4E4MA

Jak2 kinase (jh1 domain) in complex with compound 30
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
296
Chain Sequence
AFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 296
sequence length 298
chains with identical sequence B, D, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e4mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e4mA01
3I81A 5K9IA 2X7OA 4X2NA 2RF9A 1REKA 5IA2A 3MTFA 3OCGA 4WO5A 2ZB1A 3EFLA 5M4IA 4Q5EA 2I0HA 5HI2A 4JNWA 3LLAA 4QP7A 2C6EA 4K0YA 4QD6A 4EH2A 2RG6A 4YZDA 3W2CA 2EXCX 3Q9WA 3R30A 3V5JA 4X0MA 4FTCA 2FSOX 4DGLC 3F5GA 4U81A 4MXCA 4EZ3A 2OI4X 3MWUA 2B9HA 2CJMA 2BIKB 2WMRA 4V01A 3FYJX 3F82A 1YHSA 2UVXA 3FYKX 4G16A 3EL7A 5CXHA 4F64A 4UALA 2YM6A 1SVEA 5F1ZA 3CGOA 5A4QA 2XK6A 4IC8A 4CTCA 2IZTA 3QHRA 4O7RA 3LCKA 3MN3A 5JSMA 1GJOA 3GB2A 1FBNA 4O82A 5TOZA 4A9SA 2RFNA 4EZ5A 2B0QA 4FL3A 5FEQA 4BBEA 2B54A 3A4OX 3UO5A 4FKIA 5CF5A 4WG3A 3R7YA 3MPAA 4CLJA 3QF9A 4ZLZA 2XP2A 4OUCA 2YHVA 3PPJA 4Q5HA 4EQMA 3FZ1A 3EHAA 4EZ7A 3O0GA 4S2ZA 3EJ1A 2QO2A 5HNGA 3TI1A 2VGOA 1FGKA 3ZSIA 4CMUA 2LGCA 5HU3A 1UNGA 3ZRKA 4AZTA 3R02A 4RWJA 4U43A 1BMKA 4JDIA 4M68A 2XIYA 5HCXA 4KKGA 3U54A 2ZDUA 2F57A 3D14A 1KV2A 3NCGA 4W4YA 2C5YA 3CR0A 4WIHA 3IGGA 2CKEA 3RJCA 4C02A 2IN6A 4AQCA 4S30A 3JR1A 2ZVAA 4H3PA 3RBWA 3CCNA 3WF6A 4BGQA 5HG7A 2WTIA 3GU4A 1YOMA 4EUTA 4TTHB 4LL5A 4UMUA 4AU8A 1OUKA 3QXOA 5A14A 2WMXA 2OXYA 4Q9ZA 1PXKA 4IH8A 3WARA 4HNIA 1REJA 4A9UA 3RI1A 4MK0A 5AP2A 1KE9A 1FMOE 3V6SA 5HE2A 3ZLXA 4FG9A 4G5JA 4RVKA 3ITZA 4B7TA 5BPYA 5J79A 2OKRA 2A19B 2G1TA 2WOTA 2YM5A 4HYSA 4WUAA 3GQLA 3KRXA 4L6QA 4UZDA 3C4CA 3E8EA 4UN0C 4ZS0A 5DGZA 3EQBA 5FXSA 3VNTA 4P7EA 4PY1A 3WF5A 2QOCA 4DN5A 4DF3A 1JKTA 5CT0A 3MVMA 3AC3A 4S33A 3HRBA 1KE7A 4F9BA 4CFNA 2GU8A 3KXXA 2P33A 5EW9A 5ITAA 5LWNA 3P79A 5I9VA 3ATTA 4NM7A 4BYIA 5DHJA 3KN6A 2PMNX 1WVWA 4DH1A 3DKCA 1K3AA 4L00A 4MKCA 3FWQA 4QYHA 1MQ4A 1YDRE 4FSTA 4FSYA 4JS8A 5EKNA 5FXRA 4F70A 2XNEA 4OTHA 3CQUA 2J2IB 2WXVA 4EH7A 4GKHA 4D2SA 2ESMA 4W9WA 2HYYA 4DFYA 5I9YA 4CV9A 1Y6AA 3VWAA 4IEBA 5HVJA 3AGMA 1J3HA 2YLFA 4JI9A 3JVRA 1SMHA 2UZOA 5E8ZA 1RQQA 5HD7A 4HW7A 5HESA 1SNUA 1XBBA 4YSMA 5AP5A 5L6OA 2NNWB 2G2IA 4RBLA 2C4GA 2OW3A 4GEOA 5CAQA 3UVRA 4OT6A 3CSVA 4FV2A 1PXOA 5EH0A 3R1NA 2REIA 5J5TA 4D0XA 3KC3A 3ZO3A 3FY0A 1X8BA 2J6MA 3LFQA 3OZ6A 3SD0A 5JRQA 3FKOA 1NW1A 2X4ZA 5IDNA 3ZOSA 4DTKA 3A8XA 1ZWSA 3DFCB 4JXFA 3ORXA 2CHLA 4U42A 3LLTA 3GNIB 3BX5A 5AR2A 3R9OA 4YPDA 4PDYA 2NP8A 3D5XA 2BFYA 3DAKA 2XIRA 1RJBA 4J98A 2Q83A 1PXJA 4F0IA 5IZFA 3IKAA 3V5WA 4U5JA 4TN6A 4WG5A 4JAIA 4DGOA 2BDJA 2VU3A 3HEGA 2OWBA 3PY1A 4RIWB 2UW7A 4DHFA 1YXVA 5HLWA 3VHKA 3FMLA 4BN1A 3DKGA 4BCGA 4O7LA 3DBFA 3PFQA 3R7EA 2IW8A 2BUJA 1E1VA 4XRLA 4U80A 1V0PA 3BV2A 4HJOA 5CU3A 4JOAA 3PSCA 4MXAA 4EOKA 2NRUA 4NM5A 4O1OA 1OL1A 4IX5A 2YM4A 2E9PA 3ZDUA 5LARA 5AP7A 4YTHA 3WZEA 4E3CA 5F9EA 2C68A 2G01A 2UW0A 1BL6A 3G15A 3FI2A 2OJGA 1XBAA 2P55A 4ALVA 1FGIA 2R3QA 4IZ5A 3CD8A 2CLXA 3LHJA 4QP2A 4FTKA 3PWDA 4WKQA 2BZKB 4FZDB 4RJ6A 3HP5A 1V0BA 5EM7A 5KE0A 4DFUA 3DLZA 4RQKA 1UKHA 4XOZA 1XH4A 1J1CA 4TKSA 3KKVA 3D2KA 3F3ZA 4YJTA 3ZLYA 2PUIA 5LJJA 2IZSA 4EOMA 3LM5A 4FTTA 4NYEA 2YWPA 3BHUA 3FLSA 5ETAA 4CZYB 1SVHA 5KNJA 2YCRA 3BE2A 1KUTA 2J7TA 4OTRA 2VRXA 3BYUA 3TIZA 4CQEA 2QHNA 2X8IA 3FMDA 4C62A 2XB7A 1ZLTA 2XM9A 2C6LA 3FV8A 3QWJA 3R28A 2FVDA 3AQVA 3W32A 2BALA 4IAZA 2BZJA 2WMSA 5EDQA 4JDHA 2XKEA 4ZTLA 3OF0A 3PG3A 4AN9A 5LMKA 2PVFA 4BDCA 3R2YA 1PXLA 4ZY5A 3UNZA 4EUUA 2IVUA 3TTJA 5M4FA 4FMQA 3B2WA 4FV0A 4G3DA 3MSSA 4X6RA 4CKIA 2JBOA 3AC4A 5IQFA 3FQHA 4IX4A 3P7AA 4U40A 3EH9A 2J0IA 4IX3A 3ET7A 3ODYX 3BWFA 4RQVA 2J4ZA 4G17A 4IB1A 4IZYA 2BHEA 5DFPA 3DNDA 4Z7HA 4O84A 5FM3A 2Z60A 3ZBFA 3FL4A 4RIXA 3FLZA 3NX8A 5A9UA 4O96A 3V5TA 2XKFA 2VTRA 4U97A 4DH5A 4L42A 4RZVA 3HMOA 1GNGA 5EOLA 3RCDA 4B4LA 4II5A 3PXQA 3SX9A 5K4IA 1JSTA 5E1EA 5JQ8A 4B8LA 1CSNA 1HCKA 1U4DA 4CEGA 3IPHA 2RG5A 3LIJA 3AGLA 3F2AA 3BGPA 3RTPA 3FJQE 5C8KA 4N57A 3DK6A 3H3CA 3FL5A 4EK8A 5AEPA 3AMBA 2JIIA 5CEIA 4QQTA 5A4LA 3II5A 4K1BA 3UG2A 3WZJA 4B99A 3FHIA 5HG5A 3JUHA 4HVGA 4UWYA 2DS1A 3BV3A 4K33A 4BB4A 3RPVA 3NWWA 2OH0E 2BFXA 2Z8CA 3UC4A 5GZ8A 3QC4A 4WA9A 3ZLWA 3Q4UA 3DZQA 2F7EE 3PRFA 3BYSA 4HCUA 5JZJA 1UU3A 2ZMCA 4FZ6A 3LKMA 4GKIA 3PA5A 1UU7A 3R7GA 3ZO2A 1GZNA 4AS0A 2GNFA 4BDDA 4AFJA 1LEWA 1SNXA 2C1BA 4YTFA 3ZU7A 3C0HA 2PVNA 4F6UA 5AA9A 4GJ3A 3FEGA 1H1WA 4AZEA 3WZKA 2HENA 4FTOA 1DAYA 5TF9A 3H9OA 3Q9XA 5CQUA 3PIXA 3FMJA 4YMJA 1KSWA 2BMCA 2WMTA 3A7FA 1BYGA 1M2PA 3NUSA 3QYWA 4FKOA 4O0RA 2X8DA 4WSYA 5CVHA 1SVGA 3LXNA 2WOUA 4DLIA 1OKYA 3D15A 3GP0A 2WMQA 2RFDA 2Z02A 4KBKA 2PVKA 4U6RA 1M7NA 4FTIA 5HE1A 3MH1A 4E26A 2J9MA 5EHLA 1XJDA 4L44A 4AW0A 3UQGA 4BDKA 3QCYA 3HECA 4BZOA 3FI3A 2R0IA 4CG9A 1P4FA 2YIYA 2H6DA 3DBQA 5AAEA 3S0OA 4KS7A 4EHZA 3PIZA 4P5ZA 5IDPA 1VJYA 1XBCA 3LFAA 1J7LA 3L9LA 3PJ8A 1JPAA 1JQHA 4B0GA 3PPKA 4G34A 2XRWA 3OY3A 4XG3A 1OBGA 4TYGA 4CD0A 2WKMA 2XS0A 3F7WA 4ZZOA 4IM0A 3NUYA 4I23A 2P2HA 2Q0BA 3EKNA 3FXXA 4IADA 4PF4A 2QG7A 4YPSA 4DG3E 3LCOA 4NT4A 4U3YA 5HIDA 2GNHA 3BLQA 