4E4MA

Jak2 kinase (jh1 domain) in complex with compound 30
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
296
Chain Sequence
AFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 296
sequence length 298
chains with identical sequence B, D, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e4mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e4mA01
2F57A 3S00A 4MX9A 1FQ1B 4RIYB 2IZSA 3PXFA 4L9IA 3OTUA 2X39A 3I4BA 3MSSA 2FSLX 3G9NA 1GZOA 2BDWA 2VN9A 3UQGA 3FI3A 4ERKA 5CAVA 5EKOA 4ZZOA 1BMKA 3QLFA 2Y6MA 4NIFB 3ENMA 2F9GA 3FI2A 3NCGA 3NUNA 4A9YA 3K2LA 3P7AA 2C0TA 5EYDA 3I7CA 4GKIA 4Y72A 1OL5A 4U3YA 4NK9A 5A46A 4IBMA 3GT8A 4CXAA 4FT7A 4B6LA 1QPEA 2ZDUA 3I79A 2ESMA 2GDOA 2G15A 4I23A 4P7EA 4YO6A 3HAMA 1OUKA 4BF2A 4LRKA 4H3BA 4ARKA 2WZJA 2R3QA 3D7ZA 2BVAA 1QPDA 2HW6A 3KMMA 4RJ7A 4OLIA 3LCKA 4MVFA 3BI6A 3BE2A 5AUTA 3PIXA 1OGUA 4B8LA 2VWXA 3QQFA 3H9FA 3QKLA 2W4KA 3O2MA 3A7IA 3KMUA 5CZIA 3F61A 3JVSA 3DAKA 4ZZNA 4O86A 3QA0A 2YJRA 4AAAA 4F65A 3NAXA 4D58A 1LEZA 4BY9E 3K3IA 3OF0A 1P5EA 2J0KA 3PE2A 2OLCA 4YURA 5T68A 3BEAA 1REJA 4QT1A 4LUDA 2YHVA 4FKPA 4RLLA 3F3UA 3NYNA 4FV0A 5AM6A 5HO8A 4CMUA 4DGOA 4NM3A 1PMNA 3PRFA 3QTXA 3PXRA 3RZBA 4HOKA 4U81A 2WKMA 3BX5A 4IFCA 4IXPA 5J87A 4YGAA 4N57A 4S30A 2YIQA 4ALUA 4V0GA 4EH2A 5K4JA 3G15A 1JBPE 1Q24A 4U79A 5EDQA 3QRKA 1WBSA 4HZRA 4BCHA 1H25A 4O82A 1U54B 1PHKA 2XNNA 2X2KA 4KRDA 4IIRA 3MFSA 3QC4A 1PKGA 4EOQA 3WBLA 2W5HA 5DYJA 1H07A 3QRUA 3DTCA 4F0FA 5CF5A 5FDXA 2YACA 5DGZA 5HGIA 3G90X 4GK2A 3MB6A 1WBNA 2RKUA 5C8NA 4YR8A 3I0QA 3MY1A 4RX9A 3D2IA 2PL0A 4RX7A 2X2MA 2F7XE 4DITA 4AOJA 3COMA 2YWVA 4YZ9A 5HU9A 4AWIA 4E5WA 3VULA 5BX0A 5L6PA 3GC7A 4YJQA 3V8TA 5EM8A 3LFBA 1V1KA 4AZSA 5KNJA 4BCNA 4NJDA 5HESA 2CHLA 3G2FA 3KXHA 4QQTA 3ZSGA 4TL0A 1OB3A 4UXLA 2BZHB 5I9WA 3NAYA 4QYGA 5DOSA 4JBVA 2EB2A 3U4WA 5L2TA 3C4ZA 4UX9A 4K0YA 4W4YA 4YC6A 3REPA 3E63A 2B9IA 4FVRA 5CLPA 2HY0A 3DTWA 3ORTA 2QO9A 4ZAUA 4AN9A 4UMQA 2CKEA 1Y8YA 2YEXA 1TQIA 4MK0A 5DEWA 2O8YA 4LQMA 3ULIA 3OS3A 2P2HA 5DR9A 4U43A 1OL6A 4G1WA 4EKLA 1YWVA 4P5ZA 3NEWA 5GJDA 2DWBA 2B55A 4UWCA 3GCSA 2I7QA 1JPAA 2WMSA 4MWHA 4GYGA 1OKZA 4DEIA 2VTNA 4LI5A 3QX4A 3E8DA 4V05A 4H3PA 4XHKB 4C02A 4HYHA 1BL7A 1H01A 1LUFA 1ZZ2A 2WMQA 4EOPA 3PYYA 2C6LA 4NEUA 4ZLZA 5M4IA 3L8XA 4V04A 4HVGA 3UC4A 4F99A 5L2IA 4JRNA 4BZNA 1IAHA 1ZOHA 5ICPA 5DMZA 3QKKA 4Z9LA 4IDTA 1YOJA 5FEQA 1UV5A 3N9XA 1PXNA 2J90A 2CN5A 4WRGA 3I7BA 5CF4A 2C30A 4CLJA 1W83A 4AGWA 3TNHA 3HUCA 3AG9A 4XCUA 4YTIA 4ANMA 4YPSA 5BUJA 3OP5A 3GUBA 3DAEA 4TN6A 4YUQA 2XJ2A 2W1CA 4Y83A 5HCYA 4EK5A 2WTDA 3RPVA 3NNWA 2BRMA 3F3TA 3ZBFA 1UNHA 4GRBA 3ZLYA 1J1BA 3BHVA 5H8EA 2X9FA 3HV3A 4GMYA 2XP2A 5E8XA 3KREA 2F7ZE 2CKQA 1WVYA 4K33A 4CG8A 4DTAA 4FT5A 4II5A 5LMKC 3TTIA 4RVMA 4YTCA 4FEUA 4F08A 2C4GA 3HV5A 1M14A 2XK4A 4FV4A 4QP3A 5HG8A 5M55A 3H4JA 4UBAA 3ZDUA 4F63A 3NVKI 3HYHA 2IPXA 2ZM1A 2ZJWA 1REKA 2VX1A 4QTBA 3DK7A 4I93A 5HOAA 5IH6A 3CXWA 4NKAA 5AX9A 5HNGA 5AUXA 3R7OA 4M84A 2XH5A 4XLIA 4BGQA 3MH1A 3KVWA 1RJBA 3LQ3A 3KB7A 3IW7A 3F5GA 4WHZA 2FA2A 1YW2A 4XUFA 4O7LA 4Y46A 3ZUTA 3EKNA 4EHEA 4W9XA 3ELJA 3PVBA 4C37A 3MA3A 1MP8A 3EL7A 2XCKA 2A2AA 5DPVA 2VWBA 3ZUUA 4D5KA 4FTCA 1OL1A 1U46A 3GCPA 4Y5HA 3KKVA 4BVUA 4TTHB 4NJ3A 4EBVA 4GIHA 3R8PA 4KIPA 2W4JA 3KCFA 3FLYA 3UVRA 4AT3A 2QOOA 3MA6A 4E93A 4NL0A 4HNFA 3PVUA 2R3RA 4D2TA 2VWIA 4FE2A 4ZJIA 4EI4A 3VS1A 4U97A 4EOIA 4O0SA 4F1MA 4C8BA 2C3IB 3P86A 4K11A 3C4EA 5JMSA 3HRFA 3R30A 3G6GA 4EL9A 5M4UA 4RC2A 3VAPA 1JWHA 4D2RA 1A48A 1YRPA 3KULA 4YU2A 3E7VA 1SYKA 4D4YA 2W17A 3UIUA 3AD4A 2W99B 4NWMA 1PKDA 4AW1A 5LVNA 5A14A 1SVEA 2PZ5A 4XP3A 3UPXA 1OIYA 2CMWA 2ETKA 2OH4A 3EQIA 3ROYA 2AC3A 5IUIA 2F7EE 2OGVA 2WTCA 3EQCA 4FR4A 4AZTA 3DXQA 4BCQA 4EBWA 3DNEA 4DT8A 2WQMA 3O0GA 5DVRA 4GKHA 2GFCA 4J7BA 5KCVA 1Z5MA 1Q8TA 2BFXA 4NFNA 1YHWA 1NXKA 3TNQB 4CZTA 1V0OA 2C6EA 5IA0A 3DCVA 4L00A 4MQ2A 5LOHA 3QQJA 3SD0A 4NUSA 4BDKA 2R3HA 1SNUA 2R3MA 3TUDA 1BKXA 2EB3A 3PJ3A 3N4VA 3MN3A 4U42A 4QRCA 3OG7A 3HRBA 4LRMA 3W32A 4R8QA 3A7FA 4C62A 4H39A 3DJ6A 4FV2A 2VO3A 4GS6A 4NSTA 4AGDA 1IA8A 2VTSA 3TDWA 4FODA 3FHRA 4O1PA 1ZLTA 4E7WA 2CNVA 5FM2A 2YAAA 3E8CA 4OTHA 2REIA 1Q8UA 3CD3A 2QODA 2R2PA 5JFSA 3Q2JA 3R21A 2VTAA 5IQFA 2F4JA 1BLXA 2G9XA 4FL2A 1WBPA 2J0LA 2JGZA 3C0GA 4IAFA 1J7UA 2UZEA 1LEWA 3V6RA 2JLDA 2OK1A 2XNPA 4C4JA 4A4OA 5M09A 3ZSIA 2XNMA 3R1NA 2XA4A 2I0VA 3DKCA 3VRZA 3JY9A 4BDDA 2X1NA 1R78A 3F6XA 4FTMA 4AFJA 4G6LA 4FZFB 3FMDA 2PMNX 5AP0A 3RWPA 2ETRA 3RPSA 4XV2A 1PXMA 4M68A 4C3PA 2HXLA 5ANKA 3RCJA 2DYLA 4U9AA 4BN1A 5HNIX 2BDFA 2V7OA 4F09A 4UWBA 3R7YA 2OJFE 3QCQA 5CSWA 2O64A 4Y73A 2RFNA 4L43A 3ZLSA 4BRXA 5HO7A 5L2WA 4IAYA 2BMCA 3SRVA 3GOKA 3DY7A 3E3BX 1RQQA 1RW8A 5LMAA 2JKOA 3AQVA 3BV2A 4JAIA 1ZYJA 3M2WA 3RVGA 5BVFA 2W5BA 3OWKA 2YCSA 2B0QA 2JKKA 2XK8A 1H1PA 5T6KA 5JZJA 4FKTA 4QNAA 2HYYA 2X6EA 2OXYA 3NNXA 2WQNA 1PXKA 1Y6AA 4X6RA 3LMHA 1DI8A 4ZTMA 1Q8WA 3EZRA 3ZSHA 5KMOA 3OWJA 5DR6A 2BZIB 3LPBA 3VUDA 3EJ1A 4HYUA 4FI1A 3QXOA 4KSQA 2BRHA 4H36A 1MRVA 4HGTA 4IDVA 5B7VA 2HIWA 2X81A 3LFSA 4RBLA 4QYFA 4N70A 