4E4MA

Jak2 kinase (jh1 domain) in complex with compound 30
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
296
Chain Sequence
AFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 296
sequence length 298
chains with identical sequence B, D, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e4mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e4mA01
2FH9A 4FEXA 2BROA 2QG5A 5EOBA 4DTAA 3GB2A 2UZVA 4O81A 3U55A 1Y8GA 2W05A 3BX5A 4G1WA 4ZK5A 3TNWA 3COMA 4IM3A 2FSLX 2I40A 4B7TA 5HU3A 4PL4A 4K9YA 2CGVA 3OEZA 2QOQA 1QPDA 2R7IA 4UMPA 5I9XA 2Z2WA 5EM7A 3ZC6A 1REKA 3FPQA 2OJJA 3VC4A 2OFUA 2QKWB 2UW7A 4F65A 3FMNA 3IECA 4HGSA 5EQEA 4ASEA 3FMKA 3FKOA 1H00A 2BVAA 5CVHA 1DAWA 4F70A 2OG8A 4G34A 5B2MA 2ITUA 4CKRA 3MWUA 4KKEA 1H1WA 4L43A 5K9IA 1RJBA 5EH0A 5L2SA 4LRKA 2YLFA 2OH4A 5HIBA 5D7VA 3MVMA 4AF3A 4CFFA 4EI4A 1LEWA 1OECA 3FMJA 5AFVA 5M06A 4I22A 3RCDA 5ANDA 3ZFXA 4Z7GA 2XMYA 5M4IA 5A14A 3G51A 3QQJA 3ZUTA 4KB8A 5L8KA 3L8SA 2EVAA 2I0VA 4UMTA 5K3YA 2Y8OA 2ERKA 3MPMA 4I5HA 4J71A 1A48A 2XIYA 3ZSIA 5DR6A 3B2WA 4D2VA 5J9YA 4KAOA 4FEQA 5TT7A 5E4HA 4K6ZA 3ORLA 4S34A 2X81A 1UU9A 3K3IA 4FVPA 4AGWA 4AE9A 3F7ZA 2XKDA 3VW6A 2VU3A 2EWAA 4L44A 4UYNA 2O8YA 5A4EA 3FSFA 5KX8A 5DMZA 3QC9A 1XH7A 4UXQA 4B8LA 4I24A 5ETAA 1G5SA 2OJGA 4R3CA 4U6RA 5HEZA 1UU3A 3E62A 3AC5A 3UIUA 4PMMA 4V0GB 2FUMA 2WXVA 3GU6A 4E7WA 5A4QA 4BHNA 4CYJA 2C6EA 5C9CA 4QQTA 2GTMA 3NW5A 2XK8A 4D4VA 2WQBA 3DQXA 3DS6A 3UNZA 3KF4A 3WF6A 4D2RA 4FUXA 1W7HA 3WF7A 5BVEA 1LPUA 3DLZA 4FK3A 4A4XA 3DJ5A 2GMXA 1UU7A 5M07A 5E8YA 5L8LA 4QQ5A 2VTJA 3BZ3A 4E6DA 3R8VA 5IQIA 5CU4A 3Q53A 4IAYA 1U4DA 2GU8A 3M42A 4PX6A 3MIYA 1LP4A 3CD8A 3W2PA 3Q4CA 5EHOA 4ZEGA 4A7CA 2HZNA 4BWPA 4ZSLA 5AR5A 5IA3A 2CCIA 4I92A 4JDIA 1Y57A 2CNQA 4DTBA 1OBDA 2NPQA 2OIDA 3ZUVA 4DCEA 4CSVA 4USEA 4GKIA 4CMUA 2PVHA 1R39A 3ORMA 3RZFA 1FVVA 4IFGA 4EC8A 4WIHA 3RPRA 5CT0A 2VWIA 5FGKA 3IW4A 4BF2A 4AT3A 4LI5A 4IX3A 4B6LA 3F5XA 3V04A 4GFMA 2UZLA 1M14A 5HCXA 5IA4A 3AG9A 4OAUC 2B53A 5IQHA 2RIOA 1H24A 1MUOA 4Y85A 2NP8A 4Y95A 4JQ7A 3FKNA 5AP1A 3R83A 5IEXA 4NYEA 5CZHA 2GNJA 3VS4A 5IA0A 4PMPA 4FKTA 4JS8A 4RZVA 4AFEA 2F49A 3ET7A 4FKVA 4RVKA 5TOZA 4DN5A 5CAUA 3NRMA 3ZZWA 5TO8A 4BCNA 4EWQA 3GC8A 2C47A 5L2TA 3E3BX 4DH1A 4PWNA 3OW3A 4QP7A 5AP3A 3OXZA 4GW8A 1QL6A 5CI7A 2VTOA 4M84A 2V7AA 1ZOHA 2CN5A 4BCQA 3DOGA 4BDJA 3OWJA 4FSNA 1GIIA 2IVUA 3BV2A 4YJNA 2C4GA 3FI3A 4BBEA 5CEPA 3GEQA 4LRMA 3UIBA 2ZV7A 3EYGA 5CAQA 2V55A 3K5UA 5CEQA 4YO4A 3O50A 3ORIA 5C4LA 3VUHA 4UYAA 1ZOGA 5JGBA 4XV2A 4WD5A 4KINA 4YU2A 4J8NA 1PF8A 5EM5A 2HOGA 4HNIA 2QO9A 3PXRA 5AUZA 3V5TA 3SGCA 1U54A 4KSQA 4AZVA 3COKA 2X4ZA 2GPHA 3HYHA 3M2WA 4WG3A 3DDQA 3GC7A 2V7OA 3OFMA 5IKWA 3DBEA 1BLXA 5GJFA 1VJYA 4QNYA 4QTCA 5DHJA 2GQGA 3ACKA 3EH9A 3HA6A 3LLTA 3C5IA 4AW2A 4FG7A 4H3QA 3CP9A 2C5NA 4TPTA 5DE2A 5HIDA 1ZMVA 4JNWA 3F3VA 4O0YA 2X9EA 4E6AA 5KMOA 3RPOA 2PE0A 3AD6A 1GZKA 4IE9A 5KMIA 4LRJA 1P4OA 5HD4A 4XNEA 5I9VA 4Q9ZA 5CANA 2WMRA 2XJ0A 3L8XA 4BVUA 4O82A 4FTCA 3E5AA 2JGZA 5E8WA 4YSMA 4H3BA 3DNEA 4GSBA 3Q4UA 3NUXA 4M7IA 5EYCA 3ERKA 3EYHA 3RJCA 3RPYA 2WTWA 1KE5A 3VS7A 4LYNA 2X2KA 4DITA 1ZARA 5HG5A 5EQYA 4XG7A 3ATTA 3WE8A 3DBDA 3UYTA 4CFMA 4L45A 3NGAA 3I6UA 3KCFA 1W98A 2QHMA 3KK9A 3UG2A 1GOLA 4BGGA 2G1TA 2A0CX 4O7TA 3AD4A 5F4NA 5BVOA 2PPQA 3RK9A 4HVGA 2VO7A 4TWNA 2PWLA 3S4QA 2H6DA 1WFCA 2UZOA 5FP6A 2OZAB 5CSHA 4IQ6A 5AUYA 5M09A 5GJGA 4DBXA 3UO6A 3G15A 1OKVA 3QTRA 2O5KA 2WTKB 3AMAA 3PE1A 4Z16A 3QCYA 5M55A 2YHVA 4CLJA 5JN2A 2HCKA 4RIXB 5FRIA 3UZTA 4QYYA 4EH9A 3CE3A 4L3LA 1ZOEA 3EKKA 2B1PA 1TQPA 3C4FA 2BFYA 1REJA 3MA6A 4JBVA 5CTPA 3TNQB 1PXJA 4I41A 4AA0A 4RVMA 1Q24A 2VAGA 4MBJA 5EDQA 3PY0A 2ITVA 1MP8A 3BE2A 3WI6A 2WKMA 2W4KA 4HCUA 3Q60A 5JFVA 5M53A 3B8RA 5AP7A 2OWBA 4J99A 4A06A 2CCHA 4OTIA 1W84A 3NNXA 4UWCA 5IA1A 4GVAA 4K8AA 3EMGA 2XEZA 3CJFA 4EUUA 3OBGA 3LJ0A 3UGCA 2XNMA 1F5QA 1YXSA 3GC9A 4M0YA 3KQ7A 3F3WA 2IG7A 3MY5A 2YFXA 3F9NA 2VTRA 5C27A 2JAMA 1H0VA 3LCTA 1J1CA 1O6YA 5FP5A 2JITA 5AX9A 2Q0BA 4EH8A 3DGKA 3H10A 3JUHA 5HE0A 4ZLZA 3LXLA 3M1SA 4G17A 5JFWA 3KXHA 3VWAA 2VWZA 3DKCA 5CU6A 2C0OA 4FIHA 1Q8ZA 5CXHA 5G1XA 3AC3A 4QTEA 2XK6A 4G16A 5C8NA 4ZY6A 4JRVA 2JKKA 4KIOA 4UY9A 5E8VA 3F7WA 2XKEA 2VNWA 3VHEA 3DAJA 1XHAA 4RFMA 4C62A 5HTCA 4KD1A 4O22A 3R30A 4EQUA 4NZWB 1UWJA 5JT2A 2Z8CA 3N4UA 3CTJA 4O27B 5ACBC 4F4PA 4FZDB 3MVJA 2H9VA 3QA0A 4FNXA 3FAAA 3QQHA 3BHTA 4MBIA 3R7VA 4F64A 2HYYA 1FBNA 5IH5A 1BMKA 3TXOA 1QPEA 3RBWA 3O2MA 5AIKA 4HCVA 2X1NA 4WG5A 4ZTSA 1L8TA 1YWVA 2CKEA 3SKCA 4FMQA 3REPA 1KUTA 2BHEA 2B52A 4FICA 5BMMA 4L53A 3ULIA 2YM6A 4FT7A 4ZZOA 5A9UA 5DVRA 5FTGA 4FTMA 3QHRA 4M67A 1PXMA 3UP7A 4CEGA 4F9AA 3F66A 2UZUE 4U5JA 4XOYA 2I0HA 2JBOA 4FZFB 4CFUA 4L8MA 4HYSA 2XM8A 4AGDA 4G6LA 4BR3A 1SVGA 5FD2A 3T9TA 1V0PA 4UZDA 1H27A 4IX5A 4E5BA 4I6QA 4F0GA 3Q6WA 2PVLA 4BIEA 5J5SA 3CQUA 3LVPA 5IMEA 1OKYA 5T68A 4FZ7A 4MD9E 3CKXA 4O91A 4U3ZA 3TM0A 5CENA 1IRKA 3EJ1A 4ZJVA 2W96B 4XG3A 2ONLC 1XKKA 4M97A 3RZBA 3COIA 4BCOA 2R3JA 3HLLA 3CGFA 1YHVA 5EHLA 1Z5MA 4WKQA 3BEAA 2VRXA 3ZSHA 4FKWA 1FOTA 3BLRA 