3HVCA 3ZHPC 2ZM3A 1XH8A 3ZC6A 4JRNA 4OAUC 5AAGA 3SA0A 4OBOA 2C5VA 4GRBA 3BPRA 3JPVA 5IQEA 5M57A 4CQGA 2BRHA 2BR1A 2VWWA 3NAYA 4LV5A 5AR3A 2PL0A 4QP8A 3UDBA 3FE3A 3FY2A 4JLCA 1M14A 1WBNA 1YQJA 3C51A 3K2LA 4OTWA 5EW3A 4FV3A 3F3TA 4Y5HA 3UBDA 5HO7A 1W82A 3BKBA 2QU5A 3G0EA 5FDXA 2W1EA 4FTUA 2QODA 4KWPA 5J8IA 4E6CA 4IB5A 4JIAA 4EH3A 4RSSA 3SXRA 1CMKE 2ZB0A 3QQLA 3SAYA 3QTZA 3OHTA 4QPMA 3U4WA 4MF0A 4BCFA 2WEIA 4HZSA 2QOQA 3QKLA 4BHNA 4MHAA 3PDTA 1UNHA 1WBOA 3WIKA 4AGUA 4K11A 1YOJA 3UP2A 3FLYA 4QPSA 5FP5A 3KN5A 5CTPA 2YZLA 1R3CA 4GFGA 3WIGA 4HYIA 3SGCA 2XNNA 4QYGA 1S9IA 5GNKA 2O8YA 5LXMA 2OIBA 5M44A 4PDSA 5EI2A 4D2VA 1GIIA 2ITTA 4FKGA 4GT5A 4FUXA 4RX8A 4O27B 4U0IA 3R83A 1IEPA 5BX0A 4JRVA 3Q5ZA 5L8LA 3KVWA 4MH7A 4IWDA 3WILA 2C3KA 2OGVA 4IM3A 4W9XA 4C4IA 2EUFB 4LMUA 3GCVA 4RIYA 1VR2A 2QOHA 4FKWA 1JBPE 3VUTA 1ZARA 3OXTA 2XIZA 1SM2A 4JAJA 2YCSA 2WELA 4EOPA 4FIHA 4NK9A 4BZDA 3OCTA 4O7VA 2J0KA 2HOGA 3GU8A 1UU9A 3U9NA 4ACMA 4PNKA 5LQFA 1QPEA 2W4JA 2VTPA 3UQFA 2PMOX 4YUQA 4XG9A 4QMOA 3VW8A 5JRSA 4BDEA 2IPXA 1CTPE 1Q99A 3U8WA 2QVSE 5ETCA 4ORKA 3JS2A 4TW9A 1NVQA 4ZZMA 4E7WA 1BUHA 4WUNA 1W83A 4ZTSA 4U7ZA 1Q8WA 4FK6A 3WZUA 5EHYA 5KMLA 3ORKA 4LFIA 3MV5A 3DDQA 4BCOA 4OTFA 3LQ5A 4YR8A 4G6LA 4UMTA 3G6HA 2H8HA 3V8WA 3QQFA 4FF8A 4WRGA 2CCHA 3A99A 4LL0A 2BZHB 5BMMA 4BHZA 2UZVA 4BKZA 4C7TA 4X3FA 1TKIA 3DLSA 2QONA 5HO6A 4KIQA 1W98A 4GG5A 1QL6A 1SYKA 5DNRA 3OUKA 4FTLA 2PUPA 4A9TA 4YHTA 2JAVA 3RAKA 2VTIA 4MVFA 2Y4IC 4BDHA 4F9CA 3VRYA 5HKMA 4PMSA 4JQ7A 2BDWA 2EB3A 2JAMA 2IO6A 2R64A 2FB8A 5AA8A 4OBPA 1OL6A 1H0WA 5E8SA 5AAFA 1BI8A 5K4JA 1Z57A 3QCXA 3ACJA 3OROA 4IE9A 4USDA 1H1QA 5CI7A 4GS6A 1DI9A 4C0TA 2YJRA 3GU6A 1U46A 1M2RA 1R0EA 3NYOA 2PTKA 5F20A 4PRJA 3I7CA 4RJ3A 4AWIA 4ZS4A 2C3LA 4EOLA 1Q41A 5KMOA 4GFOA 4IXPA 3PJCA 4MEDA 5DH3A 1WVXA 1YWVA 5JQ5A 1PXPA 3WE8A 3QX2A 2C6MA 3R9NA 1GZOA 1RE8A 3FXWA 1Y57A 2PE2A 3R8MA 4F6WA 3R1QA 3BRBA 3QQHA 4BICA 2B9IA 3ANQA 4DCAA 4TNBA 4IVAA 2JKOA 3HV3A 2XJ2A 3HA6A 4CYJA 3GUBA 4QMYA 2JDTA 1H27A 4IWPA 5E8YA 1UKIA 3IW8A 4K8AA 2CKPA 3DBEA 4YZCA 3Q2JA 2SRCA 2C0TA 4HVHA 2YA9A 3ODZX 1W0XC 1B6CB 4HVDA 3BBTB 2VUWA 1JSVA 1UV5A 3L9MA 2Y4IB 4O38A 3A7GA 4KIKB 4HGLA 4QMNA 4DYMA 3NVKI 4CRLA 4NWMA 4ACCA 2V62A 3T8OA 3E88A 5ANJA 3QA0A 4RWLA 2UVZA 4R1YA 1GOLA 4JVGA 4EBVA 5GZ9A 1KWPA 4EL9A 2HW7A 2QHMA 4FL2A 4RMZA 5BVKA 3R1SA 3QQJA 5IA3A 2BILB 3BLRA 4GCJA 4R7BA 3LMHA 4NUSA 3TKHA 4IB0A 2W1IA 3R6XA 2QLQA 4X6QC 3V3VA 4YU2A 1ND4A 2NRYA 4RX5A 3QLFA 1Q8TA 5E1SA 4ANSA 5B2MA 1I44A 3MYGA 3OXIA 2YLEA 3QZGA 4IACA 4C4JA 3FQEA 4DEBA 3R7IA 2A1AB 5BUIA 1ZYDA 3PRIA 2W4KA 5AUWA 5AWMA 3PVUA 4QYEA 5L2IA 5CU6A 4S32A 3KK8A 3AT3A 3PP1A 2I1MA 1ZY4A 3IECA 3ZCLA 1H4LA 4O0YA 4D4YA 5L8JA 4M69B 2PSQA 2OIDA 5CSHA 1XH6A 3V5QA 3R8VA 3MPMA 4YBJA 5DT3A 3TACA 3UO4A 2YISA 4JIKA 4DEIA 5AV3A 4Y72A 4RJ4A 3HAMA 1URCA 3BHVA 4S34A 4IX6A 5HG8A 1YKRA 5IISA 4NCTC 4UZHA 4BTKA 4AE9A 2VO6A 3OOMA 4MNEB 3PXRA 3ULZA 3W2PA 2DWBA 2XMYA 2CSNA 2X6EA 2FA2A 4RX9A 4YJNA 4AN3A 3NEWA 4F9AA 3VW6A 1MUOA 4JQ8A 4OTGA 5HIBA 4AW5A 4ASXA 4J96A 5A4TA 2R3OA 4NKSA 3ROCA 4U3ZA 5D7AA 1U59A 4I1ZA 2J50A 5C8NA 4UWCA 3TM0A 4O0XA 2GCDA 3D5UA 3ZRMA 3O8PA 5L4QA 5KBQA 2R3PA 3BGZA 3CPBA 4RFMA 4XMOA 5H9BA 3TNIA 5AV4A 3TZMA 2XJ0A 3G5DA 2CNVA 3ORMA 3GC0A 4EI4A 4E6DA 5CLPA 4KSQA 4FR4A 1R39A 5IUIA 4O2ZA 1XH7A 3F5PA 4N6ZA 3OT8A 5BVNA 4FTMA 4P2KA 2R3RA 5CAVA 4YSJA 4C2VA 4D5HA 1KE8A 2CGXA 2UZNA 3VIDA 3EQFA 1BLXA 2VX3A 2YACA 4E5AX 4C4HA 3NW5A 3Q5IA 3MFSA 5IQDA 4MQ1A 4TYHB 1O9UA 5FWKK 2W4OA 1MQBA 1NXKA 4AGDA 4EOJA 2F2UA 4RRVA 2VTOA 2YDIA 4Z16A 5JH6A 2ONLA 5ETIA 1XH5A 2W06A 1PY5A 4CMOA 4IW0A 4X3JA 3VBYA 2B4SB 4ZJJA 5ACKA 4UMRA 2HELA 3O51A 5CVFA 3THBA 5AP0A 1XWSA 4QMPA 2XNOA 3I0OA 3Q4ZA 4O81A 1DAWA 3R73A 4PMTA 3FKNA 1JKLA 1VEBA 3NYXA 4PX6A 4BDIA 2OXXA 4O7ZA 2Y7JA 3QRIA 3Q9ZA 4FIEA 5HOAA 1KOBA 4BDAA 3EMGA 2GDOA 4P5QA 3CP9A 2IWIA 3L9NA 2UW8A 1VYWA 4JG6A 3RMFA 1YDTE 2XNPA 3W33A 4BDJA 4EKLA 5A46A 1J7UA 1Q62A 3RWPA 2GTNA 3W1FA 5EOBA 4DEGA 4TYEA 4XV3A 5IA4A 3O23A 4X2GA 4IHPA 4J8NA 1OKWA 1XH9A 5HQ0A 3HV4A 2JKQA 4RGJA 4GT4A 4FT5A 3R00A 3QD4A 1Q97A 2XA4A 2P4IA 1XR1A 5IEXA 3QD3A 2GTMA 2C6IA 2WNTA 2Z7SA 3OUNB 4NM0A 5C01A 2YEXA 2W5AA 1PKGA 5T3QA 3U51A 2RKUA 4I24A 4CGAA 3LZBA 1UVRA 3TTIA 5J1WA 1PMNA 1QPDA 2AC5A 5HICA 3HV5A 2OG8A 3KF7A 4IM2A 4LM5A 3POZA 3GC7A 4FI1A 4AACA 4BGGA 4C2WA 1E1XA 4RVLA 2WGJA 5IA0A 5DMZA 2YIQA 1Q3DA 3FC1X 3F66A 3SLSA 4G2FA 1OBDA 2VX1A 4OAVB 2C6DA 3NS9A 3QU0A 4GV1A 1Q4LA 4J8MA 3QZIA 2CDZA 3DB8A 4ZSGA 4NZWB 1ERKA 2X9EA 4A07A 2ZM1A 4DTBA 5JFVA 4L3JA 4J7BA 4BGHA 4HGSA 2OBJA 2C0IA 4RLLA 4WD5A 3QQGA 2QURA 3DPKA 1R1WA 3FZPA 3R71A 5CF6A 5J95A 5IEVA 3BEGA 3QRKA 5HNBA 3SRVA 3O8UA 4FIIA 2OK1A 4I3ZA 4TWPA 4IFGA 3Q4CA 4GYGA 3F61A 3GU5A 4LUDA 3BHHA 2OICA 5AR7A 3V51A 4C3RA 4EBWA 4CKRA 3UIBA 1OGUA 3PVWA 3Q60A 5AUVA 2PYWA 3FC2A 2WQMA 4N4SA 3UP7A 4C4EA 5E4HA 2IW9A 4Q9SA 3VUKA 4C35A 1M17A 3MH3A 3HLLA 4ITHA 2FYSA 2PWLA 1HCLA 1QMZA 3QRJA 2OXDA 4J71A 4AOTA 3FXZA 4E4NA 4Z7GA 3OW3A 3R63A 3E7VA 3PVBA 5HCYA 2UV2A 1FOTA 2H9VA 2WB8A 3KFAA 