4Y85A 2PE0A 5IU2A 5JFVA 4IWQA 2WQBA 1W8CA 2C6TA 4RJ3A 4EZ7A 4QMXA 3MIYA 1OITA 3IOKA 1WAKA 3UO4A 1M7QA 3JYAA 2J0IA 5LVPA 1XBAA 3DBQA 4UB7A 4O1OA 2WTJA 3A7HA 3GU4A 4FTNA 4JS8A 2QG7A 5KZ0A 1OIQA 4BDEA 3L8VA 3T3UA 2QNJA 2WTKB 4FZ6A 4QQ5A 4CQEA 4L67A 5CSVA 5HEZA 3BKBA 4DA5A 3CLYA 3ZEPA 2IVUA 2R3KA 4L3JA 5ANJA 4EUUA 5IEYA 2HWOA 3OEFX 4PDSA 1H08A 3FY2A 3TKHA 4M0YA 5HX8A 2I6LA 4XEYA 3UNJA 4D0XA 2JD5A 3ZCLA 3DBCA 4FV3A 3BHYA 4WOVA 2E9VA 4MBLA 4WNOA 4BWXA 5JSMA 3RBWA 5CWZA 2NNWB 2ITWA 4RMZA 3QBNA 4E20A 3QZFA 4EUTA 2VZ6A 3O50A 3ANRA 3BCEA 3IKAA 1GY3A 3ORMA 4BDHA 3GBZA 5HTIA 3QD2B 2VTQA 2W06A 4XX9A 4AUAA 2UW5A 1H0WA 1WMKA 2G2FA 4BTFA 4YJUA 2HW7A 2OSCA 2C3LA 4C61A 4WA9A 5HIDA 3C1XA 2HY81 1BL6A 3MYGA 5IH5A 2RFSA 2ITPA 2VTPA 3W18A 2CNQA 1GZKA 3GCVA 3PZEA 3IQ7A 2W96B 3PFQA 4YJNA 4EJ7A 5EM7A 3HUBA 1UWHA 3FI8A 3C7QA 4Y95A 4BCFA 2A1AB 4YPDA 3BHHA 3C0IA 2XK7A 2YIYA 3OBGA 4BDIA 4BTKA 2VWVA 3DBFA 2W9ZB 3WZKA 5HE1A 1UA2A 5AR7A 4C36A 2GS6A 4FSWA 1U5QA 3UODA 3LCSA 3R0TA 4IM2A 2YZAA 1CM8A 4ACCA 4O81A 4NT4A 1AQ1A 2W4OA 3P7BA 5M56A 4UWYA 2WQOA 2ZM3A 5JRSA 4DEAA 4JIKA 5JGDA 1Q97A 3UP2A 5BVDA 4JDHA 4WG4A 4PF4A 4RA4A 1XR1A 2RFEA 4F7NA 4NZWB 1GIHA 5CF8A 4I22A 2GMXA 3P23A 3W8QA 3FZOA 5CVFA 3EWHA 3R01A 4X2JA 4XP2A 1MRYA 3W2OA 3R7GA 1XHAA 3Q96A 4FKJA 4U0IA 3CTQA 4PTGA 3UIBA 4EC8A 5KMJA 3QZHA 5L2QA 4RX5A 3NPCA 3A8WA 3QXPA 3R9NA 3Q9XA 5EI2A 3LFDA 3HMMA 3S1HA 4BCMA 2NRYA 1SNXA 5L8JA 5CYIA 4EH7A 2GNGA 4C4EA 3KK9A 4TYIA 4HGLA 3WZUA 1PXJA 1ZMVA 1URWA 2A19B 1IASA 4KBKA 4AZVA 3QUEA 4MF1A 4UN0C 5EOBA 4F70A 1PMVA 4F0IA 3CBLA 2VD5A 5LXMA 3PSCA 2ITVA 2GHMA 2B9FA 4B7TA 5CVHA 4D1ZA 2GNFA 2Q83A 1XKKA 2A0CX 2E9UA 4KUJA 3KL8A 1JSUA 1OIRA 1YDSE 3QGYA 4FOCA 4PTCA 5FGKA 4WO5A 4G6NA 4G17A 5EW9A 5HNBA 4B9DA 5IEXA 4FIFA 3E88A 5ACBC 1GZ8A 5LWNA 4D5HA 5DEYA 4FNXA 1PYEA 3QX2A 1X8BA 5BUEA 3UTOA 3WF5A 3ORLA 5IMXA 1Z57A 3FZPA 3MJ2A 4O7SA 2EUFB 5CT7A 3PLSA 4L44A 3RM7A 3W1FA 3SW7A 4O7WA 4DG3E 4EZ5A 3PA4A 2JIVA 2OI4X 5TOZA 1FMOE 1FVVA 2O63A 2LGCA 3K3JA 2Z60A 2PZIA 2KULA 4IX6A 3Q2MA 5EW8A 2UZBA 3W55A 1CKIA 4ZJJA 3UMXA 1PXIA 2OW3A 3K5UA 4MXOA 4AZEA 3HX4A 2PVRA 3TIZA 3E93A 3EFWA 4EOOA 3RHXA 2R0IA 5EW3A 3AT2A 3PG3A 3OROA 4ITJA 2XUUA 3VBTA 2UW8A 3LXKA 1JKLA 4W4WA 4OAVB 4JR7A 3R7VA 4IZYA 1WVWA 2OF4A 1U59A 3GU5A 4HCUA 4U6RA 3PUPA 5C9CA 2WMTA 5HD4A 5J1VA 2BIYA 2IJMA 3GCUA 2YABA 3R8ZA 2PVFA 3RK9A 5JRQA 3V8WA 2WTWA 3QU0A 2R0UA 5EG3A 3KULB 1OKVA 4IAZA 4C33A 2AC5A 3A99A 3CPBA 3D5VA 3KU2A 2BHHA 4FNWA 3F2RA 3W2RA 2XRUA 5A54A 4DLIA 3NW7A 5CU2A 5J9YA 4BGHA 3HMOA 4ZK5A 4IX3A 1ZWSA 2QONA 4AF3A 3SDJA 3VHKA 5HORA 1YI3A 3ZDIA 2ZMDA 4HJOA 3WF6A 4JL9A 3VS3A 3OY1A 4DEDA 2PTKA 3L9PA 2NO3A 2WD1A 3HDMA 4O6EA 5FEDA 4E73A 4FGRA 4J95A 3KMWA 3R2YA 4P2KA 3KQ7A 4RJ4A 1YKRA 3C51A 5K3YA 2OWBA 3U6IA 4YZCA 5CS6A 4F7SA 3DAJA 3UQFA 2UZNA 3C50A 4GFOA 1GJOA 4FKOA 2C1AA 2B1PA 3EB0A 3KF4A 3COIA 3HKOA 3R1QA 1Y6BA 2OU7A 2R3LA 1OECA 3A4PA 4MD7E 4WNPA 2GS7A 4MNFA 4C57A 2XJ1A 2UW6A 4BICA 3N51A 3Q53A 2CNUA 1OKWA 2QLQA 2HWPA 2CGWA 4CD0A 3GB2A 3ZRLA 4BL1A 4NU1A 3NYXA 3Q9ZA 4QYHA 3SVVA 1JAMA 2ZVAA 4EH4A 2W1FA 5CI6A 3NW5A 2EU9A 2IN6A 2YDJA 3MH0A 3A7GA 3EHAA 3FMMA 4PDPA 4O7ZA 4FICA 3ATTA 2ZV7A 3EYHA 3UE4A 3PPKA 5BQ0A 4KWPA 4DCEA 1DM2A 3MFTA 2VO0A 4C2VA 2JIIA 2GS2A 3U51A 4XRLA 2XBJA 4V01A 5KHWA 3UO5A 2IW8A 4UY9A 2UVXA 4AT4A 3O7LB 2XNEA 2VWYA 2XIZA 4CSVA 4DT9A 4AS0A 3KN5A 1SZMA 2NP8A 3II5A 4EONA 2RSVA 3P79A 4RIXB 3GQIA 2JKQA 4IQ6A 5CEIA 1E1VA 2P55A 3P78A 4Q5EA 5EFQA 5C4LA 2JDSA 1OMWA 4R5SA 4C2WA 3SRVB 2V62A 3L8PA 1UWJA 3IW5A 1R0PA 4IWOA 5CEKA 5J7HA 1HCLA 3M1SA 1ZAOA 4OTPA 1H00A 5D1JA 3BEGA 4YP8A 3ZONA 2Y0AA 3PA3A 1V0PA 1TKIA 3AC1A 4FT0A 3B8QA 4PRJA 4S34A 5GJGA 4FTUA 4ZSLA 3DOGA 4FV7A 3D0EA 4O38A 1GAGA 1K9AA 5AEPA 4DFUA 5FXRA 4YLKA 2WO6A 3AOXA 4X2KA 2PY3A 3LFEA 3VNTA 4MCVA 3CQUA 4DGGA 4XG9A 4DH1A 2WMRA 4DEBA 2XCHA 4XV1A 5BUIA 3ET7A 3U9CA 4BWKA 5DBXA 3EFLA 4RZVA 2OFVA 3F2AA 3QKMA 3CQEA 2ZAZA 4BKJA 1B39A 4YMJA 4E4MA 3QTSA 4EJNA 3FLQA 4XG8A 1J7LA 2PUNA 4RIWA 3QHWA 1H1QA 2P0CA 1SM2A 2OIQA 2PPQA 3EZVA 3VS0A 1PJKA 2I1MA 4M14A 4QP8A 3EN7A 2YISA 4UMTA 3QLGA 4OTQA 5DT3A 5FTQA 4YBJA 3FKNA 3TV4A 1OL7A 2GCDA 3NX8A 5CXHA 5IA1A 2HELA 4JG6A 4AGCA 4DTKA 2CLQA 3F7ZA 4UV0A 4DF3A 4AZFA 4D4RA 4XV9A 3QD0A 4EK3A 4LOOA 5HKMA 3IG7A 3EYGA 3BWFA 1KSWA 2PE1A 5IQBA 5AUVA 3ORIA 2PZRA 5D10A 2BAKA 3D15A 2IO6A 3VC4A 1STCE 1TQMA 2PVHA 3QTQA 4YO4A 3FSKA 4JQ7A 3FQEA 4OT6A 4KIOA 5DFPA 5K0KA 5LVOA 4IVBA 3LIJA 3WI6A 4FVPA 4C4IA 2W0JA 5F4NA 4I6QA 4PP7A 1Q41A 1W0XC 2QO2A 4ERWA 3UDBA 3UG2A 3GU8A 5C1QB 3A60A 3LFQA 1QPCA 3HP2A 1TVOA 3GOPA 3VS6A 2C6OA 1WBVA 3LM5A 5C01A 4QMVA 3UVPA 3A7JA 1CKJA 3COHA 3SXRA 3V5WA 4CFUA 4DH7A 3PIZA 3GU7A 1L8TA 3GFEA 4I5HA 4F9BA 5IQAA 2XS0A 3QALE 4GG5A 2PHKA 2BRNA 3NUXA 5AR2A 3BBWA 4FKRA 4JXFA 2JBPA 3EN4A 4MNEB 1YI6A 4OTWA 2BROA 5ANIA 3WILA 3MIAA 5HZNA 4I5PA 1YQJA 2X8DA 4BBMA 3GI3A 1ZY5A 1W84A 4RFMA 3I81A 2YA9A 2ZYBA 3OFMA 4ZZMA 3VW6A 2I0HA 2YAKA 3WYYA 4GJ2A 3CEKA 2QHNA 4FT3A 3VF8A 5EQPA 4QMZA 3FMLA 3DFAA 4BI1A 4NCTA 2YIWA 4FSRA 5IQIA 3FLWA 4HZSA 