4E4MA

Jak2 kinase (jh1 domain) in complex with compound 30
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
296
Chain Sequence
b'AFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Identification of Imidazo-Pyrrolopyridines as Novel and Potent JAK1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 296
sequence length 298
chains with identical sequence B, D, E
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e4mA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e4mA01
4ACMA 4FMQA 4MCVA 5ANKA 3D5VA 5E8YA 3QRJA 2X6EA 2YISA 3IOPA 1UU3A 1LEWA 3ZM4A 1QL6A 4DFBA 3IOKA 4FE2A 2JD5A 1E1VA 2XIYA 4B99A 5IZFA 2WQBA 5IQEA 4ITIA 1IASA 4JQEA 3AGMA 2NP8A 2VO0A 4MQ1A 2VD5A 1RW8A 3R8ZA 1V0BA 3ZLSA 1XH9A 2C6KA 5CSPA 3IG7A 1MRUA 4WNOA 5FBOA 1JKSA 4DC2A 3ZBXA 4DH7A 4L00A 3FZSA 3TUDA 3C0GA 3O8PA 4NCTA 3BBTB 4X6QC 5D7AA 3E87A 3PTGA 3MFSA 1ZAOA 3ZLYA 3PDTA 1SZMA 2W1CA 4MWIA 1IA8A 4RC4A 3OEZA 4PMTA 4RVTA 2X4ZA 3ZO2A 3DBEA 5J79A 1WBSA 1CMKE 3DAEA 4QYGA 4LYNA 5K4JA 2QG5A 3PWDA 1E9HA 4FKWA 3OY3A 1Y8YA 4CQEA 3ZFYA 1YHVA 3QZIA 4D5HA 4F09A 4RMZA 2PMNX 4YGAA 5AP2A 5DLSA 3RM6A 2F7XE 4BTKA 4BVUA 3U6JA 3UC3A 3AC4A 3I7CA 5EH0A 3DDQA 4FODA 2B1PA 5FTGA 2CKEA 3C4ZA 1O9UA 4YPSA 5HLWA 4XEYA 3UMXA 4XV9A 2R7BA 2VNYA 4YJTA 3VS7A 3MWUA 5IU2A 4RQKA 4B8LA 2VTOA 4ZXTA 4I24A 4JVGA 3HV5A 4FKQA 4G1WA 4UMQA 1H1RA 3KXZA 3EQGA 4LGHA 2BRBA 4Q5EA 3CY3A 3KRXA 2EB2A 4XCUA 2C6MA 4FVRA 4DG2E 3O51A 2YM7A 5FLFA 1MP8A 1ZOEA 2B9JA 2XNMA 4RIYA 3UJGA 5AUVA 2G2IA 2FSMX 4K18A 2YA9A 4IAFA 2YDIA 1W8CA 4MXXA 3ALOA 4DG3E 2R5TA 2ZB1A 1GY3A 3CCNA 2J50A 3MS9A 4TYHA 3HX4A 4XG4A 3NUAA 4ALWA 4Z7GA 3VAPA 4FK3A 4MF0A 4OTPA 4ENYA 4B7TA 5JFXA 5IEYA 2AC3A 1HOWA 5E92A 3RALA 4NW5A 5DA3A 4RJ3A 4YJRA 1ZZLA 3VO3A 1H01A 2YJRA 4R1VA 5CZIA 4FNXA 5EI2A 2ETRA 4DBNA 3IKAA 4II5A 4BWKA 2YZAA 5M53A 3SDJA 4AN3A 3A7JA 3EQPA 2FSTX 4OAUC 4USEA 3OEFX 4TYEA 5E4HA 1FPUA 3VS3A 4C58A 5BMMA 1OKWA 2OFUA 2WGJA 2HIWA 3TKUA 3AD4A 2J51A 2WQOA 4EQCA 2W4OA 5EYDA 1SVHA 4C34A 3JR1A 3MFRA 2P3GX 3VHEA 2B0QA 5EHYA 3KMWA 4FSZA 1Q3DA 2WZJA 2WTCA 4D1XA 4L9IA 5E8TA 1UV5A 3FZOA 2XNOA 4LUEA 4EUUA 3FI8A 4M13A 4Z9LA 5F20A 3LXKA 5ANIA 3ZYAA 2C5NA 5KBQA 4DEIA 1YI4A 4KSPA 1LP4A 5DH3A 2ZAZA 3O2MA 5EI8A 3W2RA 3ZLWA 4U97A 4BGHA 4A4OA 4F99A 4D2PA 4C3FA 1UNGA 3SA0A 2IVTA 3G15A 3NUYA 3KKVA 2JKQA 3WE8A 3ZSHA 3WZJA 4IW0A 2C69A 3CGOA 4GV1A 5CXHA 1UNHA 4EBVA 5H8EA 5H8BA 3ZRKA 4CVAA 3F3UA 1TQMA 2XA4A 4WA9A 5GHVA 1CKPA 3ORIA 3PG3A 5EFQA 4USFA 2WIHA 4A9SA 1PF8A 3EFJA 3ATSA 4GS6A 4G3FA 4AGWA 2BTRA 4FTCA 2W5BA 3CLYA 5HI2A 3UVPA 3G5DA 2DWBA 4M66A 2XBAA 3S1HA 1H0VA 3U54A 4AT4A 3LOKA 4YZBA 5CAUA 1W7HA 3H30A 3AC3A 4A07A 4H1JA 4BCHA 3QAME 5FTOA 4NIFA 3K54A 3QA0A 1UU8A 3OWPA 4Z7HA 5HX6A 4D2VA 3V5WA 5M44A 1QPDA 4RG0A 3UQGA 4ONAA 3I79A 1PJKA 5L8LA 3MVMA 4EQMA 3WZKA 5AP6A 3KRJA 3BYSA 3QBNA 3IDBA 1SVGA 3ORMA 4UXLA 4FOBA 3HRFA 4RIYB 2GHLA 3PP0A 4UEUA 2J9MA 3ELJA 2XNBA 2ITWA 4HYHA 2YLFA 4PTEA 4IAAA 2PZPA 1PKGA 2WTIA 2H34A 5AADA 2R7IA 4M7IA 2VAGA 3RHXA 3ULIA 4TYHB 3UOLA 4C33A 3F88A 4FVQA 3ZO1A 4NEUA 3OZ6A 4YO4A 2YDJA 3TZMA 4GFOA 3NS9A 5CZHA 4WBOA 5I9YA 4MXZA 3P7BA 1WVWA 2W5AA 1YHWA 3PRIA 5JGBA 3EKNA 3A4OX 4QPSA 3E8NA 4E5BA 3QTXA 2VTIA 3P08A 4QMSA 3NUUA 1ATPE 1GZKA 2E9OA 3PPZA 2QC6A 5KUPA 4E6QA 1OL2A 1A48A 2IZUA 4IZ5A 4I0RA 1J7IA 5EHOA 5FP6A 1H00A 3FQSA 2F7ZE 4G34A 4DEHA 1OBDA 1Q8ZA 2RSVA 4DFNA 4IZAA 5CEOA 5A4QA 2OIBA 3S00A 3KFAA 5D11A 3VJNA 3QYZA 5IUHA 3DK6A 5I9WA 2WU7A 1L3RE 3EWHA 3D9VA 4WUNA 3EQBA 3W18A 2C5YA 5HBHA 4UB7A 3C0IA 3EH9A 2QOKA 4QT1A 4ZZNA 3UQCA 4XG6A 2P2IA 3NNUA 3AC5A 1Q41A 5AP0A 2OJIA 3FHRA 5EYCA 5A3XA 5LVMA 1J1CA 5DT0A 5AR2A 1H08A 4ZTNA 5BNJA 4TY1A 3SLSA 4JL9A 1WBOA 4YZDA 5EYMA 2EXCX 2XNGA 3LFSA 4ALUA 5FRIA 4BKJA 4F65A 4QMMA 5AUTA 3UZTA 1QMZA 3UOKA 3ZM9A 4KIKA 2UW7A 2PVNA 3UBDA 2YDKA 4Y95A 5J1VA 2YABA 3QRKA 3HL7A 3ZZEA 4TYGA 4E4XA 4CKJA 3PG1A 4XG3A 3SAYA 4DE4A 2HELA 2OW3A 3FPMA 4IC8A 2HZ0A 2PVHA 4RZVA 5AR3A 4DITA 4L46A 3JVSA 4EH3A 3KN6A 3NNWA 3E5AA 4LV5A 1U5RA 3DNDA 3UTOA 2F2CB 5TE0A 3FLYA 4Y46A 2XM8A 3EN5A 3OUKA 5H8GA 3PSBA 2IW9A 4EH6A 3K2LA 3PUPA 2O2UA 4ZSJA 1XH7A 2XS0A 3A60A 3RAKA 2BIYA 2C1AA 1OL5A 3EZRA 3TJCA 3A7HA 1XR1A 4TWOA 3WIKA 1M7QA 1ZZ2A 3AMYA 3QRTA 4FTQA 4DAWA 2B4SB 4NIFB 3PVUA 5E7RA 5DHJA 3SW4A 2GS7A 2XK4A 4G3DA 3DTCA 2QODA 2FSOX 4KNBA 4YJOA 4LOPA 5IEVA 4C57A 3UO5A 4ZMFA 1PXLA 4DYMA 4BCKA 2OBJA 2ZDUA 4UMUA 2OH0E 3D2KA 4W8DA 3AOXA 2XYUA 4XX9A 5HG8A 5KMLA 4QMXA 4EOOA 4MEDA 2YJSA 3PZEA 2XIKA 4ZAUA 3MH1A 3WF8A 4MNEA 5L8JA 4QMQA 5BYZA 5CALA 4HVGA 3K5VA 3D4QA 2WHBA 3L8VA 4N6ZA 4AWIA 4W9WA 2HENA 1GIHA 4PDOA 3PIZA 3BCEA 4I5CA 4RIWA 4QYFA 4XG7A 3PWYA 1IAJA 2XIXA 3I0OA 4FSRA 2YCRA 3NVKI 1FMOE 3UIXA 4U41A 2ITVA 2OFVA 3VN9A 4CMTA 4FGBA 4FSNA 5AUXA 4DN5A 3SW7A 2CNVA 1Z57A 4FT3A 2H96A 4ZJIA 5FQDC 3NNXA 3GT8A 4NFMA 4ZSLA 2WMWA 3EQDA 4KSQA 3C4CA 4FL2A 2PZRA 2Z7SA 4PUZA 3OS3A 4EWHA 1WCCA 1JQHA 4HVDA 3K3IA 4TXCA 2FH9A 3KRWA 3HUBA 3OT8A 4UZDA 4YUQA 3HUCA 4I1ZA 4DCAA 3FMJA 3MN3A 5AM6A 2X39A 5IUGA 4O0YA 5K9IA 5EYKA 3BYMA 4RJ7A 4BICA 3A99A 3THBA 5AA9A 1YHSA 