4R6VA 3AT4A 5HQ0A 3KRWA 4L7SA 2W1HA 5IUGA 3FBVA 4WUAA 5EDPA 3FEGA 3VUMA 3S95A 1H28A 3TZ8A 4D2TA 1Q97A 3POZA 3F82A 1OGUA 4H1JA 2WD1A 4HVDA 4IAIA 4DGGA 5CF4A 3CY3A 5EFQA 1KOAA 4BI2A 1YOMA 3TJCA 4P5QA 3ALNA 4DH8A 4MNEB 1RE8A 3FKLA 5GIOE 4O7SA 1KE9A 3WF9A 2PUIA 2XCHA 2VWXA 4GJ3A 3UC3A 3A99A 5I9UA 2B7AA 2R3GA 1UV5A 5FG8A 4PF4A 2XS0A 4AX8A 4G6NA 5D41A 3PG3A 2JIIA 3RINA 3T3VA 3FLZA 3Q52A 2HELA 4TRLA 5K4IA 3IKAA 5CU3A 5DWRA 3A4PA 4WOVA 4YZNA 4EOOA 4EK3A 2OI4X 2P4IA 1S9JA 2C5XA 3FDNA 3K54A 5EM8A 5AA8A 4MD8E 5JGDA 2OIQA 2DYLA 3HP5A 4GEOA 1ZLTA 1GZOA 3MY1A 4ZTNA 3PWDA 4KSPA 4EONA 4GV1A 2E9PA 3DU8A 3OBJA 4FG8A 3TTJA 5IMXA 3HV3A 2PSQA 1M7NA 3ZLYA 3PXQA 4C4IA 2PZIA 3EQBA 3UVPA 1XR1A 3D94A 5FTQA 4QO9A 3MYGA 5KNJA 4WNKA 5DG5A 3UO4A 2ITNA 2RFDA 2W99B 4HOKA 3TV6A 4U9AA 2G2IA 3BPRA 3IDPA 3UIMA 3TDVA 5AEPA 1Q41A 2C6MA 4B99A 4CG9A 4ALWA 2X2LA 2J5EA 4UBAA 3IOPA 4JT3A 2VZ6A 2WMBA 4C3RA 3RAWA 4IM0A 4AW5A 4AA4A 5HORA 4YNOA 3R22A 1H4LA 3BRBA 2KULA 2XP2A 4MQ1A 4BYIA 5IDPA 2HIWA 4LV5A 2BRBA 3KCKA 4ONAA 3NX8A 1Q8WA 3L9LA 3OP5A 4B0GA 2Q0NA 1WBSA 4FX3A 5IA2A 2YJSA 2GQRA 4FBXA 5DR9A 2ZV2A 2C6IA 1OL7A 4KBAA 5BUEA 3CIKA 5JSMA 4HZSA 4XG4A 4H05A 4O7RA 2XJ1A 3MJ1A 3OT3A 4RQVA 4PV0A 4YJSA 3ODYX 3ZRKA 4EH3A 2C0TA 3OUKA 3JPVA 2W0JA 4UX9A 4GJ2A 4J98A 1ZY4A 3TNHA 3CPBA 4PDSA 5FWKK 2C5YA 2WOUA 3QUPA 3JYAA 4QNAA 1OKZA 4N70A 3UC4A 1IA9A 3Q32A 1XO2B 3HMIA 4O7ZA 5HVKA 3KXMA 4R78A 1WAKA 4HYHA 5EG3A 4QP9A 5FM3A 5LWNA 4V0GA 1GY3A 1ZYJA 3TN8A 4XS2A 4CRLA 2X9FA 4QP6A 2W5HA 5GJDA 3R8UA 3I79A 5M57A 5BYLA 2HY81 2JDRA 4GS6A 4E73A 5LOHA 4FKPA 3SG8A 3H9FA 3PWYA 1ATPE 3BYVA 4PMSA 2YLEA 3OCGA 3R7IA 2RG5A 3PXKA 3UVQA 4RVTA 4O1OA 2W1EA 2XM9A 4IAKA 4F9CA 5CLPA 5FQDC 4DFNA 4EQCA 4PDYA 4AXAA 4BWXA 4KRDA 2GNHA 3ZXTA 5AM7A 4KIPA 5BUJA 4AP7A 5EOLA 4S2ZA 4AZTA 4FVQA 1NT2A 2B4SB 4D28A 2VO6A 1OZ1A 4YJVA 2RFNA 5L8JA 3ENHA 1YXUA 1ZYSA 4UB7A 3D7TB 2QOCA 3W2RA 2C6TA 2E9OA 2GHLA 4DGLC 2UZBA 3A7GA 4ACMA 4BDBA 4ZMEA 3UNKA 4BL1A 3QRIA 3EFLA 3COHA 2YM5A 2O63A 2X6DA 4KA3A 3NNVA 5DT0A 3DKOA 3RAKA 3RM6A 4ACGA 4BDIA 3KRRA 1WCCA 3NYOA 3T9IA 4JBOA 3QXPA 5CEIA 3QALE 2J90A 2XYUA 2C1AA 1SNXA 1W83A 5IQBA 4RSSA 2JFMA 2BILB 3NYVA 3R1YA 3DB8A 3PSBA 3O51A 2Y9QA 4QQCA 4UMUA 5CAOA 5J95A 4DT9A 4Q9SA 4DFXE 2ZB0A 5CQWA 4TT7A 3G6HA 4O0WA 3U8WA 4II5A 4JQ8A 3U6IA 3UVRA 3KREA 4XLIA 3IO7A 3EQCA 2OSCA 3R2YA 5AUXA 5GHVA 5CF8A 3QXOA 4EOJA 4EK5A 1WZYA 2WIHA 1H8FA 2WTCA 3OOGA 3TIYA 4PNKA 3DAKA 4GU9A 4BI1A 3KMWA 2J51A 3ACJA 4ZSAA 1IA8A 4FG9A 4IW0A 4BTFA 5B0XA 1YKRA 3Q04A 2GFCA 4D55A 2H34A 2UW5A 1NW1A 5CNNA 4F7LA 4FV8A 2XRWA 3KC3A 4JJRA 1UVRA 3FJQE 1K3AA 3F5GA 5J7HA 2VWBA 4AFJA 4WSQA 5CYIA 2OF4A 3O0GA 3TKUA 2R3IA 5JFSA 4NU1A 3HL7A 3KEXA 4FTNA 4BZOA 4DF3A 2PVNA 2I7QA 3ZYAA 4IX6A 2DS1A 2VUWA 2ZMCA 4BDDA 4DEGA 4R77A 2HW7A 4R5YA 4FTKA 2ZM1A 4LOOA 3HVCA 4YNEA 4U0IA 3VULA 3ZRMA 4LGHA 1PKGA 1SYKA 2XNBA 3S2PA 1BUHA 4I6FA 4E5WA 4YTFA 3BGQA 5HCZA 3MH0A 4PUZA 4FT0A 2C1BA 4ASXA 2VTAA 2OFVA 5L6OA 1ZZ2A 4LMUA 4E4XA 1IR3A 4N0SA 3VRZA 4TTHB 3VAPA 2YDJA 2UZWE 3P1AA 4FNZA 4EHEA 3U6JA 2OK1A 2PMLX 2PVYA 3CXWA 4JG8A 4ACDA 4YURA 3SHEA 3EIDA 5FEDA 4OTFA 2WMTA 4AU8A 3JVRA 1OMWA 3GU4A 1BL6A 2BZJA 2QNJA 5ETCA 4AT5A 2F7XE 4EKLA 2W4OA 4WNPA 4P90A 2EU9A 3A7JA 4J1RA 5F95A 4CT1A 3PLAE 3IW7A 3Q9WA 3I0OA 5HBEA 3E88A 3G2FA 3FLSA 4FF8A 4HCTA 3V8WA 3PY3A 3FI8A 2QU5A 4EOLA 3RAIA 2XRUA 1DM2A 3NLBA 4BICA 4YR8A 4G3EA 4KS7A 4W9XA 4O21A 4HW7A 4C37A 4IJ9A 4RMZA 3AMYA 4ZXTA 1YVJA 1Y91A 2Y6OA 3NEWA 4H1MA 5CSPA 3HUCA 4L3PA 3VF9A 2C3LA 2CDZA 2OZAA 3UMWA 2VX0A 4IB0A 4BKJA 4ZZNA 5T3QA 2IVTA 4EH7A 2UZTA 5KHXA 4IVDA 2WU7A 3VO3A 5IU2A 3KULB 3QZIA 4DG2E 4X3JA 4F0FA 1YDSE 3E87A 4RIXA 2IVSA 3R21A 5M4FA 4RA4A 4W4VA 5F1ZA 2IZRA 3RPSA 4BCFA 4D0WA 5JMSA 2OO8X 4ZTHA 3VUDA 1G8AA 2YAKA 1NVQA 2QD9A 2PK9A 4C02A 3LFQA 5D9HA 4MF1A 4GH2A 4X0MA 5JQ5A 5H9BA 5AV3A 1RW8A 4RLLA 4XEYA 5HU9A 2DUVA 4FIJA 3VS0A 3HECA 2XKCA 5DT4A 4ANSA 1JLUE 2FYSA 3LMGA 4OT6A 1JVPP 4HPUE 4XRLA 3PJ2A 4ORKA 3VS6A 4YZMA 3HRCA 3ZONA 2VNYA 2XIRA 5EHYA 1H01A 3NDMA 3SW7A 3E92A 4XLVA 3WF8A 4KUJA 3MB6A 4C34A 5CY3A 3FZTA 2IPXA 4KNBA 2YCQA 4MXZA 3ZM4A 4C57A 4EEVA 2REIA 1CMKE 3F5UA 5IEYA 1OITA 3DFAA 5EK7A 3TZMA 4ZY4A 4MXCA 3VUKA 3C0GA 4S31A 2QCSA 4YTCA 2PVMA 4FA2A 1FGKA 4MF0A 2C3IB 3RTPA 2NO3A 1OL5A 3OG7A 5HTBA 3VBWA 4KKGA 1H1PA 2G9XA 3OS3A 2VWUA 1CKJA 3A7IA 4CFXA 3IDCA 3E93A 5AP4A 4HPTE 4HGTA 3TIZA 3UNJA 3FPMA 2XCKA 4DFBA 3OD6X 4MKCA 1X8BA 2H8HA 2HXLA 4S32A 4X3FB 4IIRA 3HNGA 5I9WA 3FZ1A 2PZRA 2XK3A 3K5VA 5HCYA 4I0SA 2PZYA 5HBJA 4YZBA 4TYHB 3ZBFA 2X6EA 4K33A 4EOIA 3HA8A 5L2IA 2UW4A 3HGKA 5GZAA 2WAJA 3LCSA 3QL8A 2PMIA 5HESA 4BCKA 1CTPE 4O83A 3ITZA 3D4QA 1W8CA 3BYSA 5HIEA 3HRFA 4QTDA 4E6CA 3QGWA 4OBPA 2QG7A 4FYOA 5M51A 2XBAA 3ZTXA 1Q3WA 4ZTRA 4JBQA 3I1AA 2HW6A 3UZPA 1KE6A 4FIGA 4GT5A 4D1ZA 3FYKX 4A9YA 3EQHA 1SVHA 2IW8A 3I7CA 5AAGA 4IH8A 4EH6A 4AWIA 1XH6A 3BBTB 3DAEA 4FKUA 4UMRA 4LUDA 5J87A 2EUFB 4PNIA 4K0YA 3FXXA 3KMMA 4ZIMA 5KBRA 3G0EA 3KXNA 3LHJA 2B9HA 3PLSA 3OCSA 4XMOA 2CNUA 1NVSA 2WMVA 2PZPA 4GYIA 1OL2A 1PRYA 4R3PA 3UYSA 