 3C8KB 4DKEH 3FQXB 1UADC 3B9KC 2ATPB 5CGYD 1TMCB 4XCCL 3QFDA 3GSWB 5FM5O 2WQRA 4ONHA 2VLRD 3C8HA 4ZTPH 4WGWB 1BOGA 3B5HA 1PG7W 2BFVH 4OZGB 3OXSA 3SKUD 1Q94A 5KVEL 4MAUH 5JMRA 2KQMA 4HJJL 5DMIL 4QHMB 4UT9H 3T3PF 1YYML 5IFHH 2OXGA 2X89A 5TE7H 4JM2A 5I30H 2ORBL 1MY7A 5TF1L 1H3UA 4PJEE 3U4BL 1RJYB 1IGTA 3KPQB 4M48L 3GHBL 5EUKA 4Q9RH 2FH6A 4BJLA 4Z7VA 2X4OA 1B88A 3HCVA 3IDUA 5HDQL 2ZOLA 4NQDE 2P5WB 3MCG1 3EYUH 1LNUA 3WE6A 3I84A 3BZEB 2G2RA 5IQ7L 2R4SH 1MPAL 5B4MD 1J5OL 3DNKA 1I9JH 4OLUH 4W4OC 1Q38A 4TQEL 3QO0B 1HDMA 3MV7B 2MCG1 5ERWA 5H35B 2NY6B 2UVFA 4JN1L 3LPGA 1F3DJ 4X6DB 2R2EB 1I1YA 2X1PA 2DI8A 5D6DC 4YR6B 5DMKA 4LDOB 4OM0L 4X9IA 3Q6GH 5LQBH 2A6IB 2C1PB 3P4MB 2ADJB 2V7HA 1CU4H 3MXWL 4EDWH 5MERB 1C16A 4Y5XA 1FNFA 1G9NC 2BK8A 5FM4A 4F15B 4HLZG 1Y6MR 2IANE 1EO7A 4GW4B 1GOHA 1NAKL 4NQCE 3MNVA 4KFZC 3QAZC 4XPBH 1K8DA 4I1NB 3U4EA 2VSDA 3T2NH 4BQ8A 2GSGB 5J1TC 3H9ZA 5CD3A 3O45B 5SWQA 3D85A 4M02A 1KTRL 5DUML 5IJVB 4KROC 3DURB 2FB4H 4JFED 4M7JH 5L88H 1U8KA 4JPWH 4LSTH 4UDTA 4M9PA 3VXSB 3T2PA 4MB3A 1OARL 1UC6A 1A6AA 1QKZH 4M61A 4P46D 5J6HB 3BQUC 4ZFOA 3VDAA 2NY3D 3UTQA 5HGAA 5JPMB 3I50L 3RPKA 3EFFB 5B38A 1TLKA 4NOBA 2DQGL 2IJ0C 4G6JH 5IB1B 3U46A 1YNTB 2BVPA 4RZCB 1MIML 3NCYS 1ZLVH 1FO0A 3RY6A 5ADOL 1XGPA 1R3LA 4GSDL 4KGLA 4JPIB 2FBJL 3K80A 3D25A 4U6XA 1OTTD 4ZFZA 3ARFD 2C1OB 4Z5RB 1T89A 2ADFH 4RX4A 5FM5M 4I0KA 1MFEH 4ALAH 4ODWA 2ICEB 4YO0A 1MUJA 4PJIF 2IWGA 5T1DH 5E2UH 3EO1A 3BEWB 1B2WH 1CGYA 2OS7A 5GRZA 1W72B 5ISZA 1UWEH 3HC4H 4HKJB 1Y6NR 3GRWA 1CGWA 4P99A 4XHJC 4XNXH 5DHVB 2P46B 5HHMB 5D7KD 3MJ9L 1E4KA 4KVNL 2V2TB 1HHGB 3N9GL 4NM4H 4XPGH 5DEZA 5EO1A 1JWUB 4GT7A 4PJDF 2EIBA 4KPHL 4XPHL 4EIGB 1VENA 3GO1L 5IW6B 5DJ2A 5I1JL 2B39A 1JVKA 2OTWA 4H5SA 4NFDA 3WLBB 3SJVA 3AGVA 2G60H 2HG5A 5FYKU 2X9XA 3FO1B 4JO1L 4K71B 1XAUA 1D5MB 4XPFL 5FOJA 3QEUA 1DANT 4CU7A 1IGFH 3ULUH 3D3VD 4O5LH 2O26U 2R9HD 3GSVB 4NBYB 3EYOA 5BO1H 5I1KH 2XNAA 4GMSL 1KYOJ 4NZTL 1LE9B 3P4NA 4XWOC 3VXPB 3STZB 2NXYD 3P3YA 3O2VH 1EEYA 4APQD 4OT1H 3RI5F 5D1ZA 3O8XB 3TPUB 4CKVX 3BDBA 1R3KB 2EDBA 2FEDD 2DQIH 1QSVA 3C6LA 4HFWB 1E4WH 1QEWA 1MAKA 2AQ3A 2F54A 4NQEE 4G6FD 2R2BA 2J6EH 1TCMA 4IDJH 5CUSL 4D9RE 1K4DA 2I9TB 4PJHA 1IGYB 5GGUB 1DN0A 3R4DA 1YA5A 4OZHE 3D87B 3BPOC 1IAKB 5EOCJ 1G7QB 2VL5B 5ELIA 3V9FA 3FQRA 1M6OA 5HI4C 1MCPL 2G9HA 3BAEL 1R3IH 4XB8A 3UO1L 4KUCD 4LSVH 3KXFE 1IAIM 4KJPD 3QDJE 1J1PH 1N4XH 3LDBB 4YHNB 4LBEB 4MA8L 1V7NL 1W0VB 4R7DA 3KPNB 3TP4A 2F8VA 4MXWH 3QIUD 2X4TB 4O4YL 1J88A 3RVUD 1LDPL 2J4WH 2NY4C 2H9GA 3GSRA 1OAXL 3ARGC 4KY1H 1E4JA 4HLZH 3PUCA 1ZHBA 2YPVH 2YD7A 4MVBC 3SQOH 2YRPA 1AXIB 3PQYA 5DD0H 5DJ0A 1KACB 3I9GL 4LCCB 1F3JA 1A1NA 3K4ZA 4Z7OE 4L3CB 2ITDB 3TBSB 5IFAH 2FLBT 3IAPA 2HJLB 1FSKB 4FFVD 4Z7QF 1JUFA 3HAEA 1KYOK 5DSCA 3X12A 2R1XA 4RSVA 4XCEB 1IBGH 5E9DA 3PL6D 3FT4A 4LVNB 4CMHB 4R7NB 4P3DB 4B5EA 5CJBA 4WWKA 4U1SA 1JPGA 4JQXA 2P44B 4RAUB 1J1XH 3IT8D 1X5AA 4OFIA 4UTAL 4DCQB 1FZMB 1QFWI 5FFLA 1VHPA 3MUY1 5HHPB 3WNLA 4ESKA 3BKJL 4D8PB 1EAPB 5FECB 4G9DA 2OCFD 4G42A 1FCCA 4GRLC 1RJLB 4PP2B 4FQQA 1T66C 2QQLL 3HZYA 3PXJA 2D03L 2W1NA 1DQJA 3TYFB 4NQCD 1NCUA 4LKXB 4QY8B 5BVJB 2MSPA 1X5GA 2DM2A 3LOWA 4ONGH 1EO8H 5EC2A 1A4KB 2PXYC 4O2EB 4NKDA 5HHXL 2D31B 3I02A 4YHZH 1OWRM 1AC0A 1A3RH 2YRZA 1G7IA 2HVJA 4P49A 2WBJC 4OFVA 4MQXD 3CXDL 4NZRH 2CKBB 2XG5A 2CDEA 4WTZA 1KFAH 5HVHC 4BH7A 1I9EA 1QBLH 3PP3K 1VA9A 3QP3A 1UYWL 3BIKA 3HG1B 4LVEA 1TTGA 5IK3B 5JHLL 2FGWH 3X13A 3Q5YA 3IDGB 2VQ1B 4B53A 3GM0A 1EK3A 2MKWA 4DKFH 3BWUC 3GMRB 4X99B 2P8PA 3CLFL 2WWMD 2V17L 2C7UA 1MI5A 1NFDA 1OP9A 4ZUSB 1FDLL 1BVKA 4LP5A 4UNVA 4LEXL 3RGVA 1FVCA 5A2LH 1ZA3A 2RR3A 1A1MB 3F62A 1YDPB 1U8OA 5DK0A 4F7EB 1CQKA 2C4FU 3S36X 3RWCB 3QHFH 4FTVA 3SEPA 5FYKE 4Y8AA 1MRDL 2HTLC 4UZGA 3WNKA 4G8GA 5JHDE 5MENA 4JM2C 4KZDL 4PRNB 4ODXB 1CXIA 4RFEA 4DWHA 4ZFOL 1SY6H 4TTDC 