2OJIA 2OH0E 3P08A 4G3EA 3IK3A 4E4LA 4EH8A 4XG7A 2YM4A 5H9BA 1Q4LA 2VRXA 4BFMA 1G3NA 5IA4A 4M69A 4ZSJA 4EH6A 2Y4PA 1SMHA 3PJ8A 5AR3A 4CZUA 5CSHA 4O7YA 1JSTA 3FHIA 2FSTX 3ODZX 4FKSA 2XMYA 4JBQA 3FL4A 3MI9A 4OW8A 4ZXTA 2OJ9A 2R3IA 3L9LA 3DK3A 3SXSA 4D4SA 5KMMA 4KKEA 1BX6A 4P5QA 3A61A 3MDYA 5E92A 2OZAB 1M2RA 2YIXA 1JVPP 3VJOA 1SVGA 3Q9YA 4WKQA 5HCZA 4M97A 4EYMA 4XG3A 1NA7A 5L6WL 1TQPA 5L8LA 3MFRA 4C3FA 5CSXA 2LAVA 3EFKA 3W2CA 4W9WA 3PY1A 3OTVA 3LVPA 4Q2AA 5JH6A 4O7VA 5TO8A 4CT1A 2JDTA 4FZDB 2O2UA 2WHBA 4QMNA 4FEQA 4EOKA 4QTEA 2I0YA 2QR7A 3L8SA 4O2ZA 2AYPA 4E1ZA 3ETAA 4ZTSA 1A9UA 4CTBA 3OW3A 5FDPA 3AC5A 3PLAE 5E9EA 3QTWA 4LOQA 1OI9A 3WIKA 2IG7A 4HPUE 5EYKA 1B6CB 3GQLA 5K5NA 3E92A 3RKBA 3LCTA 4EQCA 2E2BA 2PVYA 2R5TA 3WE8A 3MTFA 4LV5A 3QD3A 2FUMA 1OVEA 5LWMA 1P14A 3NRMA 2J6MA 4M0ZA 5H8BA 3P1AA 5AX3A 3SG9A 4BGGA 4FIJA 3HDNA 3FMJA 1Z9XA 2W1DA 4IB0A 3QTZA 5KBQA 3Q32A 1JKKA 3KCKA 4RWLA 4DN5A 4CNHA 4G5PA 2WQEA 3R1SA 3NUAA 3GVUA 4GT4A 3Q4ZA 4I5CA 2SRCA 1NY3A 2UW7A 3ENHA 4CCBA 1AD5A 3Q52A 3Q4UA 4RC3A 4ANNA 3OCBA 3PSDA 2HXQA 1F3MC 2F49A 4G5JA 4L53A 3KXNA 3KF7A 2J4ZA 2OFUA 5FWKK 4E6QA 4IH8A 3ITZA 3O8UA 4CG9A 1IG1A 5KHXA 4KS7A 4G2FA 3PJCA 4H58A 1H1RA 2YFXA 2J2IB 2ONLC 1PXOA 4MQ1A 3EQRA 3ULZA 4BCGA 3JVRA 4OGRA 1I44A 2C6KA 4I4EA 4UMPA 5F1ZA 4YZMA 5HQ0A 3O23A 3LE6A 2W1ZA 2UW9A 5EM5A 3IONA 3R8UA 3F88A 4FTOA 2Z7RA 5CZHA 3UOLA 4A7CA 2XIKA 2GNLA 3HMPA 4LOPA 3VS2A 4CMTA 4E6CA 5CASA 4XG2A 2GQSA 2CGUA 4KBAA 4IX4A 5JFWA 5AUWA 4IZ7A 3NSZA 4S32A 3R9HA 2F2UA 5M4FA 4J8NA 3FC2A 2YM6A 4IVCA 3RTPA 2PE2A 3O8TA 1ZOEA 5I3OA 3TN8A 5IMEA 2WFYA 3DLZA 1WFCA 4O0XA 4XNEA 5TKDA 3IW8A 2R3JA 5JQ8A 4CRSA 4QMSA 4BDGA 4ZOGA 5JN2A 5FRIA 2XKFA 3ZRMA 1S9JA 1H1WA 3RCDA 4J97A 2X7GA 5AP7A 4CZYB 3UOHA 3TM0A 1KE8A 1YHVA 3D94A 2XM9A 3BQRA 5BYZA 4FTAA 2OG8A 4NTSA 3IGOA 3HGKA 2HAKA 3FWQA 2PVNA 3VF9A 3AC2A 4ACHA 1YXXA 2QKWB 5CX9A 4WNKA 4L52A 4FEVA 4I6HA 4RFYA 5GJFA 5D12A 3R9DA 2C5OA 2JDRA 4LMUA 2QOCA 4Z55A 4OTDA 3LQ5A 4FUXA 2V22A 3MB7A 2Q0BA 3UJGA 2GHLA 3NIZA 4ZY6A 3LCDA 4X2FA 3V51A 4DGLC 3D5WA 4I5MA 1YXTA 3FL5A 2CKOA 4QMUA 3LMIA 1I09A 5AP1A 4RJ8A 3A2CA 3F69A 3V6SA 3UVQA 4HVDA 4RJ5A 2YCFA 5DNRA 4CKRA 3KXMA 2J51A 3EN6A 3CS9A 3HZTA 4OBPA 3FMKA 5BVNA 2XK3A 1UU3A 2Z2WA 4R1VA 4JAJA 3TZ7A 5ANDA 3NVMB 4R3CA 4IAKA 2R3FA 2XJ0A 4FSYA 4PDOA 4AA5A 2B4SB 2GNIA 3KY2A 4U40A 2QQ7A 2R7IA 5M06A 2J5FA 3BELA 4BI0A 2YM7A 4H3QA 2YWPA 4I20A 4XBUA 4O7NA 3MV5A 5I9UA 4DEEA 4OUCA 5IQCA 4NM0A 4L3LA 2RIOA 3DB8A 4YZDA 4MD8E 2ZV8A 4IW0A 3DKGA 4KIKB 4QQCA 5CEMA 4E3CA 4MAOA 3TTJA 5DG5A 4FSMA 1ZZLA 2UZWE 3ZU7A 2VU3A 4FG7A 2E9OA 4AN3A 5FUTA 4KAOA 4R77A 2C0OA 4W4VA 4O0VA 3OXIA 4O0WA 2R3PA 3QQKA 4DBNA 4XP0A 4RLKA 1W82A 3JR1A 1Q99A 1KE7A 3BYOA 2ITYA 4MYGA 5KUPA 2J5EA 4XLVA 2ZB1A 3ZO2A 4YLJA 4JDKA 4ZMFA 3DGKA 3LLTA 2QHMA 4FTLA 4ZEGA 3TACA 5JK3A 4WUNA 5E8YA 1WBTA 2VTTA 2WMVA 3AGLA 4DEHA 4O7TA 2QLUA 3ZRKA 4GH2A 3ZC6A 5LVMA 2B9HA 2QD9A 5HI2A 3OWLA 4G9RA 3EKKA 4QTDA 3BYSA 1H28A 3KGAA 1UU9A 4KINA 4O6LA 5J95A 4AE9A 4F9YA 2UZDA 2WTKC 2BAQA 5C03A 1KE9A 3LCOA 4TYJA 4FKIA 1JLUE 3FLSA 4X2NA 5EHOA 3BV3A 3ZH8A 2UZTA 5CY3A 4GIIA 5HTCA 4MBJA 3UNKA 5I0BA 2OXXA 4TWNA 4RVKA 3KXGA 2OJGA 2XNOA 3TL8A 3BYMA 3NDMA 4FSQA 5IDPA 4CVAA 4WNMA 3AC8A 2PVJA 3NNUA 4I6BA 2Y4IB 3LJ0A 4GU9A 1A06A 4FIIA 1YHSA 4MHAA 3G0FA 4G6OA 5A6NA 2GNJA 4FNYA 1S9IA 4N6YA 4DE4A 3AC4A 5FTOA 3IDCA 3LFCA 3FMHA 4D2WA 1MRUA 2VV9A 5BPYA 5ETCA 4L7SA 1Q62A 3QQLA 1J91A 4IX5A 2CPKE 1VEBA 4RX8A 5AIRA 3MVHA 2WU6A 4DHFA 3R00A 1E1XA 3TV6A 4F1OA 4TT7A 4W8DA 4O83A 3BHUA 3ALOA 4BC6A 3FYJX 1JQHA 1PRYA 2JEDA 3OCTA 3UZRA 4KB8A 3ACKA 1OKYA 4PP9A 5HLPA 3H10A 3VRYA 2HZ0A 3BWJA 4TPTA 3LXLA 3DQXA 4IAIA 3PXZA 4USDA 4I94A 1XBCA 5AV3A 5AIKA 3VJNA 1WZYA 1ZYSA 4U41A 2PYWA 2GHGA 4QP9A 3DXNA 3AMAA 3ANQA 3HEGA 4M13A 2OF2A 3BBTB 3CE3A 2BPMA 4GYIA 1YXUA 4ZSEA 5KMNA 1FBNA 5IQHA 2W1EA 3C13A 4BCKA 4PL3A 5FQDC 3QFVA 3MVJA 4V0GB 3RHKA 5J5TA 3VUTA 3WZDA 1J3HA 4APCA 2QVSE 5F9EA 4R3PA 3D14A 4YJSA 4AXAA 4MF0A 1KV1A 2XKCA 4ANOA 5IUGA 4UALA 3FQSA 4LRJA 1IRKA 4J99A 5IQEA 2QC6A 4FMQA 2EXCX 4QTAA 4UZDA 1YWNA 4FGBA 3GC8A 4HGEA 4X3FA 4FEXA 4IB1A 5C26A 3DT1A 5EYMA 1UNGA 4I41A 4GUBA 4EOMA 5HBEA 1BI7A 3WIGA 2C5YA 2JDOA 3EOCA 4LYNA 3AXWA 3S2PA 3RAIA 3DZQA 3UO6A 4C4HA 3PY3A 4Z7GA 3L9MA 4W8EA 1LR4A 4W4XA 2QG5A 4E6AA 5AV4A 4O96A 4R1YA 4E4XA 1PY5A 1BUHA 3BU5A 3D7TA 3WYXA 3R22A 3ZHPC 4C0TA 4C58A 4O27B 3G51A 3CD8A 4GW8A 3ORKA 4C34A 3CGFA 4FEWA 1WCCA 4U80A 1ZMWA 5GZ9A 3AMYA 3LMGA 3R04A 5HBJA 3ZM4A 4FSTA 1ERKA 3ORNA 5DT0A 3HV4A 4YC3A 1W7HA 4I0RA 5AAFA 4FV5A 4L6QA 4FV1A 3SC1A 5GINE 2VTJA 5ANGA 2R3OA 2JAVA 2EXEA 5D41A 4O0RA 2UZLA 1GZNA 4XRJA 4FKLA 2XIYA 4JX3A 3O96A 3B2TA 4APPA 1OM1A 4GSBA 4RPVA 2X7OA 5I9XA 2WMUA 3MY5A 4NW5A 3MWUA 4DH3A 5CSPA 4MKCA 4FK6A 4CYJA 1DAYA 4AE6A 3RAKA 3DFCB 2CLXA 5A3XA 2C6DA 4WSYA 5CVGA 3V01A 5HX6A 1VZOA 4TYHA 3ZMMA 3VQUA 4DG0E 2QR8A 3NMUF 4XJ0A 4F6UA 4P4CA 2QKRA 3I6UA 3R73A 4KNBA 5T3QA 4F4PA 1F5QA 4ZSGA 3NS9A 3E62A 3FXZA 2J9MA 4ASXA 4EWQA 3TKUA 2QURA 3A4OX 2PVMA 3MESA 4YNEA 3QRIA 4BCOA 3THBA 5CF6A 3HV6A 