2QQ7A 5EKOA 5HIDA 4FEQA 3CEKA 1Q24A 4C4IA 3NW6A 4CV9A 3COMA 5CU0A 4C3RA 4WKQA 4L68A 1ERKA 2J7TA 4CV8A 2PUPA 5E9EA 3R8LA 3MY1A 1PXOA 4DFZE 4L3JA 4YTFA 4DGGA 5LVPA 2PWLA 2JDSA 3CD3A 1OPKA 4IB3A 2XBJA 4KIKB 3WI6A 3RK7A 4FTTA 4GCJA 2IPXA 3R7IA 1Q97A 4LQMA 4XNEA 3BE2A 3CPBA 4U3YA 1GZOA 3KF4A 4ANLA 3QTWA 3EQRA 4D4VA 3AT4A 3R9NA 3CJGA 4RJ6A 5IMEA 3PZHA 5HCZA 2R3NA 3C7QA 3IDPA 2C30A 3D7ZA 2B52A 3A7IA 4C4EA 4YNOA 3VUKA 2A2AA 2HWOA 3HECA 4NSTA 5CF4A 2WMQA 4C4HA 3OG7A 2JKMA 2HWPA 5HE2A 2J5EA 2IW8A 2PVJA 4UZHA 3TACA 2XB7A 1GAGA 4PL3A 3MV5A 5DRBA 4KUJA 2XUUA 3UPZA 2YIWA 4E6AA 4JIKA 1XBAA 2BRMA 4NWMA 3UNJA 2XCKA 1H28A 2C4GA 4H1MA 5JN2A 4AGUA 3DU8A 4PL4A 4FT7A 1PXPA 2IO6A 3BELA 4OUCA 2UZEA 4QMZA 3UGCA 5KCVA 3DKCA 4O27B 4U79A 3A2CA 4WSQA 3I1AA 3CQWA 2VX0A 2GNIA 4DFUA 3EN7A 1TQPA 2ITTA 3LXLA 4M84A 2PTKA 3CJFA 3D14A 4QP1A 4XHKB 4EK5A 4EONA 5KMOA 2PVMA 4O81A 3RM7A 3G33A 3QRIA 5EDQA 3ZONA 4MNEB 4AACA 1JSVA 3ODYX 4BGQA 3TNQB 3SXFA 2JBPA 4DH5A 5L2IA 5A4LA 3V04A 2VTRA 5AM7A 4GG7A 4IB5A 4TL0A 1SNXA 1STCE 2QCSA 3MIAA 2WMRA 2O3PA 4AN2A 2XNEA 2GNJA 2YERA 3E3BX 3MPAA 4RIWB 5J95A 3UVQA 2OO8X 4QP9A 4FF8A 4EOQA 5J87A 2UV2A 1G5SA 4F6WA 3RPRA 3PRFA 5FBNC 3DDPA 3QQFA 5TO8A 3UPXA 4MXOA 4DGOA 1PRYA 4A9UA 2GSFA 4RGJA 4U5JA 3NYNA 2B9IA 2V5QA 1WAKA 4I41A 4B0GA 4QP2A 3N4UA 3H10A 4HGTA 3CQEA 2OKRA 2F7EE 3BQCA 3SGCA 5DEWA 5C4KA 4I23A 4UX9A 3QU0A 4HVSA 4JLCA 4FV8A 3HGKA 5HG5A 2O64A 5CS6A 4BTMA 2KULA 4CG9A 3QLGA 4IM3A 5CQUA 1SVEA 4RWLA 5FDXA 3R7GA 4LRMA 5IDPA 2HAKA 3U8WA 4D28A 3QQJA 3SRVA 2BCJA 2IVUA 4AT5A 4DTAA 4BF2A 3MY5A 3NUPA 5F94A 2GTMA 3FE3A 3R0TA 3V51A 4DINA 1H1SA 3FI3A 3PFQA 3O50A 4U6RA 4Y72A 2GU8A 2X9FA 4YTHA 3ACJA 2H6DA 2WTDA 4TW9A 1NT2A 4J8NA 1WBVA 5CU2A 4EH9A 3DKGA 2ZJWA 2KTYA 4FKUA 3W10A 3R1QA 5DE2A 2CKQA 3RMFA 3R9OA 2GNFA 1LR4A 4ASZA 4FG7A 4GRBA 3MB7A 5EOLA 3NUXA 1OITA 5L6WL 3LFQA 1JVPP 3V5TA 4FIIA 3LMGA 1H1PA 4A9TA 4CZTA 1JOWB 4QTCA 4B8MA 3TCPA 3BU3A 3BGPA 4C36A 4UALA 1BLXA 4MKCA 3KVWA 4AOJA 1UA2A 1KE6A 2NO3A 4JBQA 5IA3A 2ZM4A 4WIHA 3RAIA 5A4TA 3T3VA 4CFNA 2YFXA 4F6SA 4ACDA 2V22A 1U4DA 5I9VA 3FDNA 5D1JA 5C03A 4A4XA 4BDAA 3UOJA 4BDDA 2JAMA 4AGDA 4CZUA 4CFVA 2PE0A 4M8TA 4PL5A 1UKHA 2OF2A 2JGZA 5KHXA 3FY2A 4JIAA 3KULB 3L8SA 4X2JA 4ZTRA 4I6QA 4KABA 4CXAA 3HEGA 3QQGA 2R3LA 3WF9A 5C26A 1WBWA 4B9DA 3OVVA 4QQTA 4IM2A 4XLIA 5IF1A 2XVDA 4ZTMA 1NY3A 3RWQA 3Q2JA 1WZYA 1WBPA 3QLFA 4ZTSA 5ICPA 4I21A 1OECA 4OR5A 5HOAA 4FKTA 3QCYA 1YRPA 2RFEA 3E8EA 1QPJA 3PVGA 2ETKA 5I3RA 5KKRB 3TDVA 2V62A 3L9NA 1OGUA 2CSNA 2JLDA 3LQ8A 3IQ7A 4HCVA 5AP3A 4NJDA 4AZSA 5HVJA 3LXNA 5JKGA 2XH5A 5T68A 4HZSA 3ETAA 1ZMVA 3MBLA 4EOMA 4EWQA 4F7NA 2ITOA 3F3TA 4FX3A 4NL0A 4QP8A 4I5PA 2CGWA 2FYSA 3MA6A 3D5UA 4DLJA 3FYJX 4D9UA 1FGIA 1ZYSA 2C3KA 2VTQA 4ZJVA 2C3JA 1TVOA 2BFXA 5CTPA 5C01A 3HMOA 3W55A 1YXXA 3FHIA 3AXWA 4EOKA 1GZNA 1OZ1A 1FBNA 5IA1A 3IW6A 4DT9A 3G6HA 4OTHA 5L6PA 3G9NA 3DLZA 3A8WA 3ZHPC 2HOGA 3GU8A 1WBNA 2C5VA 3ZO3A 5JFVA 1HCLA 2G2FA 3BX5A 4CLIA 4QMWA 4LGGA 1JWHA 4YLKA 2YAAA 2CMWA 2B9HA 2QONA 1XH4A 3AGLA 5FXSA 5I9UA 5IUIA 4XLVA 3K5UA 3DZQA 3GFEA 5EQYA 4UWBA 1PYXA 4C7TA 5HG7A 3SRVB 3H9OA 3QXPA 4ANMA 2XRUA 2R3FA 2QG7A 5CANA 3KCFA 2BDFA 2WO6A 4NKSA 1VEBA 4J53A 3C4EA 2OXYA 4EH4A 3COIA 4MX9A 3FV8A 4JQ8A 5J7HA 3ROYA 2XMYA 4P7EA 3ATTA 1PMUA 4AW2A 2X4FA 3HNGA 4IFCA 4L3PA 5E91A 4K11A 3L8PA 2Z7QA 5AV2A 5DR2A 2J6MA 4GUEA 1PXMA 2VWWA 3MH3A 4J1RA 1OUKA 3AC2A 2OJJA 4BKZA 5IQCA 2QO7A 5JZJA 3FLZA 4ITJA 2PPQA 1NA7A 2HW6A 4D5KA 1APME 2J0MB 4N57A 3RP9A 1J91A 3F5XA 1CM8A 2BDJA 3FLNC 2ZV2A 3E64A 4WNPA 5M4UA 1YXVA 3TEIA 1Q3WA 3R2BA 1VZOA 3R8MA 5JRQA 1BL7A 4G16A 4FKGA 4BYIA 4KAOA 5TOZA 5CAOA 3TI1A 5AR7A 4GW8A 4NYEA 3VRYA 1XO2B 3ORZA 1ZYDA 5HTBA 4EORA 3SVVA 3CTHA 5FXQA 5TR6A 4G6LA 4E3CA 5DPVA 3VW6A 2WELA 4FSTA 2QURA 3WZEA 1LEZA 2X1NA 4EHZA 4FIGA 2V7AA 4ZIMA 5HNBA 3VQHA 4AFJA 3FL4A 4KKHA 5BYYA 2UW3A 2O0UA 3R8PA 5DRDA 4FKRA 4EUTA 4DFLA 2PL0A 5G1XA 3V8SA 2EU9A 3WZUA 5AAFA 1PHKA 1KOAA 3WBLA 4U0IA 4ACCA 3QD3A 1K2PA 3Q4UA 1PXIA 4FV1A 4IIRA 3UO4A 1YWNA 2BR1A 3I6WA 4QMOA 2WMTA 4AZEA 4K33A 4QTEA 3F5GA 5D10A 3UG1A 2WTKC 2CN5A 2FB8A 3O71A 4OTDA 4OT6A 4EH7A 2UZLA 4O6EA 2YIYA 4CD0A 1YWRA 3HMMA 4AX8A 4FIHA 3LMIA 1IA9A 1GNGA 2A27A 2VWIA 4FK6A 4V04A 4PRJA 1S9IA 4OBQA 5JGDA 2GQSA 4XV2A 4P90A 5E8VA 4JOAA 4PY1A 2UZBA 3ALNA 3IK3A 3LJ2A 4RIXA 4FKJA 3S3IA 3VIDA 1KE7A 2YHVA 3FZRA 3JVRA 1KE9A 1R0EA 4WG3A 5HESA 4DFXE 5GIOE 4ASXA 3RAWA 3ZFXA 4GUBA 3Q9YA 1DI8A 4M0ZA 3F3WA 1M52A 3BYVA 4H36A 4JBOA 4AGCA 3VUHA 4N4SA 3ZZWA 3ORLA 5J1WA 4FIFA 1AGWA 4G6NA 4XG2A 5EW3A 1PMNA 1PY5A 2R3PA 2XRWA 2Y6OA 4XP2A 3AD6A 4NW6A 3R21A 2Z02A 3TZ7A 1GIIA 3OW3A 2AUHA 5HNGA 3AD5A 2X8IA 4A9YA 2CCHA 5BVNA 2CNQA 3TUBA 3QCQA 3OCGA 4X6RA 3FKLA 5ETIA 3VS6A 4ARKA 1XBCA 4Y73A 5FTQA 3LFAA 5L2SA 4XRLA 4WO5A 4QTBA 3MH2A 4GK4A 2QOBA 4ZLYA 4PWNA 4MAOA 1UVRA 4CCBA 4E4MA 3MESA 4GFGA 2WTVA 4LOOA 5BVKA 3DPKA 5IMXA 4E4LA 3GQIA 3D5XA 3TV6A 4W8EA 4C62A 5KBRA 2BZKB 4S34A 1OIRA 1MUOA 4M68A 5HLPA 3O8TA 5IA5A 4WG4A 1BYGA 4FL1A 1LUFA 3F82A 4JDIA 4ZMEA 3RGFA 4I20A 2X2KA 4UMPA 4R5SA 5M09A 1CDKA 