1P1ZA 1EBAA 4MD4A 5EORH 4DGVH 1EBPA 3BJLA 5F89B 1T5WA 1H3XA 4QRPE 1KPRA 2VE6B 2CLRA 1ZOXA 5F6HI 3BGAA 3LKSB 3MA9L 4MNQE 3ECBB 5CZXD 4V2CB 4ZS7L 1WBXB 1OT1A 3F5WA 2CRZA 3VWJD 4Z77A 1U8JA 3MFGB 4G80A 4N8CH 5JNYB 3IB4A 1S5IL 5IVXF 5I8EA 3VGBA 5JW4Q 3ROLB 1DUYB 3WIFA 5J06A 1T1WA 1QLEL 1QACA 2YHGA 4YLQT 3CGTA 1XR9A 5AD0B 2NY7L 3OKKB 1CICA 3LS5L 1KC5L 5E00A 1FL5A 3Q3GA 2QQKH 3WO3B 4XPAH 4LSSL 4WWID 3ARUA 4MGXA 4JN2B 1QSFD 4C58B 4OZFB 5FHBH 1OL0A 1DSFH 5I1IH 2VLJE 3F7YA 4KKAD 4NHCL 5IWLC 3LB6D 1EAJA 3UTTE 4JFOA 5F9OH 3T1FA 4PBWD 3RUGE 2E6JA 4XMLH 3T4AA 1K8IB 3DX9B 5HTSA 4IM8A 4WFED 5I16B 2FATH 4OFYD 2B0SH 5IESH 4LQ1A 3WIIL 1T1YB 4CVWA 2E8ZA 5DGQA 5C0EA 5KG9B 1XCTB 1YY9D 1MLCB 3ULUE 4JRYB 2JB5L 4MS8D 3FQWB 2WQ8A 1GYAA 1H8NA 3RJDA 4IMKC 4NJ9L 5ACLA 3QDJD 4B0MM 1MHCA 4Q9QH 4IRSA 1WISA 3AM8A 3T1WA 1JYVA 4OZIA 3VJ6A 1TCRB 4MLIA 1CG9B 1UCBL 1PAMA 1N6VA 3MLVH 5ESVA 3ULVL 2UYLA 3DV6A 1MVUB 1UZ6F 1CDUA 3BO8B 2A0LC 3P0VL 3KR3H 1NEUA 3TA3A 3GSNH 4TUJA 5JW4M 3IGAA 4IS6B 2BVEA 4DW2L 1N5YL 5GJTL 4CMMA 1TZIA 2A2QT 2VDRH 5IOPB 1A6UL 3CK0H 2IG2H 1H5BA 1UFUA 2W91A 2ZSVB 2VWEE 3EZJB 1S8DB 1NGPL 1JGUL 1T21A 4JREB 1L0XA 1QNZH 3A6CL 1LMKA 1Z9MA 5BQ7B 2CJUH 4HS3B 2RAMA 1KJMB 5HPMB 1FL6B 1L6ZA 5CINL 5GPRA 5FK9A 3IDNA 2BOBB 1DCLA 4L4TB 3K46A 4UMGA 43CAB 1T89C 3SCMA 3NH7H 2XZQH 2YD2A 4S0TD 4LU5H 3ZYOA 4EN3B 1VEPA 3MRCA 4H8WH 3MLSL 3LH2L 5K9JH 1J7VR 1EZVX 4PS4H 4AEEA 2GW5A 4R90L 2FIRT 2UZYB 1GC1H 4GAJL 1CS6A 1NCCL 3VFNB 1CF8H 2PF6A 2X4NB 3GGWB 2JJUA 3Q2CA 1G9EA 3EJYC 3C08H 1DE4B 4IOFC 4NO2A 3FQTB 5ID1A 4ETYA 5LGKA 2J8OA 1MHPH 3DXAD 4GW1A 1S9XB 1MCNA 2R56L 1LO4H 5I15H 2ITCB 4AM0B 2H6PB 4F2MB 1LK2A 3IFOA 4N0CD 1JPFA 4MA3B 4NN6C 2DIBA 2OLDA 4KXZH 2E27L 1CBVL 1YEDB 3QUML 3IDJA 3QEQB 4PGDA 3T77A 4ETQA 3REWB 4LDEB 4NZUL 4FQJL 5FYJL 3S5LA 3K2UL 2O61A 5DJ6B 1D5ZB 1QFPA 5JUEL 3I2CL 4RGND 3VFVA 5T1KD 4POZC 5D1ZC 1PKQA 3MGTA 4LPWA 4WDIB 3TNNA 1AXTH 1PX4A 3ULVC 1J0IA 1FIGL 1ZS8B 1TTUA 2AJZA 2C3VA 1I1AB 2ATKB 4GKNB 1W0WB 3C5SA 5HGGS 4MAYA 4HWNA 3O41B 1BBJA 1KIPA 2GITB 5KVMC 1N6UA 3OKEB 3IDMB 5IB3A 5CSGA 4UILH 4WI5A 1WTGT 4Y5YA 3D69A 4QLRA 3LKNA 1DR9A 5J1AB 4P2OC 4S1QL 4BYHA 1KCLA 1DLHA 5F7EH 4D2NA 1G9NH 1R6VA 2D7NA 5HXMA 1Y6KR 4QRRB 1MOEA 3F7PC 3L7FA 4OM1L 4JM2F 4Y2OA 3LKPA 4WCYH 3CZJA 3RVTC 5L6YH 2EH8H 1T4KA 2G75B 2EO1A 2R0ZL 4FFWD 4WU5A 5FYKD 3GI8H 2Z9TA 4OCYH 1CK0L 2VZUA 1S7SB 2Z35A 3CC5A 4LSQL 4QHKJ 4Z7VF 5TPWH 5JHDD 1YYLL 4YH6A 3R06A 1DQML 1FQ9C 1KIUA 5KSAA 3V5KB 4MSWA 1DDHB 4I48B 1CFTA 4PJGE 4V1DE 4ISVA 2XV6B 1UZ8B 3WHE0 1CDGA 4X80L 4QRPD 4LAJH 3SDXE 1LEIA 3LSOB 1YUHB 2XN9B 3HPLA 3CDGB 2EDLA 2BDNL 2VDNL 3BH8A 3VE0B 4BSVB 3THML 1S7UA 4X5LA 3G5XB 4LRNH 4PV8A 3VD3A 2WP3T 3O11B 3OAYH 5J7CC 5DMIH 2EE2A 1M71A 1MCBA 1KBGH 2HJFB 4Y16A 4FZEH 3U36A 4Y4KB 4J4PD 3T0EB 2P43B 4JQXC 2XA3A 4WRLA 1AXSA 5I1AB 4Q6YA 4ZPVA 3U4BH 2JIXB 3GHBH 5LAXB 1MJ8H 3MJ7A 1KCRL 5I2IB 1UCTA 2AQ1A 2AAVA 2R23A 4HIJA 2VLJD 5BVPL 4U1JB 3V6FB 2A73B 4JVPA 3UTTD 3FT2A 5E8EA 4FRWA 5EBWB 1R24B 1A21A 1HQRA 1MPAH 1BHGA 5C0NC 4PJXB 2OBGA 1J5OH 2B8OT 3VXME 4CU8A 1A7PH 2CK2A 4XNMA 4TQEH 2WANA 3O4LA 1T5XA 4X7SL 4I0PA 2DLEA 5E8OB 4M1CC 5CLTA 2EC9U 1NCWL 4LF3B 1FYTE 4ZFFA 3CZFB 1A7RL 3ULUD 4Y7MA 2DQJH 4R2GC 5BOZG 1PX3A 2APWA 2FHCA 4IIQB 4OM0H 2X4SB 3NCJL 4LQFL 4ZUTB 3ZZ1A 3UTZA 3D48R 3U2SB 3ZO0A 1T2XA 4G6KL 3BMWA 4OTXL 4ZDHA 1OHQA 4M4PA 2PR4L 1KCSL 2GSIB 3KYOB 5IIEB 3O3DA 1S3KL 5EU6D 5I74B 4FN0A 5GS2H 1IT9L 3U7WL 1E27A 5K59F 3BGMB 1G9ML 3ULSA 3TIEB 1YEFH 5T33L 2UZIH 3WKNA 5T1MB 1UM5L 2OK0H 4OSUH 4P5TD 4YPGB 1OSZA 3KWWB 4JZOA 1FNEA 3QZWB 2GTWB 5AG8A 4AK1A 4HGMA 4W6YB 3TIDA 2DM7A 5CHNA 4LSUH 2YS4A 4PJIE 2EDNA 2P42B 5L8JB 5FV2A 2DS4A 5ICXB 5HYSA 2WIIA 3EOTH 3EZ8A 5GISL 3HMXA 1L0QA 5HHNB 2XTJB 2QADB 3ZDXF 3H0TB 3HZVB 1YEJL 1NMBH 4NKMA 3MLRL 3MCKB 2J8HA 4YHYB 4K3DL 3DVGB 4JPVL 