2WQNA 3NZ0A 3SC1A 4FV7A 1KV2A 3C5UA 3OY3A 3S3IA 3ID6C 3QTUA 4FEVA 4IDVA 5ANJA 2FO0A 3Q4ZA 3ORXA 4LL0A 3ZOSA 1UNLA 4MWHA 1XBBA 4EOQA 3PE2A 4FNYA 4AA5A 1ERKA 3TL8A 2WQOA 3QWKA 4IZYA 2DWBA 5HVJA 4IBMA 3VBXA 4BDEA 1TQMA 3OF0A 5CAVA 3FMMA 3FHIA 4QMLA 4GG5A 3U87A 1VYZA 4YLJA 2WTKC 4TWCA 4M69B 2QOHA 3P0MA 3GU7A 4ASDA 3P23A 3GCQA 3FMDA 2OXDA 4MNFA 4FTJA 4MNEA 3QX2A 5AUUA 5IQAA 3OWPA 2VTLA 3OXIA 5KE0A 4O6LA 4ZLOA 4FK6A 3QGYA 4RIYB 1OVEA 3PSDA 4IMYA 5BMSA 3WIGA 5BYYA 4ZY5A 1VZOA 3RHKA 1KWPA 3QC4A 4FTAA 4JQEA 5HHWA 1JPAA 3R9RA 2BAJA 2BRMA 3QUEA 4RJ5A 3VBYA 4FKQA 3MS9A 4MXOA 4IWPA 4O7YA 3LFCA 5HE3A 3LFEA 3THBA 4BZDA 4DH5A 4ANMA 3C0HA 4ZJIA 3BWFA 4C4GA 3GU5A 3ODZX 3FE3A 2WEVA 3TTIA 4JRNA 1W0XC 3PYYA 4OLIA 2F7ZE 3AD5A 1FMOE 2LGCA 4X2JA 3OOMA 4OBQA 4EORA 4BCIA 2J4ZA 3QBNA 4JAIA 4TYIA 3DZQA 1SNUA 3FZSA 4Y46A 5CU0A 5C26A 3U9CA 4ANLA 4FSUA 1QCFA 3PA5A 3O8UA 4RBLA 2J0JA 4C0TA 4QMMA 3R7UA 3D5VA 1SMHA 2R2PA 2HAKA 2UW0A 3LFDA 4V04A 4EK8A 1CDKA 3HMOA 3GI3A 2F9GA 3NYXA 4MXXA 4QPAA 1U5QA 4AN3A 4AZSA 3EFJA 3PPKA 1PYEA 3CBLA 2FVDA 2GDOA 4DA5A 4U79A 5CF6A 3CLYA 2GNIA 4IHPA 3UQFA 5AUVA 1B39A 1UKIA 1OL1A 3IW5A 2QOKA 5AP5A 2VN9A 3I7BA 1PW2A 3H30A 2PUPA 2J5FA 3LOKA 4D1SA 2PY3A 4RX7A 3JY0A 3KRJA 3PA4A 4EC9A 3BE9A 2X8EA 2YITA 3DXQA 2CMWA 2GS6A 5J1WA 3R8MA 1FMKA 4A9UA 2BR1A 3GFWA 3LKMA 3JXWA 3QZHA 3FY0A 4IM2A 4TYEA 3VN9A 4D9UA 3AOXA 3V6RA 1OIYA 3FLYA 3P79A 3FI2A 5FM2A 3FL5A 3WARA 1GIJA 3I0QA 4WRSA 4RA5A 5CS6A 4KKHA 4DT8A 2JIUA 3MH3A 2Z60A 4FOBA 4OTPA 3QLGA 3MA3A 1H25A 4DHFA 2W5BA 4F0IA 5GINE 3KGAA 4FL2A 5DR2A 3DXPA 4QTBA 4AW0A 1L3RE 5J9ZA 4FSYA 2VTTA 2WTJA 5HOAA 4AZEA 3R7OA 1E9HA 3AMBA 2W17A 3OTVA 2XIZA 2HZ0A 4JG6A 4C4EA 3O71A 4KBCA 4IC7A 4J96A 4TYJA 3BLHA 4EBVA 4FIEA 2WMUA 2R4BA 4PL3A 5HGIA 3TWJA 2CGXA 2ONLA 3Q9YA 4NK9A 4FVRA 2ZMDA 5IUHA 4GK4A 3IQ7A 3BYUA 2XK9A 4TY1A 3SLSA 3P9JA 4RX5A 4NKAA 4DAWA 4IAZA 4XYFA 4DFYA 4DEIA 4TXCA 2XVDA 4NKSA 4F7JA 3MW1A 1FGIA 1OB3A 3O23A 3GXLA 4RIWB 1Q4LA 4CTCA 4P4CA 3L8PA 3VW8A 5ANOA 3WF5A 5EQPA 2QO7A 2X8DA 3FZOA 3LLAA 2XB7A 3G0FA 5E8ZA 2X39A 3I81A 4L9IA 4LGGA 3H0ZA 2PUUA 2YZAA 4PTGA 4DGOA 4U97A 3D7TA 2XIXA 3EN6A 3I4BA 1JBPE 1V1KA 3QQFA 4H58A 3QRKA 4I21A 4EZ3A 3D5WA 3QTZA 3BIZA 3Q5IA 3VUTA 1PXNA 2VTSA 4AGUA 3N51A 1XBAA 4E20A 4DLJA 1OPLA 3W10A 4X2FA 5EYDA 3AXWA 4ZMFA 3LFFA 5LARA 4JOAA 3DBQA 3NUPA 4NFMA 4NCTA 5LMKC 4JDJA 3EKNA 2Y0AA 3R1QA 3ZHPC 3V6SA 3WILA 4V01A 4FEWA 3EQPA 2VV9A 4ANQA 2JDOA 5DLSA 3SV0A 4I6BA 3W33A 2ZAZA 4B8MA 4A9SA 5FEQA 4BDCA 5IQFA 3NMUF 4RC4A 3KY2A 1JAMA 2R3HA 1WVYA 4YPSA 3NNUA 2W1CA 3MPAA 3C13A 3F2NA 2ITTA 4FL1A 4XRJA 4C3FA 3W2QA 1I44A 2YABA 3H3CA 4AOJA 3ZXZA 3SDJA 3FHRA 3LM5A 1CM8A 3ZO4A 1S9IA 5H3QA 2P55A 2R64A 4FV2A 3W2SA 4K18A 4IB5A 5M44A 3D2IA 3LJ1A 3SX9A 4RWKA 5LVPA 2QO2A 3C51A 3IG7A 3BBWA 3ANRA 3VRYA 2J50A 3KL8A 3H0YA 2XIKA 2ZDTA 4ALUA 3KFAA 3NVKI 2C6OA 3GT8A 4KS8A 5AIRA 2VGPA 5CQUA 5E8UA 2CKPA 4H3PA 3GP0A 4HYIA 3PJ3A 5BVFA 2PVRA 5IG1A 2OH0E 2VTNA 3QF9A 1BL7A 2CLQA 4IVCA 4OGRA 4RFYA 4EZ5A 4O7VA 2WO6A 3GGFA 5J5TA 4DFUA 2JKOA 2GS2A 2PMNX 3NCGA 1H0WA 4LV8A 4ALVA 5DPVA 4GIHA 2J0LA 2Q83A 2IO6A 3ZO1A 1K9AA 5IDNA 5KUPA 3EN4A 2I0EA 2OBJA 5HD7A 3C4EA 1PMUA 1MQBA 3UPZA 3MFSA 4FSZA 4FNWA 4QMWA 2AC5A 3TT0A 4X2GA 5DH3A 3QD4A 3LFSA 4JVGA 4TN6A 2X7GA 4PP7A 5FUTA 4QPMA 5E8TA 4EOKA 3Q2MA 4IAAA 5GIPE 3DTCA 3GC0A 2YCFA 4KIKB 4YJRA 4FT9A 4BZNA 1UNHA 5IPJA 4FSWA 3PJ1A 1BX6A 1Y8YA 3F61A 2HENA 1OPJA 5H8GA 3TZ7A 4CLIA 3VHKA 1GIHA 3G9NA 4BDFA 5HTIA 3D5UA 5K0KA 2B55A 2YDIA 4L3JA 2VGOA 4E4NA 2XK7A 5ANEA 1URCA 2BALA 2PZ5A 4JXFA 4ANBA 2UUEA 1Q62A 3R8PA 1ZRZA 2R3QA 4PY1A 3UMXA 3OY1A 4WHZA 4I5MA 4BN1A 4RT7A 3UOHA 3SA0A 3QCQA 2XA4A 3DKFA 5AR4A 3E8NA 2YERA 2R3LA 2O0UA 3F2AA 3PTGA 4I4EA 3QKKA 4FT3A 4WT6A 4CQEA 1IAJA 2BRHA 2CHLA 4G3DA 4IVBA 2R9SA 4E5AX 1H07A 3F3UA 5H8EA 3OROA 3P5KA 1A06A 3GCSA 2EB2A 4XUFA 3A2CA 3LZBA 3PXZA 3HMNA 2WTVA 3AC8A 2I0YA 4MX9A 3NVMB 4KRCA 4C8BA 1XQZA 1WMKA 4L68A 3UIXA 5LVMA 3H4JA 4X2NA 5AX3A 2VTIA 5HE2A 3OVVA 5CVGA 1K2PA 2QU6A 4R1VA 2QHNA 3QRJA 1V0BA 2UW8A 3HZTA 2XF0A 4FIFA 4OTHA 5TR6A 4BTJA 2ACXA 4NCTC 4WSYA 2IZUA 5E92A 4HVIA 4ASZA 2WMQA 4QMOA 3GVUA 4QMPA 4FEUA 5B7VA 5LVNA 5HNBA 3TACA 5C8MA 4K2RA 5AUTA 2VTPA 3WZEA 5LXMA 2ZOQA 3L9MA 5A4TA 2P0CA 3PSCA 3HX4A 4DFZE 4Z7HA 5AUWA 2WU6A 4I93A 4Y72A 2PUNA 4D1XA 5CAPA 4D4SA 2CJMA 3CTQA 2XNPA 1O6KA 2WQMA 2W1FA 1H08A 3HP2A 2IZSA 1R0EA 4O0VA 1E1XA 3DKGA 4WNMA 4EK4A 3MVHA 2RGPA 2BKZA 1OIUA 2BZKB 3MESA 4YJUA 5IQDA 2ZM3A 4G31A 1G8SA 1A9UA 2IN6A 5IISA 3MSSA 4WA9A 2R7BA 4X3FA 5ETIA 2GFSA 4FTTA 4ITJA 5CT7A 4C35A 5FXRA 4Q5EA 3QLFA 5LVOA 3MB7A 1WBNA 4GK3A 4R5SA 3C4XA 4TYHA 4OT5A 4F09A 3KRLA 3D7ZA 2WELA 2ZB1A 4YO6A 2YACA 5H8BA 3N4VA 5AMNA 4CCUA 5EW9A 4QOXA 4LM5A 2R3KA 3PG1A 2BDJA 2W4JA 4NTSA 3RP9A 3S1HA 4I5CA 4F08A 3FQEA 4GK2A 3OHTA 5CVFA 3SW4A 4NTTA 3S0OA 3BGZA 3R28A 5DI1A 3MN3A 2J0IA 3IPHA 4BCMA 3MBLA 4BFMA 1AQ1A 3R9DA 3FLWA 3QTXA 4WUNA 5DT3A 3DV3A 3OMVA 5CXZA 2C5OA 5FDXA 1SZMA 3K2LA 4GYGA 4BDGA 2RFSA 3NAYA 1OPKA 5AM6A 3QRTA 5F9EA 4C59A 4EJ7A 2ITXA 5IA5A 3A4OX 4M14A 4FOCA 