4F08A 3ZDUA 2Q0NA 5E8XA 2GCDA 2OXXA 4S31A 5I9ZA 3BKBA 4EOJA 1YXUA 3TG1A 4JDJA 2ITUA 5ITAA 2W17A 4YJSA 4QMLA 4X21A 3QC4A 4L53A 3HMPA 4XV1A 1OM1A 4BCFA 2GNGA 3VF8A 1E1XA 4OTIA 4S33A 4ANBA 5KHWA 3R7VA 2IWIA 5CI6A 5IQIA 3IW5A 4O0RA 1QPEA 2GQGA 2PUNA 2XCHA 4G5JA 3ET7A 1SNUA 1UWJA 2XK8A 4I4EA 1MRYA 3DQWA 4FT9A 1NVRA 3NAXA 3H9FA 3ZFMA 2FGIA 4BC6A 2BVAA 3Q04A 2R0UA 1H27A 4BZOA 2BAKA 1JKLA 3GU6A 3HMNA 4IAIA 5CX9A 3SD0A 5IH5A 2YIRA 4EKKA 4ZTLA 3U55A 1PXNA 1NXKA 4BDKA 3HAMA 3R04A 4C4GA 4C35A 3CSVA 3LFCA 2W96B 4F0IA 3RCDA 4IB0A 1XHAA 3CXWA 4F9WA 4FKPA 1YI6A 3QTZA 3ITZA 4U80A 2CKPA 3UIUA 2YM6A 2WMVA 4J7BA 4O86A 4ZSEA 4AZTA 2XKFA 1XBBA 5F4NA 5M56A 3BGQA 5IA2A 2QOIA 3M42A 3GXLA 2UZNA 1IRKA 2YM5A 3Q9WA 2CGUA 3I60A 3VS1A 4F1TA 3SOCA 1CKJA 3GCQA 3GGFA 4D2TA 3KA0A 3HZTA 4FTNA 3REPA 4QPMA 3LXPA 1O6LA 4ZZMA 2XK7A 4A7CA 1ND4A 4RIXB 3QALE 5EW9A 2YWVA 3QD0A 1J7UA 4CRLA 4YC6A 2ITXA 4KD1A 4MXAA 2XK6A 3KXXA 2CCIA 5B2KA 3QZGA 1XKKA 3FC2A 3KL8A 4KKGA 4K77A 1DAYA 3RTPA 3V5QA 3ZEWA 2VGOA 2W1ZA 4S2ZA 2JIVA 5CU6A 3VUIA 2V55A 5HIBA 3F61A 2R3HA 5DG5A 4NM3A 4F7SA 5DEYA 4BCIA 3VBQA 3DFAA 3E63A 4FTKA 4A9RA 1OL1A 3U6HA 2J0JA 3BPRA 4K8AA 2QKRA 1OVEA 4DH1A 4V0GA 3P23A 2YEXA 2OSCA 3PE1A 4RRVA 3MFUA 5M4FA 2B9FA 4O7SA 2YLEA 4O82A 4LM5A 4O0XA 3W2PA 1IEPA 4O91A 4GYIA 3QZFA 2BTSA 5IDNA 4YZNA 2QHMA 2YCQA 3CY2A 4PMSA 3MTLA 4ZOGA 1JNKA 4ZY6A 5JZNA 3DXPA 4WNMA 1BI7A 1R1WA 4QTAA 3PJ2A 5GNKA 4KA3A 3EYHA 1H4LA 4YJVA 4RA5A 4ZY4A 4AFEA 4RIOA 3HMIA 4LRJA 1XQZA 3BWFA 3RHKA 4QP7A 3R1NA 3A4PA 1T45A 4FV6A 3NYOA 4HYIA 4ERWA 5AA8A 4HVIA 2QOFA 3QD2B 4QP4A 3V8WA 4RX9A 3QQLA 4MH7A 4U9AA 4TZRA 4FTMA 4DGMA 4FNWA 1KOBA 2WEVA 3LM5A 1IR3A 3OTVA 3CD8A 4QO9A 4F6UA 4O1OA 3LFDA 4FVPA 4R7HA 5AUWA 2GS2A 1PKDA 5DNRA 4O7NA 5DN3A 3WIGA 5A4EA 5DT4A 5JH6A 1Q8TA 2P33A 4NTSA 5L2TA 3NCZA 5DMZA 4GK2A 3BV2A 2X7OA 3ZH8A 3SG9A 3OBGA 4DEGA 3LPBA 3VQUA 3TNPC 2W1GA 3QTRA 3DOGA 2XZSA 5T6KA 2GQRA 3OXZA 4BN1A 1A9UA 2YAKA 3Q60A 4OTWA 4TWCA 3NW5A 2UW5A 4G17A 5AP5A 4C02A 2ZDTA 3U87A 2J2IB 2P55A 2QO9A 3TWJA 4EKLA 4IX6A 2BILB 3BYOA 2JITA 3LKMA 1OI9A 2VTSA 5C9CA 4HGSA 4O1PA 3WE4A 4ENXA 3TDWA 2BALA 4L01A 4UXQA 5EKNA 3KN5A 4G9RA 5FDPA 5IEXA 5C8MA 3C1XA 4CT1A 4L52A 3BIZA 3OT3A 4U43A 5CVHA 4EYMA 3BWJA 1X8BA 5JQ8A 1BL6A 2P0CA 5FXRA 2O63A 3R71A 5KE0A 2PHKA 2VO7A 5JSMA 4O2PA 3TL8A 4BCOA 2C47A 2VWBA 3UYTA 4BHZA 3ORNA 3O0GA 2VX3A 4KINA 2G01A 4PV0A 1VYZA 1M14A 2R3QA 3KVXA 4PP7A 5BVFA 2VWVA 2V0DA 4EHVA 3RZFA 4R8QA 2C5OA 4AW0A 5IQFA 2CDZA 3DQXA 4U44A 4EHEA 2WAJA 4ORKA 3OXIA 4FC0A 5DWRA 4ACHA 3ZMMA 2B55A 3HV3A 2YCFA 3H9RA 5FEDA 4ERKA 4EBWA 2PU8A 5LWMA 4XBRA 4DTBA 2IJMA 1G8AA 1FVRA 3EQIA 4FBXA 3KRLA 1U54A 2C3LA 4V0GB 3EL8A 3VBWA 4EK3A 4BCJA 5HD4A 4B6LA 3I81A 3OW4A 2IN6A 2UZOA 4JG8A 5CLPA 3ORPA 3BLQA 3KMMA 4EK4A 2Z2WA 3ZCLA 4F7LA 3QGYA 2OZOA 3O96A 2VNWA 5EOBA 5HO8A 4BCGA 3TKIA 4E6DA 2Y0AA 5HBEA 5IQGA 3GU4A 4CTBA 4O0UA 4B4LA 4H3QA 1IG1A 2W7XA 2WPAA 3C0HA 4P4CA 4QPAA 5HZNA 3RPOA 1OKYA 3ENHA 1P4FA 3ORTA 5JFWA 5LJJA 5LQFA 2E9PA 3FBVA 3HLLA 4J8MA 3C5IA 5GINE 5FM2A 3N9XA 4C4JA 1UKIA 2R3KA 4D4RA 2J0IA 3DJ6A 2E9NA 3DLSA 3F6XA 3DKOA 3PJ3A 1KUTA 3L9PA 3RK5A 3IGGA 1OBGA 3FQEA 4BDBA 4RA4A 2O8YA 2ZV9A 3RPYA 2ERZE 4FNZA 4QNAA 5ANOA 4ZLZA 4FOCA 4WRSA 2VTTA 5CENA 5LMBA 2DQ7X 2OGVA 1BX6A 4MBLA 5H9BA 2G15A 3NX8A 3R63A 2VGPA 1AQ1A 3HV6A 4QQCA 4R3RA 4E1ZA 3VS2A 1UU7A 5BQ0A 5IA4A 5HE0A 4FSWA 2B7AA 5FP5A 1P2AA 4DGNA 4M3QA 3KMUA 3P7AA 5HD7A 2QU5A 3V8TA 3V5PA 5I3OA 1UNLA 5HCYA 1KV1A 2X2MA 5AR8A 5HBJA 3Q3BA 4O7TA 3F3ZA 4IADA 3CGFA 4V05A 3FJQE 3SHEA 5DIAA 5BVWA 3F5PA 2PVKA 4GT3A 2R3MA 3EOCA 4EEVA 4F9AA 4DGLC 2VU3A 1OB3A 4ZSAA 3DZOA 3VW8A 2GMXA 4IFGA 2BKZA 3EYGA 1QPCA 2EXEA 3D7TA 3VUDA 2ZM1A 4G5PA 5FD2A 1MQ4A 4DT8A 2R3IA 4IDTA 4V01A 2WQEA 5AP1A 5DOSA 1TQIA 2YITA 3OWJA 1I09A 3BU5A 3EKKA 3V01A 4BIEA 4KS8A 4D55A 4IAYA 2JIIA 3R9DA 4F9CA 5AR4A 3UODA 2QKWB 1FVVA 2VTJA 2WD1A 4D4SA 3LW0A 5ETAA 4FEWA 1JBPE 5AWMA 2ZMCA 3C4XA 3TUCA 2VTMA 5LMKC 2Q0BA 5A46A 4CKIA 3OXTA 3QKMA 3DK7A 3LE6A 4EC9A 1M7NA 4IWPA 3TJDA 3VBVA 4BI1A 5LXMA 4KS7A 1RJBA 2I6LA 3NEWA 5FM3A 5HU9A 3FSFA 2PZYA 4BR3A 3PP1A 3QTIA 3FEGA 2EWAA 2BHEA 1W0XC 1BKXA 2ITQA 4X3FC 3Q53A 2R9SA 4YHFA 4G3CA 3T8OA 2BDWA 1Q8WA 3P9JA 4I4FA 1U54B 4H3BA 1WVXA 2PULA 5CEMA 5LOHA 1ZOGA 3M11A 5CU3A 1W84A 4ZK5A 3AC8A 1Q8YA 3FZ1A 1U5QA 2SRCA 2QOLA 3GC0A 3ZU7A 2W4JA 3KULA 1CTPE 3OOGA 5DI1A 3W8QA 1FOTA 4O0WA 4IEBA 4DH8A 4FV3A 4IZ7A 5LCKA 4F0GA 4QD6A 3HP2A 3OWKA 3BHUA 3EZVA 2GTNA 4K1BA 4XMOA 5K3YA 3NSZA 3IW4A 2JDVA 4NM7A 5A9UA 2OU7A 2JEDA 2ZMDA 2EUFB 2VZ6A 3JS2A 5HU3A 3PPJA 2R3RA 4HOKA 1Y91A 3E7OA 3E62A 4IZYA 3VF9A 3DXNA 3R9RA 2R0IA 4IACA 4LUDA 3KF7A 4BBMA 2X81A 2YACA 4D2RA 3PVWA 4IJ9A 2G9XA 3NUSA 2YN8A 3PIXA 3T3UA 1Z9XA 2C3IB 2ETMA 2WMBA 5DGZA 3CP9A 4GYGA 4ZY5A 3G6GA 1U46A 1URCA 3LFFA 4YJUA 2QNJA 2W06A 1REKA 5E8ZA 2XNNA 2QLUA 2ONLA 3RVGA 4BRXA 4FYNA 4HW7A 4WNKA 3ZLXA 3JY9A 3DT1A 3DXQA 4HGEA 4M67A 4K6ZA 4AZFA 3FWQA 4QYEA 3BHHA 4FSYA 4J96A 4EOSA 3DK3A 3FLQA 3MPTA 3KCKA 1M17A 1I44A 4JBPA 4RPVA 3BGZA 4JI9A 4ZS0A 3I4BA 3TNWA 2REIA 5C8NA 5ETFA 