4WW1A 4EDXA 4OIIH 4MD5A 2GY7B 1OVZA 2C9AA 4A6YH 2DQGH 1KB5L 5HGHA 1NEZG 1RPQA 3WJJA 4KI5D 4HHAB 4KI1A 2AJ3A 2CXKA 3BISA 1VKXB 4QEGA 3WFEL 2CR3A 3QBTB 2YRLA 4GSDH 2VAJA 2RIKA 3MROB 2FBJH 1A7OL 4HJ0D 3W9DA 3HC0A 5GZOC 5F72S 1GGTA 3QI9D 3FOLA 1KIRA 3QDAA 1A2YB 1AR1D 5TE6L 4D3CL 5GJSL 5AEAA 1ADQA 2BY2A 1F2XK 5DRXB 3MXVL 4HXBH 1FZJB 5FV1L 15C8L 1F90L 5B8CB 1CXKA 1MEXH 1T1XA 1X4XA 4X4YA 1CICC 4U7KA 3OPZL 3WNOA 3EJJX 4AQ1B 3MJ9H 3BUYA 3SKNA 4MJIE 4YQXL 2AI0L 1ITBB 2RJMA 2YUXA 2WUCH 5JOFB 4D0DB 4PJHF 3NCYP 5GGVH 5KN5A 5JQ6H 1G9MC 1U8LB 3E2HC 3QIBA 4X5XA 2A9NH 3SN6N 1A3QA 3RKDD 3GI9H 1NDMA 2CRYA 2VAAB 5DC0A 3G04A 3CPLA 4NZTH 3ES6A 4E41A 3LRGA 2R2HB 3GIZH 1U92A 4M6OH 5EBLA 2VLME 3QXTA 4JFHE 4ZUVA 3K7UA 4G6ML 5HYEA 4J3TA 4R4BB 1N0XL 4YFLF 4O02L 1I75A 4CRPA 4OCRH 4DEPC 3AM8C 2VKXA 4NZDA 3RWEA 4C83A 1FZOB 4PJGB 4X5WB 1N2RB 1MHEA 2APXA 1XR8B 1F4WL 2JLLA 1D6EA 2ZCHH 4X7TA 2BMKA 1MF2L 3PV6A 5B38G 2QEJA 3OG6B 3V6ZB 5IMLB 3IDIA 3NN8B 3L6FA 4LLAA 4K7PY 4F57L 1AGCA 3PWLB 3GSXB 3BAEH 3QUZD 1AD0B 4V1DD 5CBEB 5CLWA 3E1F1 5JDSA 2E7LC 3ALPA 3HS0A 4Y8DC 4MA8H 1D9KA 5I0DA 5DEGB 3NZHL 1T1ZA 5C0FB 4HUXB 3DSFL 3MNZA 4X8JB 5FUOL 1VERA 5INCB 4Z8FH 3DX8A 3AB0B 2BRQA 3SCMC 3OKOB 1T20B 5LGJA 2RHEA 4M6NL 1UB6A 1IQDB 2X4PA 3QH3B 5INDA 1WCBA 1Q9KA 2VZOA 4QXWA 3WV0A 4Y19A 3QQ4A 4NQXB 4LOUD 2YBRA 2EDQA 3KAAA 5IHLB 4ZXBD 3QA3A 2CQVA 5MI0B 4ZO8A 3Q0HA 5LWYL 3SGDH 4PRHE 3C60A 3E8UL 3RL2A 5C3TA 1I7RB 5D2NE 4NSKA 4PJ9B 4DAGH 5TGBB 5E4EB 2EIDA 4EQ2A 3V5HB 4MJ5B 4XVUC 3VXMD 2ED9A 1NGYB 4NGHL 5DLML 3RWGB 3X14A 1WFUA 2VIRB 4YHLL 3MREB 5E6ZA 1GXEA 4U1MA 4QRTB 5C0CA 4E5XB 4LEOB 3BKJH 2NX5A 1EH9A 2CKNA 4NRZA 3W5MA 3MR9B 2F5AL 4NC1C 1OP3H 5FKPB 3W11D 1JWSA 3TBWB 5MEPA 2AV7A 4PREA 2QQLH 3T09A 3I6LD 3SBWC 5HI3D 2D03H 1HYSC 4PIRF 3NA9H 2BNUB 2F53A 1CFQB 1NBYA 3EYSL 2Y06L 2FJGB 2P24A 3U83A 2W60A 5D7JA 3FN9A 3FONA 3OB0H 5E8PA 3DRTB 4K8RL 1GJIA 4OD2A 4JFFE 1H3PL 2NW3B 5C0BE 1NAML 3FO9A 1KPUA 1TPXC 3KPLB 4MAYC 2GFBB 4KMLB 1OTSC 3SGKA 3LKQA 1NFDF 3FB7A 5LXGL 1KIQB 4N1EA 1IAIL 5JA9A 4YHKH 3RZCA 2J8UA 4L3EA 2ZUTA 1YPZA 3TN0D 2BNQD 4X7EC 1GGCH 3CVHB 4PG9A 4GW5A 4WW2B 3DMMC 3TWCL 4YX2L 2WP3O 5DI8A 1TTFA 2IH1B 1QSEA 5EA0H 4TNVF 2EECA 4LLDB 1XZ0B 1CQYA 1SQ2N 4CNIB 1OWWA 4HAGA 1BD2E 4WV1B 3WJLA 3GDBA 4LSDA 5CCKL 1IM9A 3HB3D 1NCAL 5C70A 4GG6A 4XCYA 3CLFH 2EIEA 3O3AA 2W65B 5KSAC 4ZNEA 3IFPB 4GQ9H 5AZEL 3HAEG 2EH7H 3O4OB 3QJFA 5KSUA 4Z0XB 4PTUA 2A38A 2AXFB 1T83C 4ELME 2BCKA 3HMWL 1EHXA 1FDLH 2NZ9C 1YN6A 2APTA 3CX2A 5EU7E 3GJFK 5F1NA 2IALB 1DBBL 5ACZA 4UDUA 5DHYB 4L4VD 3QCVH 4PJCB 4M4RA 1PLGH 1FNAA 3Q6FB 1AQDB 1T7XA 4Y16C 1LO2H 2PTUA 4KZDH 1HI6A 4YHPA 3LZFL 3ZKMD 5E5RB 2D7QA 2O5YL 2X09A 4KTYA 5EC1A 5HHOE 5IMKA 1TNMA 5J12C 1FG2B 4RGMB 5DJAA 5BXFA 3B2UD 3ARYA 1KN4H 2YA0A 1CLZH 3DIFA 2CUMA 4BQ6A 5BRZA 4MJID 1FO0H 1T3FA 2FX7L 4HD9A 1JFQL 1RHHA 1AO7E 2DDQH 2IBZX 2V5TA 3SE8L 2FEEL 4S2SA 2C4FT 2DTSA 3RTQD 4HT1H 1S5IH 3ZE1F 5MEOB 3D18B 4UOW1 4K94H 3TYGH 1HH6B 4CJ0A 3EO0A 1A64A 1QLEH 1ADQL 5KSBA 1JV5A 4F9PA 4GBXB 5F1IB 1BP3B 4F3FA 3TBTA 3V5DA 4CN1A 4P2YA 3PWPB 3FZUD 1FAIL 2AJXH 2BHYA 2ADIB 2Y7QB 5EOTA 4LSSH 1TJIL 1UZ6E 3FOMB 4XCNA 4LFHG 3C5JA 3GRWH 4WTZG 6FABL 4OZIF 3JV5A 5FKAB 4JFHD 4P9ML 2QBWA 3UTSE 1AY1H 1J10A 2YPLA 4F58L 1Q1JH 4XWGL 4QO1A 1YECL 4CVUA 1ZGLP 1VPOH 3E3QE 3IF1A 1JHTB 2IPKA 3HNSH 2CR6A 3MRFA 5DRWA 2V2XA 4KHTL 4R96A 1OGAE 3OTTA 4JHAL 5GRJH 1EMTL 2J3SA 4U33A 2YWYA 3QDGA 3WIIH 1CDJA 2DBJA 4XXDA 3G08A 1JHLL 5D7SH 1X5HA 2VH5L 4J3OC 2W92A 1OAZH 3TO4A 2JB5H 4KRMB 2FR4A 1V05A 2BSTB 5CSZA 4FS0A 1LO5A 4RBPH 4YDJA 3EGSB 5DFTA 1NC4B 3N1PC 3H2WA 3LRHA 1PSKL 3PWVA 3BUTA 1S7WB 5D71L 5EPMA 1BQHB 2PO6D 4LRIA 4EI5D 1UCBH 3WN5A 1VFOA 3QPXL 1T2QH 3IDYC 1BWWA 1BECA 4JLRB 4UV7L 3FMGH 4JDZB 1A6VH 1I7UA 3JZ7A 1WK0A 2VLKB 5HYJA 2X41A 5GJTH 5F7UA 1N3NA 3KJ4C 1J11A 1A6UH 