4YZDA 4HYUA 3ZDIA 3TUCA 4FE2A 3R01A 4MBLA 3FMLA 4L00A 3ORZA 4C58A 5K5XA 4CZTA 3DA6A 4DLIA 3UPXA 4OTQA 5E8SA 4FSTA 4PQNA 1SVEA 2QLQA 2E9VA 4MXAA 4YTHA 3EWHA 3ZEPA 4LOPA 2QODA 4FV5A 4K77A 4XOZA 4DEHA 4RZWA 2VD5A 5HE1A 4F9YA 4ZOGA 4IDTA 3PY1A 2ITQA 1FINA 3C4WA 4C61A 3CJGA 4CVAA 3MJ2A 4D0XA 3QRUA 1Z57A 5KMKA 3NWWA 5GZ8A 3U54A 4QMVA 2JKQA 3WYXA 3LCDA 1DI9A 4EH5A 1XBCA 3ZBXA 3C1XA 1JWHA 1JOWB 4Y83A 4EYJA 3I6WA 4NM5A 4EUTA 2H96A 2R0IA 4O1PA 5M4UA 3RAHA 4MXYA 3GQLA 3SRVB 5KMJA 4FKRA 1MRYA 4M15A 3C4CA 5HBHA 5IF1A 4FGBA 4MWIA 1PMNA 4M69A 2WZJA 4EJNA 1XH8A 2P2IA 3U4WA 2UVYA 4M0ZA 3T8OA 3V51A 5B2KA 5JRQA 4RJ7A 2QKRA 1I09A 5IQCA 2JAVA 3DBCA 4XH6A 5A6NA 4JIAA 3PA3A 2VWVA 5M08A 4D58A 4TW9A 2BKKA 5CZIA 3PIXA 3U4UA 4RIYA 3OT8A 2JIVA 3LJ2A 3HDMA 4MTAA 3EZRA 2WEIA 4XCUA 3AC2A 2CGUA 5KO1A 4FL3A 4C4JA 1JKLA 3QQLA 4QP8A 4UZHA 3U9NA 1WBWA 4GVJA 1J7IA 4ZTMA 2VTMA 3EQFA 4S30A 3S00A 4M13A 2J9MA 2XKFA 3C9WA 2YEXA 4U3YA 3KRXA 3P08A 1WVWA 4XBUA 2OW3A 3L1SA 1JSTA 5A6OA 2ZDUA 1WVXA 2Z7QA 3QKLA 4JR3A 5FXSA 4DBNA 5A4LA 2F57A 2R3PA 4X7QA 5LCJA 4EH4A 5DEYA 2WFYA 3AT3A 2W1ZA 3OCTA 5DOSA 3R00A 3P7CA 3UTOA 3Q6UA 4A4LA 1OIQA 3HKOA 2GHMA 4XG8A 1B6CB 3UP2A 1O9UA 3P7AA 4F6SA 4Z9LA 4DEBA 2JDTA 3F5PA 2B0QA 2PULA 2RL5A 2PYWA 2QI8A 4X3FC 4CMTA 5K0XA 1B38A 5AV0A 3WZKA 2BAKA 1M7QA 2ITOA 3EN7A 2VTQA 3EQDA 4UN0C 3L8VA 3SXSA 4LFIA 4E8AA 4RC2A 1OI9A 3LPBA 3UZRA 4IB1A 4J52A 4GKHA 3PJCA 5C01A 2PHKA 1G3NA 3KU2A 3PIYA 4QRCA 2W7XA 2UZNA 3OWKA 3PIZA 4AAAA 4YJQA 5AP2A 1GZNA 5DFPA 1H26A 3HDNA 5E91A 5IUIA 4YZCA 5IQGA 4YJOA 3UBDA 3MFRA 4ZLYA 3RKBA 3EL7A 4U45A 5I3OA 4QYGA 1OIRA 4XG6A 3HUBA 4GFGA 4YBKA 2J6MA 4YHJA 3SAYA 4AZWA 1U46A 1R1WA 5FLFA 3CPCA 4U42A 1ZAOA 4GUBA 3LQ8A 3CSVA 5LVLA 3SQQA 3Q96A 3PDTA 3RK5A 3QKMA 2G2HA 4FV4A 5EKOA 3OCBA 1J7LA 3MVLA 4QMSA 3KVWA 4UWYA 3TNIA 5ANKA 4DEDA 4DG0E 1U59A 2Z02A 2BIYA 2O64A 3IONA 3TNPC 4TNDA 3E8CA 2WMWA 4ZTLA 1FPUA 1T46A 3EQIA 4TNBA 3TI1A 4I94A 2UW3A 3GUBA 4C38A 4LL5A 3Q2JA 4ZS4A 2EXMA 5C1QB 1BKXA 3GFEA 3P78A 4EQMA 4D5KA 4O0UA 4O86A 3NAXA 3QTQA 4FTUA 3U51A 4UV0A 5I9YA 2PL0A 3EFWA 4C7TA 2NRUA 4HZRA 3NW6A 5CEMA 3R1SA 3PXFA 4EWHA 1LEZA 2F4JA 2R5TA 4RWLA 4IB3A 1PXPA 2CGWA 3R9OA 3V8SA 4ZSGA 5C4KA 3DCVA 2FGIA 4FKIA 4L46A 2ZVAA 2CN8A 4ZZMA 3FLNC 2PU8A 2V62A 1M2QA 4RIWA 2YIQA 3ZMMA 5HLPA 3R0TA 3TZ9A 2QOFA 4JAJA 5FEEA 3G33A 2BFXA 1Q8UA 2I6LA 4RC3A 4U41A 1JSUA 3R1NA 2OJIA 3E7OA 2BTSA 5CEOA 3QYZA 4P2KA 3AGLA 1TVOA 4G5PA 3MDYA 5JZNA 3ROYA 4FR4A 2I1MA 4FIIA 3NR9A 5HG7A 2AC3A 1Z9XA 3DJ7A 4K11A 3WE4A 3BHYA 2JFLA 4WBOA 5L2QA 4YHFA 2YDKA 3TKHA 4JBPA 3EQGA 5HX8A 3QCSA 4JG7A 2RKUA 2YISA 3ZS5A 3PP1A 2BIKB 3QD3A 4XJ0A 2R3MA 5HKMA 4J8MA 4PDOA 4TWOA 5LMBA 4O0RA 5M56A 4NL0A 1HCLA 1PXOA 5ETFA 3MH1A 3P86A 3TUDA 5JQ8A 4W8DA 3VBVA 3BELA 2JDVA 5CI6A 4IAFA 1KE8A 2W1IA 5JK3A 5AV2A 4C2WA 4BCHA 4BGQA 4ENYA 4J97A 3NUNA 2QOIA 3NPCA 5D11A 4CFWA 3POOA 4IANA 3W16A 5EI8A 3QHWA 3PPZA 4DYMA 4R7HA 2P2HA 3NIEA 4AQCA 4DTKA 4OTDA 4OTRA 3D5XA 1M2PA 4CFNA 2B9FA 4CNHA 4BGHA 5J7BA 2A2AA 1PXKA 4NM0A 5L3AA 4NJ3A 1HCKA 4OW8A 3W2OA 4BKZA 1M52A 5A4CA 4PTEA 4E4LA 4XHKB 5C8KA 2GNFA 2QR8A 2R3OA 4RIOA 5JEBA 2B9JA 3BHUA 4GUEA 4BTMA 3HAMA 4C36A 4USDA 2BAQA 2G2FA 2P3GX 4UXLA 1TKIA 1OM1A 4W4YA 3LFBA 2O3PA 2YIYA 3A7FA 5L6PA 3PZHA 1URWA 2ZV9A 4Q5HA 3E64A 3LE6A 5FXQA 4IEBA 4O6EA 3DXNA 2OJ9A 3TKIA 3D15A 4BHZA 4O7LA 3CS9A 3DY7A 2Y4IC 2GNLA 3GU8A 2OGVA 3MGYA 2G15A 2IZTA 2Y4PA 3V8TA 1YHSA 4H39A 1P4FA 3VVHA 4EHVA 3VJNA 2VX3A 3A60A 2XNEA 5CF5A 2BUJA 3QD2B 4XG9A 2UZEA 5E1EA 4CMOA 4CGAA 3PVUA 1VEBA 3KXXA 5ANIA 1J91A 4KIKA 4QMZA 3DJ6A 3FC1X 3CQEA 3UE4A 2OLCA 3PFQA 5CNOA 3DNDA 5F20A 4ACCA 2VO0A 3KKVA 2HWPA 3OUNB 4XV9A 3V5QA 4FSMA 1VYWA 5IZFA 4YMJA 1ZYDA 5ACKA 2CPKE 1UWHA 1NY3A 1SM2A 3LCKA 1ZYLA 3ZSGA 4I0TA 4H36A 4TL0A 3JR1A 4E93A 3FQHA 2EB3A 5L6WL 4ANNA 2CKQA 4FTQA 2WB8A 4WO5A 2NNWB 2EXCX 4N6YA 4FC0A 4RRVA 2XEYA 3PP0A 3QFVA 4AW1A 4DINA 2ZYBA 1MRVA 2OICA 4ID7A 3BI6A 3R8LA 5TE0A 3N4TA 4FV1A 1DAYA 5E8XA 5BVDA 5DIAA 4NT4A 2WHBA 4D2PA 4DEAA 3SG9A 5T6KA 2J0KA 4MHAA 4YSJA 2UVZA 3AGMA 2EXEA 3QYWA 3F88A 4M66A 1J3HA 2QQ7A 3HV4A 2YIXA 2QVSE 4C33A 4FKGA 4HJOA 4IFCA 4BBFA 4KBKA 5LJJA 5AP6A 5BVNA 5K4JA 3OTUA 2ZM4A 5I0BA 5LMKA 2ITPA 3FYJX 4XX9A 4BYJA 4E6QA 3KF7A 3R9NA 3D83A 2VWYA 1J7UA 4D2WA 3JY9A 3G90X 4O38A 4FV6A 4YLLA 2F2CB 3NSZA 4B4LA 2CKOA 4DCAA 3BCEA 5I5ZA 2C30A 4CV9A 4PL5A 4IXPA 5TF9A 1YQJA 4U81A 3ZCLA 4CT2A 5KZIA 1STCE 2A27A 4HGLA 4CCBA 5GNKA 5KBQA 2W9FB 5KMNA 5HO7A 3W1FA 4JR7A 4XP2A 1BYGA 2YN8A 5HICA 4FKSA 4FSQA 2RSVA 2ESMA 3VS1A 1MQ4A 4PPCA 2BZIB 3KXZA 3LW0A 4J53A 5E90A 1PJKA 2C3JA 2YZLA 2YM3A 3I5ZA 4HVSA 4I20A 4GIIA 5DRBA 4F7NA 2W1GA 2R0UA 4K1BA 4I6HA 2C6DA 4Y5QA 3D9VA 1QPCA 3BU3A 4RWIA 4PP9A 4ZSEA 4JIKA 4EKKA 1ZZLA 3QU0A 4QT1A 5KZ0A 4IADA 3SXRA 2W9ZB 4F9WA 3C50A 5HNIX 3CR0A 3O8TA 4L52A 4LG4A 2V0DA 4MEDA 2F7EE 4ZS0A 5CEKA 4L6QA 4MCVA 4FTRA 4TYGA 2FSOX 5FTOA 3VS5A 4L67A 3FWQA 4R1YA 4FODA 5BPYA 5LCKA 4DE4A 2Y6MA 1IAHA 2XUUA 4ZAUA 3UQGA 4CTBA 5ITAA 2XK4A 4U8ZA 2GS7A 3HEGA 3O17A 4JX7A 4AOIA 3OZ6A 2Y4IB 3ZM9A 1FQ1B 