4RWIA 4Y73A 3MIAA 3ZRLA 3EFWA 5JMSA 3KXHA 1CM8A 4FNWA 3VF9A 5EYCA 3Q53A 3EN6A 3OTUA 2OFVA 2BTSA 4ZTHA 3GU7A 2EVAA 2YIRA 3CXWA 4FVQA 3D7ZA 2W17A 1OECA 4H3QA 5JGDA 3CBLA 4Z9LA 4K18A 5G6VA 5DT0A 4ZY4A 2O63A 3LFDA 4XOYA 4YC8A 1WBSA 3ETAA 5FBNC 2PK9A 3I6WA 5EFQA 3FLQA 2W96B 3KXZA 3RNYA 3EIDA 2R3HA 3QD0A 4YJSA 4FSNA 5CT7A 3R2BA 5DT4A 4AGCA 4AE6A 2R3FA 5M55A 2W5HA 2VWYA 3ORLA 4MBLA 3B2TA 4KB8A 4EONA 4F65A 5AR8A 4EC9A 2WAJA 3SOCA 2XVDA 3PJ2A 4YNEA 2CLQA 5LCJA 3R7OA 3DT1A 2OF2A 5IA1A 3PLAE 4FC0A 3DA6A 2RSVA 5CEQA 4CFUA 5CVGA 2E9OA 4F7JA 3O96A 5T68A 5AIKA 3IDBA 3MS9A 2P0CA 4W8DA 3P1AA 4DG2E 4QMWA 4ZZNA 4ERWA 1MP8A 1CKPA 3RAWA 4J95A 4QP3A 4U41A 4FOCA 3TL8A 5L2SA 5GIOE 2YAKA 1LPUA 1F5QA 2HWPA 2RIOA 3BGQA 2VO3A 2ZMDA 2WQEA 1OL2A 3VS5A 4D4RA 4USEA 3KULB 5IPJA 3LOKA 3ULIA 1IA8A 3EWHA 2NPQA 4HVIA 4O7SA 3CY3A 5CXZA 4ZTQA 2YJSA 5ANOA 3R8ZA 2WMUA 1H1RA 3JVSA 1OIUA 3MI9A 3OVVA 3QTIA 4KABA 4M3QA 1OL7A 2A4LA 1IR3A 2W1DA 3NNXA 3AMAA 3PY0A 3NYVA 5FG8A 5FRIA 5I9UA 4EH4A 2ITZA 1XHAA 2QOFA 3AT4A 4R3PA 5HTCA 4JT3A 3W2SA 3QTXA 3PVGA 2R3LA 2QQ7A 5AJQA 3BEAA 3FHRA 4A9YA 5KMNA 1H07A 2OO8X 4XBUA 1PMVA 4YHFA 4EYJA 3COMA 3OEZA 4U44A 2JC6A 4GL9A 4XYFA 3ZM4A 1IAJA 3W2QA 2BCJA 1T45A 4FKUA 4C61A 3M2WA 5AUTA 2O3PA 5IH6A 3A60A 5CSWA 4E4MA 4CKJA 4RT7A 5DA3A 3C7QA 3KCFA 1P2AA 2BRBA 3EYGA 4HGEA 4JJRA 3SW4A 1YI3A 5JGAA 3PG1A 4HVSA 5JN2A 3ORIA 3TDVA 1JLUE 4AG8A 2JKMA 4ZIMA 3KMMA 4KA3A 4LGHA 5IF1A 2GNGA 3F7ZA 3P7CA 2JFMA 3C4FA 5HGIA 5LVNA 4CT1A 4BTFA 3VHEA 3NUAA 5FBOA 3CKWA 4DGGA 3LFSA 4I22A 4F7NA 4V0GA 5CY3A 4ITIA 5BYZA 4E73A 3H10A 2JEDA 4ASDA 4AXAA 4FSMA 3EN7A 4DLJA 4EC8A 3W2OA 4DTAA 4TT7A 3U55A 2QNJA 2X6DA 2WTCA 3MDYA 3RGFA 4DH3A 1ZOGA 5KKRC 4XG6A 2XK3A 3EQHA 5AM6A 5A4EA 2VTLA 5JGBA 3UQCA 3VJNA 4I5CA 3NW6A 4BCHA 2WFYA 3BU6A 2UW4A 4WT6A 3IW5A 5DN3A 3WF7A 4UX9A 5EQEA 3HX4A 4D1XA 1UWJA 1CKIA 4IAFA 4ZSAA 4CRSA 5C4LA 3EFJA 4L67A 1B38A 4C4GA 3OTVA 4AFEA 4KBAA 3QLGA 4LOOA 2C6OA 4FKTA 4M84A 3ZM9A 2OJIA 1J91A 4DT8A 5IA5A 4GK2A 5G1XA 4IVCA 2IG7A 3A7HA 2Y6OA 4DFZE 5CQWA 4JR3A 5L6PA 4FYOA 2X7FA 3QALE 3ZUTA 2YDKA 2WU6A 4FT3A 4H58A 3DB6A 3P78A 4LGDA 4YJVA 3M1SA 4FOBA 5FQDC 3CC6A 2F7XE 3PXFA 2Q0NA 5IKWA 2EWAA 4YZBA 4ASZA 3BBWA 3CD3A 2PMIA 3HYHA 2XEYA 3HV7A 4I21A 4PPBA 4XG7A 5AUXA 5HVYA 5M53A 2BTRA 4KIOA 5HIEA 5HD4A 4RPVA 2W05A 5ACBC 2ACXA 1YXXA 3M42A 4BR3A 5KKRB 1U5QA 3ORPA 5FDPA 1JVPP 3ELJA 5IU2A 3TZ9A 4FBXA 3Q6WA 4O2PA 3ZEWA 3PWYA 4H1MA 4D28A 3ZBXA 5C4KA 3OBGA 3IQ7A 1H01A 5F95A 3MA3A 4BWKA 4EWQA 1YWRA 2XNGA 3LVPA 1QPCA 3AXWA 2PZPA 2YERA 2W1GA 1WBTA 2XKCA 5E7RA 5E8XA 4PQNA 4BZNA 4O7WA 4DBNA 3TZ7A 2VGPA 1IA9A 4QTBA 1K2PA 2W5BA 3E7OA 2JGZA 2PUUA 2ITVA 3R22A 4JX7A 3A2CA 3RKBA 1ZMVA 5KO1A 5BVDA 4QTEA 3H4JA 3DGKA 2E2BA 5BVEA 4AZFA 3NUNA 5DRBA 4O7YA 2I0VA 3GCSA 4RC3A 5CENA 4X2FA 2QOBA 2BRGA 2UZTA 2C5XA 2H34A 5CSVA 3P0MA 5KMJA 4JBVA 3ZUUA 2UZEA 3N4UA 2I0YA 4FEVA 4R5SA 2R0UA 3D2IA 4Y5QA 2AC3A 2VTSA 5L8KA 4MYGA 4QMUA 2W9ZB 2OZAB 1PMUA 2WU7A 3OFMA 4E8AA 4ACHA 2QC6A 5TT7A 1ZY5A 3OBJA 3PYYA 3R21A 2E9VA 3A4PA 4ZP5A 4G3GA 1OIRA 3RZFA 5D41A 2DYLA 4IDVA 5IH5A 2C6TA 4J53A 4EH5A 1YDSE 2ITPA 4CZTA 4BC6A 3IOPA 4RA5A 3WF8A 2W1FA 1OKVA 3EL8A 3ZZWA 1W8CA 2E9NA 5HX8A 1ZYCA 2XK4A 2QR7A 4Y46A 2ETRA 2WEVA 4R1VA 1U54A 1Q24A 1ZRZA 3MH0A 4I93A 2ITYA 2UZWE 5C26A 1AGWA 4I6FA 2O5KA 1XKKA 1VZOA 2PZRA 4AUAA 4BCIA 5JFWA 4XLIA 4GSBA 4UXQA 3Q3BA 3MVHA 3UZTA 4OTDA 4O83A 1GIHA 4GUBA 3REPA 3NUUA 2NO3A 4EH9A 2ZJWA 1YWNA 3L8SA 5EM6A 3RPRA 4Q2AA 4J99A 3DXNA 3E87A 2XBJA 5I9WA 3R8LA 4FE2A 1OZ1A 4IAIA 2W0JA 4OBQA 4UWBA 4Z3VA 3IO7A 3T3VA 2BROA 4R7HA 4F08A 3O7LD 3BQCA 3C0GA 2VWVA 4I5PA 4WBBB 3IW7A 3QBNA 4YJUA 2QOKA 4RVMA 4L8MA 3LFBA 5D1JA 3T9IA 3RPOA 1PRYA 4PL5A 2GHLA 2BZIB 2JDVA 2BAJA 3BELA 4L46A 4TY1A 5ANKA 3UE4A 3VS3A 4RJ8A 5LMKC 5I0BA 4AW1A 3TXOA 4MD7E 3S00A 1ZZ2A 5CF8A 4L45A 3SV0A 3W55A 1PYXA 4BVUA 2ZAZA 3QCQA 5CX9A 2X2MA 3LMIA 3O50A 3VN9A 4MTAA 4TPTA 4FSZA 5L2TA 5AP3A 2GQRA 3HMIA 3BCEA 4GIIA 3F2RA 4BCJA 3TUDA 5BVOA 3KMWA 2HIWA 2UZUE 4HZRA 1ZYJA 2J90A 2VWIA 2F4JA 5ETFA 3AC1A 3NSZA 4QO9A 4FICA 3RAHA 1DS5A 4AX8A 3GCPA 3VUIA 4D0WA 2QO9A 3L1SA 4H1JA 3DQWA 3TWJA 4E93A 4R3CA 4EOOA 1EH4A 1LR4A 4CYIA 4QYYA 3P5KA 4L53A 3SW7A 2PHKA 1KOAA 4EH8A 4FTQA 5HTIA 4XG8A 3QXPA 5JKGA 4UEUA 3R01A 4FIFA 3C4WA 3QUDA 3ACKA 2VTNA 3DAEA 4N70A 4NIFA 3RVGA 3GT8A 3FI4A 3VUMA 4WBOA 3T9TA 5GIPE 4JX3A 3HMPA 3VBQA 2W1HA 4HCTA 3UOKA 4FIGA 2VN9A 3MPTA 3KXMA 3UO6A 2VWXA 3U6IA 3FZTA 1W84A 2YM8A 5BVWA 3D7TA 3BYOA 1YXUA 1OVEA 4ANNA 4BKYA 1OI9A 4M97A 2ZV8A 3BWJA 3QTQA 5ANIA 3NAXA 4YBKA 1UNLA 2R7IA 3LMGA 4ITJA 3WYXA 4F9YA 3KRWA 4DFLA 4MWIA 3CIKA 3OEFX 4FKJA 3ZSGA 2V7AA 3PLSA 4AF3A 4NW5A 4EORA 3UNKA 3O2MA 4O0VA 4RIXB 5DIAA 4FG8A 3VRZA 4D2TA 2PVLA 2GS7A 3W16A 2PUNA 3PSDA 3UIXA 4EK4A 4ZMFA 1PHKA 4FV5A 4AA4A 1AQ1A 3PZHA 4KIPA 1FQ1B 4JR7A 2PVHA 3DTWA 4FSRA 3R8PA 3EQGA 5IQAA 3LJ1A 5DVRA 2JKKA 4BI2A 4YJQA 4L3PA 1PJKA 3H0ZA 3QL8A 4GU6A 4CZUA 2JFLA 2BKZA 4OLIA 4AGWA 1XO2B 4F1OA 1JKSA 4FNYA 5D10A 3UPXA 3S2PA 4FV7A 3QQUA 4YNOA 3W8QA 3NR9A 1YI6A 3MY0A 3E3BX 3D83A 3DK3A 