4UYAA 2IZTA 3GCQA 2O0UA 4CQGA 2PK9A 2VTRA 4CFWA 2YM8A 2R3NA 1QMZA 2VX3A 4DEGA 3W2SA 1UNLA 4CCUA 3PG1A 3OUNB 2IVTA 3TIYA 4EC9A 2JFMA 1CKPA 2CGVA 2UVZA 3BU6A 3VBQA 1U54A 1YXVA 3TZ8A 4XS2A 3R8VA 1OPLA 4JX7A 5GNKA 4E26A 3LFAA 3U54A 2OIBA 3PP0A 4DTBA 4F6SA 1LP4A 4QP7A 3EN9A 1UKHA 3RPOA 3D2KA 3KVXA 3TG1A 3LXPA 3UOJA 4MXAA 4QOXA 5BVWA 3R7UA 3C4CA 3F9NA 3QRJA 3SKCA 3QAME 4ZTRA 3RALA 5A4LA 2JIUA 3ZXTA 3E3PA 2C3JA 4O2PA 3PSBA 3PRIA 4IZ5A 3ZLWA 2XKDA 4EZ3A 4Y8DA 4IWPA 3EN5A 5F95A 1R0EA 1Q5KA 4IACA 4M7IA 5AAGA 5M51A 3V5QA 5I5ZA 4LL5A 4E6DA 2O5KA 4NH1A 4RWIA 1VYZA 3H9RA 3RINA 4DLJA 4G9CA 3DQWA 5L6OA 2RG6A 2ETMA 4WRSA 2WMXA 4XH6A 2YLEA 2G01A 4AA0A 2A27A 5KMLA 3OVVA 5D7AA 4BDCA 5IZFA 3KK8A 3OUKA 4FTQA 3I5NA 2BHEA 3QWJA 1OL2A 3QTUA 5HE0A 5J79A 4USEA 3CKXA 3GNIB 1MUOA 4NM5A 1PYXA 3C4FA 2BR1A 2RG5A 4A9RA 2X4FA 2XB7A 2PZPA 1K3AA 4RJ6A 3RPRA 4BTMA 2DS1A 4HYIA 4BWPA 3LOKA 5A4QA 2CJMA 3OCSA 5AUYA 5DH3A 5AV0A 4PUZA 4PWNA 2JC6A 2Z8CA 1VJYA 4BKYA 3D4QA 4C4GA 2PSQA 2YDIA 2BTSA 4ZS4A 2RFDA 1Y91A 4FV9A 3F7WA 1NVSA 2ERKA 4AQCA 4D2VA 3SLSA 4RVLA 4ITIA 1J7IA 4WG3A 3DPKA 5KZIA 5EK7A 1YVJA 1ZARA 3UG1A 3G9LX 1KV2A 4I0TA 3Q4TA 1O6KA 4QO9A 3FKOA 2JDVA 2FB8A 2C6MA 2OO8X 3JY0A 5AR8A 5HLWA 5E4HA 1OPJA 3VO3A 5CEPA 2XKEA 5JGBA 3M11A 3RNYA 1M7NA 3BIZA 3NUSA 3ACJA 4TWPA 1XH7A 5AMNA 4YTFA 4CLIA 3SGCA 3Q5ZA 2VUWA 4WG5A 4DFBA 2JBOA 4JJRA 2OJJA 3EL8A 4R3RA 4UEUA 4BR3A 3NIEA 3LFNA 4ZS0A 4BCIA 5B0XA 1KWPA 2OICA 3V04A 4IC8A 5M44A 3COKA 3U9NA 4DH5A 2B54A 4FTIA 3PXKA 1IEPA 3QQHA 4KRCA 3S95A 5C8KA 4CV8A 5KKRB 4EHVA 4LL0A 3O8PA 4OR5A 1OBDA 4QQJA 4L7FA 3FV8A 4IFGA 5E8ZA 2VTIA 5LVLA 3P9JA 3CTHA 4HGSA 5FBOA 4BB4A 5IA3A 3FEGA 1M2QA 3UOKA 3MPTA 2WOUA 3W33A 4R7HA 5BVOA 3MPAA 5AP5A 2W1HA 3KFAA 3W2PA 1G5SA 1XH6A 3E8EA 3FAAA 5CNNA 2X8IA 2WXVA 4PPBA 4QTCA 3UIMA 2YM3A 3TJCA 2KTYA 3W8LA 4OAUC 3FXXA 4J52A 3UMWA 1E9HA 4G16A 3CKWA 5IA2A 4PDYA 4MTAA 2GTNA 4D2PA 4PNKA 2GFSA 4DGMA 4BYIA 5IDNA 5L2SA 2HZIA 3HMNA 3VBXA 5FD2A 4BIEA 4X6QC 4IB3A 4DC2A 4WT6A 5TR6A 2QOIA 3CGOA 2HENA 4YZNA 1KOBA 3BPRA 1HCKA 3TUCA 3G6HA 2Z7QA 3CCNA 4QMQA 5CENA 5D7VA 3FLNC 3QCXA 4QP1A 5K0XA 2XYNA 4IM0A 1WVXA 5HBHA 3D5UA 4J8MA 4PPCA 4S31A 3V5TA 1PW2A 2J0MB 5J9ZA 5KBRA 5KMIA 1YWRA 5FLFA 3ORXA 4CFMA 3EQHA 4BHNA 3P4KA 4KS8A 2C1BA 2WTVA 2YDKA 3U4UA 2G2HA 2H34A 2HK5A 3LJ1A 4FG8A 4CFFA 3F5XA 1WBOA 4NKSA 5AR4A 5HG5A 4IC7A 2VWWA 2ONLA 1Q3WA 4EH9A 3NGAA 3R8LA 5TF9A 3GU6A 1Q61A 3E64A 5BMMA 1NW1A 1FGKA 5AA9A 4RWKA 2PU8A 2E9PA 5G1XA 4J53A 3L1SA 4CV9A 3GXLA 3JUHA 5AUZA 4ENYA 3ZXZA 2ACXA 4BHZA 5D9HA 3BU3A 3C5UA 3NW6A 4DYMA 5HTBA 1LPUA 1U4DA 3WF7A 1H26A 3OY3A 4GT3A 3PXYA 1JKSA 2ZV2A 4AOTA 5IG1A 2VTLA 3S4QA 2ZM4A 5EI8A 3LM0A 2XK9A 5CT0A 5AP6A 3SOAA 5LMKA 3LKMA 2OKRA 2C69A 2WELA 2VAGA 4QPMA 4ZTHA 5M53A 1XO2B 2C68A 2UZVA 3KRXA 5FG8A 1H0VA 3UNZA 4XOZA 4EOSA 3KRWA 1ND4A 4O7RA 3T9TA 4K6ZA 1KUTA 5IA5A 4ANLA 3QZIA 1P4FA 3OD6X 4YZBA 5IKWA 3OW4A 5GZAA 3DU8A 1ZYCA 2IZUA 2PMOX 5CTPA 2PUPA 4TKSA 1MQ4A 1L3RE 2CN8A 5AAEA 4I4FA 5JQ5A 3TEIA 3QUDA 3QQGA 4K9YA 4U44A 4GVAA 3SW4A 2X6DA 4QPAA 2Q0NA 4AX8A 2FGIA 3ID6C 3OWPA 2DQ7X 3VUHA 1ZYLA 3R71A 4X3FB 4YSJA 5GHVA 3QHRA 1YOLA 2JKMA 2WMWA 4N0SA 3NYVA 4FK3A 5JGAA 1XH8A 4XV3A 3H0ZA 5GIOE 3IW6A 2C3KA 4FIEA 4OTGA 3DA6A 4IVAA 4X3JA 4AG8A 2R3GA 2YIRA 5FP5A 3QL8A 4BYJA 4BZDA 2XM8A 5C8MA 4DFLA 2ZV9A 3D7TB 3FZRA 4LGDA 3T3VA 2PMIA 2PZYA 3WOWA 3TDVA 4TNBA 5HG9A 1MQBA 2BTRA 2X4ZA 2BAJA 4FKVA 3SG8A 2NRUA 3VUGA 2PMLX 5HIEA 1O6YA 2P4IA 1M52A 2DUVA 5IUHA 4PL4A 3LQ8A 4AN2A 2JAMA 4B99A 3NUYA 4A9TA 2PULA 2IW9A 5DI1A 4BDFA 2XYUA 2B52A 4RZWA 5LJJA 1OPKA 1XQZA 1YDRE 3HA6A 5G6VA 4OT5A 4RGJA 2H8HA 4AT5A 5J5SA 1JNKA 3Q60A 1IA9A 3V8SA 4LG4A 4PMSA 4YBKA 2HZ4A 4JDIA 4K18A 2VO6A 3FBVA 4IEBA 4PQNA 3UP7A 3ZBXA 4ONAA 3ORZA 4D9TA 4BCJA 4AW5A 2PWLA 4H1MA 5I4NA 2EVAA 3FJQE 1G8SA 4TYHB 2BIKB 5KMKA 4FV6A 5I9VA 1H1SA 5FEEA 5FXQA 4JVGA 4ALVA 4R6VA 4CEGA 4OBQA 4TXCA 3CJFA 1OIUA 1PXPA 3CR0A 1PXLA 4OTFA 2QI8A 3PVGA 3PZHA 2CCHA 1Y57A 4GK3A 4L68A 1PMEA 3QUPA 3RZFA 4DFZE 4DAWA 5KO1A 2XF0A 3ZYAA 3VS4A 4BBEA 4EWHA 4A9UA 5JEBA 3BE9A 3DKFA 4AU8A 3Q9WA 4AFEA 1Q3DA 3R2BA 4FYOA 3PA5A 4CFNA 2NPQA 2WEVA 5TT7A 3TNPC 3ZTXA 4CTCA 3F3WA 4BDBA 3ALNA 3F3ZA 5BNJA 4BKZA 3FQHA 4D1SA 2W1GA 4L46A 3Q04A 5LCKA 2VGPA 3LW0A 4O22A 1KE5A 4J98A 4K8AA 4CYIA 4FSNA 3QQUA 4FKWA 5FM3A 3QCSA 4XG6A 3VIDA 2ITOA 3IDBA 4FL1A 4MXXA 4O21A 2WMAA 4Q9SA 5CNOA 5K4IA 4RSSA 4M8TA 2CCIA 3RP9A 2UZOA 3DK6A 3ZC5A 4N4SA 2UUEA 4RC4A 3KEXA 2ITXA 3H9OA 4IANA 3RAWA 4CKIA 4ZY4A 4J1RA 5LQFA 1FVRA 3O7LD 3VW8A 3ZUVA 5L8KA 4D2SA 3MY0A 3G33A 4QP4A 4USFA 4F9CA 4BZOA 5HVYA 4DG2E 5IPJA 4PX6A 4E4NA 4R7IA 1IR3A 2Z7SA 3R02A 4TWOA 2B53A 3QTIA 4PMTA 2FSMX 3R28A 3E87A 2X7FA 3AGMA 3LAUA 1XBBA 3FXWA 2V7AA 5M07A 5EQYA 4I24A 5BYYA 2XIXA 5AP3A 4FTRA 4PV0A 4U5JA 4NM7A 1ZY4A 4FV8A 4IWDA 3UZTA 3NLBA 5E7RA 4G3FA 5HE2A 4EYJA 4I6FA 3KXXA 1JKTA 3G0EA 3UIXA 2RGPA 3DJ7A 1KOAA 3QYWA 5DLSA 2ZB0A 4FTJA 4WIHA 4YJPA 3H30A 4IAAA 2ITQA 1R3CA 4GT5A 3TJDA 5I3RA 3CC6A 3QD4A 3BYUA 1Q8YA 5J9LA 3U6JA 4FSUA 2VWZA 3JXWA 4LV8A 5FBNC 4IB5A 