4TYJA 4ZZOA 3IGOA 5CSWA 3D15A 3LFEA 1WFCA 4OBOA 4J95A 4MBIA 4OTQA 4DHFA 2R3JA 4IJPA 3EMGA 4FKVA 3FL5A 5G6VA 3KREA 4ZJJA 3KK9A 2IZRA 4BZNA 4IX5A 4CZYB 5M51A 3D7TB 5CWZA 1KWPA 2ITPA 3FZPA 4BDJA 4GIHA 3FXZA 3W33A 1SYKA 3MSSA 1YWVA 3NPCA 2RFNA 3KY2A 2IVVA 2RGPA 4FKSA 4IC7A 4LG4A 4W4YA 4XG8A 3EN6A 1OPJA 3DCVA 1P5EA 4PF4A 4WT6A 3ZS5A 4BL1A 3EB0A 4FV0A 4JBVA 1Y8GA 4QNYA 3VWAA 3LM0A 5KMIA 3P86A 4FR4A 4FEUA 2F57A 5GZ9A 1ZXEA 4I5MA 5HIEA 4H58A 2JDTA 4BIBA 1S9JA 3KQ7A 5JGAA 3NYXA 2XF0A 5KNJA 2YM4A 3SQQA 2VWZA 3CR0A 4LOQA 2P2HA 5CYIA 2ZYBA 3MIYA 4FL3A 3OF0A 3BHTA 3OY1A 4JAIA 4JX7A 2NNWB 1K9AA 1GZ8A 3KXHA 4HZRA 4C8BA 4A4LA 1YQJA 4CMUA 4I22A 2ZOQA 3UVRA 4AS0A 4Z55A 2VN9A 4I6FA 3BLRA 3GC7A 3TKHA 2XEZA 4KRDA 4BKYA 2ITZA 3KEXA 3F7WA 1YDRE 2C5XA 3QTSA 4IE9A 3U9CA 2RL5A 3G2FA 3HDMA 2A1AB 2PVLA 5BUIA 1W82A 5DFPA 1PXJA 3HDNA 5CNNA 5K0KA 2CNUA 5CEIA 1MRVA 4KB8A 3OFMA 4YC8A 4CNHA 2WQNA 4FUXA 5E8WA 4FG8A 5HVYA 3BU6A 4FZAB 2FUMA 2WMUA 4TYIA 2ZVAA 3ERKA 4FV9A 2PE2A 1BUHA 1FGKA 4GT5A 3VJOA 3V5JA 3FAAA 3MYGA 3Q5ZA 1OUYA 3BQRA 4GH2A 3BZ3A 2JKKA 4M69A 4C38A 4DH3A 4RX5A 3PA5A 5C1QB 2W99B 5HTIA 4IBMA 4UN0C 4FTAA 5H3QA 3VRZA 3LCTA 5J8IA 3ROCA 4IWOA 2E2BA 4CRSA 4CG8A 3G90X 2BMCA 3LFNA 3ZC5A 3OCBA 3QCXA 4XYFA 4DLIA 3PY0A 3CQUA 5CEKA 3R73A 2BAJA 1DI9A 3BI6A 4O21A 3NNVA 5K0XA 1JAMA 2QR8A 3GC9A 1YW2A 3QRUA 4D0XA 1P14A 5J7BA 5M55A 4G3EA 3QUPA 3E3PA 2I0YA 3PXFA 4PTGA 4APPA 5CAVA 3UC4A 3A62A 2CHLA 5M07A 3FYKX 2V7OA 4PPBA 1H0WA 4JS8A 4ANSA 5E1EA 1U59A 2IW6A 4C59A 2LGCA 4O7LA 3RJCA 3H0ZA 2C0IA 3VHKA 5CT7A 3Q4CA 2Y7JA 3ZRMA 3NMUF 2OJFE 3O7LB 4FI1A 4UMRA 3TN8A 3CC6A 3ZTXA 3MJ1A 4E73A 1NVQA 1F3MC 4E5WA 5CAQA 5CASA 1HCKA 1XH5A 4Q9SA 4UYNA 5CNOA 2UVXA 4JQ7A 3R7UA 1REJA 4F9YA 3MTFA 4YC3A 4TT7A 3QFVA 4E5AX 3P5KA 5BPYA 4O7RA 1W98A 1GJOA 1JPAA 1Q5KA 2ZV7A 3R1YA 4Z16A 4BBEA 5KMJA 4FIEA 3O7LD 2OH4A 4CFUA 5EQPA 4JT3A 3NZ0A 2XJ1A 5L2QA 2YZLA 1F0QA 4XOYA 4U7ZA 3QCSA 3TNHA 4CFWA 3TV7A 4YPDA 2FO0A 5FG8A 4U81A 4Y8DA 5IQAA 2UZDA 3GVUA 5ETCA 4H05A 3GBZA 2R3OA 3A7FA 3QC9A 4EZ7A 2E9VA 1YOJA 2WEIA 1SM2A 5AJQA 4ASEA 4DEBA 5D9HA 3QX2A 5J9LA 3OCTA 4O0TA 3QZHA 4AZWA 4EZ3A 2PVFA 4HNIA 4WSYA 3EFWA 4I6BA 5HGIA 5E90A 3LLAA 4RFYA 4TRLA 5KO1A 2OIDA 5HO6A 5EQEA 3VNTA 5TKDA 3TV4A 3MFTA 5GZ8A 5LARA 2Y4PA 4BDHA 4LI5A 2W1IA 4OLIA 3LCDA 2PK9A 2JDRA 2HZNA 2PSQA 4QQJA 4RFZA 4F64A 1H8FA 1RE8A 3IW7A 4AU8A 4AOIA 5IQHA 1KSWA 2NRUA 4LL0A 3VS0A 1Z5MA 4O22A 1DAWA 3Q52A 4X7QA 5D7VA 5FWKK 4NT4A 2OI4X 5ANGA 3T9TA 2PVRA 5K4IA 2Z8CA 3WOWA 2OF4A 4EJNA 3OWLA 2XYNA 2W5HA 4D58A 3Q32A 2CN8A 2R4BA 3P79A 2PMOX 4XOZA 1H1QA 4XS2A 4RC3A 5JRSA 4TN6A 4BDFA 4BCNA 1V0PA 3ZXZA 1M2QA 3V6SA 4M69B 2X8EA 4C2WA 1PYEA 2G2HA 2QOQA 3NAYA 4MD8E 5JFSA 1Q61A 3OHTA 4I0SA 5LMAA 3SXSA 1OIUA 5I0BA 3TZ8A 3QD4A 4EH8A 3WYYA 4X0MA 4L45A 3EN4A 2ESMA 2QLQA 4ZTHA 3LMHA 3EQHA 3PXQA 3Q2MA 4FGRA 1P4OA 3IONA 4D9TA 4ALVA 3O23A 4D2SA 2C1BA 4GJ3A 4IWDA 4FTOA 4O0SA 2FA2A 5CEQA 4YO6A 2DYLA 3GCVA 3W16A 4AZVA 4BWPA 2B53A 4FKLA 3UQFA 2CLQA 4AAAA 4GKIA 5HICA 5HQ0A 3B8RA 4NK9A 3M1SA 1CKIA 5CXZA 4C4FA 4YBJA 3F7ZA 4RBLA 5FEEA 5TF9A 5BUEA 4HYSA 3UP7A 5FEQA 4QMYA 4IVBA 2OICA 3Q4ZA 3R7OA 4EZ5A 5J9YA 3QA8A 5JQ5A 2Q83A 4TPTA 4AQCA 4FYOA 2DUVA 3HA8A 2I0EA 3HAVA 3AG9A 3T9IA 1JKTA 3NCGA 3ZSGA 1LPUA 3AQVA 2WKMA 2QR7A 4H3PA 2YIXA 3C51A 3OCSA 4L7SA 5L6OA 3OBJA 4FV2A 4E20A 4LRKA 3FLWA 2Y4IC 2UZTA 3DAKA 4RWKA 5AV0A 5T3QA 3GB2A 3Q4TA 3RBWA 4PMPA 5DYJA 4IAKA 4AA5A 3E7VA 4RWIA 4F4PA 3W8LA 4JG6A 1L8TA 4NFNA 4L44A 5AEPA 3ZC6A 5IA0A 4TWPA 4CMOA 2X6DA 2OLCA 4Y85A 3S4QA 5CVGA 5A6OA 3DBFA 3PYYA 4NZWB 4EK8A 2PY3A 1O6KA 3AMAA 3PJ1A 1SMHA 3R02A 1M2PA 5AIKA 2HXLA 3QQHA 2WIPA 4IH8A 4FNYA 2OXDA 3LCSA 5ACBC 3R8VA 4E93A 4FZFB 2W0JA 2J5FA 4ZLOA 4IX4A 3MW1A 3ORKA 4ANNA 4BDIA 2GNLA 1ZYJA 3GP0A 3QWJA 3GCSA 4IXPA 4BI0A 1NW1A 2HXQA 2BRGA 2IVSA 2R3GA 3B2TA 3POOA 3MDYA 1H07A 2C0OA 3FC1X 5KX8A 3QYWA 2C6IA 5CSXA 2UW6A 2UW4A 3ZO4A 3L8XA 4EOPA 2JKOA 3UYSA 4QOXA 3AMBA 4O2ZA 3DBCA 2BPMA 4GU6A 4BCPA 3BYUA 4NJ3A 3C5UA 3VBTA 2NRYA 3FXXA 3HP5A 4BCQA 2PZIA 4IWQA 4X2KA 5K5NA 1VJYA 3EL7A 4ZEGA 3QQUA 1CSNA 4ITHA 3EJ1A 4GL9A 4IHPA 2VRXA 3FI4A 4QMUA 2HK5A 3HYHA 3DAJA 4OTRA 4AA0A 3GNIB 1JLUE 4E7WA 3A8XA 3R28A 4O84A 4ASDA 3NUNA 4W4VA 3OD6X 4G2FA 4BTFA 3U6IA 2VTLA 3PIYA 1Q8UA 5EDRA 4IAZA 3TXOA 2X7GA 2HCKA 3N51A 3Q6UA 1ZYLA 1WMKA 2GHMA 3NIZA 4YZ9A 1WBTA 4JRVA 5HHWA 3TT0A 3W32A 4BGGA 4C3PA 5A6NA 4RVKA 3D5WA 4EI4A 3OTUA 2QD9A 2IG7A 5KZIA 1R0PA 2O65A 3QHWA 4KRCA 2XP2A 3DTWA 4Y5QA 4DFYA 5HNIX 4YMJA 4FTRA 2BIKB 4UWCA 3NIEA 2Y8OA 4G9CA 3JYAA 3JXWA 2I1MA 5AAEA 2YWPA 4PNIA 3WARA 3PJCA 4TWNA 4GFMA 3GCUA 3R2YA 4GIIA 3TIYA 2Y9QA 3DS6A 3MGYA 5EG3A 4FEXA 4F70A 1NVSA 4YBKA 3LCOA 2XEYA 4LMNA 2YIQA 3LHJA 2E9UA 1KV2A 5D12A 3BLHA 3SX9A 3LFBA 4EHGA 5DVRA 2PUIA 2XM9A 3SG8A 4KBKA 3RZBA 5J5TA 2QHNA 1ZY5A 3GEQA 3OC1A 4ZP5A 3TTIA 5IG1A 2EB3A 4NH1A 3FMEA 5KMNA 2PMIA 4X3JA 3OMVA 3LIJA 4MD7E 5AUYA 5AMNA 4W9XA 5B7VA 4O96A 4MD9E 5EM8A 1KE8A 1YOLA 2F9GA 2GFCA 3FMHA 2VTHA 5IPJA 5KMMA 5AP7A 4XH6A 3JPVA 3AT2A 3R9HA 4AN9A 2BKKA 4LL5A 5J9ZA 3MVJA 2A19B 4OW8A 2XKEA 