1NVRA 2WMAA 3G5DA 3LIJA 3TEIA 4I4FA 2OZOA 4E4MA 4RPVA 4YTIA 5KMLA 1UU8A 2SRCA 4QYFA 2IVVA 4UEUA 5LWMA 5DN3A 4QP1A 4CV8A 4GU6A 4C4FA 1JQHA 4TKSA 3ULZA 5BQ0A 3QWJA 3GCPA 1YOJA 5AR8A 2UV2A 2YM8A 4C4HA 2XYNA 3BYOA 3ZO2A 2PVJA 3NYNA 4APPA 3MV5A 5A54A 2JKMA 1OKWA 2HK5A 4AN2A 3LMHA 3ORPA 3N9XA 4APCA 3R6XA 2JD5A 3BU5A 4QQJA 2JDSA 4E3CA 3SVVA 3VBTA 1H1SA 4M8TA 3ZFMA 2BMCA 1ZWSA 4DEEA 5KKRC 4AZFA 4V05A 3E7VA 2HWOA 5CWZA 3C0IA 3SRVA 2F2UA 4Y5HA 4RJ3A 3PRFA 4FUYA 5D10A 2CNVA 1FVTA 2QOLA 1YXVA 3OWLA 1XJDA 5AV1A 5JZJA 2X0GA 5D7AA 4F9BA 1JKTA 2W1DA 3FSKA 1XWSA 1UNGA 3LFNA 1UA2A 3RNYA 5J8IA 3F6XA 5CX9A 3LM0A 4CZYB 2GQSA 2W06A 2XH5A 4FSRA 4MVFA 2C6KA 3H9OA 3AQVA 3GNIB 1YDRE 2X7OA 3DK6A 2A1AB 1YRPA 4UALA 3WZDA 2J2IB 1Q8TA 4NUSA 3I60A 3TG1A 2HZ4A 4F1MA 4O7WA 3FI4A 1YWNA 1V0OA 2IWIA 3V3VA 4E26A 2YM7A 4A9TA 3PUPA 5IEVA 4IZ5A 1JSVA 4DH3A 2X2MA 4BDHA 2AUHA 2CLXA 3KN5A 3F69A 3NNWA 4GFOA 4P7EA 4YGAA 5AJQA 4TWPA 5B2LA 5K5NA 4AE6A 2VTHA 4GT3A 3QAME 3HAVA 2YCRA 4GL9A 4NJDA 3RK7A 3W8LA 2HZIA 1DS5A 1CKPA 3CGOA 3DB6A 3LXKA 4G3GA 4N6ZA 4NIFB 5IH6A 5JKGA 2Z7LA 4E1ZA 5CASA 2VX1A 4QMYA 2NRYA 3R73A 2QC6A 4IWQA 5HX6A 3R04A 3Q9XA 4PDPA 3OEFX 3RHXA 3GCUA 2ETKA 1ZXEA 4QP2A 4RX9A 3R8ZA 5FBOA 3ZEWA 5BNJA 3ZO3A 1AGWA 2X4FA 3IGOA 3EZVA 3QCXA 4DH7A 2ITWA 5BUIA 4FT5A 2PE1A 3EHAA 3FY2A 2Z7RA 5KHWA 4I0RA 2O65A 5I3RA 2P33A 3PVGA 5AR3A 4YC8A 2C0IA 4PPBA 3RNIA 3EQRA 5HLWA 2YCSA 4QPSA 5JFXA 3FUPA 1NA7A 3PJ8A 4YHTA 4EHZA 2B9IA 3FLQA 2XZSA 4NW6A 4O0TA 4RX8A 3ZU7A 1YXXA 5D1JA 3VS3A 5C03A 2J7TA 3JVSA 4G6OA 3ZZEA 4FV3A 3FC2A 4JL9A 3ZDUA 3VNTA 2BZHB 4AG8A 4BCPA 5J1VA 1Q61A 3R2BA 4YJPA 5FBNC 1PYXA 3RWQA 1DI8A 4JI9A 3QX4A 5BYZA 3UJGA 3BYMA 2GNGA 4CG8A 3QZGA 1M2RA 3TV7A 4XP3A 5IH4A 2QLUA 1KOBA 4FGRA 3CEKA 3EN5A 2LAVA 1Q8YA 4L42A 4NM7A 3L9PA 4G9CA 4M3QA 4EOSA 3R63A 4CQGA 3H9RA 2W5AA 3DZOA 4WRGA 2KTYA 1YI3A 4RLKA 2XNNA 4PRJA 3F2RA 4JLCA 3KB7A 1YI4A 4EHGA 3C4ZA 4N4SA 5I9ZA 4FZ6A 1YHWA 4D5HA 3IS5A 3KK8A 1CSNA 2PVKA 1ZMUA 3DDPA 5TKDA 3A8XA 4AN9A 3Q9ZA 3QZFA 3QTWA 4YZ9A 5EW8A 4XP0A 4IACA 4HVHA 5AAFA 2IJMA 4JDHA 4NH1A 3WBLA 2BTRA 4EBWA 5LMAA 1ND4A 4YP8A 4O7NA 3IGGA 1P14A 4I5PA 4AGCA 2OJFE 3MH2A 2C3KA 4JX3A 1XH4A 4NSTA 5KKRB 2QURA 2FSTX 3NIZA 3RCJA 3WOWA 2GHGA 5GZ9A 2PMOX 3BGPA 2X7FA 3D2KA 4WNOA 5CSXA 4FV0A 1YWRA 5AR7A 3RPVA 5HNGA 4D2SA 4IZAA 4XV1A 4BY9E 5KMMA 2XNOA 3G6GA 2V22A 3G9LX 4QYEA 3KULA 2UW6A 2X8IA 3QUDA 3AC1A 4LMNA 2OXXA 3L9NA 4GT4A 3E3PA 2ETMA 5JRSA 5HG9A 4W4XA 4OR5A 2ITYA 3BHVA 5M4CA 3FV8A 3VBQA 4I3ZA 2E9NA 1KV1A 3FZRA 3ALOA 2C5VA 3E63A 1WBTA 1QPJA 4O0SA 4EL9A 5LQFA 4QD6A 5JGAA 4DG3E 5HVYA 1R78A 1APME 2OIBA 3FZPA 3NUAA 2IW6A 4D4YA 2C6LA 5BVKA 4F63A 3GENA 5A3XA 4ACHA 1CKIA 5AWMA 4LQMA 3ZLWA 4D9TA 3VIDA 4UMQA 2BDWA 3UO5A 4MYGA 4Y8DA 5CU2A 3NW7A 2JC6A 3C7QA 4EH2A 2ZJWA 3LQ5A 3R9HA 3ZRLA 4EYMA 3II5A 4X6QC 3DTWA 3NS9A 1Q5KA 3MIAA 3ENMA 3QQKA 2A19B 4CFVA 3BQRA 4AS0A 5BX0A 4QMXA 1E1VA 4G2FA 4OTGA 4GRBA 3DQWA 5FDPA 5J79A 2CSNA 2R3RA 3ANQA 3CQWA 3ZC5A 2A4LA 1H1RA 2YAAA 2YIWA 4U40A 3R02A 1GAGA 2BHHA 3BEGA 3BHHA 3DK3A 4DFLA 3WZJA 3OC1A 1IEPA 1P2AA 4WBBB 4P5ZA 2J0MB 4FKLA 4QYHA 1PKDA 4C3PA 3BLQA 4S33A 4U44A 3QQGA 3MFTA 4QMUA 1PY5A 3VF8A 5AAEA 5L2WA 4U43A 3RALA 5DBXA 3IW8A 3HRBA 3KA0A 5EM6A 3SOCA 4QMNA 4L01A 2WMSA 4Z55A 3UODA 4IX4A 2E9UA 4FYNA 4YLKA 2AYPA 4QMTA 3LCOA 4M68A 1PXLA 4CYIA 4F1OA 4MAOA 1RQQA 4NFNA 4A07A 3PRIA 1KSWA 5AADA 4RJ4A 2FA2A 2O2UA 3R7EA 2JEDA 3LXPA 4XG2A 4TZRA 3IOKA 3AT2A 1U54B 2WMXA 3AC4A 3PPJA 4YC3A 2Z7SA 3WZUA 4F7SA 1Y6AA 2WTDA 4RVLA 5I4NA 4C2VA 3OW4A 1FVRA 3DLSA 3IDBA 3BU6A 3TCPA 2BRNA 2ITZA 4YUQA 3ZUUA 4USFA 2WTIA 1ZMWA 1GNGA 2V5QA 1R0PA 2ERZE 3DK7A 4QP4A 3BV3A 4FZAB 4R7BA 4X6RA 2FSMX 4ZJJA 5EKNA 4OBOA 3ZH8A 3PVBA 2BCJA 3BKBA 3QQUA 2WNTA 4J95A 1WBOA 2E2BA 3CTHA 3NCZA 4AUAA 4EK6A 4OAVB 3GCVA 3MTFA 4OUCA 5E7RA 1MRUA 4CZUA 3P7BA 3ORKA 1ZYCA 1YW2A 2RFEA 4WG4A 1Q3DA 2RF9A 4RQKA 3BWJA 5EW3A 2WPAA 4NWMA 2GCDA 3WYYA 2G01A 5EYKA 4NW5A 5JH6A 5E9EA 3KMUA 5D12A 5KCVA 5HI2A 4ERKA 2PVFA 3EN9A 2WOTA 2GTNA 1PXIA 2WIPA 3ZLXA 5IQEA 4DGMA 2XNGA 2ZV8A 3R7GA 3MI9A 3V01A 4RFZA 5AR2A 4BKYA 3IW6A 1XH5A 1QMZA 4I1ZA 3FXZA 1VR2A 3CCNA 1O6LA 3GOKA 4GMYA 3RMFA 3FMEA 2DQ7X 1OUYA 4QTAA 3HMPA 3ZFYA 4KABA 3VS2A 3ATSA 2WQEA 3Q4TA 3GBZA 2BDFA 5J9LA 1F0QA 1U5RA 3D0EA 2HY0A 3A61A 4YC6A 1Y6BA 2UVXA 2BPMA 3R71A 4I23A 2PE2A 4W4WA 4CKJA 4KWPA 3DPKA 5DGZA 2IW9A 3MPTA 4NM3A 4EOMA 1AD5A 5E1SA 2C68A 2QOBA 2UW9A 4BDAA 5L4QA 2QR7A 4YBJA 3O7LB 3NUSA 4F99A 4Z3VA 3B8QA 4O2PA 4BB4A 3LXNA 2R3FA 4FTLA 3DT1A 4FKJA 1WBVA 5DRDA 5EI2A 5BVWA 4FI1A 3CC6A 2WGJA 4RWJA 4XV3A 4EOPA 1KE7A 2BRGA 3HV7A 4NEUA 2ETRA 4G5JA 4LUEA 1YDTE 3NUUA 4QP3A 3LMIA 4U80A 4U7ZA 1Q99A 4ENXA 4LGDA 3QA8A 4MD7E 5ANGA 4G3CA 3W2CA 4N57A 3V5JA 2PTKA 3MFUA 1BI7A 2R3NA 3E8DA 3E8EA 3LAUA 4GG7A 4PMTA 5HO6A 3RWPA 3EB0A 4F6UA 4A9RA 3ROCA 3CY2A 4BCGA 4J7BA 3T3UA 3K3JA 4BBMA 1JKSA 4F1TA 1P5EA 2OKRA 4ZP5A 4FKOA 4BCJA 1OUKA 3V5WA 3ORNA 3JS2A 4F6WA 4HNFA 4JDKA 3KN6A 1IASA 4CD0A 1JNKA 4O2ZA 4B9DA 4YJTA 3B2TA 1BI8A 4XBRA 3W8QA 4AT4A 3A62A 2RG6A 1PHKA 3MY0A 