3TUCA 4LUEA 3P7BA 3BI6A 4AA0A 4XJ0A 1CDKA 3ERKA 1J7IA 3RPYA 4JDJA 2XCKA 5LCKA 4QQCA 1YXTA 4QP1A 3FSFA 5IQBA 4WSQA 2YCQA 4YJRA 2Y9QA 4EWHA 4BBFA 1ZOEA 4E5BA 4DEHA 1V1KA 2QOLA 1L8TA 3F3VA 4DT9A 3DBDA 4EOQA 5J1VA 3OG7A 4CSVA 4KAOA 4IFCA 5AV0A 4V05A 4ZJIA 2YN8A 3KB7A 4PPAA 5AV2A 3RWQA 5DRDA 2OH4A 4Y85A 4F7LA 4EHEA 1E9HA 5IUGA 5HHWA 3V8SA 1RW8A 4RC2A 4ZY6A 4G3FA 2GQSA 3LQ8A 4C4FA 2OJFE 3GCUA 2KULA 4NSTA 5FTQA 3VS1A 3E64A 5FLFA 4XS2A 5HE3A 3ZLSA 2VZ6A 3SG8A 3CGFA 1LP4A 5AP4A 5AP6A 3HV6A 3QA8A 4PUZA 2VTHA 5CI6A 5D11A 3RK9A 3UIUA 4FKRA 1V0OA 2FSLX 4USFA 3R9RA 3VAPA 4I5MA 4XG2A 4I20A 3NPCA 5T6KA 3UNJA 3G90X 4YC3A 4J97A 4C36A 4FEWA 4R78A 4BI0A 5E8TA 1Y91A 3EOCA 3HP2A 3R04A 4PDPA 5E8VA 3TJDA 3AMYA 4I6BA 2C6KA 4QQJA 4IVDA 3BIZA 4QT1A 4LGGA 4DAWA 2WHBA 1H28A 3KL8A 3LXKA 1XQZA 3G33A 3A7JA 2VD5A 2QLUA 5JK3A 1M52A 1FPUA 3FMKA 4QRCA 2X81A 3ZONA 1LUFA 4ASEA 4ZK5A 3DAJA 5J87A 4DA5A 4D5KA 3CJGA 3W8LA 4EHVA 2BPMA 4FV1A 4PV0A 1PW2A 3QZFA 3DJ7A 5B0XA 2XBAA 4CCUA 4OTIA 3JYAA 4O7TA 4I4EA 1ZXEA 4G3EA 4FT9A 2IZUA 2ITXA 4F7SA 3MFTA 4KRDA 5CS6A 3T3UA 2ETMA 2CNUA 2ZDTA 3E62A 2JLDA 2QKWB 3KA0A 4QOXA 4WNKA 5AR4A 5KHXA 1YHWA 3L8PA 4DH8A 5EI8A 3R7VA 4CXAA 1BL7A 1Q3WA 4GU9A 2PVRA 2JDSA 4W4XA 4IZ7A 4C8BA 3KRRA 3V04A 4CV8A 1H08A 1S9JA 1YXSA 3EQCA 4ANLA 4C37A 1Q8YA 5TKDA 3CTHA 3FMNA 5E8WA 1ZAOA 2HY81 2JIUA 4W4WA 2UVYA 3VO3A 3VUHA 4RIOA 3EQDA 4XBRA 5JEBA 4RG0A 4U45A 5ANDA 1FVRA 2VNYA 2XF0A 4OTQA 4BWPA 4UYNA 2VWZA 3ATSA 4O1PA 4A4XA 3QTWA 1TQPA 3I7BA 4E6AA 4BWXA 2F9GA 3A7IA 3IONA 5H8BA 3O8TA 4UXLA 3SOAA 1JWHA 2YCFA 5I9XA 5GINE 4FZ7A 2JD5A 5BVFA 3GQIA 5E9EA 4J1RA 3LCDA 5FP6A 1GZ8A 3KRLA 1RDQE 2GHMA 3TN8A 4FT7A 5FTOA 4TWNA 4KD1A 4FTRA 3NIZA 4X3FC 3V6RA 5LVLA 4YJPA 5DBXA 3S95A 3CQWA 3SDJA 4AP7A 2CMWA 4HCVA 5GJFA 2BHHA 2X9FA 3K54A 2HZNA 3D5WA 4AW2A 2Z7RA 3OC1A 3O71A 5HLNA 5KHWA 3OMVA 4ONAA 5EYKA 3DY7A 4ANBA 3JY0A 4FKPA 1KE5A 3SKCA 4R7IA 4ACGA 4BIBA 1PXMA 4FEUA 1OIYA 4D4SA 4MXZA 2GSFA 5A6OA 1H24A 2UUEA 2V7OA 2Z7LA 3CS9A 5ANEA 4D2WA 5A54A 2WZJA 3SXSA 2HZ4A 4UMQA 3ZC5A 5AUUA 4JL9A 4ZOGA 4APCA 3HAVA 3KEXA 4UYAA 2XKDA 4NJ3A 4E20A 3QWKA 3MGYA 3GGFA 3L9PA 2X39A 5D12A 3UPZA 2BAKA 1URWA 4I6HA 1M2QA 3TCPA 4Y83A 3PP0A 4AZWA 3EZVA 1GIJA 3ZXZA 3HGKA 5EI6A 5M08A 4FVRA 4LRJA 4QNAA 3WOWA 2QD9A 3ALNA 2VWBA 3B8RA 4C57A 4BFMA 4K2RA 4X3FB 2GNIA 5EG3A 3DKFA 3UG1A 3ZSHA 5KCVA 2J51A 2FUMA 2OLCA 4B6LA 2Y6MA 4FSWA 4W4VA 1AD5A 4NEUA 5CANA 4L9IA 1ZMWA 3F5XA 4X7QA 5TO8A 3RM6A 5M51A 5J9LA 4I0SA 1STCE 1WBVA 1QPJA 4UV0A 2O65A 5LMBA 3IW4A 4MXYA 2B1PA 5H8GA 2OFUA 3ALOA 3SXFA 4PTEA 4IB3A 3BZ3A 5EYDA 1IRKA 3CY2A 4KSPA 2R5TA 2WTKC 3PXYA 4L01A 3S3IA 4FGRA 4FGBA 5JFSA 5CAUA 3UTOA 4ANQA 1H26A 3VBXA 3VBTA 4BCPA 4DINA 5IQGA 3BU3A 5FEEA 2CPKE 2HZIA 3PZEA 2B53A 3I60A 3MFRA 4J52A 3MA6A 4IJ9A 4IWQA 5KMIA 5DE2A 4NFNA 2CN8A 4G1WA 4FKLA 3MVJA 1OKZA 4FIJA 1JNKA 3Q96A 4L68A 4YC6A 3COKA 3SG9A 4EOIA 1P5EA 5IQCA 3DOGA 3LCSA 4TXCA 2X0GA 2C3JA 2WQNA 4ZTNA 3NVMB 2QCSA 3NW7A 4RIWA 3QRTA 4RJ5A 3ZMMA 4MXOA 5ANGA 3VQUA 2QO7A 2E9UA 4LYNA 3R9HA 4MNFA 4PNIA 4BTMA 5JFXA 3QHWA 2HK5A 4MBJA 3PE1A 4BI1A 3QUEA 4N6YA 3MY5A 3C5IA 5DG5A 4LOPA 4YZMA 3FMHA 4FVPA 3RALA 1BKXA 2FSMX 3OS3A 5GHVA 4ALWA 3KRJA 3OP5A 4KKEA 5D9HA 3ZS5A 4D4VA 3UZRA 4D9TA 4MD9E 3H30A 4R5YA 2GNJA 4FNXA 4YTIA 2WTKB 3MB7A 4G9RA 3HDNA 4PTCA 3HNGA 4BCNA 3NDMA 4OR5A 4TYJA 2XK9A 3AD6A 4XCUA 1WBWA 1Z5MA 4YURA 5M07A 4D1ZA 3TG1A 5CU2A 2FH9A 5EW8A 5IQHA 4TRLA 2GMXA 2A2AA 3BQRA 3MIYA 5AR5A 1UA2A 5DWRA 3MJ2A 3C4XA 4DFXE 2YM3A 3QZHA 2XIXA 4O21A 4PTGA 4RZWA 2C69A 3KXNA 2F7ZE 4E4LA 1OIQA 2Y8OA 4YZNA 1OL5A 3TKUA 3ENMA 4GFMA 4R6VA 4DCEA 2ITQA 2VAGA 4XP0A 3DQXA 2YITA 5C27A 2PZIA 4CG8A 1OPLA 5HE0A 4DEEA 1CKJA 5IMXA 3GCQA 3Q9YA 3QTRA 4XNEA 2BRNA 3HUCA 3RP9A 4G6OA 3OXZA 3ZH8A 4DFBA 4FSUA 2W9FB 5JZNA 4LOQA 3U4UA 4DEAA 2IZRA 5BMSA 1GY3A 4Y95A 4PMPA 4TWOA 3SC1A 5HU9A 3ORZA 4FV4A 5CZIA 4FNZA 3QTSA 3D5VA 4FTJA 5BYYA 3MY1A 2ONLC 3DCVA 3AC2A 2ITWA 2ZOQA 3LJ2A 3VS4A 3SQQA 4C59A 4EEVA 1Q5KA 4IJPA 3UODA 2GHGA 1MRVA 2ITNA 2JDOA 5M56A 3OT3A 3F3WA 4FODA 3N4TA 4OW8A 2VX0A 4L3LA 3ZFXA 3HUBA 4NFMA 2PE1A 3MESA 3FDNA 2IJMA 4G6NA 2VO0A 3LW0A 3E5AA 4YZ9A 3OY1A 4U9AA 2HXLA 4EK6A 3AG9A 3PE2A 2RGPA 3H9RA 4E6QA 3E8CA 2EXEA 2GQGA 2QOIA 3FLNC 2B9JA 4W8EA 4D55A 5M4CA 3VS7A 4MBIA 5DEYA 3UMWA 5GZAA 4FTNA 4BL1A 2R3MA 3P9JA 4AOIA 5ICPA 2PVYA 1F0QA 3EB0A 2EB2A 2UW9A 5HORA 3TNHA 3Q04A 3O17A 3CLYA 2GFCA 3DXPA 2FGIA 3CTQA 2VTAA 4EK5A 4QMVA 4QMMA 5EDRA 2XCHA 4YP8A 2XNMA 3R1YA 5CAOA 5IG1A 3PXKA 2OZAA 3Q6UA 5BUJA 1P4OA 3NYNA 2VTMA 1ATPE 1JSUA 2HY0A 2XIKA 5CF4A 1U5RA 4GVJA 4F99A 4DC2A 4B9DA 4CVAA 5KUPA 4ZLOA 4JDKA 4YHJA 3MJ1A 4JG7A 4MCVA 1H25A 3ZO4A 2XZSA 2OJ9A 3NNUA 2Y4PA 4O0TA 5EM5A 5C9CA 1Q8UA 2C5OA 3OWPA 4H36A 1R78A 3KK9A 2CKQA 3RK5A 1I09A 3LXLA 3LJ0A 5HG9A 5BQ0A 5DR2A 4ZLYA 4XV1A 3UC3A 4H05A 3Q2MA 1A48A 2BDFA 2V5QA 5F94A 3MFUA 3LAUA 3WBLA 4C3FA 3UMXA 1L3RE 3LCTA 4ZSJA 5AIRA 4F9WA 2WMAA 4LG4A 3C13A 4EJ7A 2I6LA 2ERZE 2Z2WA 2WMVA 3AD4A 5CASA 5CAPA 3AD5A 3U6HA 1VYZA 3I79A 4JG8A 4MAOA 5HVKA 3DDPA 3E92A 5FXQA 4E5WA 