3PPJA 4FL3A 1H4LA 5HCXA 3EQFA 4QMWA 3S0OA 4D55A 1YI4A 3VUIA 5E8TA 3BLRA 3CY2A 3O51A 3R63A 3RPYA 4OBOA 4ZSAA 1ZOGA 1PMUA 2GPHA 5EKNA 3BGQA 5EDRA 2OZOA 5M57A 2YERA 3CP9A 3LXNA 2QOKA 4BDJA 5DR2A 2I40A 2YN8A 4RG0A 3GFWA 1ZMUA 4YHFA 5HG7A 4D28A 2ITUA 1AGWA 3Q3BA 4FKGA 4G3CA 5EH0A 4TZRA 1H27A 3GC9A 2H6DA 2C6IA 4RT7A 2WGJA 5B2KA 1QCFA 1DS5A 4FVQA 3BGZA 3OC1A 4PTEA 3TKIA 2C5NA 5AV2A 5J1WA 3P7CA 5EHLA 4MD9E 3TI1A 4G34A 5DHJA 3PJ1A 2XRWA 2UVYA 3WZJA 4ASDA 4FT9A 2GTMA 1YOMA 2OBJA 3JS2A 4CRLA 3DBEA 3ZOSA 4D0WA 5GIPE 4AGUA 3ZZWA 4EQMA 3HA8A 3HLLA 4S33A 1T46A 1XH5A 3PDTA 5AFVA 4O91A 3IDPA 3F66A 4HYSA 5ITAA 4NYEA 2UW4A 3ZM9A 1UU7A 4KBCA 4NFMA 2XIRA 4QP6A 4YJVA 2BZJA 3HECA 1OZ1A 2VNYA 2VO7A 3VUKA 2H9VA 3C9WA 3TUBA 4ORKA 5HO6A 3OXTA 2RF9A 3I5ZA 3R9RA 3NNVA 1G8AA 3AD6A 4QPSA 3AT3A 5E8VA 4ZTNA 3UC3A 3PY0A 4X2GA 2GQRA 4YJOA 3VQHA 2Z02A 5KE0A 3Q5IA 4HCVA 3QF9A 3I60A 3FZ1A 4ZY5A 5FTGA 3I6WA 5HVKA 4L42A 5DT4A 5E1SA 1GIIA 2BALA 3IPHA 1VYWA 2Y4IC 4EEVA 4B8MA 3QTRA 4F9AA 1SVHA 2UW0A 5AA8A 4FF8A 2WTIA 4J71A 4FZ7A 4M15A 4D9UA 1FINA 2IWIA 4QMMA 2UW3A 3LLAA 3KRLA 4KKGA 2R7BA 5M08A 3ZFYA 2O65A 3MW1A 5H2UA 4P90A 2XZSA 3HAVA 3BLHA 4FC0A 4L3PA 1P2AA 3FYKX 5ACKA 1WBWA 2ITTA 3L9NA 3ROCA 3R9OA 1R1WA 3BLQA 3DV3A 5B2MA 4JI9A 2VX0A 2J0JA 3MH3A 4ZLYA 5DE2A 4JG7A 4S2ZA 2CGXA 3OXZA 3E7OA 4F0GA 3FMEA 4IZAA 2IVSA 4M67A 2EWAA 3BRBA 4DH8A 4HW7A 4IM3A 4L45A 4A06A 3R83A 3M42A 4QP2A 1YDTE 3IOPA 1VR2A 2XEYA 4TWCA 3T8OA 1M2PA 3TCPA 4H05A 4RIWB 3RMFA 5CAUA 5A4CA 3S3IA 2GSFA 2CDZA 3SXFA 2XK6A 2RL5A 2Y9QA 4HVSA 3FMNA 1FPUA 3OT8A 5IQGA 4X21A 4ENXA 2P33A 4U7ZA 4JBPA 3HNGA 3QYZA 1BI8A 3QZGA 4NCTC 3DB6A 3RM6A 4LFIA 3Q6WA 3UYSA 4JR3A 2BFYA 4FBXA 3GENA 2QOHA 3IECA 4GVJA 1F0QA 1XJDA 2FVDA 3R7IA 3V5LA 4QMLA 5E1EA 3EH9A 4HPTE 4C3RA 4TYGA 5CXZA 5IQDA 3PTGA 3UYTA 4FTTA 4TRLA 5DN3A 4ANSA 4FYNA 5AWMA 4O0UA 2W9FB 4A4XA 3POOA 3DS6A 2IZRA 4DCAA 3TNWA 3C5IA 2QOLA 2Y7JA 5AUUA 3AMBA 3BQCA 4MH7A 3PP1A 2WB8A 3CIKA 1URCA 2ZOQA 3EMGA 4UZHA 4FKQA 4QYEA 1FVTA 1RDQE 3E8NA 4AZWA 3MFUA 2W7XA 3PWDA 5AP4A 4C59A 3NYOA 5FXSA 5EQEA 4A9SA 4EK4A 4JLCA 5CEOA 2BKZA 4D1XA 4ZMEA 4JQ8A 4EORA 2QOQA 5H8GA 3WF8A 5I9ZA 1BYGA 3B2WA 2C5VA 3GGFA 4RRVA 1J1CA 5EHYA 4RIXA 2XNGA 4A4LA 4D4VA 5IH4A 3V5PA 4MXZA 2H96A 2QU6A 4NTTA 3ZEWA 4B0GA 1ZXEA 3KXZA 4RWJA 2WPAA 3HVCA 3ZS5A 4KA3A 2X0GA 4FX3A 3IW4A 2BUJA 3H3CA 3FE3A 5CU4A 4DBXA 2BRGA 2YITA 4YJRA 2O3PA 1FGIA 4CMOA 3OOGA 2V0DA 3MVMA 4CFVA 5DRDA 3PJ2A 1GNGA 3AT4A 4ASZA 3FLZA 4JT3A 4IVDA 3AD5A 4G31A 3PIYA 4BIBA 3U55A 3ORPA 4IJPA 3C4WA 3LJ2A 5CI7A 4F9WA 4I21A 3ERKA 2R4BA 3HV7A 3TT0A 4EH3A 2QOBA 4F64A 1DI9A 3DKOA 3KRJA 2XVDA 4M69B 4QMYA 2UZUE 4OTIA 4RIYA 4LGGA 2CSNA 5CQWA 5L4QA 3FY0A 4R7BA 3FZTA 3OHTA 4M12A 2PUUA 4IADA 3W2QA 5DRBA 2X9EA 2WEIA 3BGPA 3CSVA 2OIDA 4NIFA 5L3AA 1CMKE 5TE0A 5I9YA 1EH4A 4EOJA 3DNDA 3EQGA 2OXDA 4YHJA 2ZMCA 1V0BA 4XMOA 4O0YA 5J8IA 2CKPA 3OCGA 1DAWA 4I1ZA 4Z16A 3SA0A 2WIPA 3QA8A 5AJQA 5DWRA 5E8UA 4ID7A 4AW0A 4RA5A 3Q4CA 3LHJA 3MJ1A 4GEOA 4KIQA 2QCSA 4XG4A 5HE3A 3VHEA 1P4OA 5CU3A 3LZBA 5ANOA 3QC9A 4RIOA 5E91A 4DFYA 3POZA 3RK5A 3D5XA 4DFNA 4U8ZA 3K5VA 4C7TA 5IF1A 3JPVA 4GFMA 5E90A 4ANBA 3QGWA 3O17A 3FC1X 3PE1A 4GUEA 4EHGA 1XWSA 3EQPA 3DBDA 2C5XA 4ANQA 1ZYDA 1XH9A 3WARA 4JBOA 3OMVA 1NVRA 5HHWA 3R1YA 4GCJA 4FIGA 4EH5A 5JZNA 3TZMA 2IVVA 3F5UA 4C38A 3FSFA 1Y8GA 4MNEA 2VTHA 3ZLXA 1PF8A 3ZFXA 3RI1A 4WD5A 3CQWA 3IO7A 4G3GA 4F1TA 3RAHA 3QRTA 3AC3A 1RE8A 3BYVA 5BVKA 4FTKA 4JQEA 4IMYA 3IGGA 1ATPE 4E5AX 1YXSA 2GNHA 2HZNA 3FPMA 5HU3A 4OTRA 2GU8A 4FSZA 2W1IA 1FMKA 3Q6UA 5B2LA 2B9JA 2VGOA 3MS9A 3SX9A 5EDPA 2YM5A 3P5KA 3U8WA 4Z7HA 4EHZA 3VVHA 3VS7A 2FO0A 4XOYA 2F2CB 5AADA 4N6ZA 3I1AA 4RVTA 3D9VA 2BZKB 4H1JA 4UMUA 2X2LA 4J96A 1FOTA 4MBIA 4EOLA 3SOCA 3OBJA 4C35A 5LCJA 4BBFA 4DFXE 2YCQA 5K5XA 1NT2A 5FP6A 5BYLA 3HMIA 3CPCA 4TYEA 2P2IA 5ETFA 3GP0A 2VTOA 2QOFA 5CQUA 4PMPA 3KC3A 1H24A 4QYYA 2VWUA 2Y8OA 5JT2A 3TV7A 5F94A 5HVJA 4FZAB 4Z3VA 4HVHA 4U45A 3NUPA 2PVLA 4PNIA 5J7BA 3EQDA 2A4LA 2E9NA 2OZAA 5GZ8A 3RNIA 2BKKA 1XH4A 2EXMA 5KKRC 4HCTA 1B38A 2YJSA 5AM7A 4QMOA 2FYSA 2XEZA 1R39A 4KD1A 2BRBA 4HNIA 5CANA 1JSVA 3CTJA 4JNWA 1KE6A 2XNBA 3MGYA 2Y6OA 4FIHA 3WE4A 3V5JA 3BZ3A 3VBVA 5CEQA 3G5DA 3NZ0A 3F3VA 4FKUA 5ANEA 1OUYA 3CJGA 1ZRZA 3W10A 2BCJA 1GIJA 4K1BA 4XYFA 5HIBA 3VBYA 5C4KA 1NVQA 1QL6A 4G3DA 1T45A 4FG9A 4AW2A 1K2PA 4K2RA 4TNDA 3W16A 5CU0A 4KABA 3E5AA 4CFXA 4LMNA 2G1TA 2PUIA 3EQBA 4IHPA 3T9IA 2C47A 4ACMA 2BILB 4RQVA 4ZP5A 3UBDA 4ZJVA 5DIAA 4YSMA 3FDNA 5C27A 3N4UA 4MXYA 5ETIA 5AR5A 1UVRA 4YC8A 5BVEA 5A6OA 4F6WA 2PVKA 4M66A 2P3GX 5KX8A 4BIDA 5K9IA 3FZSA 2JITA 3A62A 3GC0A 4O84A 2J50A 4L01A 5CALA 1OBGA 4LM5A 4NW6A 4U3ZA 3HL7A 5IEVA 5JFXA 4BDAA 1JOWB 3SQQA 1UKIA 3ZZEA 4R78A 3K54A 3VS5A 3OT3A 3TZ9A 2JFLA 3TWJA 3RK7A 5CAQA 2FH9A 5CAOA 4X0MA 4LGHA 4F7JA 1M17A 3UPZA 1W98A 1IAJA 4FNZA 5CU6A 4ZTQA 3ZO1A 5EM6A 3DXPA 3ATSA 2WAJA 4QMTA 2B7AA 1U5RA 3O71A 2YZLA 3R7EA 5E8SA 4FOBA 4XBRA 4FA2A 3IS5A 3WZEA 4L8MA 4GV1A 1GOLA 3NUUA 3PPZA 2IW6A 3A8XA 3N4TA 2ZDTA 4ASEA 4DINA 2VNWA 5A9UA 2X8EA 2UV2A 