5I1DA 1LQSR 3RFZC 4JFXA 3NIGE 4KROD 1EFQA 4RA3A 4EJ1C 5IEKB 4OD3L 4PBXA 1E6OL 3A6CH 12E8H 4PRHD 2MTPA 3MYJA 4PJAB 3VG0L 3VXNB 3CMOL 4C56A 5TH2A 3CXHK 1NLBH 4HDIA 1XGUB 3VXRA 4OI8A 1BM3L 1I3VA 32C2B 2UUDK 3ARBB 1P84K 5ID0A 5IBLC 3N50A 4YXLH 3MLSH 4TVSa 3WFDH 3SDCA 3QIWA 3BQUD 4QRUA 3SDAB 4O2FB 2DYPD 4R90H 2V6HA 4GAJH 1NCCH 4KDTA 4NQTA 3VWKC 1QRNB 3QUYB 2ED7A 4LSPL 5C0BB 5BCAA 4Y2DB 1EO5A 2WINB 3GBLA 5J13B 2DLIA 1AGBA 3UZQA 3GSWA 3HAEH 5C0AB 1NSNH 2YD6A 4NQVA 5CP3A 1F4XL 2R56H 3MRRA 4FQXD 4ZFGL 3MRDA 1KLFA 1FFOB 3HE6A 4P2CG 4LGPB 1YQVL 4AZ8A 4QHMA 3PV7A 1RJZB 3WSQH 1U2HA 3VFUB 2Z92B 5EBMA 2E27H 4MA7H 1CBVH 4L8SC 4MYWB 4YHOH 3ELAT 1BFTA 1RJYA 4FQJH 3TBVB 4U6YB 2H32A 3KPQA 5EDXA 5JUEH 4GRMB 5DVLA 4Z7VE 5F6IB 3I2CH 2D7PA 1ZLSL 4OBSA 3VXUE 4PJFA 2P5WA 4W68A 1RHFA 1UJ3C 3QDMB 5E94B 5I71C 1UVQA 5I8OL 4PJ8D 1J8HA 4TSBL 1HHIB 3BZEA 4ELMB 2DJSA 3CFCL 1JZ3A 4O51B 4JJHA 3W2DH 4JVWA 3QO0A 5L2KE 1I8LC 2VUOA 1BZ9B 2EEDA 3MV7A 4FXKA 1B0RB 3CFEA 2ICCA 4ZAKB 3QHZL 4X6DA 4JY4B 5C6WH 1WC7B 4YR6A 2XA8H 4QXGH 2A6IA 2C1PA 5D72H 1KCVL 3P4MA 3TPKA 35C8L 5MERA 1U8IB 4D9QE 2JTDA 4OGXL 4GMTL 1OCWL 4OM1H 2BVUA 4NJAL 3BT2L 4GW4A 3WLWC 1DFBL 2MQ3A 2R0ZH 3LN5B 1F8TL 3MUZ1 2HLAB 2ZJSH 5KW9L 2MKLC 4H20L 1ZHLB 4UU9A 1P7QD 1UB5B 1N64H 2ZG2A 1KTLB 1MLBB 4BFBD 1YYLH 2OXHA 1DQMH 3FO0L 1CGSH 3O45A 3P0YH 5HHOD 3IJHB 3CFIC 3DUSA 4JPKH 3RDTC 4CDGC 3C2AH 1NUDA 1KELL 3IKKA 2Q8BL 4X80H 5DDHB 2NQCA 5IJVA 2R15A 1R3JA 3DURA 4P2QD 3JWNC 1HE7A 2PW2B 1LO3H 3C60C 1AO7D 1OAKL 5HY9B 4FMFA 1EVUA 4W70A 4WUUB 3QULB 5C0RH 4RWHA 1ZXQA 1LDSA 2DTML 4PJBA 2Q76A 4M6MH 3ARGD 3IVKB 2ICWI 4HZLA 4KKLC 5L2JB 5J6HA 5HI5D 2N56A 2OJZL 1KCRH 4DZBB 3EFFA 5I1GL 3OKNB 5FA3B 4FOMA 4NRYB 1U58B 2DF3A 4JRXA 5IF0A 1YNTA 1BIHA 3L3IB 5IGXH 4U0RC 3UTSD 3T0BA 1OT2A 5FYLL 4ELKB 4YE4L 3MUGA 1DEDA 3L3KB 4JPIA 4M1DH 1A5FL 3SDDD 1MCSA 2DKSA 4XVSH 2C1OA 2EDYA 2F19H 3DVIA 4X7SH 4Z5RA 3N1MC 1YEHL 3L95A 4OI9A 3S88L 5AYUL 3MRLA 4UT6L 1A7RH 1ZLVK 1VFAA 3WFHB 3BH9B 3BPNB 3SGKC 4U3HA 3NCJH 5ISZE 1W72A 4KDWA 5ILTH 1F42A 1CWVA 4G6KH 4HKJA 4OTXH 5L0QC 4J12A 4WGVB 5DHVA 4BH8B 3HE7D 1KCSH 4M5YL 3QXUA 4ZODA 3FB6B 1N7ML 2QHLA 3PIQB 4MJ4A 1G9MH 2QTEA 3TCLB 1OGTA 4NO3B 3WLBA 3TC9A 3K4DA 4JHBA 5KTEL 1N5AB 2EC9T 2N1KA 4JJ5A 5KS9B 4LDLB 3FO1A 4APQA 3QUXC 2PXYD 3V6OA 1UGNA 5C07B 5ADPL 1Z6JT 3V6BR 3GSVA 2NNAA 1KJ2L 5E95B 4Q6IC 1AKJD 3ARDB 3NGBB 2C3GA 3NCCB 1LE9A 4DGIL 3BN9C 4RAHA 3VXPA 4P4KA 5SWZE 1SEQL 4XNUH 1ROWA 4HUUB 5GISH 1WBYA 2VXQL 1C5CH 2F58H 3O8XA 3TPUA 1SMOA 1R3KA 1TQBB 3WDJA 5DD1H 3BKML 2DQDL 3R8QA 4K3DH 4JPVH 2W0LA 3HUJB 3FB8A 4PJHE 3AS0A 2I9TA 5GGUA 4NKOB 5CGTA 3BDXA 1JGDB 4RMQA 1HNGA 1Z2KA 3VRJB 3WFEH 3HNTL 4KJWC 1FV1B 4Y1AE 4OFPA 4B50A 1BIIB 4J3XA 4NKIL 4YHNA 3IS1X 4D3CH 1W0VA 2A6DB 1PDKA 5GJSH 1ZE3C 4YIQB 3DROA 2FRGP 3MXVH 1P9MC 2X4TA 1QSFB 2N7BA 2KQNA 4NQDA 2ARJB 15C8H 1F90H 1RUAH 2A1WL 2HTLD 2NY5L 4JKLA 1KSRA 2X89D 4JM2D 1EIBA 3PQYE 3BDYL 3HTLX 2AK1H 1GL4B 5LCVH 5B3NA 4KV5F 2CIKB 2IFFL 3P9WB 4LCCA 4FQIL 3UBXI 5D9SB 3VXUD 1EJ6A 2ITDA 1HXYB 1QFOA 3SY0B 3TBSA 2H3NB 3G6AB 4KTEL 2HJLA 3JWDL 4YWGL 2E7CA 1CIDA 4IJ3B 3FCTB 3OAUL 4NNXB 3TCXA 4YHIB 2B1HL 3PJSB 4MDJB 3W5NA 5EZLB 3QEGL 5HHQB 1PY4A 2FO1A 4R3SB 5E9DE 4P3DA 5E8NB 2HT4D 4LGRB 4HIXH 3DUHA 3BWAB 3ZE0F 2IANA 4LP4A 2DWDB 4RAUA 2IBZY 3T8XB 4MLSA 5HYSG 4JFDE 3ESUF 4PGZA 5BS0E 3S4SB 1B3JA 2BSED 4DCQA 1ODAA 3MRMB 4ZUWB 1CFVH 4MX7A 2K1MA 4G6MH 5HHPA 4NO5A 3OJDB 1F45A 1G7JA 1RK0B 3AAZB 1AI1L 1N0XH 3GJFA 4O02H 4D8PA 5IV2B 2FX8L 3UJJH 5J56B 1E28B 1EAPA 3DTXA 4X98B 5FECA 3WO4C 1RJLA 4PP2A 4DK3A 1F4WH 3VRLF 4RQQB 3IXAB 4M7KL 3SE4C 2VABB 4L3AA 3WN5C 3TYFA 5I17B 1PQZB 1UG9A 4L4JA 3IRZA 5IBUB 4QY8A 4K7FB 5BVJA 1W8OA 1LGVA 1RZJL 1D5IL 2AP2A 1A4KA 1MCIA 1OTUC 4OI7A 2D31A 4OJFL 1TJHL 3T2OA 3D85D 2K7PA 2R0LL 1INDL 3T4YB 1I9IH 5GQBA 3UJIH 4DUWA 