3O7LB 3VUDA 5CSPA 4AAAA 5IQIA 3F88A 3POOA 4C3PA 4L7SA 4G31A 4BCQA 3A61A 5A4CA 3GOPA 4O7NA 4V04A 3KCKA 3OW4A 1H0VA 5KX8A 5LVOA 3E3PA 4D2PA 4QTDA 4U79A 3GENA 3F9NA 5AUZA 3TKIA 2B7AA 3F2NA 4DG0E 3CQEA 4KBCA 3PJ3A 5EKOA 5IEYA 2QKRA 3GVUA 3HKOA 1YVJA 2BIYA 5DOSA 4HPUE 4EH6A 4MXXA 3UZPA 4I5HA 2GS2A 3GEQA 3QFVA 4MD8E 5CU0A 3TDWA 4GUEA 4EHGA 3COHA 4BDBA 1MRYA 3R7UA 3UJGA 3UYSA 4NH1A 5F4NA 4PPCA 3V5PA 5EQPA 3ZZEA 1YHVA 4ENXA 2PPQA 1ZZLA 3EFKA 2HAKA 4XX9A 3NNVA 2CGUA 4O0UA 3SRVB 3WI6A 2ZM4A 2UZBA 4I0TA 3D0EA 4FYNA 4IANA 4L7FA 4DITA 5HBJA 3VVHA 4OT5A 5I3OA 2C5NA 3TUBA 3C0IA 4LRMA 1BI7A 2ITOA 2OZOA 3PSBA 2O2UA 2ITUA 4HGTA 3DJ5A 4FV8A 3VQHA 2F49A 4CFVA 4G9CA 4QTAA 5K0KA 2ZV7A 3PJ1A 3TZ8A 2PVJA 4APPA 3BYVA 4JQEA 5TR6A 4IIRA 4ERKA 4LMNA 3U87A 4ZSEA 1OMWA 2B9FA 3DK7A 4A7CA 5KBRA 5M4UA 5C03A 4HOKA 2X2KA 4BCKA 4UMPA 5FUTA 2WIHA 4HYHA 3UIMA 5A3XA 3VBWA 3NNWA 3EYHA 5J9ZA 4KNBA 2IW6A 4XV2A 4BDFA 2Y0AA 4GJ2A 5CEMA 3AC8A 3CEKA 5BYLA 1BX6A 4JBOA 5J5SA 4GT3A 3P08A 4LRKA 5DEWA 4M0ZA 4NTTA 4M12A 2CN5A 4X21A 5BUEA 2QG5A 3ZFMA 4X2JA 3EN4A 3TT0A 3EQRA 3RHKA 4P90A 4BIDA 3TIYA 2W7XA 3OOGA 5AMNA 4K77A 1WFCA 2OIQA 3FKLA 4L43A 3KF4A 5IMEA 3CPCA 1OB3A 3P4KA 3BHYA 1YW2A 2AYPA 5E91A 4FUYA 4IZAA 3DBCA 4MX9A 3PTGA 1YRPA 2EXMA 2R3IA 2QU6A 1OPKA 1Q61A 2KTYA 1NT2A 4NTSA 1H00A 3MTLA 4QMSA 4ZMEA 5IUHA 4R3RA 4X2KA 3D94A 2XRUA 5E92A 5M09A 3FUPA 2HW6A 3IG7A 4HYUA 4PP9A 1WVYA 3FZSA 4G3CA 4QYFA 3R8UA 2ERKA 3G6GA 4GG7A 4QMZA 5HBEA 4EK3A 4N0SA 3GFEA 4IC7A 3H0YA 4YO6A 4CMTA 1O6YA 2WTWA 3C5UA 3EN5A 2XK8A 2OF4A 4XLVA 2GFSA 4FA2A 1ZOHA 3FSKA 4PL4A 4UY9A 3RNIA 2A27A 4IAAA 2VTTA 3CE3A 3NLBA 3OWJA 4DBXA 3C9WA 3UVQA 3V5LA 2B52A 4R77A 1KV1A 2PZ5A 2C3IB 4O22A 4H39A 4DGNA 3DNEA 2Z7QA 4GIHA 5K3YA 3E93A 4DE4A 2XM8A 3Q52A 2ZV9A 3IDCA 3VC4A 4YLLA 4CFFA 5A6NA 4LV8A 3NUPA 2OU7A 4QP9A 1OITA 5LVMA 1G3NA 4O6EA 4AZVA 2YIWA 3PA4A 2I0EA 3LFNA 4RLKA 3C1XA 3NUXA 3QUPA 3TV7A 1SZMA 4A4LA 3RAIA 3FQSA 1NVSA 3S1HA 2G9XA 4ID7A 2BVAA 4PL3A 2GPHA 5CSXA 1FVTA 5K0XA 1WZYA 3DKOA 4AT4A 4BIEA 3QRUA 4HNFA 1PKDA 2QR8A 5E90A 2WD1A 1APME 1P14A 2GNLA 2VWUA 3EQIA 4FTAA 4QP4A 1UWHA 3FBVA 3RM7A 4CNHA 5CALA 5J9YA 5CU4A 4RWKA 1WMKA 3G9NA 4D9UA 5I4NA 3FMMA 4ENYA 3FPQA 3ZXTA 4YLKA 4WOVA 1WBPA 2UW5A 4KS8A 4BCMA 3HMNA 4NM3A 4AA5A 5AUYA 4IAKA 5FD2A 3FI8A 2WMWA 1KE6A 3GXLA 3RZBA 5FTGA 1JOWB 5HO8A 2V22A 4V0GB 4XUFA 3OCSA 1GAGA 4I94A 5C8MA 4XEYA 3VF8A 2YABA 3DTCA 3UYTA 3W10A 5L2WA 4CCBA 3UOHA 3KMUA 5J7BA 2H96A 2P3GX 4IMYA 3RHXA 4QQ5A 4ANOA 1OM1A 2R2PA 4QMLA 4AN2A 5CEKA 3ZEPA 3C4EA 2PMLX 3QAME 4RFZA 3FMEA 2DQ7X 3G2FA 3AOXA 4F1TA 4Y8DA 5CNNA 1UU8A 1OPJA 4KIKA 4K9YA 5I9ZA 2CGVA 4PP7A 5C1QB 2HZ0A 3LFEA 4XH6A 1H1SA 5AFVA 2IVVA 4XRJA 4WG4A 4MWHA 4OTPA 2WO6A 5L3AA 1JAMA 2V55A 3IW6A 3QGYA 4FZFB 4JBQA 4M7IA 3D9VA 4WNMA 2B55A 2VTQA 2OSCA 2YZAA 1PF8A 4LQMA 5B7VA 3DJ6A 4F1MA 2A0CX 3R9DA 3NZ0A 3M11A 5KMMA 4FEQA 3KVXA 3QX4A 2X7GA 3ORTA 5B2LA 4JBPA 3VS0A 3K3JA 3DS6A 1K9AA 3HRFA 2VV9A 5CEOA 2LAVA 2IVTA 5HTBA 2WTVA 5H8EA 2BKKA 3QGWA 2RFSA 3LXPA 2R7BA 4NL0A 2HXQA 3NIEA 4L52A 3EKKA 4ZAUA 4F0FA 3MVLA 5H2UA 3MW1A 5FEDA 4BYJA 2RFEA 4ZXTA 4IQ6A 2X8EA 4M69A 4WHZA 4A06A 1Y6BA 2G2HA 5J7HA 4B8MA 5K5NA 3P86A 2C1AA 5I3RA 2BRMA 2RL5A 3AC5A 3RK7A 3UOLA 1FINA 4O86A 3HDMA 3NGAA 4P4CA 3CTJA 4MNEA 3QC9A 3FPMA 3N4VA 4XHKB 4FKQA 4TZRA 4NKAA 2PE0A 4IWOA 4FX3A 2ETKA 4KKHA 3VJOA 3W18A 2QOOA 3BHTA 3K3IA 3W2RA 2DUVA 3SVVA 1IAHA 4QMTA 3SHEA 4FV6A 4FEXA 1ZYSA 3F6XA 1TVOA 4FSQA 4RX7A 5AV1A 3JY9A 3RINA 5HBHA 4O0WA 4ALUA 4D2RA 3TEIA 2O0UA 4R8QA 5EK7A 1WAKA 3A62A 3B8QA 4M8TA 3I1AA 4I0RA 1G8AA 3WZDA 1Y8YA 4HPTE 1HOWA 4M15A 3PXZA 3WE4A 3TNPC 4ZJVA 4GW8A 3IDPA 4GVAA 3OWKA 3PUPA 3COIA 3IGOA 2J0MB 2PVMA 5B2KA 1WCCA 3ENHA 1M7QA 2UZLA 3VS2A 4CT2A 1A9UA 3ZFYA 3ORNA 5L2QA 3U6JA 2ZV2A 2J5EA 3EQPA 4AZSA 4CFWA 3UVPA 2VTJA 3I5ZA 2WTJA 2I40A 3OWLA 4TYHA 5JT2A 3I6UA 2XK7A 3AT2A 4YLJA 2XJ1A 3UGCA 3ZTXA 1Q8ZA 2V0DA 3C4ZA 3GC9A 3KXGA 4I6QA 4BF2A 4NCTA 2HWOA 4D58A 3QQKA 4CLIA 5EM8A 4M67A 4PDOA 3LFFA 1TQIA 3F3UA 3LE6A 5DI1A 1J1BA 2O64A 3CJFA 1U54B 3U9CA 2HCKA 2G15A 2EU9A 1JKKA 3RCJA 3ZO1A 2W99B 5AX3A 3RPSA 2YM7A 4WRSA 3QYZA 4EOSA 4EYMA 4DEDA 5BNJA 2BAQA 4I92A 3VS6A 1FMKA 3PY3A 5L6WL 5LMAA 3ID6C 3FZOA 1T46A 3K5VA 2G2FA 4CTBA 1NA7A 3DZOA 4F6SA 5LWMA 3UOJA 3I5NA 5KZIA 2X2LA 2R4BA 5CWZA 3S4QA 4TL0A 2JIVA 2XUUA 4EJNA 2CGWA 3E63A 4BBMA 3WYYA 1YI4A 2VO7A 2CCIA 4E4XA 5EYMA 1YOLA 2CNQA 2YDJA 3MBLA 2UZDA 3GFWA 3KU2A 4ARKA 3N9XA 4O6LA 1FVVA 1IG1A 1GZKA 5HZNA 1O6KA 3ZYAA 2XYNA 2WQBA 5HX6A 3MB6A 3VBVA 2WIPA 3EZRA 4EQCA 2AUHA 4GYIA 3BE9A 2FSTX 2YAAA 4RC4A 4NJDA 1LEZA 4EKKA 1ZYLA 5EDPA 2GS6A 1G8SA 5CNOA 5EQYA 3I4BA 3H9FA 2C0OA 5DPVA 2PZYA 3TJCA 3OCBA 4BDGA 2C30A 1OUYA 4KRCA 2YWVA 4QNYA 4EQUA 1MRUA 2R3NA 3G9LX 4F09A 3G51A 3ZDIA 3D4QA 4CFXA 4DH7A 5AADA 5K5XA 3GI3A 4M13A 4ZTRA 4RVTA 4DFNA 4WNPA 3PIYA 4Z55A 5KZ0A 3WF9A 4UB7A 3FAAA 4FKVA 5DYJA 1PXIA 3QTUA 2FO0A 2JITA 2UW3A 4ZEGA 2J0LA 1NVRA 4GK3A 4DGMA 3PA3A 4BY9E 2WMBA 3QKMA 1W7HA 4F0GA 1Z9XA 3V8TA 3DU8A 4ANMA 4ACDA 3L8VA 4MF1A 5FGKA 4AT5A 3E8DA 2WTDA 