4UXQA 3B8RA 4KKHA 4ALWA 2HOGA 4CGAA 3FUPA 1Q8ZA 4KSPA 3DDPA 3ZO3A 2ERZE 4HVIA 5EI6A 4UYNA 4UMRA 3PVWA 5D11A 4EK8A 3DLSA 4CT2A 5JKGA 4O0TA 5A4TA 4PMMA 4PPAA 1CSNA 3NWWA 2WU7A 5F20A 5H3QA 5IISA 4AACA 3OZ6A 4Q5HA 3SV0A 2V5QA 4F7LA 4YLLA 4QD6A 5HD7A 3U6HA 3OOMA 4YNOA 4ZLOA 3P0MA 4M3QA 2C0IA 4CKJA 4EK6A 3SHEA 2WNTA 4GK4A 4GU6A 2FSOX 3FI4A 4X7QA 4YHTA 2YCRA 2WOTA 2HCKA 4IJ9A 3H0YA 3LFFA 4ZTLA 3HRCA 3QWKA 5DA3A 5HLNA 5ETAA 3MTLA 4X3FC 4GJ3A 4GFGA 4WBOA 4WBBB 3C0HA 4EQUA 3VN9A 3U87A 3F5PA 4RQKA 4TY1A 5LARA 2WIHA 3RWQA 5HICA 4DGNA 5A4EA 4ZIMA 3TNIA 4RFZA 4AA4A 4QNYA 2Z7LA 4TW9A 3V3VA 3F82A 3ODYX 3ZO4A 2W05A 3RJCA 2ITZA 2VTMA 4C4FA 4JRVA 4WSQA 4I92A 3VWAA 3FPQA 3DDQA 4MXCA 4ACDA 2AUHA 1CTPE 2XBAA 4A07A 4ACGA 3BHTA 2W5AA 1O6LA 4IE9A 3NR9A 4JOAA 2J7TA 2G2IA 3C4XA 3KRRA 3D83A 3QCYA 3VBWA 3KA0A 2QU5A 3DJ5A 4JG8A 4PY1A 5EOLA 3CY3A 3R8MA 4Q9ZA 4ITHA 1QPJA 3HP5A 2QO7A 1UU8A 1HOWA 2I0EA 3EIDA 4WUAA 3UZPA 3ZFMA 1H8FA 3MBLA 4JDJA 3R6XA 2GQGA 4KIKA 3WF9A 3I0OA 2YLFA 4GG7A 4GL9A 4Y5QA 4AOIA 3MVLA 4E5BA 3F2NA 4B4LA 5M4CA 3MH2A 4MEDA 2WMBA 3FKLA 5E8WA 2R9SA 4PL5A 3NCZA 4BI2A 3GEQA 2ITNA 4BCPA 4YTHA 4I0SA 4K77A 3SAYA 3KN6A 4JIAA 3MPMA 4R5YA 3UGCA 4E8AA 5AP2A 2R64A 4YJTA 5AV1A 3PWYA 3VUMA 3PXQA 4LUEA 5EYCA 3OEZA 3RGFA 4AP7A 3UQCA 4I3ZA 4BTJA 4EKKA 5LMBA 1APME 3DZOA 5BMSA 3EFJA 5CAPA 3TXOA 4FUYA 4MWIA 1O9UA 2V55A 4QMPA 1CDKA 2BDJA
chains in the Genus database with same CATH superfamily
2F57A 3S00A 4MX9A 1FQ1B 4RIYB 2IZSA 3PXFA 4L9IA 3OTUA 2X39A 3I4BA 3MSSA 2FSLX 3G9NA 1GZOA 2BDWA 2VN9A 3UQGA 3FI3A 4ERKA 5CAVA 5EKOA 4ZZOA 1BMKA 3QLFA 2Y6MA 4NIFB 3ENMA 2F9GA 3FI2A 3NCGA 3NUNA 4A9YA 3K2LA 3P7AA 2C0TA 5EYDA 3I7CA 4GKIA 4Y72A 1OL5A 4U3YA 4NK9A 5A46A 4IBMA 3GT8A 4CXAA 4FT7A 4B6LA 1QPEA 2ZDUA 3I79A 2ESMA 2GDOA 2G15A 4I23A 4P7EA 4YO6A 3PUFC 3HAMA 1OUKA 4BF2A 4LRKA 4H3BA 4ARKA 2WZJA 2R3QA 3D7ZA 2BVAA 1QPDA 2HW6A 3KMMA 4RJ7A 4OLIA 3LCKA 4MVFA 3BI6A 3BE2A 5AUTA 3PIXA 1OGUA 4B8LA 2VWXA 3QQFA 3H9FA 3QKLA 2W4KA 3O2MA 3A7IA 3KMUA 5CZIA 3F61A 3JVSA 3DAKA 4ZZNA 4O86A 3QA0A 2YJRA 4AAAA 4F65A 3NAXA 4D58A 1LEZA 4BY9E 3K3IA 3OF0A 1P5EA 2J0KA 3PE2A 2OLCA 4YURA 5T68A 3BEAA 1REJA 4QT1A 4LUDA 2YHVA 4FKPA 4RLLA 3F3UA 3NYNA 4FV0A 5AM6A 5HO8A 4CMUA 4DGOA 4NM3A 1PMNA 3PRFA 3QTXA 3PXRA 3RZBA 4HOKA 4U81A 4LDTA 2WKMA 3BX5A 4IFCA 4IXPA 5J87A 4YGAA 4N57A 4S30A 2YIQA 4ALUA 4V0GA 4EH2A 5K4JA 3G15A 1JBPE 1Q24A 4U79A 5EDQA 3QRKA 1WBSA 4HZRA 4BCHA 1H25A 4O82A 1U54B 1PHKA 2XNNA 2X2KA 4KRDA 4IIRA 3MFSA 3QC4A 1PKGA 4EOQA 3WBLA 2W5HA 5DYJA 1H07A 3QRUA 3DTCA 4F0FA 5CF5A 5FDXA 2YACA 5DGZA 5HGIA 3G90X 4GK2A 3MB6A 1WBNA 2RKUA 5C8NA 4YR8A 3I0QA 3MY1A 4RX9A 3D2IA 2PL0A 4RX7A 2X2MA 2F7XE 4DITA 4AOJA 3P5JC 3COMA 2YWVA 4YZ9A 5HU9A 4AWIA 4E5WA 3VULA 5BX0A 5L6PA 3GC7A 4YJQA 3V8TA 5EM8A 3LFBA 1V1KA 4AZSA 5KNJA 4BCNA 4NJDA 5HESA 2CHLA 3G2FA 3KXHA 4QQTA 3ZSGA 4TL0A 1OB3A 4UXLA 2BZHB 5I9WA 3NAYA 4DHIB 4QYGA 5DOSA 4QEBA 4JBVA 2EB2A 3U4WA 5L2TA 3C4ZA 4UX9A 4K0YA 4W4YA 4YC6A 3REPA 3E63A 2B9IA 4FVRA 5CLPA 3UDSA 2HY0A 3DTWA 3ORTA 2QO9A 4ZAUA 4AN9A 4UMQA 2CKEA 1Y8YA 2YEXA 1TQIA 4MK0A 5DEWA 2O8YA 4LQMA 3ULIA 3OS3A 2P2HA 5DR9A 5BV3A 4U43A 1OL6A 4G1WA 4EKLA 1YWVA 4P5ZA 3NEWA 5GJDA 3ML1A 2DWBA 2B55A 4UWCA 3GCSA 2I7QA 1JPAA 2WMSA 4MWHA 4GYGA 1OKZA 4DEIA 2VTNA 4LI5A 3QX4A 3E8DA 4V05A 4H3PA 4XHKB 4C02A 4HYHA 1BL7A 1H01A 1LUFA 1ZZ2A 2WMQA 4EOPA 3PYYA 2C6LA 4NEUA 4ZLZA 5M4IA 3L8XA 4V04A 4HVGA 3UC4A 4F99A 5L2IA 4JRNA 4BZNA 1IAHA 1ZOHA 5ICPA 2X0PA 5DMZA 3QKKA 4Z9LA 4IDTA 1YOJA 5FEQA 1UV5A 3N9XA 1PXNA 2J90A 2CN5A 4WRGA 3W0PA 3I7BA 5CF4A 2C30A 4CLJA 3UDZA 1W83A 4AGWA 5M06A 3TNHA 3HUCA 3AG9A 4XCUA 4YTIA 4ANMA 4YPSA 5BUJA 3OP5A 3GUBA 3DAEA 4TN6A 4YUQA 2XJ2A 2W1CA 4Y83A 5HCYA 4EK5A 2WTDA 3RPVA 3NNWA 2BRMA 3F3TA 3ZBFA 1UNHA 4GRBA 3ZLYA 1J1BA 3BHVA 5H8EA 2X9FA 3HV3A 4GMYA 2XP2A 5E8XA 3KREA 2F7ZE 2CKQA 1WVYA 4K33A 4CG8A 4DTAA 4FT5A 4II5A 5LMKC 3TTIA 4RVMA 4YTCA 4FEUA 4F08A 2C4GA 3HV5A 1M14A 2XK4A 4FV4A 4QP3A 5HG8A 5M55A 3H4JA 4UBAA 3ZDUA 4F63A 3NVKI 3HYHA 2IPXA 2ZM1A 2ZJWA 1REKA 2VX1A 4QTBA 3DK7A 4I93A 5HOAA 5IH6A 3CXWA 4NKAA 5AX9A 5HNGA 5AUXA 3R7OA 4M84A 2XH5A 4XLIA 4BGQA 4DHZA 3MH1A 3KVWA 1RJBA 3LQ3A 3KB7A 3IW7A 3F5GA 4WHZA 2FA2A 1YW2A 4XUFA 4O7LA 4Y46A 3ZUTA 3EKNA 4EHEA 4W9XA 3ELJA 3PVBA 4C37A 3MA3A 1MP8A 3EL7A 2XCKA 2A2AA 5DPVA 2VWBA 3ZUUA 4D5KA 4FTCA 1OL1A 1U46A 3GCPA 4Y5HA 3KKVA 4BVUA 4TTHB 4NJ3A 4EBVA 4GIHA 3R8PA 4KIPA 2W4JA 3KCFA 3FLYA 3UVRA 4AT3A 2QOOA 3MA6A 4E93A 4NL0A 4HNFA 3PVUA 2R3RA 4D2TA 2VWIA 4FE2A 4ZJIA 4EI4A 3VS1A 4U97A 4EOIA 4O0SA 4F1MA 4C8BA 2C3IB 3P86A 4K11A 3C4EA 5JMSA 3HRFA 3R30A 3G6GA 4EL9A 5M4UA 4RC2A 3VAPA 1JWHA 4D2RA 1A48A 1YRPA 3KULA 4YU2A 3E7VA 1SYKA 4D4YA 2W17A 3UIUA 3AD4A 2W99B 4NWMA 1PKDA 4AW1A 5LVNA 5A14A 1SVEA 2PZ5A 4XP3A 3UPXA 1OIYA 2CMWA 2ETKA 2OH4A 3EQIA 3ROYA 2AC3A 5IUIA 2F7EE 2OGVA 2WTCA 3EQCA 4FR4A 4AZTA 3DXQA 4BCQA 4EBWA 3DNEA 4DT8A 2WQMA 3O0GA 5DVRA 4GKHA 2GFCA 4J7BA 5KCVA 1Z5MA 1Q8TA 2BFXA 4NFNA 1YHWA 1NXKA 3TNQB 4CZTA 1V0OA 2C6EA 5IA0A 3DCVA 4L00A 4MQ2A 5LOHA 3QQJA 3SD0A 4NUSA 