3MLTB 4LLUB 1LHZA 1RAMA 3MBEC 3V95A 1F3DH 3NZHH 5KOVC 2CKBA 4FQ1H 4F9LA 3K4AA 4FQLL 5BV7L 3IFLL 4QHNB 4RRPA 2X1WL 3MFFB 3DX6B 2C4XA 4LARH 4LCUB 1F02I 2I5YL 2Q86A 1AFVH 1CYGA 1FN4B 5AAWA 2A0LD 1EX0A 3HG1A 5CGYC 4Z18A 5GIRB 4JAMA 1EERB 2NY5C 5IK3A 2HN7B 4JG0H 5D93C 3U0TA 3IDGA 3QIWC 7FABL 1C12B 4TN9A 1F4YL 3DXAB 3BEVB 1A6WL 1RIVL 4EUPA 4XNYL 3GMRA 4X99A 4Y4HB 3BE1L 1UACL 3PABB 1BAFL 3E8UH 1MI5E 5K9OA 4ZUSA 3F7VB 3JWDC 3BGFB 3GEWB 1WV7T 3MOAL 2A77H 1T7VA 1KEGH 4GAGL 5DZLA 2AABL 4GAFB 3QYCA 3VI3E 1A1MA 1YDPA 4F7EA 3HE6C 2J8UF 4RX4D 1VCAA 5DLMH 3RWCA 2WK2A 5ESQB 3JV0A 4RGNB 3UCRA 4I3GA 4G8GE 3WIHL 4PRNA 1HCFX 1JNNH 4ODXA 4BUHA 5GGQL 5ISZD 3MRIB 2F5AH 4YK4B 1MFAL 5DS8B 3MV8E 5F89A 2VE6A 2E7HA 3LKSA 3SQBA 3ECBA 4WTWA 4LSRL 3EYSH 1WBXA 2Y06H 3SO3B 5CJXA 4GG6F 3FFDB 3SJVD 2YWZA 5JNYA 1H3PH 1ZHKB 1NAMH 4P59L 3ROLA 4Y4FB 1LEKB 1DUYA 1TQCB 4JRWA 5FO8B 1QHOA 5LXGH 5AD0A 1IM3B 3OKKA 4NQEA 1WEJL 1JNHB 4IMLB 3C6SB 5IQ9A 3TWCH 2ZKHH 4JN2A 4OZFA 1FCGA 3U0PB 4TRPH 4PRPB 5B39G 5D1ZD 1YJDL 5BV7C 1RFDL 1J12A 3NFSL 3C6LD 1GZPB 5I6XC 1DBML 2F54D 5CCKH 1K8IA 5J57B 1AHWC 1D5XB 3KXFA 3QDJA 3LRSB 4WI3A 5SX4H 5DRZB 5I16A 1FNSL 3U7AA 3P73B 3VGAC 4XX1G 2OTUB 1T1YA 5C0IB 1BVZA 5KG9A 2GT9A 1MLCA 1SM3H 3VFSB 4WVRA 1R5WB 5FCUL 1LEGB 1P4BL 3RAJH 1CD1A 5JLZA 3HMWH 4FXGB 1WIUA 5FGSA 4MCZB 5TDOB 2FZ3B 3U0WH 2YPKB 4Y1AD 3RQ3A 3O6ML 4P46C 4NNYA 5GZNC 3H8NA 5KSBF 1RZFL 2NY3C 3HMXH 3RNKB 4JKPH 4ZO6A 2H26A 1CG9A 3GM8A 1L7TH 3CFKB 1MVUA 3NZ8B 3BO8A 3LZFH 3W0WE 2IAMB 3PDOB 1OM3L 1D6VL 4OUUB 4IS6A 3JWOH 4HF5L 4ZD3L 1OAYH 3PQYD 1OTTC 5SX5K 3ARFC 1IKFL 4I8DA 3P4LA 1A0QL 4J23A 4YDLC 5EOCH 2ZSVA 4HIIB 1S8DA 2YUVA 4FQHB 3SE8H 4M3JA 4R4FH 1QR4A 3LQMA 5BS0B 4LNRB 2EEBA 1L4IA 5J11B 3WFZA 4HS3A 1KJMA 3T3MF 3KLSA 5HPMA 3BSZL 2UVEA 1FL6A 5F96L 2BOBA 1ADQH 4MHHG 1JK8A 4KAQH 5E9DD 43CAA 1PKOA 2VN4A 4UQ3A 2FWOB 4HEME 2MQ0A 4WWKD 1S7XA 1FAIH 4U6TA 4EN3A 3V52L 2XKNA 1TJIH 2Q8AL 3EO9L 1G6RB 4JFDD 6FABH 3SE9H 4XBEH 4LCWE 3VFNA 1VFBB 2YD1A 3DO7B 3GGWA 1JBJA 2WWKT 3RI5K 1U42A 4JZNB 1YJDC 2AJSH 4I18B 2R9HC 4H0IA 2FLRT 4KHTH 3CFJB 3PP3H 1XF5A 2OP4H 5C0ND 3NFNB 4PRIB 5D8JL 1MQ8A 4M8VA 2HWZL 2NXYC 2ITCA 5FDWB 3RIAF 4F2MA 1DVFB 1JHLH 2VH5H 4APQC 3PGDB 4M7LH 5D1QB 1PY9A 4ZSOE 1NKOA 4HC1A 2FEDC 2GKIA 4G7VH 4LGSB 1SYVA 1IGIL 2Z4QB 4R2GD 2FHBA 3H42L 4Z7UB 1YEDA 2D3VA 1WLHA 4OV5B 2NY2D 4N0UE 1U95A 2Y5EA 4JCMA 5D71H 4P4KC 4DN4H 4UTBL 3LAFA 5F8QC 4XP6L 2A74B 4HKBB 4RA0C 4CN6A 1ZLUH 4AIZB 4LFHD 1HSBA 3QPXH 4JY6B 4DUXA 2HJKB 4E0RB 4E9LA 2EE3A 1ZS8A 2CUHA 2R2CA 1FJ1A 4OB5L 2ATKA 3MGOB 4F8QA 1W0WA 1I7ZA 3AREA 4BQ9A 2GITA 1CL7L 2P49B 5I1EL 5DT1L 4N0RA 4RMTA 3IDMA 3CH1B 3RA7L 3QIUC 3RVUC 4OD3H 1LO0H 1E6OH 5J1AA 1MI5D 3VG0H 2NCMA 1GZQA 3ZE2E 3D2UB 1Q0YL 3RGVD 4QRRA 4WFGE 3PHOB 3LQZA 2Z8RA 5AZ2H 5I8CB 5AWNL 3HR5B 4BKLB 3HHRB 1M7IA 4LVHC 1HZHH 4ZPTB 3RHWK 5JXAL 4FTVD 4MNHB 2G75A 4MNQA 4FFVC 4DOHB 3FT3B 3ILPB 3MUHL 4G8GD 5MEND 4PJFF 4GKSB 4N0YH 3FRUB 4OZ4A 3QT2A 2IGFL 2OI9B 2WZPD 4KJYA 3V5KA 5SV3A 2VISB 4I48A 3S34H 3PL6C 4POYA 1UZ8A 3VMNA 1QFUH 1U6AH 1A22B 4U1KA 2NXZB 3LSOA 4UAOB 1YUHA 3D39B 3JV4B 4OQTL 3CDGA 3DI2B 5GZOD 1S9YB 2OL3L 3VE0A 5AUMB 4ZO7A 4ZFGH 1S7QB 3G5XA 4XC3H 1GHFL 3A67L 3PDDA 1SJVA 1JF5A 3O11A 4WHCA 1YQVH 4XCFL 2OM5A 4QNPF 4X6DF 2HJFA 1JYNA 2AJVL 4WO4B 4N5UA 4QXUH 4HWUA 3S98A 3SOBH 5I1AA 1CICD 2JIXA 4ZOBA 4AL8L 4U05A 5LAXA 3OAYK 5H94B 2CIIB 1ZLSH 1A6ZB 4GKOA 5IM7B 5C0GB 5CEYB 4U1JA 5F7DB 3V6FA 2A73A 3L5JA 1ZGLB 1EEZB 2Q6WB 5LKNA 2VXUL 3NBNA 5EBWA 1R24A 3B5TA 3VW3L 2IADA 2AKRA 3O4LE 2WLYA 1UH3A 3VG9B 4MQXC 2XZAL 4M62L 43C9B 3B83A 1IARB 5E8OA 2NY0C 1WBZB 3KPRB 4QRQB 5E1HB 4O00A 3TJHC 4IIQA 3CU1A 5GGTA 4ZUTA 1NGWB 3WXWL 3W0WB 1BFOB 3OXRB 5D6CB 2CK0H 4PJ5B 4PJBF 5F9WB 3KYNB 4PR5B 4HUWB 5ACMA 4OGXH 4HPOL 3BZ4B 3ZSTA 3GBNL 1ZEAL 4IRSD 2GSIA 1AQKL 4WHYG 1F11B 