4O0SA 3EN9A 5AX9A 2X1NA 1ZMUA 4CFMA 1IASA 5LOHA 3F69A 3GBZA 2ZYBA 3E8NA 2J5FA 4BKJA 4E1ZA 2CKOA 3KY2A 4NIFB 4M14A 4AOJA 3VULA 4MQ2A 3DXQA 2JBPA 4QMXA 4GK4A 4YTCA 3ROYA 3PPZA 2R9SA 2OJJA 3DV3A 3LQ3A 1DI8A 3LM0A 3TNQB 4TNDA 2W1CA 3TV4A 3L8XA 2UW6A 3V01A 4QP6A 4OGRA 3ZUVA 5FM2A 5E8UA 3KQ7A 5DR9A 3BYMA 1PXNA 3Q4TA 3QKKA 2YIXA 2QI8A 3D7TB 3G0FA 4FZAB 2R3JA 3A8WA 3KGAA 1DM2A 2XH5A 4RIYB 3BLHA 4C34A 5HCZA 3BU5A 3HMMA 3GC8A 4IDTA 4KINA 4PMMA 4C33A 4YO4A 5I5ZA 4ZSLA 4XP2A 1H8FA 2R3KA 4GMYA 4XV9A 4YGAA 1PYEA 4QTCA 5HEZA 2WQOA 5CZHA 4GH2A 3QCSA 4I4FA 4IAYA 3Q32A 5M06A 1R0PA 4FV9A 3TNWA 5TE0A 5LVPA 4FG7A 3HL7A 3P23A 5D7VA 5AP1A 4PWNA 3C50A 5DLSA 3NRMA 4M66A 4KUJA 3HA8A 4S31A 4U8ZA 1B39A 4ZTMA 4F63A 4AT3A 5HNIX 4XP3A 4H3BA 1Y8GA 4M0YA 1F3MC 1H1PA 2IVSA 4C58A 4RJ7A 2J0JA 3IS5A 3HRCA 3LFCA 4WNOA 2I7QA 5GJGA 4BRXA 5GJDA 3KULA 1A06A 3DFAA 4FK3A 4K6ZA 3R0TA 2PY3A 4BTJA 4QPAA 4QMQA 4A4OA 3I0QA 4TWCA 3QD2B 4FT0A 4FKSA 4A9RA 1QCFA 3F5UA 3GOKA 3MH2A 3FZRA 4FL1A 4IVBA 2C47A 2XNBA 5EHOA 4UBAA 1PMEA 4D1SA 3KREA 1TQMA 4F4PA 3HZTA 1G5SA 4NU1A 5CEPA 5AM7A 4RA4A 1O6LA 3IK3A 2VNWA 3LPBA 5CYIA 3ANRA 3CKXA 2JDRA 4TYIA 2XYUA 3OD6X 2P2IA 4G5PA 5KMKA 3VUGA 5H3QA 3NMUF 2F2CB 1NY3A 2YFXA 2WPAA 3NCZA 4YJOA 3K5UA 2PULA 3N51A 3JXWA 2XEZA 4NW6A 4IBMA 4LI5A 4RFYA 3TV6A 3IOKA 2W1ZA 4C38A 2PU8A 4O91A 5HLPA 3FLWA 2R3GA 5DR6A 2X4FA 5IH4A 4I41A 4XG4A
chains in the Genus database with same CATH superfamily
3I81A 5K9IA 2X7OA 4X2NA 2RF9A 1REKA 5IA2A 3MTFA 3OCGA 4WO5A 2ZB1A 3EFLA 5M4IA 4Q5EA 2I0HA 5HI2A 4JNWA 3LLAA 4QP7A 2C6EA 4K0YA 4QD6A 4EH2A 2RG6A 4YZDA 3W2CA 2EXCX 3Q9WA 3R30A 3V5JA 4X0MA 4FTCA 2FSOX 4DGLC 3F5GA 4U81A 4MXCA 4AXEA 4EZ3A 2OI4X 3MWUA 2B9HA 2CJMA 2BIKB 2WMRA 4V01A 3FYJX 3F82A 1YHSA 2UVXA 3FYKX 4G16A 3EL7A 5CXHA 4F64A 4UALA 2YM6A 1SVEA 4BJJB 5F1ZA 3CGOA 5A4QA 2XK6A 4IC8A 4CTCA 2IZTA 3QHRA 4O7RA 3LCKA 3MN3A 5JSMA 1GJOA 3GB2A 1FBNA 4O82A 5TOZA 4A9SA 2RFNA 4EZ5A 2B0QA 4FL3A 5FEQA 4BBEA 2B54A 3A4OX 3UO5A 4FKIA 5CF5A 4WG3A 3R7YA 3UDSA 3MPAA 4CLJA 3QF9A 4ZLZA 2XP2A 4OUCA 2YHVA 3PPJA 4Q5HA 4EQMA 3FZ1A 3EHAA 4EZ7A 3O0GA 4S2ZA 3EJ1A 2QO2A 5HNGA 3TI1A 2VGOA 1FGKA 3ZSIA 4CMUA 2LGCA 5HU3A 1UNGA 3ZRKA 4AZTA 3R02A 4RWJA 4U43A 1BMKA 4JDIA 4M68A 4AAYA 2XIYA 5HCXA 4KKGA 3U54A 2ZDUA 2F57A 3D14A 1KV2A 3NCGA 4W4YA 2C5YA 3CR0A 4FRFA 4WIHA 3IGGA 2CKEA 3RJCA 4C02A 2IN6A 4DDIA 4AQCA 3BL9A 4S30A 3JR1A 2ZVAA 4H3PA 3RBWA 3CCNA 3WF6A 4BGQA 5HG7A 2WTIA 3GU4A 1YOMA 4EUTA 4TTHB 4LL5A 4UMUA 4AU8A 1OUKA 3QXOA 5A14A 2WMXA 2OXYA 4Q9ZA 1PXKA 4IH8A 3WARA 4HNIA 1REJA 4A9UA 3RI1A 2A98A 4MK0A 5AP2A 1KE9A 1FMOE 3V6SA 5HE2A 3ZLXA 4FG9A 4O4FA 4G5JA 4RVKA 3ITZA 4B7TA 5BPYA 5J79A 2OKRA 2A19B 2G1TA 2WOTA 2YM5A 4HYSA 4WUAA 3GQLA 3KRXA 4L6QA 4UZDA 3C4CA 3E8EA 4UN0C 4ZS0A 5DGZA 3EQBA 5FXSA 3VNTA 4P7EA 4PY1A 3WF5A 2QOCA 4DN5A 4DF3A 1JKTA 5CT0A 3MVMA 3AC3A 4S33A 3HRBA 1KE7A 4F9BA 4CFNA 2GU8A 3KXXA 2P33A 5EW9A 5ITAA 5LWNA 3P79A 5I9VA 3ATTA 4NM7A 4BYIA 5DHJA 3KN6A 2PMNX 1WVWA 4DH1A 3DKCA 1K3AA 4L00A 4MKCA 3FWQA 4QYHA 1MQ4A 1YDRE 4FSTA 4FSYA 4JS8A 5EKNA 5FXRA 4F70A 2XNEA 4OTHA 3CQUA 2J2IB 2WXVA 4EH7A 4GKHA 4D2SA 2ESMA 4W9WA 2HYYA 4DFYA 5I9YA 4CV9A 1Y6AA 3VWAA 4IEBA 5HVJA 3AGMA 1J3HA 2YLFA 4JI9A 3JVRA 1SMHA 2UZOA 5E8ZA 1RQQA 5HD7A 4HW7A 5HESA 1SNUA 1XBBA 4YSMA 5AP5A 5L6OA 2NNWB 2G2IA 4RBLA 2C4GA 2OW3A 4GEOA 5CAQA 3UVRA 4OT6A 3CSVA 4FV2A 1PXOA 5EH0A 3R1NA 2REIA 5J5TA 4D0XA 3KC3A 3ZO3A 3FY0A 1X8BA 2J6MA 3LFQA 3OZ6A 3SD0A 5JRQA 3FKOA 1NW1A 2X4ZA 5IDNA 3ZOSA 4DTKA 3A8XA 1ZWSA 3DFCB 4JXFA 3ORXA 2CHLA 4U42A 3LLTA 3GNIB 3BX5A 5AR2A 3R9OA 4YPDA 4PDYA 2NP8A 3D5XA 2BFYA 3DAKA 2XIRA 1RJBA 4J98A 2Q83A 1PXJA 4F0IA 5IZFA 3IKAA 3V5WA 4U5JA 4TN6A 4WG5A 4JAIA 4DGOA 2BDJA 2VU3A 3HEGA 2OWBA 3PY1A 4RIWB 2UW7A 4DHFA 1YXVA 5HLWA 3VHKA 3FMLA 4BN1A 3DKGA 4BCGA 4O7LA 3DBFA 3PFQA 3R7EA 2IW8A 2BUJA 1E1VA 4XRLA 4U80A 1V0PA 3BV2A 4HJOA 5CU3A 4JOAA 3PSCA 4MXAA 4EOKA 2NRUA 4NM5A 4O1OA 1OL1A 4IX5A 2YM4A 2E9PA 3ZDUA 5LARA 5AP7A 4YTHA 3WZEA 4E3CA 5F9EA 2C68A 2G01A 2UW0A 2XARA 1BL6A 1W2FA 3G15A 3FI2A 2OJGA 1XBAA 2P55A 4ALVA 1FGIA 2R3QA 4IZ5A 3CD8A 2CLXA 3LHJA 4QP2A 4FTKA 3PWDA 4WKQA 2BZKB 4FZDB 4RJ6A 3HP5A 1V0BA 5EM7A 5KE0A 3AKLA 4DFUA 3DLZA 4RQKA 1UKHA 4XOZA 1XH4A 1J1CA 4TKSA 3KKVA 3D2KA 3F3ZA 4YJTA 3ZLYA 2PUIA 5LJJA 2IZSA 4EOMA 3LM5A 4FTTA 4NYEA 2YWPA 3BHUA 3FLSA 5ETAA 4CZYB 1SVHA 5KNJA 2YCRA 3BE2A 1KUTA 2J7TA 4OTRA 2VRXA 3BYUA 3TIZA 4CQEA 2QHNA 2X8IA 3FMDA 4C62A 2XB7A 1ZLTA 2XM9A 2C6LA 3FV8A 3QWJA 3R28A 2FVDA 3AQVA 3W32A 2BALA 4IAZA 2BZJA 2WMSA 5EDQA 4JDHA 2XKEA 4ZTLA 3OF0A 3PG3A 4AN9A 5LMKA 2PVFA 4BDCA 3R2YA 1PXLA 4ZY5A 3UNZA 4EUUA 2IVUA 3TTJA 5M4FA 4FMQA 3B2WA 4FV0A 4G3DA 3MSSA 4X6RA 4CKIA 2JBOA 3AC4A 5IQFA 3FQHA 4IX4A 3KIOC 3P7AA 4U40A 3EH9A 2J0IA 4IX3A 3ET7A 3ODYX 3BWFA 4RQVA 2J4ZA 4G17A 4IB1A 4IZYA 2BHEA 5DFPA 3DNDA 4Z7HA 4O84A 5FM3A 2Z60A 3ZBFA 3FL4A 4RIXA 3FLZA 3NX8A 5A9UA 4O96A 3V5TA 2XKFA 2VTRA 4U97A 4DH5A 4L42A 4RZVA 3HMOA 1GNGA 5EOLA 3RCDA 4B4LA 4II5A 3PXQA 3SX9A 5K4IA 1JSTA 5E1EA 5JQ8A 4B8LA 1CSNA 1HCKA 1U4DA 4CEGA 3IPHA 