4BDKA 2R3HA 1SNUA 2R3MA 3TUDA 1BKXA 2EB3A 3PJ3A 3N4VA 3MN3A 4U42A 4QRCA 3OG7A 3HRBA 4LRMA 3W32A 4R8QA 3A7FA 4C62A 4H39A 3DJ6A 3W0OA 4FV2A 2VO3A 4GS6A 4NSTA 4AGDA 1IA8A 2VTSA 3TDWA 4FODA 3FHRA 4O1PA 1ZLTA 4E7WA 2CNVA 5FM2A 2YAAA 3E8CA 4OTHA 2REIA 1Q8UA 3CD3A 2QODA 2R2PA 5JFSA 3Q2JA 3R21A 2VTAA 5IQFA 2F4JA 1BLXA 2G9XA 4FL2A 1WBPA 2IEWA 2J0LA 2JGZA 3C0GA 4IAFA 1J7UA 2UZEA 1LEWA 3V6RA 2JLDA 2OK1A 2XNPA 4C4JA 4A4OA 3UDTA 3ZSIA 5M09A 2XNMA 3R1NA 2XA4A 2I0VA 3DKCA 3VRZA 3JY9A 4BDDA 2X1NA 1R78A 3F6XA 4FTMA 4AFJA 4G6LA 4FZFB 3FMDA 2PMNX 5AP0A 3RWPA 2ETRA 3RPSA 4XV2A 1PXMA 4M68A 4C3PA 2HXLA 5ANKA 3RCJA 2DYLA 4U9AA 4BN1A 5HNIX 2BDFA 2V7OA 4F09A 4UWBA 3R7YA 2OJFE 3QCQA 5CSWA 2O64A 4Y73A 2RFNA 4L43A 3ZLSA 4BRXA 5HO7A 5L2WA 4IAYA 2BMCA 3SRVA 3GOKA 3DY7A 3E3BX 1RQQA 1RW8A 5LMAA 2JKOA 3AQVA 3BV2A 4JAIA 1ZYJA 3M2WA 3RVGA 5BVFA 2W5BA 3OWKA 2YCSA 2B0QA 2JKKA 2XK8A 1H1PA 5T6KA 5JZJA 4FKTA 4QNAA 2HYYA 2X6EA 2OXYA 3NNXA 2WQNA 1PXKA 1Y6AA 4X6RA 3LMHA 1DI8A 4ZTMA 1Q8WA 3EZRA 3ZSHA 5KMOA 3OWJA 5DR6A 2BZIB 3LPBA 3VUDA 3EJ1A 4HYUA 4FI1A 3QXOA 4KSQA 2BRHA 4H36A 1MRVA 4HGTA 4IDVA 5B7VA 2HIWA 2X81A 3LFSA 4RBLA 4QYFA 4N70A 4Y85A 2PE0A 5IU2A 5JFVA 4IWQA 2WQBA 1W8CA 2C6TA 4RJ3A 4EZ7A 4QMXA 3MIYA 1OITA 3IOKA 1WAKA 3UO4A 1M7QA 3JYAA 2J0IA 5LVPA 1XBAA 3DBQA 4UB7A 4O1OA 2WTJA 3A7HA 3GU4A 4FTNA 4JS8A 2QG7A 5KZ0A 1OIQA 4BDEA 3L8VA 3T3UA 2QNJA 2WTKB 4FZ6A 4QQ5A 4CQEA 4L67A 5CSVA 5HEZA 3BKBA 4DA5A 3CLYA 3ZEPA 2IVUA 2R3KA 4L3JA 5ANJA 4EUUA 5IEYA 2HWOA 3OEFX 4PDSA 1H08A 3FY2A 3TKHA 4M0YA 5HX8A 2I6LA 4XEYA 3UNJA 4D0XA 2JD5A 3ZCLA 3DBCA 4FV3A 3BHYA 4WOVA 2E9VA 4MBLA 4WNOA 4BWXA 5JSMA 3RBWA 5CWZA 2NNWB 2ITWA 4RMZA 3QBNA 4E20A 3QZFA 4EUTA 2VZ6A 3O50A 3ANRA 3BCEA 3IKAA 1GY3A 3ORMA 4BDHA 3GBZA 5HTIA 3QD2B 2VTQA 2W06A 4XX9A 4AUAA 2UW5A 1H0WA 1WMKA 2G2FA 4BTFA 4YJUA 2HW7A 2OSCA 2C3LA 4C61A 4WA9A 5HIDA 3C1XA 2HY81 1BL6A 3MYGA 5IH5A 2RFSA 2ITPA 2VTPA 3W18A 2CNQA 1GZKA 3GCVA 3PZEA 3IQ7A 2W96B 3PFQA 4YJNA 4EJ7A 5EM7A 3HUBA 1UWHA 3FI8A 3C7QA 4Y95A 4BCFA 2A1AB 4YPDA 3BHHA 3C0IA 2XK7A 2YIYA 3OBGA 4BDIA 4BTKA 2VWVA 3DBFA 2W9ZB 3WZKA 5HE1A 1UA2A 5AR7A 4C36A 2GS6A 4FSWA 1U5QA 3UODA 3LCSA 3R0TA 4IM2A 2YZAA 1CM8A 4ACCA 4O81A 4NT4A 1AQ1A 2W4OA 3P7BA 5M56A 4UWYA 2WQOA 2ZM3A 5JRSA 4DEAA 4JIKA 5JGDA 1Q97A 3UP2A 5BVDA 4JDHA 4WG4A 4PF4A 4RA4A 1XR1A 2RFEA 4F7NA 4NZWB 1GIHA 5CF8A 4I22A 2GMXA 3P23A 3W8QA 3FZOA 5CVFA 3EWHA 3R01A 4X2JA 4XP2A 1MRYA 1W2CA 3W2OA 3R7GA 1XHAA 3Q96A 4FKJA 4U0IA 3CTQA 4PTGA 3UIBA 4EC8A 5KMJA 3QZHA 5L2QA 4RX5A 3NPCA 3A8WA 3QXPA 3R9NA 3Q9XA 5EI2A 3LFDA 3HMMA 3S1HA 4BCMA 2NRYA 1SNXA 5L8JA 5CYIA 4EH7A 2GNGA 4C4EA 3KK9A 4TYIA 3NFFB 4HGLA 3WZUA 1PXJA 1ZMVA 1URWA 2A19B 1IASA 4KBKA 4AZVA 3QUEA 4MF1A 4UN0C 5EOBA 4F70A 1PMVA 4F0IA 4FJVA 3CBLA 2VD5A 5LXMA 3PSCA 2ITVA 2GHMA 2B9FA 4B7TA 5CVHA 4D1ZA 2GNFA 2Q83A 1XKKA 2A0CX 2E9UA 4KUJA 3KL8A 1JSUA 1OIRA 1YDSE 3QGYA 4FOCA 4O4DA 4PTCA 4WO5A 4G6NA 4G17A 5EW9A 5HNBA 4B9DA 5IEXA 4FIFA 3E88A 5ACBC 1GZ8A 5LWNA 3VONA 4D5HA 5DEYA 4FNXA 1PYEA 3QX2A 1X8BA 5BUEA 3UTOA 3WF5A 3ORLA 5IMXA 1Z57A 3FZPA 3MJ2A 4O7SA 2EUFB 5CT7A 3PLSA 4L44A 3RM7A 3W1FA 3SW7A 4O7WA 4DG3E 4EZ5A 3PA4A 2JIVA 2OI4X 5TOZA 1FMOE 1FVVA 2O63A 2LGCA 3K3JA 2Z60A 2PZIA 2KULA 4IX6A 3Q2MA 5EW8A 2UZBA 3W55A 1CKIA 4ZJJA 3UMXA 1PXIA 2OW3A 3K5UA 4MXOA 4AZEA 3HX4A 2PVRA 3TIZA 3E93A 3EFWA 4EOOA 3RHXA 2R0IA 5EW3A 3NFGB 3AT2A 3PG3A 3OROA 4ITJA 2XUUA 3VBTA 2UW8A 3LXKA 1JKLA 4W4WA 4OAVB 4JR7A 3R7VA 4IZYA 1WVWA 2OF4A 1U59A 3GU5A 4HCUA 4U6RA 3PUPA 5C9CA 2WMTA 5HD4A 5J1VA 2BIYA 2IJMA 3GCUA 2YABA 3R8ZA 2PVFA 3RK9A 5JRQA 3V8WA 2WTWA 3QU0A 2R0UA 5EG3A 3KULB 1OKVA 4IAZA 4C33A 2AC5A 3A99A 3CPBA 3D5VA 3KU2A 2BHHA 4FNWA 3F2RA 3W2RA 2XRUA 5A54A 4DLIA 3NW7A 5CU2A 5J9YA 4BGHA 3HMOA 4ZK5A 4AAYA 4IX3A 1ZWSA 2QONA 4AF3A 3SDJA 3VHKA 5HORA 1YI3A 3ZDIA 2ZMDA 4HJOA 3WF6A 4JL9A 3VS3A 3OY1A 4DEDA 2PTKA 3L9PA 2NO3A 2WD1A 3HDMA 4O6EA 5FEDA 4E73A 4FGRA 4MUQA 1ST4A 4J95A 3KMWA 3R2YA 4P2KA 3KQ7A 4RJ4A 1YKRA 3C51A 5K3YA 2OWBA 3U6IA 4YZCA 5CS6A 4F7SA 3DAJA 3UQFA 2UZNA 3C50A 4GFOA 1GJOA 4FKOA 2C1AA 2B1PA 3EB0A 3KF4A 3COIA 3HKOA 3R1QA 1Y6BA 2OU7A 2R3LA 1OECA 3A4PA 4MD7E 4WNPA 2GS7A 4MNFA 1G8KA 4C57A 2XJ1A 2UW6A 4BICA 3N51A 3Q53A 2CNUA 1OKWA 2QLQA 2HWPA 2CGWA 4CD0A 3GB2A 3ZRLA 4BL1A 4NU1A 3NYXA 3Q9ZA 4QYHA 3SVVA 1JAMA 2ZVAA 4EH4A 2W1FA 5CI6A 3NW5A 2EU9A 2IN6A 2YDJA 3MH0A 3A7GA 3AKLA 3EHAA 3FMMA 4PDPA 4O7ZA 4FICA 3ATTA 2ZV7A 3EYHA 3UE4A 3PPKA 5BQ0A 4KWPA 4DCEA 1DM2A 3MFTA 2VO0A 4C2VA 2JIIA 2GS2A 3U51A 4XRLA 2XBJA 4V01A 5KHWA 3UO5A 2IW8A 4UY9A 2UVXA 4AT4A 3O7LB 2XNEA 2VWYA 2XIZA 4CSVA 4DT9A 4AS0A 3KN5A 1SZMA 2NP8A 3II5A 4EONA 2RSVA 3P79A 4RIXB 3GQIA 2JKQA 4IQ6A 5CEIA 1E1VA 2P55A 3P78A 4Q5EA 5EFQA 5C4LA 2JDSA 1OMWA 4R5SA 4C2WA 3SRVB 2V62A 3L8PA 1UWJA 3IW5A 1R0PA 4IWOA 5CEKA 5J7HA 1HCLA 3M1SA 1ZAOA 4OTPA 1H00A 5D1JA 3BEGA 4YP8A 3ZONA 2Y0AA 3PA3A 1V0PA 1TKIA 3AC1A 4FT0A 3B8QA 4PRJA 4S34A 5GJGA 4FTUA 4ZSLA 3DOGA 4FV7A 3D0EA 4O38A 1GAGA 1K9AA 5AEPA 4DFUA 5FXRA 4YLKA 2WO6A 3AOXA 4X2KA 2PY3A 3LFEA 3VNTA 4MCVA 3CQUA 4DGGA 