1J1BA 4CXAA 4UWBA 5EDRA 5DYJA 5HG8A 3FXWA 3NUYA 4FTIA 4IC8A 3ELJA 3EOCA 3QD0A 5ICPA 5AV4A 4W9WA 4BTKA 4ITHA 2C69A 3W18A 5HLNA 3HV6A 3UG1A 4IZ7A 3VQUA 3UQCA 3LQ3A 3I5NA 3QTSA 3CD3A 2QONA 3GQIA 4EZ7A 4IVAA 4OTWA 3VUGA 4BDKA 2YJRA 4ERWA 3QTIA 3P4KA 4ZSJA 2YWPA 4X21A 3HV5A 3R7YA 3Q3BA 4RJ6A 2Y7JA 1JKKA 3V5PA 5DNRA 1H1QA 2YM4A 1R3CA 2OXYA 3UOLA 3O96A 4R8QA 3DBFA 1UKHA 4HGEA 4ITIA 4PTCA 3DFCB 3A8WA 4MQ2A 3FQSA 2VO3A 4IWOA 3RM7A 3W32A 3W55A 3U6HA 5EYMA 3UOKA 1PMVA 2YA9A 2GSFA 2HXQA 3IK3A 1T45A 4O0XA 5DA3A 1RDQE 1YI6A 2XBJA 1LR4A 3PVWA 5AP0A 5HO8A 4BIDA 3UOJA 3O8PA 1WBPA 3PZEA 3SXFA 3OXTA 3D14A 2YWVA 1HOWA 2OF2A 4RGJA 4BC6A 4R3RA 4L7FA 1IG1A 3A7HA 4FV9A 3SD0A 3VQHA 1NXKA 3ZLSA 3V5LA 4M12A 4FTOA 3PXYA 4BRXA 3EL8A 1XH9A 4MK0A 3O7LD 5G6VA 1M17A 3VUIA 2FB8A 4W8EA 3WIKA 3TUBA 2JLDA 2JBPA 3TJDA 4AACA 3M11A 3SOAA 3MTLA 4ANOA 2OU7A 3RVGA 1GJOA 4BI0A 2B54A 5CALA 3TV4A 1ZY5A 5AA9A 1F3MC 4IJPA 3KXGA 4A4OA 3RI1A 4DC2A 4O84A 1TQIA 5DEWA 4Q2AA 2QOOA 1EH4A 3UDBA 5HZNA 3Q5ZA 5EI6A 2VWWA 4QMQA 3LFAA 1OL6A 1OBGA 5A46A 3BQCA 5CSVA 3CKWA 3F3ZA 3RGFA 4G9RA 4G3FA 4IWDA 2UZDA 4ARKA 4LOQA 4RG0A 4MH7A 5CSWA 1LUFA 4O96A 4BIBA 4DGNA 5H2UA 3TDWA 4Y73A 2XJ2A 4PPAA 4YPDA 5F94A 3GOPA 4R7IA 4ZTQA 3FMHA 4RJ8A 4X2KA 3ETAA 1PMEA 3F3TA 3HMMA 3EFKA 2YIRA 4KIQA 1W82A 3FL4A 4NIFA 3VJOA 4D4RA 4CKIA 4AOTA 4BWKA 1GZ8A 3ORTA 4CRSA 3KVXA 1YOLA 4GCJA 1YXTA
chains in the Genus database with same CATH superfamily
2FH9A 4FEXA 2BROA 2QG5A 5EOBA 4DTAA 3GB2A 2UZVA 4O81A 3U55A 1Y8GA 2W05A 3BX5A 4G1WA 4ZK5A 3TNWA 3COMA 4IM3A 2FSLX 2I40A 4B7TA 5HU3A 4PL4A 4K9YA 2CGVA 3OEZA 2QOQA 1QPDA 2R7IA 4UMPA 5I9XA 2Z2WA 5EM7A 3ZC6A 1REKA 3FPQA 2OJJA 3VC4A 2OFUA 2QKWB 2UW7A 4F65A 3FMNA 3IECA 4HGSA 5EQEA 4ASEA 3FMKA 3FKOA 1H00A 2BVAA 5CVHA 1DAWA 4F70A 2OG8A 4G34A 5B2MA 2ITUA 4CKRA 3MWUA 4KKEA 1H1WA 4L43A 5K9IA 1RJBA 5EH0A 5L2SA 4LRKA 2YLFA 2OH4A 5HIBA 5D7VA 3MVMA 4AF3A 4CFFA 4EI4A 1LEWA 1OECA 3FMJA 5AFVA 5M06A 4I22A 3RCDA 5ANDA 3ZFXA 4Z7GA 2XMYA 5M4IA 5A14A 3G51A 3QQJA 3ZUTA 4KB8A 5L8KA 3L8SA 2EVAA 2I0VA 4UMTA 5K3YA 2Y8OA 2ERKA 3MPMA 4I5HA 4J71A 1A48A 2XIYA 3ZSIA 5DR6A 3B2WA 4D2VA 5J9YA 4KAOA 4FEQA 5TT7A 5E4HA 4K6ZA 3ORLA 4S34A 2X81A 1UU9A 3K3IA 4FVPA 4AGWA 4AE9A 3F7ZA 2XKDA 3VW6A 2VU3A 2EWAA 4L44A 4UYNA 2O8YA 5A4EA 3FSFA 5KX8A 5DMZA 3QC9A 1XH7A 4UXQA 4B8LA 4I24A 5ETAA 1G5SA 2OJGA 4R3CA 4U6RA 5HEZA 1UU3A 3E62A 3AC5A 3UIUA 4PMMA 4V0GB 2FUMA 2WXVA 3GU6A 4E7WA 5A4QA 4BHNA 4CYJA 2C6EA 5C9CA 4QQTA 2GTMA 3NW5A 2XK8A 4D4VA 2WQBA 3DQXA 3DS6A 3UNZA 3KF4A 3WF6A 4D2RA 4FUXA 1W7HA 3WF7A 5BVEA 1LPUA 3DLZA 1TFFA 4FK3A 2NYAA 4A4XA 3DJ5A 2GMXA 1UU7A 5M07A 5E8YA 5L8LA 4QQ5A 2VTJA 3BZ3A 4E6DA 3R8VA 5IQIA 5CU4A 3Q53A 4IAYA 1U4DA 2GU8A 3M42A 4PX6A 3MIYA 1LP4A 3CD8A 3W2PA 3Q4CA 5EHOA 4ZEGA 4A7CA 2HZNA 4BWPA 4ZSLA 5AR5A 5IA3A 2CCIA 4I92A 4JDIA 1Y57A 2CNQA 4DTBA 1OBDA 2NPQA 2OIDA 3ZUVA 4DCEA 4CSVA 4USEA 4GKIA 4DDIA 4CMUA 2PVHA 1R39A 3ORMA 3RZFA 1FVVA 4IFGA 4EC8A 4WIHA 3RPRA 5CT0A 2VWIA 5FGKA 3IW4A 4BF2A 4AT3A 4LI5A 4IX3A 4B6LA 3F5XA 3V04A 4GFMA 2UZLA 1M14A 5HCXA 5IA4A 3AG9A 4OAUC 2B53A 5IQHA 2RIOA 1H24A 1MUOA 4Y85A 2NP8A 4Y95A 4JQ7A 3FKNA 5AP1A 3R83A 5IEXA 4NYEA 5CZHA 2GNJA 3VS4A 5IA0A 4PMPA 4FKTA 4JS8A 4RZVA 4AFEA 2F49A 3ET7A 4FKVA 4RVKA 5TOZA 4DN5A 5CAUA 3NRMA 3ZZWA 5TO8A 4BCNA 4EWQA 3GC8A 2C47A 5L2TA 3E3BX 4DH1A 4PWNA 3OW3A 4QP7A 5AP3A 3OXZA 4GW8A 1QL6A 5CI7A 2VTOA 4M84A 2V7AA 1ZOHA 2CN5A 4BCQA 3DOGA 4BDJA 3OWJA 4FSNA 1GIIA 2IVUA 3BV2A 4YJNA 2C4GA 3FI3A 4BBEA 5CEPA 3GEQA 4LRMA 3UIBA 2ZV7A 3EYGA 5CAQA 2V55A 3K5UA 5CEQA 4YO4A 3O50A 3ORIA 5C4LA 3VUHA 4UYAA 1ZOGA 5JGBA 4XV2A 4WD5A 4KINA 4YU2A 4J8NA 1PF8A 5EM5A 2HOGA 4HNIA 2QO9A 3PXRA 5AUZA 3V5TA 3SGCA 1U54A 4KSQA 4AZVA 3COKA 2X4ZA 2GPHA 3HYHA 3M2WA 4O4FA 4WG3A 3DDQA 3GC7A 2V7OA 3OFMA 5IKWA 3DBEA 1BLXA 5GJFA 1VJYA 4QNYA 4QTCA 5DHJA 2GQGA 3ACKA 3EH9A 3HA6A 3LLTA 3C5IA 4AW2A 4FG7A 4H3QA 3CP9A 2C5NA 4TPTA 5DE2A 5HIDA 1ZMVA 4JNWA 3F3VA 4O0YA 2X9EA 4E6AA 5KMOA 3RPOA 2PE0A 3AD6A 1GZKA 4IE9A 5KMIA 4LRJA 1P4OA 5HD4A 4XNEA 5I9VA 2IF8A 4Q9ZA 2WMRA 5CANA 2XJ0A 3L8XA 4BVUA 4O82A 4FTCA 3E5AA 2JGZA 5E8WA 4YSMA 4H3BA 3DNEA 4GSBA 3Q4UA 3NUXA 4M7IA 5EYCA 3ERKA 3EYHA 3RJCA 3RPYA 2WTWA 1KE5A 3VS7A 4LYNA 2X2KA 4DITA 1ZARA 5HG5A 5EQYA 4XG7A 3ATTA 3WE8A 3DBDA 3UYTA 4CFMA 4L45A 3NGAA 3I6UA 3KCFA 1W98A 2QHMA 3KK9A 3UG2A 1GOLA 4BGGA 2G1TA 2A0CX 4O7TA 3AD4A 5F4NA 5BVOA 2PPQA 3RK9A 4HVGA 2VO7A 4TWNA 1XMMA 2PWLA 3S4QA 2H6DA 1WFCA 2UZOA 5FP6A 2OZAB 5CSHA 4IQ6A 5AUYA 5M09A 5GJGA 4DBXA 3UO6A 3G15A 1OKVA 3QTRA 2O5KA 2WTKB 4LV7A 3AMAA 3PE1A 4Z16A 3QCYA 5M55A 2YHVA 4CLJA 5JN2A 2HCKA 4RIXB 5FRIA 3UZTA 4QYYA 4EH9A 3CE3A 1TZDA 4L3LA 1ZOEA 3EKKA 2B1PA 1TQPA 3C4FA 2BFYA 1REJA 3MA6A 4JBVA 5CTPA 3TNQB 1PXJA 4I41A 4AA0A 4RVMA 1Q24A 1VLRA 2VAGA 4MBJA 5EDQA 3PY0A 2ITVA 1MP8A 3BE2A 3WI6A 2WKMA 2W4KA 4HCUA 3Q60A 5JFVA 5M53A 3B8RA 5AP7A 2OWBA 4J99A 4A06A 1ST4A 2CCHA 4OTIA 1W84A 3NNXA 4UWCA 5IA1A 4GVAA 4K8AA 3EMGA 2XEZA 3CJFA 4O4DA 4EUUA 3OBGA 3LJ0A 3UGCA 2XNMA 1F5QA 1YXSA 3GC9A 4M0YA 3KQ7A 3F3WA 2IG7A 3MY5A 