4U3ZA 4L6QA 4PDPA 3MPMA 4GVJA 5CF5A 4E6CA 5M4CA 3S0OA 3QXOA 3KRRA 2ITNA 5JEBA 4L3LA 4O0VA 5M08A 1FINA 1B39A 2JFLA 3C13A 2ZV8A 4P5QA 1PW2A 3F2RA 4F1MA 4RC2A 1YXSA 4BYJA 3IO7A 3BE9A 3N4TA 4U40A 3ACKA 4MQ2A 1RQQA 3I6UA 4QMVA 4N6YA 2GFSA 4L67A 4C61A 5JT2A 1URWA 3VC4A 1R3CA 4HJOA 3GQLA 3QQKA 3F2NA 3MY0A 4QMPA 4QMNA 3DV3A 4F1OA 3LJ1A 2BFYA 2VO3A 3V5LA 3FXWA 3D2IA 5A54A 4XRJA 3II5A 5DBXA 3UIBA 5B2LA 4KIOA 3PLSA 2W1EA 1YDSE 3CPCA 3QL8A 3ZUVA 2PVYA 4IVAA 3DA6A 3NLBA 4NCTC 5B0XA 5LMKA 3LLTA 3UNZA 2PE1A 2J0KA 4R3PA 3U9NA 3U51A 3GU5A 2QOHA 5F9EA 4PDSA 5LVLA 2LAVA 5M06A 1GIJA 3NYVA 1BI8A 2PZ5A 3MJ2A 4OTFA 3FMMA 5GJDA 4E4NA 4O7VA 3RINA 1ZYCA 3CIKA 3ZEPA 2UZVA 5HCXA 3NVMB 3ANQA 3B2WA 4X3FA 5HG9A 4M97A 3OP5A 2P4IA 2CLXA 1AD5A 2BRNA 4BB4A 3GC8A 4G6OA 3ZDIA 4YJPA 3TNIA 2W9FB 3COKA 4GJ2A 2C6OA 3P4KA 4K0YA 5ANEA 1KE5A 3DKFA 2W1FA 3DB6A 4J98A 3ZRLA 3I0QA 4NU1A 2HW7A 1V1KA 4U42A 4FSUA 4CSVA 5E8SA 2JIUA 4OTGA 2WOUA 3UO6A 3D83A 4XUFA 4ZS4A 3PXYA 4MXYA 3M2WA 5AAGA 2GS6A 3CKWA 4L8MA 4J99A 3W2CA 2O5KA 3IS5A 3O8UA 4GSBA 3FMDA 1FMKA 1G3NA 3QKKA 1WVYA 4QP3A 4MWHA 4I6HA 4YHJA 4Q9ZA 5BVDA 5IISA 4EH5A 3JUHA 4YURA 2XNPA 3B8QA 1J3HA 1H1WA 2J4ZA 3LAUA 3UG2A 3WILA 3KGAA 4YJQA 4BIDA 4HPUE 4NM5A 3SXRA 2OJGA 4CKRA 5C27A 3VUGA 3MA3A 5EHLA 2H8HA 1OIQA 1R78A 2R2PA 5EM7A 4YTIA 2GNHA 2EXMA 1JSUA 4GT4A 2AYPA 2X7FA 4QYHA 4XJ0A 4EYJA 2WTWA 4GU9A 4YLLA 5A4CA 5HX8A 4TKSA 5IQBA 4DA5A 3DFCB 4O7ZA 2VTNA 3GU7A 4CFXA 4EH2A 3QUEA 4WD5A 5TT7A 5BVOA 3VBYA 1M2RA 3PY3A 4KKEA 4MF1A 3ID6C 3LCKA 4O6LA 5LVNA 4NTTA 3R30A 1XH6A 4DBXA 1ZRZA 3ZUTA 2C6TA 3N4VA 4RT7A 2QOCA 2VTAA 4W4XA 3HV4A 4E8AA 2X0GA 3CBLA 1R39A 3JY0A 4WG5A 4RJ8A 2QU6A 3FY0A 5EM5A 3P78A 5AIRA 2IZSA 4ZTQA 3W2SA 4YJNA 4R77A 3K3JA 3I5NA 3FPQA 3ZBFA 4AF3A 4GKHA 2XK9A 4WHZA 2VUWA 3S95A 4APCA 5KMKA 1Y6AA 1UWHA 3R00A 3DNEA 5AR5A 2W1DA 2OK1A 4C37A 4PX6A 4Q5HA 3PA3A 4FKOA 3PA4A 4FG9A 2XJ0A 4MNFA 4RZWA 5GZAA 3EHAA 3TIZA 3VVHA 2I0VA 4HYUA 3QHRA 3BRBA 1UU9A 4D0WA 3UP2A 4DEDA 4YTCA 4PPAA 4CCUA 2AC5A 3G0FA 4R6VA 3KXMA 5L3AA 4QMTA 3RCJA 3PXKA 2GHGA 4PDYA 1OPLA 4UV0A 2WQMA 3UIMA 4EK6A 3W2OA 2BUJA 1PMVA 5I5ZA 1PMEA 4IVDA 4D1SA 4X3FB 4AXAA 2W9ZB 3WYXA 4IVCA 4CQGA 2WNTA 4R78A 4XG9A 3BBWA 3QF9A 3GUBA 5GJFA 2UVYA 4S30A 5AUUA 1YDTE 3L9LA 2Y6MA 4P5ZA 4CTCA 2A0CX 1DM2A 4UYAA 5AFVA 5EM6A 4LFIA 5ANDA 3PPKA 5BX0A 3G0EA 3ULZA 4D1ZA 4CLJA 2UW0A 5L8KA 4PPCA 3FZTA 3FMLA 2QI8A 2VX1A 5HE3A 2C6DA 3P0MA 4HCUA 3RK9A 2B54A 3FI2A 1ZLTA 2I7QA 2UZUE 4I92A 2RFSA 5J5SA 4R5YA 4RLKA 3DJ7A 4RSSA 3DB8A 4EQUA 4R7BA 3V6RA 4USDA 4MTAA 4L7FA 1EH4A 4RVMA 3UMWA 4IDVA 1J1BA 4MHAA 4Y83A 3HRCA 4YNEA 3HVCA 2J0LA 4ZSGA 4FA2A 5FGKA 4BWXA 2CKOA 5C4LA 1ZY4A 2WOTA 1VR2A 1W83A 2XK3A 4KBAA 4ANQA 5AV4A 5GJGA 2BZHB 5CVFA 4OBPA 3EFKA 4OAVB 2XJ2A 4EJ7A 5BMSA 4OGRA 3VULA 4F7JA 2VTPA 4MXCA 4X2NA 4DCEA 3GENA 5HORA 4ANOA 2YCSA 4AUAA 1YVJA 1GOLA 3G51A 4FIJA 5HKMA 4AW5A 3PXZA 2XIRA 4GEOA 4MVFA 4AOTA 2F2UA 1ZWSA 4FICA 2RG6A 4YZCA 4I0TA 4BBFA 4C0TA 1IAHA 5IQDA 4RX8A 4RQVA 3UZPA 4UBAA 4F0FA 3PXRA 4KBCA 4KIQA 5AUZA 3BHVA 3MB6A 3R83A 3DBQA 4KWPA 4CEGA 4DEAA 1PXKA 4LV8A 3W2QA 4YHTA 3RNYA 5LVOA 1OKZA 3QGWA 2RKUA 3R8UA 4FT0A 2JAVA 3DBDA 1F5QA 4MYGA 3SOAA 3NRMA 2JFMA 3FKOA 3KXGA 5EDPA 2QOOA 3LZBA 4JG7A 5ACKA 2XIZA 4H39A 3EQCA 3W1FA 3KU2A 4CFMA 5CF8A 3NWWA 5EK7A 3GI3A 4BDCA 3L1SA 5CQWA 2UW8A 3FQHA 1H26A 4IQ6A 2VO6A 1YOMA 4GK3A 4AT3A 4XBUA 3G9LX 4QP6A 4FT5A 4EOLA 4FTJA 4R3CA 3RPVA 4NKAA 4KIPA 2OZAA 3Q5IA 4WBBB 3RNIA 3E8CA 3Q6WA 2UW9A 3F3VA 3ZUUA 4EOIA 5BUJA 3FMNA 3P7CA 5I4NA 3GFWA 4I93A 2BZIB 5B2MA 4ACGA 4G3GA 5E1SA 3Q9ZA 4O83A 3QWKA 4RVLA 2WB8A 5A14A 3CE3A 5CF6A 2BROA 4M0YA 1B6CB 5JK3A 4QTDA 4A06A 3FSKA 4I94A 4W4WA 5IH6A 3DJ5A 3NDMA 4N70A 3WF5A 1ZARA 4M14A 3ANRA 3RAHA 4DTKA 1XJDA 2UZWE 4FTLA 4F63A 4DF3A 4FV4A 2R64A 5E8UA 4AG8A 1YKRA 4EL9A 1DS5A 3A61A 4J71A 3DY7A 2WMAA 4UY9A 4YLJA 4IM0A 4BI2A 4S32A 3UOHA 3WZDA 4JNWA 5JMSA 4PP9A 3F66A 5CSHA 3KB7A 3EQFA 5BYLA 4NUSA 3CKXA 4D2WA 3BV3A 1JSTA 4BDGA 1XWSA 3ZSIA 1B38A 2J90A 3GOPA 5EW8A 2HY0A 3CS9A 3P1AA 3E93A 3QTQA 4Q2AA 4BCMA 4CYIA 1O6YA 3HRBA 2OWBA 3BHYA 3QX4A 4FV5A 5L2WA 4RX7A 4BTJA 5HE1A 2BAQA 3R22A 5CU4A 4YP8A 4TNBA 3I7BA 3R1SA 4P2KA 4FEVA 5ANJA 3ODZX 2C6EA 3WF6A 2UUEA 4DEEA 2IZTA 4JRNA 1Y57A 4QRCA 3PVBA 4O7YA 4WRGA 5I9XA 1Q62A 2DS1A 3POZA 4FZDB 3LQ5A 2Z60A 3D0EA 4JDKA 4YR8A 3C4WA 3KXNA 2BRHA 5CSVA 2CGXA 3SC1A 1G8SA 4E26A 3IDCA 5AV1A 5CAPA 1VYWA 4Z3VA 3E88A 3AT3A 3RPSA 5HO7A 3F2AA 1OL6A 4HCTA 2RIOA 3HKOA 3VS4A 5C8KA 5IH4A 3AC1A 4AE6A 2NPQA 5M57A 5AX3A 2VV9A 4FSQA 4U45A 4BDEA 2JBOA 4PMMA 3EN9A 3LVPA 3I5ZA 3OOMA 4CYJA 2OIQA 4R7IA 5KZ0A 3R7EA 4YSJA 3UNKA 3F69A 4EC8A 3D94A 5HEZA 3BEAA 3F9NA 4C2VA 3NR9A 5IKWA 3FKNA 4AE9A 5H2UA 3GCPA 4J52A 4RLLA 1A06A 5K5XA 3VUMA 4AA4A 2YM3A 3ORXA 2JDOA 3IECA 3O17A 4BFMA 2I0HA 2WMXA 4PTCA 3PE2A 1T46A 4MK0A 5AP4A 4IX3A 4YSMA 2W4KA 2A4LA 3CTQA 2X8DA 4FTIA 4HNFA 2WXVA 2OJ9A 3DGKA 3C50A 1OL7A 4JX3A 2OZAB 4L42A 3QUDA 2C6LA 2Z7LA 4XP3A 2ITYA 5HLNA 4Y5HA 4CGAA 4XP0A 1Y6BA 4FZ7A 4J97A 4QYYA 4HPTE 3RI1A 3MH0A 3MVLA 4I5HA 3FMKA 2FVDA 1FVTA 4JJRA 