3KYOA 5F88B 4MWFB 1EHNA 1DFBH 1F8TH 5KW9H 5BW7A 1KEML 5B3JF 4X4XB 2P5EB 3BGMA 3O9WB 4I77L 4K23H 2H8PB 3TIEA 5DJ8B 4PUBL 3FO0H 3TA3D 5DMYA 3L5XH 4YPGA 5ENWA 4XRCB 3QZWA 2GTWA 1J0JA 1RIHL 3TZVA 2AEQH 1KELH 2Q8BH 1HWHB 1NLDH 5ICZA 1ZA6B 3DVNB 4XBGA 5CKAA 4K3HA 5GSVB 1G6VK 1UXWA 2Y9RT 1NCDL 1OAKH 5ICXA 4HG4J 4LCWB 5GGSY 2DTMH 3KS0H 3H0TA 3TNMB 2WSKA 3SCMD 2YKLL 3I75B 1I1FA 3MCKA 4FG6D 4OCXH 1V3KA 5CZXC 1X6LA 1XGRB 2C3XA 1G7HA 5DR5L 2OJZH 3VWJC 4M5ZH 3ZYJA 2GQHA 3ISWA 3Q1SH 5KVFL 3KLHD 3T0AA 3V0WH 4Q2ZA 4MAUL 3T65B 2PNDA 4RMUA 2JE8A 3QXWA 4GS7B 5C2UB 4HHAA 4U3XA 2OQJA 5I73B 1VKXA 5D1XB 2D4DA 3P30L 4YE4H 4NCC2 5TE7L 5E8DH 1A5FH 3SKOA 5BOPA 5C0DB 4FQPA 4M9OA 5MHSE 5CJXC 3OF6A 2BNQB 5AYUH 3B2VH 5F1OB 2XQYK 4Q9RL 4OD1L 4UT6H 1CGXA 5F6HJ 5DRXA 4K7PH 2GTZB 3LB6C 1FZJA 5JZ7D 1MJ7H 3EYUL 5B8CA 4H25A 5E6IB 4BUGA 2X40A 4P23A 3QXAB 2GCYB 2R4SL 4K2UH 3U30C 3DRQB 1UENA 4M5YH 1I9JL 4OLUL 1N7MH 4WU7B 1FFRA 1YY9C 4RMRA 2R29H 3TLRA 5JOFA 1HYSD 3O3UN 1P69B 4MS8C 4K9EC 5F3HA 4G8EB 2ERJC 4K07A 4NO0B 4HUVA 1U8LA 3Q6GL 5LQBL 4EZMA 4EDWL 5ADPH 4MAYD 4ZUUA 1BZ7B 3WS3B 3BW9B 4HC1L 4NN7C 2VAAA 1WJ3A 4L4VB 4U3CA 2R2HA 1MCWM 3K1KC 3MJ8B 5IVZB 4NP4H 1NCNA 4LLMB 4WFHE 3L7EB 4R4BA 1HH9B 2JCCB 4KV5E 2X70A 4PJGA 1N2RA 3GHEH 2DQDH 1XR8A 4ERSL 1AD9B 4HMDA 4MXVE 3SDXA 1Q72H 3B9KB 2JJTA 4HS8H 3V6ZA 4M7JL 1YC8A 3NN8A 5EOQL 2P7TB 2WWKO 3L9RB 3CVIL 4JPWL 4KQ3L 5GSRA 3GSXA 1MY5A 3HNTH 2AXJA 1AD0A 1H3VA 1HK6A 2EICA 5CBEA 3AFLA 5GRYA 2R69H 2VDQH 2KL6A 4LPTA 5FYKL 3REVA 4NKIH 5I9QC 3MLPA 4RISH 1QKZL 1JRHL 5FHAH 2EDRA 5DEGA 1QA9B 5C0FA 4HUXA 4PD4K 2BVOB 1OAQH 2E6PA 2H45A 5I1LB 3VCLA 5F7FA 5INCA 4G6JL 5GGRY 4Y16D 3OKOA 1T20A 4WHYH 1Z3GL 1OP5H 4YFEA 4Q0XL 5EULV 2B5IC 2NTFB 1IQDA 4W81A 4HK0B 3QH3A 3BDYH 1HYRC 3GKWL 3SE3A 4H0GA 4NQXA 1MCRA 4GXUM 3WEXB 3K74B 3JWDH 4YWGH 1FYTA 3QRGL 1I7RA 2RGSA 5E2UL 5I18L 1QBBA 4PJ9A 1KNOA 5CP3H 2QL1A 3QEGH 4O2CA 5TGBA 3V8CA 3HC4L 4U1NB 4MJ5A 1SEBB 3O4LD 4I3SH 2R8SL 4I0PD 4A2MA 2AERT 4NM4L 3RWGA 1AJ7H 5C8JB 2VIRA 3IXTB 1MCEA 3MREA 3OR6A 5C0CE 4QRTA 4E5XA 4LEOA 3QAZB 2H32H 1JNJA 1AI1H 4XVJL 2WV3A 1IVLA 2G60L 1GIGH 5EZOH 3L3HA 2FX9H 2IQ9H 3VFPB 1QYGH 5FKPA 4NUJA 5BZWB 3TBWA 5EIQA 3ULUL 1IGFL 1AGDB 1FVEA 4O5LL 2BNUA 5BO1L 1CFQA 4KROB 1WT5C 2HFTA 4DZ8A 3N0PB 3ZDZE 3DRTA 4N90E 4G8FB 1OP3K 3WFCL 1WZKA 3O2VL 3KPLA 3AREC 2GFBA 3SPVB 4OT1L 4YJZL 1AGEB 5IJKA 2R0LH 1TJGL 3P9LB 1K85A 5D7IE 2DQIL 4DJMA 1KG0B 5IR1B 4KH2A 1YPZE 3V79C 2J6EL 5FGCE 4FFWC 2P4AB 5GGTL 1B0GB 3CVHA 4WW2A 4OKDA 3BQUB 3V7AE 5BV7H 2DYPB 4LLDA 1XZ0A 4XP9L 3UPRB 2I5YH 1VACA 2K9UA 2CDFA 4CNIA 4OIBA 3U1SL 4WV1A 3IETB 1IAII 3S96B 4LSVL 1Q9OB 4MDIB 5FIEA 7FABH 1J1PL 1N4XL 3GMPB 1A6WH 4OF0A 4Q9BA 5HDLA 5C0JB 1JZ7A 4UUJA 1UACH 2W65A 3IFPA 4MXWL 1BAFH 3K8KA 2AEPH 3GSQB 2BOCB 3QQ9C 4Z0XA 2AXFA 4J4PC 4KY1L 2LU3A 1FG9C 4GAGH 5JR1L 4OF5A 4K3EH 5F7YC 4I13B 2ZG3A 3SQOL 1J8KA 3MRKB 5DD0L 5DHYA 4PP1D 4X7CC 4Y5VA 2G5BB 1AQDA 4GLRI 4OAWA 5IFAL 1HILB 1EPFA 4HK3N 2MPAH 4O58H 5HDBE 1RZIB 1Y18B 1P4IL 4QXTA 4YUEL 5AG9A 5MEQB 3OX8B 5BRZE 1EV2E 1XT5A 5EN2B 4EQ3A 3R1GL 4LSRH 1ORSB 3ULUC 2Y5TA 5ANME 3ARQA 5KZCB 5IVXB 2DMKA 3BZDA 3IAGC 2ICWB 4ONFH 4QYOB 2P8MA 5MEOA 3D18A 4P59H 3QIBD 3BYYA 3NTCH 1HH6A 2XWTB 3AS2A 4QOKE 5KSBE 3ZT5A 5DD3H 2ZUQC 4GBXA 5F1IA 2J12B 3PWPA 5IW1A 2ADIA 1HHKB 4ZYKB 1W72H 4E41D 2FEEI 3FOMA 4RRPG 5CBAB 5DHVH 5FKAA 3ZYIA 4ONGL 1P7QB 1EO8L 4P5TC 4S1DD 4WFHD 2YPLE 3BPOB 4WJ5B 2BHUA 3DX7A 3NFSH 4OKVB 4HIEB 1DBMH 4A6YB 1A3RL 1XGYH 2P1YA 4QT5B 2QSTA 3HC3H 3B5GA 2XXMB 4EUPG 2VWEC 1FNSH 3QDGE 5TF0A 4NZRL 4S1SL 3T3ME 5D96C 3TZVC 1P4BH 3VMOA 1KFAL 2BSTA 2VDLH 4P5MB 2ICES 5FYJU 3EGSA 5EIIA 1NC4A 2NY4B 5DA0B 3ARGB 3L5WA 1NKRA 1VGEL 2FGWL 1D9KD 4P4RA 4HWZA 1S7WA 3GSOB 5IB5B 1BQHA 4JCLA 4DKFL 3AY4C 1BF2A 1T7WA 1MSPA 4F37F 1CGVA 4RBPK 3WLWD 2V2WB 4TOYH 5A3ID 3OKMB 2PYEB 