4XG9A 4DH1A 2WMRA 4DEBA 2XCHA 4XV1A 5BUIA 3ET7A 3U9CA 4BWKA 5DBXA 3EFLA 4RZVA 2OFVA 3F2AA 3QKMA 3CQEA 2ZAZA 4BKJA 1B39A 4YMJA 4E4MA 3QTSA 4EJNA 3FLQA 4XG8A 1J7LA 2PUNA 4RIWA 3QHWA 1H1QA 2P0CA 1SM2A 2OIQA 2PPQA 3EZVA 3VS0A 1PJKA 2I1MA 4M14A 4QP8A 3EN7A 2YISA 4UMTA 3QLGA 4OTQA 5DT3A 5FTQA 4YBJA 3FKNA 3TV4A 1OL7A 2GCDA 3NX8A 5CXHA 5IA1A 2HELA 4JG6A 4AGCA 4DTKA 2CLQA 3F7ZA 4UV0A 4DF3A 4AZFA 4D4RA 4XV9A 3QD0A 4EK3A 4LOOA 5HKMA 3IG7A 3EYGA 3BWFA 1KSWA 2PE1A 5IQBA 5AUVA 3ORIA 2PZRA 5D10A 2BAKA 3D15A 2IO6A 3VC4A 1STCE 1TQMA 2PVHA 3QTQA 4YO4A 3FSKA 4JQ7A 3FQEA 4OT6A 4KIOA 5DFPA 5K0KA 5LVOA 4IVBA 3LIJA 3WI6A 4FVPA 4C4IA 2W0JA 5F4NA 4I6QA 4PP7A 1Q41A 1W0XC 2QO2A 4ERWA 3UDBA 3UG2A 3GU8A 5C1QB 3A60A 3LFQA 1QPCA 3HP2A 1TVOA 3GOPA 3VS6A 2C6OA 1WBVA 3LM5A 5C01A 4QMVA 3UVPA 3A7JA 1CKJA 3COHA 3SXRA 3V5WA 4CFUA 4DH7A 3PIZA 3GU7A 1L8TA 3GFEA 4I5HA 4F9BA 5IQAA 2XS0A 3QALE 4GG5A 2PHKA 2BRNA 3NUXA 5AR2A 3BBWA 4FKRA 4JXFA 2JBPA 3EN4A 4MNEB 1YI6A 4OTWA 2BROA 5ANIA 3WILA 3MIAA 5HZNA 4I5PA 1YQJA 2X8DA 4BBMA 3GI3A 1ZY5A 1W84A 4RFMA 3I81A 2YA9A 2ZYBA 3OFMA 4ZZMA 3VW6A 2I0HA 2YAKA 3WYYA 4GJ2A 3CEKA 2QHNA 4FT3A 3VF8A 5EQPA 4QMZA 3FMLA 3DFAA 4BI1A 4NCTA 2YIWA 4FSRA 5IQIA 3FLWA 4HZSA 2OJIA 2OH0E 3P08A 4G3EA 3IK3A 4E4LA 4EH8A 4XG7A 2YM4A 5H9BA 1Q4LA 2VRXA 4BFMA 1G3NA 5IA4A 4M69A 4ZSJA 4EH6A 2Y4PA 1SMHA 3PJ8A 5AR3A 4CZUA 5CSHA 4O7YA 1JSTA 3FHIA 2FSTX 3ODZX 4FKSA 2XMYA 4JBQA 3FL4A 3MI9A 3W0SA 4OW8A 4ZXTA 2OJ9A 2R3IA 3L9LA 3DK3A 3SXSA 4D4SA 5KMMA 4KKEA 1BX6A 4P5QA 3A61A 3MDYA 5E92A 2OZAB 1M2RA 2YIXA 1JVPP 3VJOA 1SVGA 3Q9YA 4WKQA 5HCZA 4M97A 4EYMA 4XG3A 2ZFYA 1NA7A 5L6WL 1TQPA 5L8LA 3MFRA 4C3FA 5CSXA 2LAVA 3EFKA 3W2CA 4W9WA 3PY1A 3OTVA 3LVPA 4Q2AA 5JH6A 4O7VA 5TO8A 4CT1A 2JDTA 4FZDB 2O2UA 2WHBA 4QMNA 4FEQA 4EOKA 4QTEA 2I0YA 2QR7A 3L8SA 4O2ZA 2AYPA 4E1ZA 3ETAA 4ZTSA 1A9UA 4CTBA 3OW3A 5FDPA 3AC5A 3PLAE 5E9EA 3QTWA 4LOQA 1OI9A 3WIKA 2IG7A 4HPUE 5EYKA 1B6CB 3GQLA 5K5NA 3E92A 3RKBA 3LCTA 4EQCA 2E2BA 2PVYA 2R5TA 3WE8A 3MTFA 4LV5A 3QD3A 2FUMA 1OVEA 5LWMA 1P14A 3NRMA 2J6MA 4M0ZA 5H8BA 3P1AA 5AX3A 3SG9A 4BGGA 4FIJA 3HDNA 3FMJA 1Z9XA 2W1DA 4IB0A 3QTZA 5KBQA 3Q32A 1JKKA 3KCKA 4RWLA 4DN5A 4CNHA 4G5PA 2WQEA 3R1SA 3NUAA 3GVUA 4GT4A 3Q4ZA 4I5CA 2SRCA 1NY3A 2UW7A 3ENHA 4CCBA 1AD5A 3Q52A 3Q4UA 4RC3A 4ANNA 3OCBA 3PSDA 2HXQA 1F3MC 2F49A 4G5JA 4L53A 3KXNA 3KF7A 2J4ZA 2OFUA 5FWKK 4E6QA 4IH8A 3ITZA 3O8UA 4CG9A 1IG1A 5KHXA 4KS7A 4G2FA 3PJCA 4H58A 1H1RA 2YFXA 2J2IB 2ONLC 1PXOA 4MQ1A 3TYKA 3EQRA 3ULZA 4BCGA 1W2FA 3JVRA 1I44A 2C6KA 4OGRA 4I4EA 4UMPA 5F1ZA 4YZMA 5HQ0A 3O23A 3LE6A 2W1ZA 2UW9A 5EM5A 3IONA 3R8UA 3F88A 4FTOA 2Z7RA 5CZHA 3UOLA 4A7CA 2XIKA 2GNLA 3HMPA 4LOPA 3VS2A 4CMTA 4E6CA 5CASA 4XG2A 2GQSA 2CGUA 4KBAA 4IX4A 5JFWA 5AUWA 4IZ7A 3NSZA 4S32A 3R9HA 2F2UA 5M4FA 4J8NA 3FC2A 2YM6A 4IVCA 3RTPA 2PE2A 3O8TA 1ZOEA 5I3OA 4BJJB 3TN8A 5IMEA 2WFYA 3DLZA 1WFCA 4O0XA 4XNEA 5TKDA 3IW8A 2R3JA 5JQ8A 4CRSA 4QMSA 4BDGA 4ZOGA 5JN2A 5FRIA 2XKFA 3ZRMA 1S9JA 1H1WA 3RCDA 4J97A 2X7GA 5AP7A 4CZYB 3UOHA 3TM0A 1KE8A 1YHVA 4DHJA 3D94A 2XM9A 3BQRA 5BYZA 4FTAA 2OG8A 4NTSA 3IGOA 3HGKA 2HAKA 3FWQA 2PVNA 3VF9A 3AC2A 4ACHA 1YXXA 2QKWB 5CX9A 4WNKA 4L52A 4FEVA 4I6HA 4RFYA 5GJFA 5D12A 3R9DA 2XAOA 2C5OA 2JDRA 4LMUA 5FGKA 2QOCA 4Z55A 4OTDA 3LQ5A 4FUXA 2V22A 3MB7A 2Q0BA 3UJGA 2GHLA 3NIZA 4ZY6A 3LCDA 4X2FA 3V51A 4DGLC 3D5WA 4I5MA 1YXTA 3FL5A 2CKOA 4QMUA 3LMIA 4QDVA 1I09A 5AP1A 4RJ8A 3A2CA 3F69A 3V6SA 3UVQA 4HVDA 4RJ5A 2YCFA 5DNRA 4CKRA 3KXMA 2J51A 3EN6A 3CS9A 3HZTA 4OBPA 3FMKA 5BVNA 2XK3A 1UU3A 2Z2WA 4R1VA 4JAJA 3TZ7A 5ANDA 3NVMB 4R3CA 4IAKA 2R3FA 2XJ0A 4FSYA 4PDOA 4AA5A 2B4SB 2GNIA 3KY2A 4U40A 2QQ7A 2R7IA 1OGYA 2J5FA 3BELA 4BI0A 2YM7A 4H3QA 2YWPA 4I20A 4XBUA 4O7NA 3MV5A 5I9UA 4DEEA 4OUCA 5IQCA 4NM0A 4L3LA 2RIOA 3DB8A 4YZDA 4MD8E 2ZV8A 4IW0A 3DKGA 4KIKB 4QQCA 5CEMA 4E3CA 4MAOA 3TTJA 5DG5A 4FSMA 1ZZLA 2UZWE 3ZU7A 2VU3A 4FG7A 2E9OA 4AN3A 5FUTA 4KAOA 4R77A 2C0OA 4W4VA 4O0VA 3OXIA 4O0WA 2R3PA 3QQKA 4DBNA 4XP0A 4RLKA 1W82A 3BL9A 3JR1A 1Q99A 1KE7A 3BYOA 2ITYA 4MYGA 5KUPA 2J5EA 4XLVA 2ZB1A 3ZO2A 4YLJA 4JDKA 4ZMFA 3DGKA 3LLTA 2QHMA 4FTLA 4ZEGA 3TACA 5JK3A 4WUNA 5E8YA 1WBTA 3TMOA 2VTTA 2WMVA 3AGLA 4DEHA 4O7TA 2QLUA 3ZRKA 4GH2A 3ZC6A 5LVMA 2B9HA 2QD9A 5HI2A 3OWLA 4G9RA 3EKKA 4QTDA 3BYSA 1H28A 3KGAA 1UU9A 4KINA 4O6LA 5J95A 4AE9A 4F9YA 2UZDA 2WTKC 2BAQA 5C03A 1KE9A 3LCOA 4TYJA 4FKIA 1JLUE 3FLSA 4X2NA 5EHOA 3BV3A 3ZH8A 2UZTA 5CY3A 4GIIA 5HTCA 4MBJA 3UNKA 5I0BA 2OXXA 4TWNA 4RVKA 3KXGA 2OJGA 2XNOA 3TL8A 3BYMA 3NDMA 4FSQA 5IDPA 4CVAA 4WNMA 3AC8A 2PVJA 3NNUA 4I6BA 2Y4IB 3LJ0A 4GU9A 1A06A 4FIIA 1YHSA 4MHAA 3G0FA 4G6OA 5A6NA 2GNJA 4FNYA 1S9IA 4N6YA 4DE4A 3AC4A 5FTOA 3IDCA 3LFCA 3FMHA 4D2WA 1MRUA 2VV9A 5BPYA 5ETCA 4L7SA 1Q62A 3QQLA 1J91A 4IX5A 2CPKE 1VEBA 4RX8A 5AIRA 3MVHA 2WU6A 4DHFA 3R00A 1W2DA 1E1XA 3TV6A 4F1OA 4TT7A 4W8DA 4O83A 3BHUA 3ALOA 4BC6A 3FYJX 1JQHA 1PRYA 2JEDA 3OCTA 3UZRA 4KB8A 3ACKA 1OKYA 4PP9A 5HLPA 3H10A 3VRYA 2HZ0A 3BWJA 4TPTA 3LXLA 3DQXA 4IAIA 3PXZA 4USDA 4I94A 1XBCA 5AV3A 5AIKA 3VJNA 1G8JA 1WZYA 1ZYSA 4U41A