2ZM3A 1JKKA 4TNDA 2QO2A 4RWJA 4JDHA 2I40A 1V0OA 1ZMWA 2YM8A 2Z7RA 3KK8A 4LGDA 4D4YA 1ZOHA 4YZMA 3HV7A 3GOKA 4HVHA 2WMSA 4YU2A 5FUTA 3COHA 5D41A 5LWNA 3E92A 2H9VA 4GVAA 3TM0A 4FTUA 4NM0A 2VWYA 2CJMA 2C0TA 3ZXTA 3HA6A 3KC3A 4PNKA 2GPHA 3H0YA 4WOVA 4FSMA 2ACXA 5LCJA 4O7WA 5GIPE 5HVKA 2X2LA 2QVSE 3SV0A 5KKRC 4M12A 5DR9A 1OIYA 4F9BA 5DR6A 2GDOA 3R01A 3WF7A 3CTJA 3QTUA 2C68A 3S2PA 1J7LA 5AV3A 5EI6A 3H4JA 5HTCA 4ID7A 3PY1A 2WU6A 2PYWA 5L4QA 4UWYA 1OMWA 1K3AA 3LJ0A 3TTJA 3LQ3A 4OT5A 2WTKB 1Q4LA 4FKIA 4UMTA 5CY3A 3U4UA 2CPKE 3Q9XA 3ZOSA 2VWUA 4IB1A 4L43A 5BVEA 2ONLC 3R6XA 5M4IA 2CGVA 1XH8A 2F4JA 3V3VA 4AP7A 2OG8A 1MQBA 4BY9E 3VS5A 3NW7A 3Q96A 2G1TA 4G31A 1FQ1B 3H3CA 2RF9A 1H25A 4I3ZA 4IANA 1BMKA 3FUPA 4JR3A 4N0SA 4HGLA 4RJ5A 1YXTA 4R1YA 2W05A 3BEGA 3IPHA 2PUUA 1H24A 3RWPA 3OUNB 5F95A 2EVAA 2HYYA 3U4WA 5CEPA 4BZDA 2F49A 3C9WA 4M15A 4CFFA 2HZ4A 4QQ5A 2HY81 5F1ZA 4MBJA 4GG5A 3EIDA 2VWXA 4LMUA 3NGAA 4RFMA 3ENMA 4WUAA 2BHHA 3IW8A 4JAJA 1RDQE 4IMYA 2HZIA 5CI7A 4JR7A 2X9EA 4JXFA 3F5UA 5CT0A 3E8DA 4K2RA 3UE4A 2FSLX 4AW1A 2PMLX 2JC6A 3FLSA 3UZRA 2RFDA 4GMYA 3MVHA 2Y4IB 3SKCA 4TTHB 3R7YA 3VBXA 3A7GA 3MI9A 1QCFA 3QKLA 4PQNA 4K9YA 4X2FA 3PLAE 5DT3A 3OROA 4X2GA 4FUYA 4BHNA 3PJ8A 2BZJA 2WTJA 1OKVA 3EFLA 3VUTA 2RG5A 1Q99A 3PSDA 5AX9A 4CT2A 3RKBA 2W1HA 3PSCA 4U8ZA 3TZ9A 4RJ4A 3C4FA 2XKDA 4XV3A 4FZ6A 1TKIA 2WFYA 3L9MA 1YI3A 2ZB0A 4FV7A 1ZMUA 3UDBA 2XKCA 2ERKA 4DG0E 2UVZA 4O38A
chains in the Genus database with same CATH superfamily
4ACMA 4FMQA 4MCVA 5ANKA 3D5VA 5E8YA 3QRJA 2X6EA 2YISA 3IOPA 1UU3A 1LEWA 3ZM4A 1QL6A 4DFBA 3IOKA 4FE2A 2JD5A 1E1VA 2XIYA 4B99A 5IZFA 2WQBA 5IQEA 4ITIA 1IASA 4JQEA 3AGMA 2NP8A 2VO0A 4MQ1A 2VD5A 1RW8A 3R8ZA 1V0BA 3ZLSA 1XH9A 2C6KA 5CSPA 3IG7A 1MRUA 4WNOA 5FBOA 1JKSA 4DC2A 3ZBXA 4DH7A 4L00A 3FZSA 3TUDA 3C0GA 3O8PA 4NCTA 3BBTB 4X6QC 5D7AA 3E87A 3PTGA 3MFSA 1ZAOA 3ZLYA 3PDTA 3PFYA 1SZMA 2W1CA 4MWIA 1IA8A 4RC4A 3OEZA 4PMTA 4RVTA 2X4ZA 3ZO2A 3DBEA 5J79A 1WBSA 1CMKE 3DAEA 4QYGA 4LYNA 5K4JA 2QG5A 3PWDA 1E9HA 4FKWA 3OY3A 1Y8YA 4CQEA 3ZFYA 1YHVA 3QZIA 4D5HA 4F09A 4RMZA 2PMNX 4YGAA 5AP2A 5DLSA 3RM6A 2F7XE 4BTKA 4BVUA 3U6JA 3UC3A 3AC4A 3I7CA 5EH0A 3DDQA 4FODA 2B1PA 5FTGA 2CKEA 3C4ZA 1O9UA 4YPSA 5HLWA 4XEYA 3UMXA 4XV9A 2R7BA 2VNYA 4YJTA 4LV7A 3VS7A 3MWUA 5IU2A 4RQKA 4B8LA 2VTOA 4ZXTA 4I24A 4JVGA 3HV5A 4FKQA 4G1WA 4UMQA 1H1RA 3KXZA 3EQGA 1TZDA 2BRBA 4LGHA 3CY3A 4Q5EA 3KRXA 2EB2A 4XCUA 2C6MA 4FVRA 4DG2E 3O51A 2YM7A 5FLFA 1MP8A 1ZOEA 2B9JA 2XNMA 4RIYA 3UJGA 5AUVA 2G2IA 2FSMX 4K18A 2YA9A 4IAFA 2YDIA 1W8CA 4MXXA 3ALOA 4DG3E 2R5TA 2ZB1A 1GY3A 3CCNA 2J50A 3MS9A 4TYHA 3HX4A 4XG4A 3NUAA 4ALWA 4Z7GA 3VAPA 4FK3A 4MF0A 4OTPA 4ENYA 4B7TA 5JFXA 5IEYA 2AC3A 1HOWA 5E92A 3RALA 4NW5A 5DA3A 4RJ3A 4YJRA 1ZZLA 3VO3A 1H01A 2YJRA 4R1VA 5CZIA 4FNXA 5EI2A 2ETRA 4DBNA 3IKAA 4II5A 4BWKA 2YZAA 5M53A 3SDJA 4AN3A 3A7JA 3EQPA 2FSTX 4OAUC 4USEA 3OEFX 4TYEA 5E4HA 1FPUA 3VS3A 4C58A 5BMMA 1OKWA 2OFUA 2WGJA 2HIWA 3TKUA 3AD4A 2J51A 2WQOA 4EQCA 2W4OA 5EYDA 1SVHA 4C34A 3JR1A 3MFRA 2P3GX 3VHEA 2B0QA 5EHYA 3KMWA 4FSZA 1Q3DA 2WZJA 2WTCA 4D1XA 4L9IA 5E8TA 1UV5A 3FZOA 2XNOA 4LUEA 4EUUA 3FI8A 4M13A 4Z9LA 5F20A 3LXKA 5ANIA 3ZYAA 2C5NA 5KBQA 4DEIA 1YI4A 4KSPA 1LP4A 5DH3A 2ZAZA 3O2MA 5EI8A 3W2RA 3ZLWA 4U97A 4BGHA 4A4OA 4F99A 4D2PA 4AXFA 4C3FA 1UNGA 3SA0A 2IVTA 3G15A 3NUYA 3KKVA 2JKQA 3WE8A 3ZSHA 3WZJA 4IW0A 2C69A 3CGOA 4GV1A 5CXHA 1UNHA 4EBVA 5H8EA 5H8BA 3ZRKA 4CVAA 3F3UA 1TQMA 2XA4A 4WA9A 5GHVA 1CKPA 3ORIA 3PG3A 5EFQA 4USFA 2WIHA 4A9SA 1PF8A 3EFJA 3ATSA 4GS6A 4G3FA 4AGWA 2BTRA 4FTCA 2W5BA 3CLYA 5HI2A 2XALA 3UVPA 3G5DA 2DWBA 4M66A 2XBAA 3S1HA 1H0VA 3U54A 4AT4A 3LOKA 4YZBA 5CAUA 1W7HA 3H30A 3AC3A 4A07A 4H1JA 4BCHA 3QAME 5FTOA 4NIFA 3K54A 3QA0A 1UU8A 3OWPA 4Z7HA 5HX6A 4D2VA 3V5WA 5M44A 1QPDA 4RG0A 3UQGA 4ONAA 3I79A 1PJKA 5L8LA 3MVMA 4EQMA 3WZKA 5AP6A 3KRJA 3BYSA 3QBNA 3IDBA 1SVGA 3ORMA 4UXLA 4FOBA 3HRFA 4RIYB 2GHLA 3PP0A 4UEUA 2J9MA 3ELJA 2XNBA 2ITWA 4HYHA 2YLFA 4PTEA 4IAAA 2PZPA 1PKGA 2WTIA 2H34A 5AADA 2R7IA 4M7IA 2VAGA 3RHXA 3ULIA 4TYHB 3UOLA 4C33A 3F88A 4FVQA 3ZO1A 4NEUA 3OZ6A 4YO4A 2YDJA 3TZMA 4GFOA 3NS9A 5CZHA 4WBOA 5I9YA 4MXZA 3P7BA 1WVWA 2W5AA 1YHWA 3PRIA 5JGBA 3EKNA 3A4OX 4QPSA 3E8NA 4E5BA 3QTXA 2VTIA 3P08A 4QMSA 3NUUA 1ATPE 1GZKA 2XANA 2E9OA 3PPZA 2QC6A 5KUPA 4E6QA 1OL2A 1A48A 2IZUA 4IZ5A 4I0RA 1J7IA 5EHOA 5FP6A 1H00A 3FQSA 2F7ZE 4G34A 4DEHA 1OBDA 1Q8ZA 2RSVA 4DFNA 4IZAA 5CEOA 5A4QA 2OIBA 3S00A 3KFAA 5D11A 3VJNA 3QYZA 5IUHA 3DK6A 5I9WA 2WU7A 1L3RE 3EWHA 3D9VA 4WUNA 3EQBA 3W18A 2C5YA 5HBHA 4UB7A 3C0IA 3EH9A 2QOKA 4QT1A 4ZZNA 3UQCA 4XG6A 2P2IA 3NNUA 3AC5A 1Q41A 5AP0A 2OJIA 3FHRA 5EYCA 5A3XA 5LVMA 1J1CA 5DT0A 5AR2A 1H08A 4ZTNA 5BNJA 4TY1A 3SLSA 4JL9A 1WBOA 4YZDA 5EYMA 2EXCX 2XNGA 3LFSA 4ALUA 5FRIA 4BKJA 4F65A 4QMMA 5AUTA 3UZTA 1QMZA 3UOKA 3ZM9A 4KIKA 2UW7A 2PVNA 3UBDA 2YDKA 4Y95A 5J1VA 2YABA 3QRKA 3HL7A 3ZZEA 4TYGA 4E4XA 4CKJA 3PG1A 4O4FA 4XG3A 3SAYA 4DE4A 2HELA 2OW3A 3FPMA 4IC8A 2HZ0A 2PVHA 4RZVA 5AR3A 3W0PA 4DITA 4L46A 3JVSA 4EH3A 3KN6A 3NNWA 3E5AA 4LV5A 1U5RA 3DNDA 3UTOA 2F2CB 