1U8MB 1XGTB 3S8WA 4M1GH 4JDZA 4HJ0C 5D2NA 2VLKA 4HF5H 2DM4A 2PKDA 3QI9C 4UIKL 3VD4A 3MV9B 1CLYH 1AR1C 1A0QH 4Y19D 2LVCA 3MO1B 3P4OB 4QTHB 3HZMA 3KHOA 5CEXA 4M93C 2VXSL 5IEKA 3VXOB 1OQOA 1IAMA 3C60D 4I3RH 2YEZB 5F7NC 4AT6B 4AYFA 2B7DT 3GMLA 3PGCB 1J0YA 3VFMB 1F4AA 3BSZH 1T0NB 25C8H 3MLWL 1RUPL 4H1LG 1SY6L 1XGUA 3NCMA 4HCRA 2XACC 2VDKH 5EORL 4DGVL 4N8PA 4LIQH 3ARBA 4RFNC 4GRLB 3N1FC 4GQPH 4Y0GA 4L29B 1ZANH 3V52H 3IU3B 3EO9H 2AV1B 3VH8B 1A9EB 3SDAA 3L3JA 3CUPA 5C0CD 4O2FA 4LVOC 4YDVB 1G7LB 4OLZL 2NX5D 2X42A 4P23C 3WKMH 1T7YA 1QRNA 3QUYA 1BLNB 4JFFA 4X83A 4NNPH 5C0BA 1ZHNB 4FZ8L 5CEZE 4KK8C 1KCKA 3N85H 3GB7B 2PXYB 4Y2DA 1KULA 1ZT1A 3WNNA 2FJFB 1RVFH 5CIPB 3PDGA 1KPVA 2F53D 1QSZA 4URTB 5C0AA 5FGCB 2QQKL 3L3OA 1H15B 4OZGE 2XG4A 4XPAL 5D7JD 4YNYB 1FFOA 3NIDE 2WBJB 1C5BH 4IHOB 5FHBL 5I1IL 5E2TH 3AMLA 1RJZA 3CMGA 2BRRH 2E8YA 5F9OL 5HD8D 4RFOL 2Z92A 3VFUA 5HVHB 1BD2A 2JJSA 3RZCD 4XMLL 3DGGB 3PHQB 4L3ED 4U6YA 4L8CA 3GJFH 3BHBA 1PEWA 4OF7A 2B0SL 2BNRB 5IESL 2P5WE 5IT2H 2WNGA 1ZT7A 3QDMA 5E94A 1CFSA 4JM4L 2UWEB 4KKNA 3IYLW 3QUZC 3UYPA 1UXSB 1HHIA 4ELMA 5IP4A 4BK4A 1OW0A 1IM9D 4JHWL 1NFIA 2JJTC 4LPCA 1CL7H 4O51A 4TVPH 5DT1H 1X6NA 4ONHB 4Q9QL 3MV7E 1IEBB 1PW3A 2PCPB 1BOGB 1BZ9A 2B2XL 1QQDB 1V5JA 3RWJB 2AK4B 4RNRB 5KANG 5I76B 4X6DE 1Q94B 4ZAKA 5FGBC 4JY4A 3MLVL 1WC7A 1XFPA 1KTDB 3FQUB 4CUCA 1S5HB 1Q0YH 3GSNL 2CKBH 4JM2B 1U8IA 3DVFA 3TGXA 5AWNH 4LOUC 2VDRL 4YXHH 4ZXBC 1TZHA 2IG2L 3CK0L 5EUKB 2NW2A 3LN5A 1EA9C 1ZHLA 1UB5A 5E2JA 1KTLA 1MLBA 5D5MB 4IOIB 1DUZB 1II4E 1LNUB 3WE6B 1NEZB 2IGFH 4CU6A 2CJUL 2D9QB 2M26A 5C71A 4EUPH 5K9QI 3IJHA 2G2RB 3SE3C 1FE8H 5DDHA 5BRZD 5GS1C 1BQSA 3NH7L 4HGWB 2CSPA 4R0LB 1KENH 2OL3H 5ERWB 4LU5L 4H8WL 3P0GB 3DJ9A 5HY9A 3A67H 4ODHL 1CE6B 4M7LT 4PS4L 5ETUA 2ZPKL 1GC1L 3QULA 3VXSE 1IEHA 1CF8L 4LLYB 1DL7L 4HKXA 3W11C 2LAGB 3OZ9H 1C16B 1B6UA 1T0MB 3KDMB 3P9MA 5L2JA 3C9NB 2VDPH 3ZTNL 1MHPL 3RU8H 1OGAA 1AR2A 2YUWA 4DZBA 3FO2B 4EEEA 3OKNA 5FA3A 4NRYA 1LO4L 1U58A 3AS1A 2QQNL 5FYJE 5I15L 1CE1L 4X0KB 3TFKD 3L3IA 4TNVK 4IRJA 2YPLD 1JE6A 4NM8H 1ED3A 3V4VH 1JZ6A 1BGXL 4P9HH 1VADA 3L3KA 3ROOB 4FA8A 3MNWB 2OMBA 1C08A 3TN0C 5DURB 4ZOCA 1FLRH 2XZAH 3QDGD 1WAAA 5KSVB 3AS3A 1J05B 1L6XA 1IGJB 2FO4B 3WFHA 3BH9A 3TO4D 2CGRH 2WW8A 3MRQB 1YEIH 2CLVB 1XIWA 1AXTL 2D9CA 3H9HB 1WUNT 4RWYL 3LIZL 5HHME 1ZVYA 3ZMRA 4BH8A 1A6AB 1G0YR 2VNCA 3GBNH 3WUZA 4Z7WB 2W07A 3FB6A 4ZFOB 5HGAB 4K9EH 1ONQB 4YEFA 5B38B 1KEMH 2A83B 2UUDH 4GUPB 4NO3A 4PRAB 5CJQL 5CWSB 8FABA 2LQRA 2W9DH 4Z6AT 1P53A 2ID5A 5F7EL 3K0WA 5HYJD 1N6QH 1RIHH 1R3LB 1XGPB 1JN6B 3V6OE 2PUQT 5C07A 4KUZH 4MA1C 1SVCP 3M8OL 4WCYL 4GXVL 1IQWH 1FC2D 2Z31B 3ARDA 1QUNA 5L6YL 1NCDH 2EH8L 2WLZA 4YC2C 2X9WA 1R3HA 2R1WA 1GGBH 3GI8L 4F7PB 4HUUA 1TVBB 3O6FA 4WNQB 4C56D 3VXRD 1GC1C 4BA8A 3GIVB 4JDVB 4GJTB 2YKLH 4Y5VC 3E6FB 5HHVL 2J7LA 3HUJA 5T1LA 5DR5H 3BZFB 2W9EH 3KPSB 2YC1A 5EO1B 3QIWD 4NKOA 3SDCD 3PWUB 5KVFH 1PVHA 3RTQC 2VXVL 4H5SB 4LRNL 4XAKD 3SJVB 1YN7A 4U7MA 5CFHA 3RWIA 5CEZD 3VRJA 1KBGL 4CDHA 4FZEL 4FQ2H 1I4FB 3P30H 3CAFA 2FIKB 3VXQA 1BIIA 3FZUC 4NN6B 3RNQA 1A4JB 3G9VA 1L9NA 3EYOB 2A6DA 3T08A 2YSSB 1MJ8L 1QLRB 3BPCB 1MHHA 4OD1H 4F7TB 3P4NB 3HE6D 4YIQA 1I1CA 3VXUA 4LIQE 4G9FE 5B21A 2ARJA 2Q20A 3CU7A 3GMQA 1EEYB 5KOMC 1KLGB 3F6IA 5D1ZB 5D2LB 1E0OB 4BM7A 2R2BB 1UM4H 1A7PL 4PJGF 1K4DB 1ETZB 3B6SB 2AW2A 5L2KA 1DN0B 5D9SA 3SDXF 3OGCA 2P5WD 4NDMA 1HXYA 2H3NA 4XXCA 2DQJL 3I3EA 1J8HD 2I27N 5CMAB 3FCTA 5DEFA 3ZHKA 1A6TB 4NNXA 4MDJA 5DVKA 1SBBA 4P2OB 5EZLA 5HHQA 4R3SA 5DVMA 4YZFF 3LN4B 4GG8B 4Z78A 5E8NA 2PO6C 3MV7D 1CT8B 4HC1H 4EI5C 5FF6B 5C92A 1NGXA 3TJEL 2DWDA 2VQUA 2X6MA 3T8XA 2NY6D 2HKHL 3S4SA 3C2SA 3MRMA 4ODBD 4ZUWA 5C9JB 3FRPG 1YEFL 3WL9B 3OJDA 2UZIL 4WENB 1RK0A 3AAZA 1KCUH 2EYTA 3TBYB 1BEYH 5IV2A 2OK0L 1XGQB 4G8IB 4OSUL 1E28A 4NC0B 4Q7DA 2VKWA 2LFGA 4ERSH 4P57A 