2RG5A 3LIJA 3AGLA 3F2AA 3BGPA 3RTPA 3FJQE 5C8KA 4N57A 3DK6A 3H3CA 3FL5A 4EK8A 5AEPA 3AMBA 2JIIA 5CEIA 4QQTA 5A4LA 3II5A 4K1BA 3UG2A 3WZJA 4B99A 3FHIA 5HG5A 3JUHA 4HVGA 4UWYA 2DS1A 3BV3A 4K33A 4BB4A 3RPVA 3NWWA 2OH0E 2BFXA 2Z8CA 3UC4A 5GZ8A 3QC4A 4WA9A 3ZLWA 3Q4UA 3DZQA 2F7EE 3PRFA 3BYSA 4HCUA 5JZJA 1UU3A 2ZMCA 4FZ6A 3LKMA 4GKIA 3PA5A 1UU7A 3R7GA 3ZO2A 1GZNA 4AS0A 2GNFA 4BDDA 4AFJA 1LEWA 1SNXA 2C1BA 4YTFA 4LV7A 3ZU7A 3C0HA 2PVNA 4F6UA 5AA9A 4GJ3A 3FEGA 4LDTA 1H1WA 4AZEA 3WZKA 2HENA 4FTOA 1DAYA 5TF9A 3H9OA 3Q9XA 5CQUA 3PIXA 3FMJA 4YMJA 1KSWA 2BMCA 2WMTA 4DHIB 3A7FA 1BYGA 1M2PA 3NUSA 3QYWA 4FKOA 4O0RA 2X8DA 4WSYA 5CVHA 1SVGA 3LXNA 2WOUA 4DLIA 1OKYA 3D15A 3GP0A 2WMQA 2RFDA 2Z02A 4KBKA 2PVKA 4U6RA 1M7NA 4FTIA 5HE1A 3MH1A 4E26A 2J9MA 5EHLA 1XJDA 4L44A 4AW0A 3UDTA 3UQGA 4BDKA 3QCYA 3HECA 4BZOA 3FI3A 2R0IA 4CG9A 1P4FA 2YIYA 2H6DA 3DBQA 5AAEA 3S0OA 4KS7A 4EHZA 3PIZA 4P5ZA 5IDPA 1VJYA 1XBCA 3LFAA 1J7LA 3L9LA 3PJ8A 1JPAA 1JQHA 4B0GA 3PPKA 4G34A 2XRWA 3OY3A 4XG3A 1OBGA 4TYGA 4CD0A 2WKMA 2XS0A 3F7WA 4ZZOA 4IM0A 3NUYA 4I23A 2P2HA 2Q0BA 3EKNA 3FXXA 4IADA 4PF4A 2QG7A 4YPSA 4DG3E 3LCOA 4NT4A 4U3YA 5HIDA 2GNHA 3BLQA 3HVCA 3ZHPC 2ZM3A 1XH8A 3ZC6A 3BLAA 4JRNA 4OAUC 5AAGA 3SA0A 4OBOA 2C5VA 4GRBA 3BPRA 3JPVA 5IQEA 5M57A 4CQGA 2BRHA 2BR1A 2VWWA 3NAYA 4LV5A 5AR3A 2PL0A 4QP8A 3UDBA 3FE3A 3FY2A 3PUFC 4JLCA 1M14A 1WBNA 1YQJA 3C51A 3K2LA 4OTWA 5EW3A 4FV3A 3F3TA 4Y5HA 3UBDA 5HO7A 1W82A 3BKBA 2QU5A 3G0EA 5FDXA 2W1EA 4FTUA 2QODA 4KWPA 5J8IA 4E6CA 4IB5A 4JIAA 4EH3A 4RSSA 3SXRA 1CMKE 2ZB0A 3QQLA 3SAYA 3QTZA 3OHTA 4QPMA 3U4WA 4MF0A 4BCFA 2WEIA 4HZSA 2QOQA 2X0OA 3QKLA 4BHNA 4MHAA 3PDTA 4MUQA 1UNHA 1WBOA 3WIKA 4DHZA 4AGUA 4K11A 1YOJA 3UP2A 3FLYA 4QPSA 5FP5A 3KN5A 5CTPA 2YZLA 1R3CA 4GFGA 3WIGA 4HYIA 3SGCA 2XNNA 4QYGA 1S9IA 5GNKA 2O8YA 5LXMA 2OIBA 5M44A 4PDSA 5EI2A 4D2VA 1GIIA 2ITTA 4FKGA 4GT5A 4FUXA 4RX8A 4O27B 4U0IA 3R83A 1IEPA 5BX0A 4JRVA 3Q5ZA 5L8LA 3KVWA 4MH7A 4IWDA 3WILA 2C3KA 2OGVA 4IM3A 4W9XA 4C4IA 2EUFB 4LMUA 3GCVA 4RIYA 1VR2A 2QOHA 4FKWA 1JBPE 3VUTA 1ZARA 3OXTA 2XIZA 1SM2A 4JAJA 2YCSA 2WELA 4EOPA 4FIHA 4NK9A 4BZDA 3OCTA 4O7VA 2J0KA 2HOGA 3GU8A 1UU9A 3U9NA 4ACMA 4PNKA 5LQFA 1QPEA 2W4JA 2VTPA 3UQFA 2PMOX 4YUQA 4XG9A 4QMOA 3VW8A 5JRSA 4BDEA 2IPXA 1CTPE 1Q99A 3U8WA 2QVSE 5ETCA 4ORKA 3JS2A 4TW9A 1NVQA 4ZZMA 4E7WA 1BUHA 4WUNA 1W83A 4ZTSA 4U7ZA 1Q8WA 4FK6A 3WZUA 5EHYA 5KMLA 3ORKA 4LFIA 3MV5A 3DDQA 4BCOA 4OTFA 3LQ5A 4YR8A 4G6LA 4UMTA 3G6HA 2H8HA 3V8WA 3QQFA 4FF8A 4WRGA 2CCHA 3A99A 4LL0A 2BZHB 5BMMA 4BHZA 2UZVA 4BKZA 4C7TA 4X3FA 1TKIA 3DLSA 2QONA 5HO6A 4KIQA 1W98A 4GG5A 1QL6A 1SYKA 5DNRA 3OUKA 4FTLA 2PUPA 4A9TA 4YHTA 2JAVA 3RAKA 2VTIA 4MVFA 2Y4IC 2AEGA 4BDHA 4F9CA 3VRYA 5HKMA 4PMSA 4JQ7A 2BDWA 2EB3A 2JAMA 2IO6A 2R64A 2FB8A 5AA8A 4OBPA 1OL6A 1H0WA 5E8SA 5AAFA 1BI8A 5K4JA 1Z57A 3QCXA 3ACJA 3OROA 4IE9A 4USDA 1H1QA 5CI7A 4GS6A 1DI9A 4C0TA 2YJRA 3GU6A 1U46A 1M2RA 1R0EA 3NYOA 2PTKA 5F20A 4PRJA 3I7CA 4RJ3A 4AWIA 4ZS4A 2C3LA 4EOLA 1Q41A 5KMOA 4GFOA 4IXPA 3PJCA 4MEDA 5DH3A 1WVXA 1YWVA 5JQ5A 1PXPA 3WE8A 3QX2A 1TFFA 2C6MA 3R9NA 1GZOA 1RE8A 3FXWA 1Y57A 2PE2A 3R8MA 4F6WA 3R1QA 3BRBA 3QQHA 4BICA 2B9IA 3ANQA 4DCAA 4TNBA 4IVAA 2JKOA 3HV3A 2XJ2A 3HA6A 4CYJA 3GUBA 4QMYA 2JDTA 1H27A 4IWPA 5E8YA 1UKIA 3IW8A 4K8AA 2CKPA 3DBEA 4YZCA 3Q2JA 2SRCA 2C0TA 4HVHA 2YA9A 3ODZX 1W0XC 1B6CB 4HVDA 3BBTB 2VUWA 1JSVA 1UV5A 3L9MA 2Y4IB 4O38A 3A7GA 4KIKB 4HGLA 4QMNA 4DYMA 3NVKI 4CRLA 4NWMA 4ACCA 2V62A 3T8OA 3E88A 3TYKA 5ANJA 3QA0A 4RWLA 2UVZA 4R1YA 1GOLA 4JVGA 4EBVA 5GZ9A 1KWPA 4EL9A 2HW7A 2QHMA 4FL2A 4RMZA 5BVKA 3R1SA 3QQJA 5IA3A 2BILB 3BLRA 4GCJA 4R7BA 3LMHA 4NUSA 3TKHA 4IB0A 2W1IA 3R6XA 2QLQA 4X6QC 3V3VA 4YU2A 1ND4A 2NRYA 4RX5A 3QLFA 1Q8TA 5E1SA 4ANSA 5B2MA 1I44A 3MYGA 3OXIA 2YLEA 3QZGA 4IACA 4C4JA 3FQEA 4DEBA 3R7IA 2A1AB 5BUIA 1ZYDA 3PRIA 2W4KA 5AUWA 5AWMA 3PVUA 4QYEA 5L2IA 5CU6A 4S32A 3KK8A 3AT3A 3PP1A 2I1MA 1ZY4A 3IECA 3ZCLA 3NFFB 1H4LA 4O0YA 4D4YA 5L8JA 4M69B 2PSQA 2OIDA 5CSHA 1XH6A 3V5QA 3R8VA 3MPMA 4YBJA 5DT3A 3TACA 3UO4A 2YISA 4JIKA 4DEIA 5AV3A 4Y72A 4RJ4A 3HAMA 1URCA 3BHVA 4S34A 4IX6A 5HG8A 1YKRA 5IISA 4NCTC 4UZHA 4BTKA 4AE9A 2VO6A 3OOMA 4MNEB 3PXRA 3ULZA 3W2PA 2DWBA 2XMYA 2CSNA 2X6EA 2FA2A 4RX9A 4YJNA 4AN3A 3NEWA 4F9AA 3VW6A 3AKKA 4AQKA 1MUOA 4JQ8A 4OTGA 5HIBA 4AW5A 4ASXA 4J96A 5A4TA 2R3OA 4NKSA 3ROCA 4U3ZA 5D7AA 1U59A 4I1ZA 2J50A 5C8NA 4UWCA 3TM0A 4O0XA 2GCDA 3D5UA 3ZRMA 3O8PA 5L4QA 5KBQA 2R3PA 3BGZA 3CPBA 4RFMA 4XMOA 5H9BA 3TNIA 5AV4A 3TZMA 2XJ0A 3G5DA 2CNVA 3ORMA 3GC0A 4EI4A 4E6DA 5CLPA 4KSQA 4FR4A 1R39A 5IUIA 4O2ZA 1XH7A 3F5PA 4N6ZA 3OT8A 5BVNA 4FTMA 4P2KA 2R3RA 5CAVA 4YSJA 4C2VA 4D5HA 1KE8A 2CGXA 2UZNA 3VIDA 3EQFA 1BLXA 2VX3A 2YACA 4E5AX 4C4HA 3NW5A 3Q5IA 3MFSA 5IQDA 4MQ1A 4TYHB 2X0PA 1O9UA 5FWKK 2W4OA 1MQBA 1NXKA 4AGDA 4EOJA 2F2UA 4RRVA 2VTOA 2YDIA 4Z16A 5JH6A 2ONLA 5ETIA 1XH5A 2W06A 1PY5A 4CMOA 4IW0A 4X3JA 3VBYA 2B4SB 4ZJJA 5ACKA 4UMRA 2HELA 3O51A 5CVFA 3THBA 5AP0A 1XWSA 4QMPA 2XNOA 3I0OA 3Q4ZA 4O81A 1DAWA 3R73A 4PMTA 3FKNA 1JKLA 1VEBA 3NYXA 4PX6A 4BDIA 2OXXA 4O7ZA 