5TE0A 3FLYA 4Y46A 2XM8A 3EN5A 3OUKA 5H8GA 3PSBA 2IW9A 4EH6A 3K2LA 3PUPA 2O2UA 4ZSJA 4AXDA 1XH7A 2XS0A 3A60A 3RAKA 2BIYA 2C1AA 1OL5A 3EZRA 3TJCA 3A7HA 1XR1A 4TWOA 3WIKA 1M7QA 1ZZ2A 3AMYA 3QRTA 4FTQA 4DAWA 2B4SB 4NIFB 3PVUA 5E7RA 5DHJA 3SW4A 2GS7A 2XK4A 4G3DA 3DTCA 2QODA 2FSOX 4KNBA 4YJOA 4LOPA 3O5AA 5IEVA 4C57A 3UO5A 4ZMFA 1PXLA 4DYMA 4BCKA 2OBJA 2ZDUA 4UMUA 2OH0E 3D2KA 4W8DA 3AOXA 2XYUA 4XX9A 5HG8A 5KMLA 4QMXA 4EOOA 4MEDA 2YJSA 3PZEA 2XIKA 4ZAUA 3MH1A 3WF8A 4MNEA 5L8JA 4QMQA 5BYZA 5CALA 4HVGA 3K5VA 3D4QA 2WHBA 3L8VA 4N6ZA 4AWIA 4W9WA 2HENA 1GIHA 4PDOA 3PIZA 3BCEA 4I5CA 4RIWA 4QYFA 4XG7A 3PWYA 1IAJA 2XIXA 3I0OA 4FSRA 2YCRA 3NVKI 1FMOE 3UIXA 4U41A 2ITVA 2OFVA 3VN9A 4CMTA 4FGBA 4FSNA 5AUXA 4DN5A 3SW7A 2CNVA 1Z57A 4FT3A 2H96A 4ZJIA 5FQDC 3VONA 3NNXA 3GT8A 4NFMA 4ZSLA 2WMWA 3P5JC 3EQDA 4KSQA 3C4CA 4FL2A 2PZRA 2Z7SA 4PUZA 3OS3A 4EWHA 1WCCA 1JQHA 4HVDA 3K3IA 4TXCA 2FH9A 3KRWA 3HUBA 3OT8A 4UZDA 4YUQA 3HUCA 4I1ZA 4DCAA 3FMJA 3MN3A 5AM6A 2X39A 5IUGA 4O0YA 5K9IA 5EYKA 3BYMA 4RJ7A 4BICA 3A99A 3THBA 5AA9A 1YHSA 2QQ7A 5EKOA 5HIDA 4FEQA 3CEKA 1Q24A 4C4IA 3NW6A 4CV9A 3COMA 5CU0A 4C3RA 4WKQA 4L68A 1ERKA 2J7TA 4CV8A 2PUPA 5E9EA 3R8LA 3MY1A 1PXOA 4DFZE 4L3JA 4YTFA 4DGGA 5LVPA 2PWLA 2JDSA 3CD3A 1OPKA 4IB3A 2XBJA 4KIKB 3WI6A 3RK7A 4FTTA 4GCJA 2IPXA 3R7IA 1Q97A 4LQMA 4XNEA 3BE2A 3CPBA 4U3YA 1GZOA 3KF4A 4ANLA 3QTWA 3EQRA 4D4VA 3AT4A 3R9NA 3CJGA 4RJ6A 5IMEA 3PZHA 5HCZA 2R3NA 3C7QA 3IDPA 2C30A 3D7ZA 2B52A 3A7IA 4C4EA 4YNOA 3VUKA 2A2AA 2HWOA 3HECA 1VLRA 4NSTA 5CF4A 2WMQA 4C4HA 3OG7A 2JKMA 2HWPA 5HE2A 2J5EA 2IW8A 2PVJA 4UZHA 3TACA 2XB7A 1GAGA 4PL3A 3MV5A 5DRBA 4KUJA 2XUUA 3UPZA 2YIWA 4E6AA 4JIKA 1XBAA 2BRMA 4NWMA 3UNJA 2XCKA 1H28A 2C4GA 4H1MA 5JN2A 4AGUA 3DU8A 4PL4A 4FT7A 1PXPA 2IO6A 3BELA 4OUCA 2UZEA 4QMZA 3UGCA 5KCVA 3DKCA 4O27B 4U79A 3A2CA 4WSQA 3I1AA 3CQWA 2VX0A 2GNIA 4DFUA 3EN7A 1TQPA 2ITTA 3LXLA 4M84A 2PTKA 3CJFA 3D14A 4QP1A 4XHKB 4EK5A 4EONA 5KMOA 2PVMA 4O81A 3W0RA 3RM7A 3G33A 3QRIA 5EDQA 3ZONA 4MNEB 4AACA 1JSVA 3ODYX 4BGQA 3TNQB 3SXFA 2JBPA 4DH5A 5L2IA 5A4LA 3V04A 2VTRA 5AM7A 4GG7A 4IB5A 4TL0A 1SNXA 1STCE 2QCSA 3MIAA 2WMRA 2O3PA 3PUFC 4AN2A 2XNEA 2GNJA 2YERA 3E3BX 3MPAA 4RIWB 5J95A 3UVQA 2OO8X 4QP9A 4FF8A 4EOQA 5J87A 2UV2A 1G5SA 4F6WA 3RPRA 3PRFA 5FBNC 3DDPA 3QQFA 5TO8A 3UPXA 4MXOA 4DGOA 1PRYA 4A9UA 2GSFA 4RGJA 4U5JA 3NYNA 2B9IA 2V5QA 1WAKA 4I41A 4B0GA 4QP2A 3N4UA 3H10A 4HGTA 3CQEA 2OKRA 2F7EE 3BQCA 3SGCA 5DEWA 5C4KA 4I23A 4UX9A 3QU0A 4HVSA 4JLCA 4FV8A 3HGKA 5HG5A 2O64A 5CS6A 4BTMA 2KULA 4CG9A 3QLGA 4IM3A 5CQUA 1SVEA 4RWLA 5FDXA 3R7GA 4LRMA 5IDPA 2HAKA 3U8WA 4D28A 3QQJA 3SRVA 2BCJA 2IVUA 4AT5A 4DTAA 4BF2A 3MY5A 3NUPA 5F94A 2GTMA 3FE3A 3R0TA 3V51A 4DINA 1H1SA 3FI3A 3PFQA 3O50A 4U6RA 4Y72A 2GU8A 2X9FA 4YTHA 3ACJA 2H6DA 2WTDA 4TW9A 1NT2A 4J8NA 1WBVA 5CU2A 4EH9A 3DKGA 2ZJWA 2KTYA 4FKUA 3W10A 3R1QA 5DE2A 2CKQA 3RMFA 3R9OA 2GNFA 1LR4A 4ASZA 4I6LA 4FG7A 4GRBA 3MB7A 5EOLA 3NUXA 1OITA 5L6WL 3LFQA 1JVPP 3V5TA 4FIIA 3LMGA 1H1PA 4A9TA 4CZTA 1JOWB 4QTCA 4B8MA 3TCPA 3BU3A 3BGPA 4C36A 4UALA 1BLXA 4MKCA 3KVWA 4AOJA 1UA2A 1KE6A 2NO3A 4JBQA 5IA3A 2ZM4A 4WIHA 3RAIA 5A4TA 3T3VA 4CFNA 2YFXA 4F6SA 4ACDA 2V22A 1U4DA 5I9VA 3FDNA 5D1JA 5C03A 4A4XA 4BDAA 3UOJA 4BDDA 2JAMA 4AGDA 4CZUA 4CFVA 2PE0A 4M8TA 4PL5A 1UKHA 2OF2A 2JGZA 5KHXA 3FY2A 4JIAA 3KULB 3L8SA 4X2JA 4ZTRA 4I6QA 4KABA 4CXAA 3HEGA 3QQGA 2R3LA 3WF9A 5C26A 1WBWA 4B9DA 3OVVA 4QQTA 4IM2A 4XLIA 5IF1A 2XVDA 4ZTMA 1NY3A 3RWQA 3Q2JA 1WZYA 1WBPA 3QLFA 4ZTSA 5ICPA 4I21A 1OECA 4OR5A 5HOAA 4FKTA 3QCYA 1YRPA 2RFEA 3E8EA 1QPJA 3PVGA 2ETKA 5I3RA 5KKRB 3TDVA 2V62A 3L9NA 1OGUA 2CSNA 2JLDA 3LQ8A 3IQ7A 4HCVA 5AP3A 4NJDA 4AZSA 5HVJA 3LXNA 5JKGA 2XH5A 5T68A 4HZSA 3ETAA 1ZMVA 3MBLA 4EOMA 4EWQA 4F7NA 2ITOA 3F3TA 4FX3A 4NL0A 4QP8A 3AKKA 4I5PA 2CGWA 2FYSA 3MA6A 3D5UA 4DLJA 3FYJX 4D9UA 4O4EA 1FGIA 1ZYSA 2C3KA 2VTQA 4ZJVA 2C3JA 1TVOA 2BFXA 5CTPA 5C01A 3HMOA 3W55A 1YXXA 3FHIA 3AXWA 4EOKA 1GZNA 1OZ1A 1FBNA 5IA1A 3IW6A 2AEGA 4DT9A 3G6HA 4OTHA 5L6PA 3G9NA 3DLZA 3A8WA 3ZHPC 2HOGA 3GU8A 1WBNA 2C5VA 3ZO3A 5JFVA 1HCLA 2G2FA 3BX5A 4CLIA 4QMWA 4LGGA 1JWHA 4YLKA 2YAAA 2CMWA 2B9HA 2QONA 1XH4A 3AGLA 5FXSA 5I9UA 5IUIA 4XLVA 3K5UA 3DZQA 3W0SA 3GFEA 5EQYA 4UWBA 1PYXA 4C7TA 5HG7A 3SRVB 3H9OA 3QXPA 4ANMA 2XRUA 2R3FA 2QG7A 5CANA 3KCFA 2BDFA 2WO6A 4NKSA 4DDIA 1VEBA 4J53A 3C4EA 2OXYA 4EH4A 3COIA 4MX9A 3FV8A 4JQ8A 5J7HA 3ROYA 2XMYA 4P7EA 3ATTA 1PMUA 4AW2A 2X4FA 3HNGA 4IFCA 4L3PA 5E91A 4K11A 3L8PA 2Z7QA 5AV2A 5DR2A 2J6MA 4GUEA 1PXMA 2VWWA 3MH3A 4J1RA 1OUKA 3AC2A 2OJJA 4BKZA 5IQCA 2QO7A 5JZJA 3FLZA 4ITJA 2PPQA 1NA7A 2HW6A 4D5KA 1APME 2J0MB 4N57A 3RP9A 1J91A 3F5XA 1CM8A 2BDJA 3FLNC 2ZV2A 3E64A 4WNPA 5M4UA 1YXVA 3TEIA 1Q3WA 3R2BA 1VZOA 3R8MA 5JRQA 1BL7A 4G16A 4FKGA 4BYIA 4KAOA 5TOZA 5CAOA 3TI1A 5AR7A 4GW8A 4NYEA 3VRYA 1XO2B 3ORZA 1ZYDA 5HTBA 4EORA 3SVVA 3CTHA 5FXQA 5TR6A 4G6LA 4E3CA 5DPVA 3VW6A 2WELA 4FSTA 2QURA 3WZEA 1LEZA 2X1NA 4EHZA 4FIGA 2V7AA 4ZIMA 5HNBA 3VQHA 4AFJA 3FL4A 4KKHA 5BYYA 2UW3A 2O0UA 3R8PA 5DRDA 4FKRA 4EUTA 4DFLA 2PL0A 5G1XA 3V8SA 2EU9A 3WZUA 5AAFA 