2YFXA 3F9NA 2VTRA 5C27A 2JAMA 1H0VA 3LCTA 1J1CA 1O6YA 5FP5A 2JITA 5AX9A 2Q0BA 4EH8A 3DGKA 3H10A 3JUHA 5HE0A 4ZLZA 3LXLA 3M1SA 4G17A 5JFWA 3KXHA 3VWAA 2VWZA 3DKCA 5CU6A 2C0OA 4FIHA 1Q8ZA 5CXHA 5G1XA 3AC3A 4QTEA 2XK6A 4G16A 5C8NA 4ZY6A 4JRVA 2JKKA 4KIOA 4UY9A 5E8VA 3F7WA 2XKEA 2VNWA 3VHEA 3DAJA 1XHAA 4RFMA 4C62A 5HTCA 4KD1A 4O22A 3R30A 4EQUA 4NZWB 1UWJA 5JT2A 2Z8CA 3N4UA 3CTJA 4O27B 5ACBC 4F4PA 4FZDB 3MVJA 2H9VA 3QA0A 4FNXA 3FAAA 3QQHA 3BHTA 4MBIA 3R7VA 4F64A 2HYYA 1FBNA 5IH5A 1BMKA 3TXOA 1QPEA 3RBWA 3O2MA 5AIKA 4HCVA 2X1NA 4WG5A 4ZTSA 1L8TA 1YWVA 2CKEA 3SKCA 4FMQA 3REPA 1KUTA 2BHEA 2B52A 4FICA 4FRFA 5BMMA 4L53A 3ULIA 2XAMA 2YM6A 4FT7A 4ZZOA 5A9UA 5DVRA 5FTGA 4FTMA 3QHRA 4M67A 1PXMA 3UP7A 4CEGA 4F9AA 3F66A 2UZUE 4U5JA 4XOYA 2I0HA 2JBOA 4FZFB 4CFUA 4L8MA 4HYSA 2XM8A 4AGDA 4G6LA 4BR3A 1SVGA 5FD2A 3T9TA 1V0PA 4UZDA 1G8JA 1H27A 4IX5A 4E5BA 4I6QA 4F0GA 3Q6WA 2PVLA 4BIEA 5J5SA 3CQUA 3LVPA 5IMEA 1OKYA 5T68A 4FZ7A 4MD9E 3CKXA 4O91A 4U3ZA 3TM0A 5CENA 1IRKA 3EJ1A 4ZJVA 2W96B 4XG3A 2ONLC 1XKKA 4M97A 3RZBA 3COIA 4BCOA 2R3JA 3HLLA 3CGFA 1YHVA 5EHLA 2ZFYA 1Z5MA 4WKQA 3BEAA 2VRXA 3ZSHA 4FKWA 1FOTA 3BLRA 4R6VA 3AT4A 5HQ0A 3KRWA 4L7SA 2W1HA 5IUGA 3FBVA 4WUAA 5EDPA 3FEGA 3VUMA 3S95A 1H28A 3TZ8A 4D2TA 1Q97A 3POZA 3F82A 1OGUA 4H1JA 2WD1A 4HVDA 4IAIA 4DGGA 5CF4A 3CY3A 5EFQA 1KOAA 4BI2A 1YOMA 3TJCA 3AKJA 4P5QA 3ALNA 4DH8A 4MNEB 1RE8A 3FKLA 5GIOE 4O7SA 1KE9A 3WF9A 2PUIA 2XCHA 2VWXA 4GJ3A 3UC3A 3A99A 5I9UA 2B7AA 2R3GA 1UV5A 5FG8A 4PF4A 2XS0A 4AX8A 4G6NA 5D41A 3PG3A 2JIIA 3RINA 3T3VA 3FLZA 3Q52A 2HELA 4TRLA 5K4IA 3IKAA 5CU3A 5DWRA 3A4PA 4WOVA 4YZNA 4EOOA 4EK3A 2OI4X 2P4IA 1S9JA 2C5XA 3FDNA 3K54A 5EM8A 5AA8A 4MD8E 5JGDA 2OIQA 2DYLA 3HP5A 4GEOA 1ZLTA 1GZOA 3MY1A 4ZTNA 3PWDA 4KSPA 4EONA 4GV1A 2E9PA 3DU8A 3OBJA 4FG8A 3TTJA 5IMXA 3HV3A 2PSQA 1M7NA 3ZLYA 3PXQA 4C4IA 2PZIA 3EQBA 3UVPA 1XR1A 3D94A 5FTQA 4QO9A 3MYGA 5KNJA 4WNKA 5DG5A 3UO4A 2ITNA 2RFDA 2W99B 4HOKA 3TV6A 4U9AA 2G2IA 3BPRA 3IDPA 3UIMA 3TDVA 5AEPA 1Q41A 2C6MA 4B99A 4CG9A 4ALWA 2X2LA 2J5EA 3W0NA 4UBAA 3IOPA 4JT3A 2VZ6A 2WMBA 4C3RA 3RAWA 4IM0A 4AW5A 4AA4A 5HORA 4YNOA 3R22A 1H4LA 3BRBA 2KULA 2XP2A 4MQ1A 4BYIA 5IDPA 2HIWA 4LV5A 2BRBA 3KCKA 4ONAA 3NX8A 1Q8WA 3L9LA 3OP5A 4B0GA 2Q0NA 1WBSA 4FX3A 5IA2A 2YJSA 2GQRA 4FBXA 5DR9A 2ZV2A 2C6IA 1OL7A 4KBAA 5BUEA 3CIKA 5JSMA 4HZSA 4XG4A 4H05A 4O7RA 2XJ1A 3MJ1A 3OT3A 4RQVA 4PV0A 4YJSA 3ODYX 3ZRKA 4EH3A 2C0TA 3OUKA 3JPVA 2W0JA 4UX9A 4GJ2A 4J98A 1ZY4A 3TNHA 3CPBA 4PDSA 5FWKK 2C5YA 2WOUA 3QUPA 3JYAA 4QNAA 1OKZA 4N70A 3UC4A 1IA9A 3Q32A 1XO2B 3HMIA 4O7ZA 5HVKA 3KXMA 4R78A 1WAKA 4HYHA 5EG3A 4QP9A 5FM3A 5LWNA 4V0GA 1GY3A 1ZYJA 3TN8A 4XS2A 4CRLA 2X9FA 4AQKA 4QP6A 2W5HA 5GJDA 3R8UA 3I79A 5M57A 5BYLA 3W0SA 2HY81 2JDRA 4GS6A 4E73A 5LOHA 4FKPA 3SG8A 3H9FA 3PWYA 1ATPE 3BYVA 4PMSA 2YLEA 3OCGA 3R7IA 2RG5A 3PXKA 3UVQA 4RVTA 4O1OA 2W1EA 2XM9A 4IAKA 4F9CA 5CLPA 5FQDC 4DFNA 4EQCA 4PDYA 4AXAA 4BWXA 4KRDA 2GNHA 3ZXTA 5AM7A 4KIPA 5BUJA 4AP7A 5EOLA 4S2ZA 3W0MA 4AZTA 4FVQA 1NT2A 2B4SB 4D28A 2VO6A 1OZ1A 4YJVA 2RFNA 3NFFB 5L8JA 3ENHA 1YXUA 1ZYSA 4UB7A 3D7TB 2QOCA 3W2RA 3P5JC 2C6TA 2E9OA 2GHLA 4DGLC 2UZBA 3A7GA 4ACMA 4BDBA 4ZMEA 3UNKA 4BL1A 3QRIA 3EFLA 3COHA 2YM5A 2O63A 2X6DA 4KA3A 3NNVA 5DT0A 3DKOA 3RAKA 3RM6A 4ACGA 4BDIA 3KRRA 1WCCA 3NYOA 3T9IA 4JBOA 3QXPA 5CEIA 3QALE 2J90A 2XYUA 2C1AA 1SNXA 1W83A 5IQBA 4RSSA 2JFMA 2BILB 3NYVA 3R1YA 3DB8A 3PSBA 3O51A 2Y9QA 4QQCA 4UMUA 5CAOA 5J95A 4DT9A 4Q9SA 4DFXE 2ZB0A 5CQWA 4TT7A 3G6HA 4O0WA 3U8WA 4II5A 4JQ8A 3U6IA 3UVRA 3KREA 4XLIA 3IO7A 3EQCA 2OSCA 3R2YA 5AUXA 5GHVA 5CF8A 3QXOA 4EOJA 4EK5A 1WZYA 2WIHA 1H8FA 2WTCA 3OOGA 3TIYA 4PNKA 3DAKA 4GU9A 4BI1A 3KMWA 2J51A 3ACJA 4ZSAA 1IA8A 4FG9A 4IW0A 4BTFA 5B0XA 1YKRA 3Q04A 2GFCA 4D55A 2H34A 2UW5A 1NW1A 5CNNA 4F7LA 4FV8A 4DT8A 2XRWA 3KC3A 4JJRA 1UVRA 3FJQE 1K3AA 3F5GA 5J7HA 2VWBA 4AFJA 4WSQA 5CYIA 2OF4A 3O0GA 3TKUA 2R3IA 5JFSA 4NU1A 3HL7A 3KEXA 4FTNA 4BZOA 4DF3A 2PVNA 2I7QA 3ZYAA 4IX6A 2DS1A 2VUWA 2ZMCA 4BDDA 4DEGA 4R77A 2HW7A 4R5YA 4FTKA 2ZM1A 4LOOA 3HVCA 4AXFA 4YNEA 4U0IA 3VULA 3ZRMA 4LGHA 1PKGA 1SYKA 2XNBA 3S2PA 1BUHA 4I6FA 4E5WA 4YTFA 3BGQA 5HCZA 3MH0A 4PUZA 4FT0A 2C1BA 4ASXA 2VTAA 2OFVA 5L6OA 1ZZ2A 4LMUA 4E4XA 1IR3A 4N0SA 3VRZA 4TTHB 3VAPA 2YDJA 2UZWE 3P1AA 4FNZA 4EHEA 3U6JA 2OK1A 2PMLX 2PVYA 3CXWA 4JG8A 4ACDA 4YURA 3SHEA 3EIDA 5FEDA 4OTFA 2WMTA 4AU8A 3JVRA 1OMWA 3GU4A 1BL6A 2BZJA 2QNJA 5ETCA 4AT5A 2F7XE 4EKLA 2W4OA 4WNPA 4P90A 2EU9A 3A7JA 4J1RA 5F95A 4CT1A 3PLAE 3IW7A 3Q9WA 3I0OA 5HBEA 3E88A 3G2FA 3FLSA 4FF8A 4HCTA 3V8WA 3PY3A 3FI8A 2QU5A 4EOLA 3RAIA 2XRUA 1DM2A 3NLBA 4BICA 4YR8A 4G3EA 4KS7A 4W9XA 4O21A 4HW7A 4C37A 4IJ9A 4RMZA 3AMYA 4ZXTA 1YVJA 1Y91A 2Y6OA 3NEWA 4H1MA 5CSPA 3HUCA 4L3PA 3VF9A 2C3LA 2CDZA 2OZAA 3UMWA 2VX0A 4IB0A 4BKJA 4ZZNA 5T3QA 2IVTA 4EH7A 2UZTA 5KHXA 4IVDA 2WU7A 3VO3A 5IU2A 3KULB 3QZIA 4DG2E 4X3JA 4F0FA 1YDSE 3E87A 4RIXA 2IVSA 3R21A 5M4FA 4RA4A 4W4VA 5F1ZA 2IZRA 3RPSA 4BCFA 4D0WA 5JMSA 2OO8X 4ZTHA 3VUDA 1G8AA 2YAKA 1NVQA 2QD9A 2PK9A 4C02A 3LFQA 5D9HA 4MF1A 4GH2A 4X0MA 5JQ5A 