3QO1A 4RQQA 2VABA 1PQZA 4LSUL 1F3JB 1INEH 4PGCA 4WEBH 4K7FA 1KJVA 5EOQH 4QTIH 3ZYZA 5D2NC 2HKFH 3CVIH 4TVPE 5DVNA 5TE4H 3EOTL 4KQ3H 1QFWL 2BX5A 5IUSA 3HAEB 3HFML 3QNYA 3CNKA 2R1XB 3QUKB 3T4YA 2YD8A 1NMBL 5FYKH 4WI9A 5H2BB 3MLTA 2UZXB 3QG6B 2OSLA 4LLUA 1JRHH 4JZJC 3ZL4L 3ZKXC 5GZND 4PRDB 4OIIL 3QUMB 4IRZH 4A6YL 3KPMA 4QHNA 4OF3A 1X3DA 2DLFL 1TETH 4P3CH 3OJ2C 1Z3GH 2JJVA 3HG1E 1FN4A 4Q0XH 4G9DB 5GIRA 3CFBA 5I66A 1A7NL 4KC3B 1Y0LB 3NABL 4FQQB 2HN7A 3HPJB 4OQ1A 1RIUL 3SGEH 3GKWH 1C12A 2XTLA 3D5OF 1IEAA 1NBZA 1QTYT 4FQXC 3MLZL 5C1MB 4MJ2A 4FNLL 4JKMA 4JRXD 1ZV5A 5F7HA 1RQ5A 4JO4L 4HXBL 5EC2B 3QRGH 4L9LC 5LJYH 3EDJA 4NKDB 5I18H 3F7VA 1MEXL 4R2GB 1CTNA 2AJUL 2V5SA 1CR9L 3TH3T 2C5DC 2DLHA 1DBAH 2XICA 2R8SH 1M4KA 3CDYA 3JXAA 1INQB 4OLXH 5ESQA 3T0XA 1ZMYA 5T3ZE 3ZDYF 2WUCL 2BY0A 4PJ8C 4WW2F 3UYRH 3FN0L 4U49A 5GGVL 4XVJH 5JQ6L 3QXDB 3MRIA 3BIKB 5DS8A 5HHMD 2A9NL 3RY5A 4NC1E 3GI9L 5DJYB 5DTFB 1CZ8L 1KT2A 5JOPE 3C5ZA 2P8PB 3LKOB 1R5VB 1AIFA 3FFDA 4U1LB 4CAGA 5D70H 3GIZL 4M6OL 4HQQH 1B90A 3L3GA 3WFCH 5SWZA 1ZHKA 5EU7C 2C7UB 3K8MA 1NFDB 4Y4FA 4HWEL 1LEKA 1TJGH 1YMHB 1KB9J 4OCRL 4LMQI 5FO8A 1EVTC 1U93B 4ZAKC 4ZS6D 2ZCHL 5E24E 1JNHA 4CVZA 5GGTH 3C6SA 5IHUH 1N59A 2RFXA 4FTVB 4U1GC 1K3ZA 2SEBB 4P4KD 3VFWB 5TQ0H 3RVXD 1ITCA 4PRPA 3EKCA 4XP9H 1IC4L 3O8XD 3U1SH 4U4BA 1GZPA 3KGRA 4MD4B 4RAVB 5F21B 4JFQA 1G7MB 5TQ2H 4Y1AA 1D5XA 1KPRB 1EUTA 2Q7YB 3P73A 4MXQC 5E70A 4XPTL 5C0IA 3F5WB 5H37G 4Z77B 4JRYE 1U8JB 3H9YA 3DETD 4HEPG 4Z8FL 4G80B 2IQAB 1R5WA 1GCFA 1QFHA 2X5PA 2FCBA 4G9FB 5I8EB 5I19L 4MCZA 3DLQR 2GJ6B 4LCIH 5TDOA 1T1WB 2YPKA 3C09C 3H7BB 5JR1H 1WGOA 1S9VB 4JE4B 1CICB 1MQKH 2J5LC 1E4XI 2XI9A 3DYOA 5HI5C 2UV3A 1BWMA 5E00B 3UDWC 3Q3GB 4P0DA 5IHBA 3RNKA 1FH5L 1ACYH 3VXTB 1QR1B 3CDFA 1QRKA 3CFKA 4NQDD 3RGHA 2FL5B 3NZ8A 1IC5L 2PETA 3E3QC 2IAMA 1Z9OA 1P4IH 3PDOA 5TJWK 1UWXH 3FTGB 4OUUA 4TSAL 3G6DH 4DAGL 1CFNA 4YUEH 3SDDC 3T4AB 5GS0L 3E2HB 3T0WA 4NFCA 2ADGB 5HJ3A 3R1GH 3HI5H 3MRGA 2BERA 1YC7A 2ICWJ 1HSAB 3RHWF 4K3JH 1FRGL 4FQHA 4IRJC 5C0EB 4F33A 1KXQE 4JGUA 3IFNH 4JFDA 5IBTL 5BS0A 4WHTA 4LNRA 2JELL 1CDHA 1DQLH 3HN3A 4L4TE 3RKPA 2FECL 3HE7C 3VDBA 1A9BB 3MPCA 1NJ9B 2FWOA 1NMAL 1MHCB 5FGRA 4WTXA 4DEPB 4I5BB 5DD6B 2IAND 2X1QA 3NA9L 3DYMA 1XIWC 1G6RA 4AENA 1C1EL 3PNWB 4M8QB 1VFBA 3DO7A 3X3GH 1C8PA 2YXMA 4OBRA 4JZNA 3BP5A 3G5ZB 1KB5B 3MQIA 3AROA 4I18A 2BVQA 3OJVC 3CFJA 2F5BL 4YHKL 2FD6H 2FJHB 1P4LB 2I07B 1MRFL 3NFNA 2AXHA 4PRIA 1NUNB 1GGCL 4S1SH 1DVFA 2I24N 2NY0D 2R0KL 1Q0XH 4TVPD 5EA0L 1SHMA 5D1QA 2Z4QA 2X4RB 4OLYH 3TJHD 3IDNB 3QEQE 4Z7UA 3SCMB 1VGEH 4NIKB 3IJYB 5A2IH 3BIAX 1XCQB 3MRCB 4P2RB 4DVBB 2A74A 3O6FC 4HKBA 4TYUA 5IG7B 5IB2A 4GQ9L 4J3UA 5E0QA 2EH7L 2HJKA 3HG1D 4E0RA 6CGTA 4ACPA 5L9DH 3HI1A 3MGOA 4CBPA 4UIKH 5DGRA 1FC1A 5CZKA 1LD9A 1ZLUK 1J0ZA 4GW1B 1RULL 5GS0C 3CH1A 4OCLC 3QCVL 1I3RB 2VXSH 1PLGL 1XH3B 4AQOA 1LO2L 3GMOB 4MZ2A 1JPFB 3MLWH 1RUPH 3D2UA 4QRRE 4B7IA 2YXFA 4BQBA 2VJXA 4HIHB 5I8CA 4BKLA 2CUIA 3MV8A 2O61B 1KN4L 1CLZL 4RDQF 1FO0L 4MNHA 3VFVB 5T3ZD 1OB1B 1DJSA 2DDQL 4BELD 3ILPA 1A47A 3MGTB 4GKSA 4OLZH 3FRUA 4OCMC 4HT1L 4FZ8H 4K94L 2VISA 4Z9KB 3TYGL 1HXMB 2AJZB 2C3VB 3G6JB 1MCCA 4GRWB 2FSEB 1TPXB 4MAYB 4ELMF 4L1DA 2HT4C 1P7KB 4XZUB 5H37H 3VFGH 1BBJB 1MCKA 2OZ4A 2XN9E 1L0YA 1U8HB 3D39A 4XXCC 1BZQK 5JOPD 2G5RA 2FYYB 2Y07L 3BD5A 5C3LD 2AJXL 1S9YA 5DQJB 3BP4B 5IB3B 5AUMA 3ZT6A 2BY1A 3GBMH 1S7QA 1YEGH 2VXTL 3GRWL 1HKFA 1UKSA 2Y36L 3DMMB 1BJ1J 4Y5XC 1AY1L 2PTTB 3ARTA 4WO4A 5ESAB 3T0EE 1Q1JL 4RFOH 4YFDB 3LD8C 1VPOL 5JIPA 3L7FB 5I8KH 2RQ8A 3HNSL 5DD5H 4NQED 3LKPB 1F58H 4D9RD 5GRJL 1A6ZA 5IM7A 5C0GA 2DI9A 2B1AH 2Z35B 3F12B 4WI8A 4JM4H 5D7SL 5F7DA 1YMMB 1OAZL 2J1KA 1ZGLA 2XWBB 1EEZA 5J3HC 1AGFB 5KSAB 1I3UA 4HFUH 4ISVB 2PW1B 4JHWH 4PJXE 2D0FA 3KXFD 2ESVB 3WD5H 4TNWK 1LEIB 4G6AC 4NCC1 43C9A 2B2XH 4KK6C 1WBZA 3FFCE