1PHKA 1KOAA 3WBLA 4U0IA 4ACCA 3QD3A 1K2PA 4AAYA 3Q4UA 1PXIA 4MUQA 4FV1A 4IIRA 3UO4A 1YWNA 2BR1A 3I6WA 4QMOA 2WMTA 4AZEA 4K33A 4QTEA 3F5GA 5D10A 3UG1A 2WTKC 2CN5A 2FB8A 3O71A 4OTDA 4OT6A 4EH7A 2UZLA 4O6EA 2YIYA 4CD0A 1YWRA 3HMMA 4AX8A 4FIHA 3LMIA 1IA9A 1GNGA 2A27A 2VWIA 4FK6A 4V04A 4PRJA 1S9IA 4OBQA 5JGDA 2GQSA 4XV2A 4P90A 5E8VA 4JOAA 4PY1A 2UZBA 3ALNA 3IK3A 3LJ2A 4RIXA 4FKJA 3S3IA 3VIDA 4FJVA 1KE7A 2YHVA 3FZRA 3JVRA 1KE9A 1R0EA 4WG3A 5HESA 4DFXE 5GIOE 4ASXA 3RAWA 3ZFXA 4GUBA 3Q9YA 1DI8A 4M0ZA 3F3WA 1M52A 3BYVA 4H36A 4JBOA 4AGCA 3VUHA 4N4SA 3ZZWA 3ORLA 5J1WA 4FIFA 4AQKA 1AGWA 2ZFYA 4G6NA 4XG2A 5EW3A 1PMNA 1PY5A 2R3PA 2XRWA 2Y6OA 4XP2A 3AD6A 4NW6A 3R21A 2Z02A 3TZ7A 1GIIA 3OW3A 2AUHA 5HNGA 4DHZA 3AD5A 2X8IA 4A9YA 2CCHA 5BVNA 2CNQA 3TUBA 3QCQA 3OCGA 4X6RA 3FKLA 5ETIA 3VS6A 4ARKA 1XBCA 4Y73A 5FTQA 3LFAA 5L2SA 4XRLA 4WO5A 4QTBA 3MH2A 4GK4A 2QOBA 4ZLYA 4PWNA 4MAOA 1UVRA 4CCBA 4E4MA 3MESA 4GFGA 2WTVA 4LOOA 5BVKA 3DPKA 5IMXA 4E4LA 3GQIA 3D5XA 3TV6A 4W8EA 4C62A 5KBRA 2BZKB 4S34A 1OIRA 1MUOA 4M68A 5HLPA 3O8TA 5IA5A 4WG4A 4JMQA 1BYGA 4FL1A 1LUFA 3F82A 4JDIA 4ZMEA 3RGFA 4I20A 2X2KA 4UMPA 4R5SA 5M09A 1CDKA 4F08A 3ZDUA 3BLAA 2Q0NA 5E8XA 2GCDA 2OXXA 4S31A 5I9ZA 3BKBA 4EOJA 1YXUA 3TG1A 4JDJA 2ITUA 5ITAA 2W17A 4YJSA 4QMLA 4X21A 3QC4A 4L53A 3HMPA 4XV1A 1OM1A 4BCFA 3W0NA 2GNGA 3VF8A 1E1XA 4OTIA 4S33A 4ANBA 5KHWA 3R7VA 2IWIA 5CI6A 5IQIA 3IW5A 4O0RA 1QPEA 2GQGA 2PUNA 2XCHA 4G5JA 3ET7A 1SNUA 1UWJA 2XK8A 4I4EA 1MRYA 3DQWA 4FT9A 1NVRA 3NAXA 3H9FA 3ZFMA 2FGIA 4BC6A 2BVAA 3Q04A 2R0UA 1H27A 4BZOA 2BAKA 1JKLA 3GU6A 3HMNA 4IAIA 5CX9A 3SD0A 5IH5A 2YIRA 4EKKA 4ZTLA 3U55A 1PXNA 1NXKA 4BDKA 3HAMA 3R04A 4C4GA 4C35A 3CSVA 3LFCA 2W96B 4F0IA 3RCDA 4IB0A 1XHAA 3CXWA 4F9WA 4FKPA 1YI6A 3QTZA 3ITZA 4U80A 2CKPA 3UIUA 2YM6A 2WMVA 4J7BA 4O86A 4ZSEA 4AZTA 2XKFA 1XBBA 5F4NA 5M56A 3BGQA 5IA2A 2QOIA 3M42A 3GXLA 2UZNA 1IRKA 2YM5A 3Q9WA 2CGUA 3I60A 3VS1A 4F1TA 3SOCA 1CKJA 3GCQA 3GGFA 4D2TA 3KA0A 3HZTA 4FTNA 3REPA 4QPMA 3LXPA 1O6LA 4ZZMA 2XK7A 4A7CA 1ND4A 4RIXB 3QALE 5EW9A 2YWVA 3QD0A 1J7UA 4CRLA 4YC6A 2ITXA 4KD1A 4MXAA 2XK6A 3KXXA 2CCIA 5B2KA 3QZGA 1XKKA 3FC2A 3KL8A 4KKGA 4K77A 1DAYA 3RTPA 3V5QA 3ZEWA 2VGOA 2W1ZA 4S2ZA 2JIVA 5CU6A 3VUIA 2V55A 5HIBA 3F61A 2R3HA 5DG5A 4NM3A 4F7SA 3W0OA 5DEYA 4BCIA 3VBQA 3DFAA 3E63A 4FTKA 4A9RA 1OL1A 3U6HA 2J0JA 3BPRA 4K8AA 1TFFA 2QKRA 1OVEA 4DH1A 4V0GA 3P23A 2YEXA 2OSCA 3PE1A 4RRVA 3MFUA 5M4FA 2B9FA 4O7SA 2YLEA 4O82A 4LM5A 4O0XA 3W2PA 1IEPA 4O91A 4GYIA 3QZFA 2BTSA 5IDNA 4YZNA 2QHMA 2YCQA 3CY2A 4PMSA 3BL7A 3MTLA 4ZOGA 1JNKA 4ZY6A 5JZNA 3DXPA 4WNMA 1BI7A 1R1WA 4QTAA 3PJ2A 5GNKA 4KA3A 3EYHA 1H4LA 4YJVA 4RA5A 4ZY4A 4AFEA 4RIOA 3HMIA 4LRJA 1XQZA 3BWFA 3RHKA 4QP7A 3R1NA 1W2CA 3A4PA 1T45A 4FV6A 3NYOA 4HYIA 4ERWA 5AA8A 4HVIA 2QOFA 3QD2B 4QP4A 3V8WA 4DHIB 4RX9A 3QQLA 4MH7A 4U9AA 4TZRA 4FTMA 4DGMA 4FNWA 1KOBA 2WEVA 3LM5A 1IR3A 3OTVA 3CD8A 4QO9A 4F6UA 4O1OA 3LFDA 4FVPA 4R7HA 5AUWA 2GS2A 1PKDA 5DNRA 4O7NA 5DN3A 3WIGA 5A4EA 5DT4A 5JH6A 1Q8TA 2P33A 4NTSA 5L2TA 3NCZA 5DMZA 4GK2A 3BV2A 2X7OA 3ZH8A 3SG9A 3OBGA 4DEGA 3LPBA 3VQUA 3TNPC 2W1GA 3QTRA 3DOGA 2XZSA 5T6KA 2GQRA 3OXZA 4BN1A 1A9UA 2YAKA 3Q60A 4OTWA 4TWCA 3NW5A 2UW5A 4G17A 5AP5A 4C02A 2ZDTA 3U87A 2J2IB 2P55A 2QO9A 3TWJA 4EKLA 4IX6A 2BILB 3BYOA 2JITA 3LKMA 1OI9A 2VTSA 5C9CA 4HGSA 4O1PA 3WE4A 4ENXA 3TDWA 2BALA 4L01A 4UXQA 5EKNA 3KN5A 4G9RA 5FDPA 5IEXA 5C8MA 3C1XA 4CT1A 4L52A 3BIZA 3OT3A 4U43A 5CVHA 4EYMA 3BWJA 1X8BA 5JQ8A 1BL6A 2P0CA 5FXRA 2O63A 3R71A 5KE0A 2PHKA 2VO7A 5JSMA 4O2PA 3TL8A 4BCOA 2C47A 2VWBA 3UYTA 4BHZA 3ORNA 3O0GA 2VX3A 4KINA 2G01A 4PV0A 1VYZA 1M14A 2R3QA 3KVXA 4PP7A 5BVFA 2VWVA 2V0DA 4EHVA 3RZFA 4R8QA 2C5OA 4AW0A 5IQFA 2CDZA 3DQXA 4U44A 4EHEA 2WAJA 4ORKA 3OXIA 4FC0A 5DWRA 4ACHA 3ZMMA 2B55A 3HV3A 2YCFA 3H9RA 5FEDA 4ERKA 4EBWA 2PU8A 5LWMA 4XBRA 4DTBA 2IJMA 1G8AA 1FVRA 3EQIA 4FBXA 3KRLA 1U54A 2C3LA 4V0GB 3EL8A 3VBWA 4EK3A 4BCJA 5HD4A 4B6LA 3I81A 3OW4A 2IN6A 2UZOA 4JG8A 5CLPA 3ORPA 4DDGA 3BLQA 3KMMA 4EK4A 2Z2WA 3ZCLA 4F7LA 3QGYA 2OZOA 3O96A 2VNWA 5EOBA 5HO8A 4BCGA 3TKIA 4E6DA 2Y0AA 5HBEA 5IQGA 3GU4A 4CTBA 4O0UA 4B4LA 4H3QA 1IG1A 2W7XA 2WPAA 3C0HA 4P4CA 4QPAA 5HZNA 3RPOA 1OKYA 3ENHA 1P4FA 3ORTA 2XAOA 5JFWA 5LJJA 5LQFA 2E9PA 3FBVA 3HLLA 1W2DA 4J8MA 3C5IA 5GINE 5FM2A 3N9XA 4C4JA 1UKIA 2R3KA 4D4RA 2J0IA 3DJ6A 2E9NA 3DLSA 3F6XA 3DKOA 3PJ3A 1KUTA 3L9PA 3RK5A 3IGGA 1OBGA 3FQEA 4BDBA 4RA4A 2O8YA 2ZV9A 3RPYA 2ERZE 4FNZA 4QNAA 5ANOA 4ZLZA 4FOCA 4WRSA 2VTTA 5CENA 5LMBA 2DQ7X 2OGVA 2XARA 1BX6A 4MBLA 5H9BA 2G15A 3NX8A 3R63A 2VGPA 1AQ1A 3HV6A 4QQCA 4R3RA 4E1ZA 3VS2A 1UU7A 5BQ0A 5IA4A 5HE0A 4FSWA 2B7AA 5FP5A 1P2AA 4DGNA 4M3QA 3KMUA 3P7AA 5HD7A 2QU5A 3V8TA 3V5PA 5I3OA 1UNLA 5HCYA 1KV1A 2X2MA 5AR8A 5HBJA 3Q3BA 4O7TA 3F3ZA 4IADA 3CGFA 4V05A 3FJQE 3SHEA 5DIAA 5BVWA 3F5PA 2PVKA 4GT3A 2R3MA 3EOCA 4EEVA 4F9AA 4DGLC 2VU3A 1OB3A 4ZSAA 3DZOA 3VW8A 2GMXA 4IFGA 2BKZA 3EYGA 1QPCA 2EXEA 3D7TA 3VUDA 2ZM1A 4G5PA 5FD2A 1MQ4A 4DT8A 2R3IA 4IDTA 4V01A 2WQEA 5AP1A 5DOSA 1TQIA 2YITA 3OWJA 1I09A 3BU5A 3EKKA 3V01A 4BIEA 4KS8A 4D55A 4IAYA