5H9BA 5AV3A 1RW8A 4RLLA 4XEYA 5HU9A 2DUVA 4FIJA 3VS0A 3HECA 2XKCA 5DT4A 4ANSA 1JLUE 2FYSA 3LMGA 4OT6A 1JVPP 4HPUE 4XRLA 3PJ2A 4ORKA 3VS6A 4YZMA 3HRCA 3ZONA 2VNYA 2XIRA 5EHYA 1H01A 3NDMA 3SW7A 3E92A 4XLVA 3WF8A 4KUJA 3MB6A 4C34A 5CY3A 3FZTA 2IPXA 4KNBA 2YCQA 4MXZA 3ZM4A 4C57A 4EEVA 2REIA 1CMKE 3F5UA 5IEYA 2IEWA 1OITA 3DFAA 5EK7A 3TZMA 4ZY4A 4MXCA 3VUKA 3C0GA 4S31A 2QCSA 4YTCA 2PVMA 4FA2A 1FGKA 4MF0A 2C3IB 3RTPA 2NO3A 1OL5A 3OG7A 5HTBA 3VBWA 4KKGA 1H1PA 2G9XA 3OS3A 2VWUA 1CKJA 3A7IA 4CFXA 3IDCA 3E93A 5AP4A 4HPTE 4HGTA 3TIZA 3UNJA 3FPMA 2XCKA 4DFBA 3OD6X 4MKCA 1X8BA 2H8HA 2HXLA 4S32A 4X3FB 4IIRA 3HNGA 5I9WA 3FZ1A 2PZRA 2XK3A 3K5VA 5HCYA 4I0SA 2PZYA 5HBJA 4YZBA 4TYHB 3ZBFA 2X6EA 4K33A 4EOIA 3HA8A 5L2IA 2UW4A 3HGKA 5GZAA 2WAJA 3LCSA 3QL8A 4QEBA 2PMIA 5HESA 4BCKA 1CTPE 4O83A 3ITZA 3D4QA 1W8CA 3BYSA 5HIEA 3HRFA 4QTDA 4E6CA 3QGWA 4OBPA 2QG7A 4FYOA 5M51A 2XBAA 3ZTXA 1Q3WA 4ZTRA 4JBQA 3I1AA 2HW6A 3UZPA 1KE6A 4FIGA 4GT5A 4D1ZA 3FYKX 4A9YA 3EQHA 1SVHA 2IW8A 3I7CA 5AAGA 4IH8A 4EH6A 4AWIA 1XH6A 3BBTB 3DAEA 4FKUA 4UMRA 4LUDA 5J87A 2EUFB 4PNIA 4K0YA 3FXXA 3KMMA 4ZIMA 5KBRA 3G0EA 3KXNA 3LHJA 2B9HA 3PLSA 3OCSA 4XMOA 2CNUA 1NVSA 2WMVA 2PZPA 4GYIA 1OL2A 1PRYA 4R3PA 3UYSA 2WQNA 3NZ0A 3SC1A 4FV7A 1KV2A 3C5UA 3OY3A 3S3IA 4BJJB 3ID6C 3QTUA 4FEVA 4IDVA 5ANJA 2FO0A 3Q4ZA 3ORXA 4LL0A 3ZOSA 1UNLA 4MWHA 1XBBA 4EOQA 3PE2A 4FNYA 4AA5A 1ERKA 3TL8A 2WQOA 3QWKA 4IZYA 2DWBA 5HVJA 4IBMA 3VBXA 4BDEA 1TQMA 3OF0A 5CAVA 3FMMA 3FHIA 4QMLA 4GG5A 3U87A 1VYZA 4YLJA 2WTKC 4TWCA 4M69B 2QOHA 3P0MA 3GU7A 4ASDA 3P23A 3GCQA 3FMDA 2OXDA 4MNFA 4FTJA 4MNEA 3QX2A 5AUUA 5IQAA 3OWPA 2VTLA 3OXIA 5KE0A 4O6LA 4ZLOA 3PUFC 4FK6A 3QGYA 4RIYB 1OVEA 3PSDA 4IMYA 5BMSA 3WIGA 5BYYA 4ZY5A 1VZOA 3RHKA 1KWPA 3QC4A 4FTAA 4JQEA 5HHWA 1JPAA 3R9RA 2BAJA 2BRMA 3QUEA 4RJ5A 3VBYA 4FKQA 3MS9A 4MXOA 4IWPA 4O7YA 3LFCA 5HE3A 3LFEA 3THBA 4BZDA 4DH5A 4ANMA 2X0PA 3C0HA 4ZJIA 3BWFA 3GU5A 4C4GA 3ODZX 3FE3A 2WEVA 3TTIA 4JRNA 1W0XC 3PYYA 4OLIA 2F7ZE 3AD5A 1FMOE 2LGCA 4X2JA 3OOMA 4OBQA 4EORA 4BCIA 2J4ZA 3QBNA 4JAIA 4TYIA 3DZQA 1SNUA 3FZSA 4Y46A 5CU0A 5C26A 3U9CA 4ANLA 4FSUA 1QCFA 3PA5A 3O8UA 4RBLA 2J0JA 4C0TA 4QMMA 3R7UA 3D5VA 1SMHA 2R2PA 2HAKA 2UW0A 3LFDA 4V04A 4EK8A 1CDKA 3HMOA 3GI3A 2F9GA 3NYXA 4MXXA 4QPAA 1U5QA 4AN3A 4AZSA 3EFJA 3PPKA 1PYEA 3CBLA 2FVDA 2GDOA 4DA5A 4O4BB 4U79A 5CF6A 3CLYA 2GNIA 4IHPA 3UQFA 5AUVA 1B39A 1UKIA 1OL1A 3IW5A 2QOKA 5AP5A 2VN9A 3I7BA 1PW2A 3H30A 2PUPA 2J5FA 3LOKA 4D1SA 2PY3A 4RX7A 3JY0A 3KRJA 3PA4A 4EC9A 3BE9A 2X8EA 2YITA 3DXQA 2CMWA 2GS6A 5J1WA 3R8MA 1FMKA 4A9UA 2BR1A 3GFWA 3LKMA 3JXWA 3QZHA 3FY0A 4IM2A 4TYEA 3VN9A 4D9UA 3AOXA 3V6RA 1OIYA 3FLYA 3P79A 3FI2A 5FM2A 3FL5A 3WARA 1GIJA 3I0QA 4WRSA 4RA5A 5CS6A 4KKHA 4AAYA 2JIUA 3MH3A 2Z60A 4FOBA 4OTPA 3QLGA 3MA3A 1H25A 4DHFA 2W5BA 4F0IA 5GINE 3KGAA 4FL2A 5DR2A 3DXPA 4QTBA 4AW0A 1L3RE 5J9ZA 4FSYA 2VTTA 2WTJA 5HOAA 4AZEA 3R7OA 1E9HA 3AMBA 2W17A 3OTVA 2XIZA 2HZ0A 4JG6A 4C4EA 4MUQA 3O71A 4KBCA 4IC7A 4J96A 4TYJA 3BLHA 4EBVA 4FIEA 2WMUA 2R4BA 4PL3A 5HGIA 3TWJA 2CGXA 2ONLA 3Q9YA 4NK9A 4FVRA 2ZMDA 5IUHA 4GK4A 3IQ7A 3BYUA 2XK9A 4TY1A 3SLSA 3P9JA 4RX5A 4NKAA 4DAWA 4IAZA 4XYFA 4DFYA 4DEIA 4TXCA 2XVDA 4NKSA 4F7JA 3MW1A 1FGIA 4DDGA 1OB3A 3O23A 3GXLA 4RIWB 1Q4LA 4CTCA 4P4CA 3L8PA 3VW8A 5ANOA 3WF5A 5EQPA 2QO7A 2X8DA 3FZOA 3LLAA 2XB7A 3G0FA 5E8ZA 2X39A 3I81A 4L9IA 4LGGA 3TYKA 3H0ZA 2PUUA 2YZAA 4PTGA 4DGOA 4U97A 3D7TA 2XIXA 3EN6A 3I4BA 1JBPE 1V1KA 3QQFA 4H58A 3QRKA 4I21A 4EZ3A 3D5WA 3QTZA 3BIZA 3Q5IA 3VUTA 1PXNA 2VTSA 4AGUA 3N51A 1XBAA 4E20A 4DLJA 1OPLA 3W10A 4X2FA 5EYDA 3AXWA 3W0RA 4ZMFA 3LFFA 5LARA 4JOAA 3DBQA 3NUPA 4NFMA 4NCTA 5LMKC 4JDJA 3EKNA 2Y0AA 4AXEA 3R1QA 3ZHPC 3V6SA 3WILA 4V01A 4FEWA 3EQPA 2VV9A 3ML1A 4ANQA 2JDOA 5DLSA 3SV0A 4I6BA 3W33A 2ZAZA 4B8MA 4A9SA 5FEQA 4BDCA 5IQFA 3NMUF 4RC4A 3KY2A 1JAMA 2R3HA 1WVYA 4YPSA 3NNUA 2W1CA 3MPAA 3C13A 3F2NA 2ITTA 4FL1A 4XRJA 4C3FA 3W2QA 1I44A 2YABA 3H3CA 4AOJA 3ZXZA 3SDJA 3FHRA 3LM5A 1CM8A 3ZO4A 1S9IA 5H3QA 2P55A 2R64A 4FV2A 3W2SA 4K18A 4IB5A 5M44A 3D2IA 3LJ1A 3SX9A 4RWKA 5LVPA 2QO2A 3C51A 3IG7A 3BBWA 3ANRA 3VRYA 2J50A 3KL8A 3H0YA 2XIKA 2ZDTA 4ALUA 3KFAA 3NVKI 2C6OA 3GT8A 4KS8A 5AIRA 2VGPA 5CQUA 5E8UA 2CKPA 4H3PA 3GP0A 4HYIA 3PJ3A 5BVFA 2PVRA 5IG1A 2OH0E 2VTNA 3QF9A 1BL7A 2CLQA 4IVCA 4OGRA 4RFYA 3TMOA 4EZ5A 4O7VA 2WO6A 3GGFA 5J5TA 4DFUA 2JKOA 2GS2A 2PMNX 3NCGA 1H0WA 4LV8A 4ALVA 5DPVA 4GIHA 2J0LA 2Q83A 2IO6A 3ZO1A 1G8KA 1K9AA 5IDNA 5KUPA 3EN4A 2I0EA 2OBJA 5HD7A 3C4EA 1PMUA 1MQBA 3UPZA 3MFSA 4FSZA 4FNWA 4QMWA 2AC5A 3TT0A 4X2GA 5DH3A 3QD4A 3LFSA 4JVGA 4TN6A 2X7GA 4PP7A 5FUTA 4QPMA 5E8TA 4EOKA 3Q2MA 4IAAA 5GIPE 3DTCA 3GC0A 2YCFA 4KIKB 4YJRA 4FT9A 4BZNA 1UNHA 5IPJA 4FSWA 3PJ1A 1BX6A 1Y8YA 3F61A 2HENA 1OPJA 5H8GA 3TZ7A 4CLIA 3VHKA 1GIHA 3G9NA 4BDFA 5HTIA 3D5UA 5K0KA 2B55A 2YDIA 4L3JA 2VGOA 4E4NA 2XK7A 5ANEA 1URCA 2BALA 2PZ5A 4JXFA 4ANBA 2UUEA 1Q62A 3R8PA 1ZRZA 2R3QA 4PY1A 3UMXA 3OY1A 4WHZA 4I5MA 4BN1A 4RT7A 3UOHA 3SA0A 3QCQA 2XA4A 3DKFA 4QDVA 5AR4A 3E8NA 2YERA 2R3LA 2X0QA 2O0UA 3F2AA 3PTGA 4I4EA 3QKKA