2Y7JA 3QRIA 3Q9ZA 4FIEA 5HOAA 1KOBA 4BDAA 3EMGA 2GDOA 4P5QA 3CP9A 2IWIA 3L9NA 2UW8A 1VYWA 4JG6A 3RMFA 1YDTE 2XNPA 3W33A 4BDJA 4EKLA 5A46A 1J7UA 1Q62A 3RWPA 2GTNA 3W1FA 5EOBA 4DEGA 4TYEA 4XV3A 5IA4A 3O23A 4X2GA 4IHPA 4J8NA 1OKWA 1XH9A 5HQ0A 3HV4A 2JKQA 4RGJA 4GT4A 4FT5A 3R00A 3QD4A 1Q97A 2XA4A 2P4IA 1XR1A 5IEXA 3QD3A 2GTMA 2C6IA 2WNTA 2Z7SA 3OUNB 4NM0A 5C01A 2YEXA 2W5AA 1PKGA 5T3QA 3U51A 2RKUA 4I24A 4CGAA 3LZBA 1UVRA 3TTIA 5J1WA 1PMNA 1QPDA 2AC5A 5HICA 3HV5A 2OG8A 3KF7A 4IM2A 4LM5A 3POZA 3GC7A 4FI1A 4AACA 4BGGA 4C2WA 1E1XA 4RVLA 2WGJA 4JMQA 5IA0A 5DMZA 2YIQA 1Q3DA 3FC1X 3F66A 3SLSA 4G2FA 1OBDA 2VX1A 4OAVB 2C6DA 3NS9A 3QU0A 4GV1A 1Q4LA 4J8MA 3QZIA 2CDZA 3DB8A 4ZSGA 4NZWB 1ERKA 2X9EA 4A07A 2ZM1A 4DTBA 5JFVA 4L3JA 4J7BA 4BGHA 4HGSA 2OBJA 2C0IA 4RLLA 4WD5A 3QQGA 2QURA 3DPKA 1R1WA 3FZPA 3R71A 5CF6A 5J95A 5IEVA 3BEGA 3QRKA 5HNBA 3SRVA 3O8UA 4FIIA 2OK1A 4I3ZA 4TWPA 4IFGA 3Q4CA 4GYGA 3F61A 3GU5A 4LUDA 3BHHA 2OICA 5AR7A 3V51A 4C3RA 4EBWA 4CKRA 3UIBA 1OGUA 3PVWA 3Q60A 5AUVA 2PYWA 3FC2A 2WQMA 4N4SA 3UP7A 4C4EA 5E4HA 2IW9A 4Q9SA 3VUKA 4C35A 1M17A 3MH3A 3HLLA 4ITHA 2FYSA 2PWLA 1HCLA 1QMZA 3QRJA 2OXDA 4J71A 4AOTA 3FXZA 4E4NA 4Z7GA 3OW3A 3R63A 3E7VA 3PVBA 5HCYA 2UV2A 1FOTA 2H9VA 2WB8A 3KFAA 4RWIA 4Y73A 3MIAA 3ZRLA 3EFWA 5JMSA 3KXHA 1CM8A 4FNWA 3VF9A 5EYCA 3Q53A 3W0MA 3EN6A 3OTUA 2OFVA 2BTSA 4ZTHA 3GU7A 2EVAA 2YIRA 3CXWA 4FVQA 3D7ZA 2W17A 1OECA 4H3QA 5JGDA 3CBLA 4Z9LA 4K18A 5G6VA 4QDVA 5DT0A 4ZY4A 2O63A 3LFDA 4XOYA 4YC8A 1WBSA 3ETAA 5FBNC 2PK9A 3I6WA 5EFQA 3FLQA 2W96B 3KXZA 3RNYA 3EIDA 2R3HA 3QD0A 4YJSA 4FSNA 5CT7A 3R2BA 5DT4A 4AGCA 4AE6A 2R3FA 5M55A 2W5HA 2VWYA 3ORLA 4MBLA 3B2TA 4KB8A 4EONA 4F65A 5AR8A 4EC9A 2WAJA 3SOCA 2XVDA 3PJ2A 4YNEA 2CLQA 5LCJA 3R7OA 3DT1A 2OF2A 5IA1A 3PLAE 4FC0A 3DA6A 2RSVA 5CEQA 4CFUA 5CVGA 2E9OA 4F7JA 3O96A 5T68A 5AIKA 3IDBA 3MS9A 2P0CA 4W8DA 3P1AA 4DG2E 4QMWA 4ZZNA 4ERWA 1MP8A 4O4BB 1CKPA 3RAWA 4J95A 4QP3A 4U41A 4FOCA 3TL8A 5L2SA 5GIOE 2YAKA 1LPUA 1F5QA 2HWPA 2RIOA 3BGQA 2VO3A 2ZMDA 2WQEA 1OL2A 3VS5A 4D4RA 4USEA 3KULB 5IPJA 3LOKA 3ULIA 1IA8A 3EWHA 2NPQA 4HVIA 4O7SA 3CY3A 5CXZA 4ZTQA 2YJSA 5ANOA 3R8ZA 2WMUA 1H1RA 3JVSA 1OIUA 3MI9A 3OVVA 3QTIA 4KABA 4M3QA 1OL7A 2A4LA 1IR3A 2W1DA 3NNXA 3AMAA 3PY0A 3NYVA 5FG8A 5FRIA 5I9UA 4EH4A 2ITZA 1XHAA 2QOFA 3AT4A 4R3PA 5HTCA 4JT3A 3W2SA 3QTXA 3PVGA 2R3LA 2QQ7A 5AJQA 3BEAA 3FHRA 4A9YA 5KMNA 1H07A 2OO8X 4XBUA 1PMVA 4YHFA 4EYJA 3COMA 3OEZA 4U44A 2JC6A 4GL9A 4XYFA 3ZM4A 1IAJA 3W2QA 2BCJA 1T45A 4FKUA 4C61A 3M2WA 5AUTA 2O3PA 5IH6A 3A60A 5CSWA 4E4MA 4CKJA 4RT7A 5DA3A 3C7QA 3KCFA 1P2AA 2BRBA 3EYGA 4HGEA 4JJRA 3SW4A 1YI3A 5JGAA 3PG1A 4HVSA 5JN2A 3ORIA 3TDVA 1JLUE 4AG8A 2JKMA 4ZIMA 3KMMA 4KA3A 4LGHA 5IF1A 2GNGA 3F7ZA 3P7CA 2JFMA 3C4FA 5HGIA 5LVNA 4CT1A 4BTFA 3VHEA 3NUAA 5FBOA 3CKWA 4DGGA 3LFSA 4I22A 4F7NA 4V0GA 1ST0A 5CY3A 4ITIA 5BYZA 4E73A 3H10A 2JEDA 4ASDA 4AXAA 4FSMA 3EN7A 4DLJA 4EC8A 3W2OA 4DTAA 4TT7A 3U55A 2QNJA 2X6DA 2WTCA 3MDYA 3RGFA 1TZDA 4DH3A 1ZOGA 5KKRC 4XG6A 2XK3A 3EQHA 5AM6A 5A4EA 2VTLA 5JGBA 3UQCA 3VJNA 4I5CA 3NW6A 4BCHA 2WFYA 3BU6A 2UW4A 4WT6A 3IW5A 5DN3A 3WF7A 4UX9A 5EQEA 3HX4A 4D1XA 1UWJA 1CKIA 4IAFA 4ZSAA 4CRSA 5C4LA 3EFJA 4L67A 1B38A 4C4GA 3OTVA 4AFEA 4KBAA 3QLGA 4LOOA 4AXDA 2XALA 2C6OA 4FKTA 4M84A 3ZM9A 2OJIA 1J91A 4DT8A 5IA5A 4GK2A 5G1XA 4IVCA 2IG7A 3A7HA 2Y6OA 4DFZE 5CQWA 4JR3A 5L6PA 4FYOA 2X7FA 3QALE 3ZUTA 3W0PA 2YDKA 2WU6A 4FT3A 4H58A 3DB6A 3P78A 4LGDA 4YJVA 3M1SA 4FOBA 5FQDC 3CC6A 2F7XE 3PXFA 2Q0NA 5IKWA 2EWAA 4YZBA 4ASZA 3BBWA 3CD3A 2PMIA 3HYHA 2XEYA 3HV7A 4I21A 4PPBA 4XG7A 5AUXA 5HVYA 5M53A 2BTRA 4KIOA 5HIEA 5HD4A 4RPVA 2W05A 5ACBC 3UDZA 2ACXA 1YXXA 3M42A 4BR3A 5KKRB 1U5QA 3ORPA 5FDPA 1JVPP 3ELJA 5IU2A 3TZ9A 4FBXA 3Q6WA 4O2PA 3ZEWA 3PWYA 3AKJA 4H1MA 2ZFYA 4D28A 3ZBXA 5C4KA 3OBGA 3IQ7A 1H01A 5F95A 3MA3A 4BWKA 4EWQA 1YWRA 2XNGA 3LVPA 1QPCA 3AXWA 2PZPA 2YERA 2W1GA 1WBTA 2XKCA 5E7RA 5E8XA 3TMOA 4PQNA 4BZNA 4O7WA 4DBNA 3TZ7A 2VGPA 1IA9A 4QTBA 1K2PA 2W5BA 3E7OA 2JGZA 2PUUA 2ITVA 3R22A 4JX7A 3A2CA 3RKBA 1ZMVA 5KO1A 5BVDA 4QTEA 3H4JA 3DGKA 2E2BA 5BVEA 4AZFA 3NUNA 5DRBA 4O7YA 2I0VA 3GCSA 4RC3A 5CENA 4X2FA 2QOBA 2BRGA 2UZTA 2C5XA 2H34A 5CSVA 3P0MA 5KMJA 4JBVA 3ZUUA 2UZEA 3N4UA 2I0YA 4FEVA 4R5SA 2R0UA 3D2IA 4Y5QA 2AC3A 2VTSA 5L8KA 4MYGA 4QMUA 2W9ZB 2OZAB 1PMUA 2WU7A 3OFMA 4E8AA 4ACHA 3ML1A 2QC6A 2X0QA 5TT7A 1ZY5A 3OBJA 3PYYA 3R21A 2E9VA 3A4PA 4ZP5A 4G3GA 1OIRA 3RZFA 5D41A 2DYLA 4IDVA 5IH5A 2C6TA 4J53A 4EH5A 1YDSE 2ITPA 4CZTA 4BC6A 3IOPA 4RA5A 3WF8A 2W1FA 1OKVA 3EL8A 3ZZWA 1W8CA 2E9NA 5HX8A 1ZYCA 2XK4A 2QR7A 4Y46A 2ETRA 2WEVA 4R1VA 1U54A 1Q24A 1ZRZA 3MH0A 4I93A 2ITYA 2UZWE 5C26A 1AGWA 4I6FA 2O5KA 1XKKA 1VZOA 2PZRA 4AUAA 4BCIA 5JFWA 4XLIA 4GSBA 4UXQA 3Q3BA 3MVHA 3UZTA 4OTDA 4O83A 1GIHA 4GUBA 3REPA 3NUUA 2NO3A 4EH9A 2ZJWA 1YWNA 3L8SA 5EM6A 3RPRA 4Q2AA 4J99A 3DXNA 3E87A 2XBJA 5I9WA 3R8LA 4FE2A 1OZ1A 4IAIA 2W0JA 4OBQA 4UWBA 4Z3VA 3IO7A 3W0OA 3T3VA 2BROA 4R7HA 4F08A 3O7LD 3BQCA 3C0GA 2VWVA 4I5PA 4WBBB 3IW7A 3QBNA 4YJUA 2QOKA 4RVMA 4L8MA 3LFBA 5D1JA 3T9IA 3RPOA 1PRYA