4E4RA

Eutd phosphotransacetylase from staphylococcus aureus
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
330
structure length
330
Chain Sequence
SNAMADLLNVLKDKLSGKNVKIVLPEGEDERVLTAATQLQATDYVTPIVLGDETKVQSLAQKLNLDISNIELINPATSELKAELVQSFVERRKGKTTEEQAQELLNNVNYFGTMLVYAGKADGLVSGAAHSTGDTVRPALQIIKTKPGVSRTSGIFFMIKGDEQYIFGDCAINPELDSQGLAEIAVESAKSALSFGMDPKVAMLSFSTKGSAKSDDVTKVQEAVKLAQQKAEEEKLEAIIDGEFQFDAAIVPGVAEKKAPGAKLQGDANVFVFPSLEAGNIGYKIAQRLGGYDAVGPVLQGLNSPVNDLSRGCSIEDVYNLSFITAAQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title EutD phosphotransacetylase from Staphylococcus aureus.
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
molecule keywords Phosphate acetyltransferase
total genus 112
structure length 330
sequence length 330
ec nomenclature ec 2.3.1.8: Phosphate acetyltransferase.
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01515 PTA_PTB Phosphate acetyl/butaryl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10750 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isocitrate/Isopropylmalate dehydrogenase-like 4e4rA02
3.40.50.10950 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e4rA01
1QZTA 1XCOA 1VMIA 1R5JA 2AF3C 4E4RA 1TD9A 2AF4C
chains in the Genus database with same CATH superfamily
1WMAA 2YRXA 4TTPA 3EXEB 3R9KA 5CEEA 2P9QA 3E58A 4M1KA 4BFWA 4KDEA 2H2IA 2NUBA 3D3WA 1XEWY 1V2GA 4Z99A 1LZKA 5CDFE 2Y1DA 1Q95A 2Q3MA 3L4BC 3OEEA 4FFBA 5A4KA 3WP1B 2R62A 1GHTA 3BZBA 2JD1A 3HO8A 4JGIA 2BYTA 1PJTA 2DF8A 2P7HA 3GT4A 4PVDA 2WIGA 4RVDA 3WOVA 4BIMA 3IL2A 4HLDA 2J59A 1USKA 5DYWA 3SI7A 3DYIA 4FR2A 3A9WA 4ETIA 4H1VA 2B6NA 1MO5A 1T8UA 1JSLA 2HCTA 3L8DA 1FFXB 3OOSA 2AZTA 4O4JA 1E2GA 3T06B 3W2GA 4ERXA 2QN2A 3PX2A 3CUKA 2Z0MA 4HQRA 4Q9AA 1JDPA 2E5LB 5FNVF 3IR5A 4JXXA 1XSEA 3NUQA 3N2ZB 1XD9A 2OR3A 1ESMA 4U7TB 4CN8A 3HPRA 2E87A 4KIUA 4S12A 5CUQA 4IRUB 4W5QA 3NBUA 1WZIA 3AW8A 2XGMA 3G6WA 3F46A 3GDHA 4KWEA 4BJ3A 3A4MA 1UBHS 2P8SA 1HSZA 5JU6A 3H3XA 1PT9A 3V80A 3I2HA 3LCRA 4Z1MD 1B2RA 5ICMA 1JDTA 2LCIA 1NVKA 1M2OA 3AFIA 1ZH2A 2KQUA 4L74A 4MAAA 3QMMA 4O4LA 4OL9A 4OP3A 1SKMA 1Z25A 4JKIA 2ADOA 4DF3A 5KU7A 5JXIA 1SXPA 3I2IA 2PVCA 4D1YA 1XFAA 1NI3A 1AB5A 1V41E 3KPVA 1VCIA 1E3JA 1TAQA 4UNPA 5LQRA 1AHIA 2H07A 2UXCB 3TOCA 1ZWKA 2C57A 4WLOA 2N3ZA 4N4AA 2ZUTA 1M72A 1CJCA 3H87A 3ROTA 4TWZA 4WJLA 3L4SO 4OQLA 1I6WA 3ZWBA 1W0CA 1RHUA 3PNBA 4WZAE 4NZNA 1DE0A 4Y2XA 4U7FA 3ZK8A 3RFFA 3WWYA 2R00A 2B4TO 3DZDA 2REXB 1A2KC 2H18A 4M9UA 4MB2A 3ETDA 4EIWA 1UWLA 4MK4A 1C3XA 1G63A 1OAKA 2EYQA 4MITA 4QQRA 2M6LA 3C3PA 4PIPA 2GRJA 3HGMA 1IY9A 3B78A 4BCBA 3KUDA 5AT1A 2FLWA 4IH1A 4WT7A 3DE2X 4ECEA 3GNLA 3IRVA 1AS0A 4FTWA 1NDQA 4U2EA 1GQOA 5ED0A 4BNDA 4CKWA 2Q1UA 1FJXA 8MHTA 1L8QA 4K86A 2H4FA 1I5EA 4IJVA 4MMYB 1ISGA 2AN4A 2IUYA 2DFPA 3QUBA 1V1RB 4PPYA 3L4EA 4QEDA 1FSPA 5TQ0A 1C1YA 1MAVA 5DNUA 4QT4A 2QHXA 2Y77A 4UUPA 1TTTA 3FPAA 5DGCA 1A5AB 5LYJA 5FFFA 2B3TA 1VQ1A 5COQA 1ZQ9A 1ZSYA 2DC1A 2QRQA 1FSSA 4OQQA 2QMZA 5AJZA 1YBHA 4AWBA 5BYAA 4OGKA 3WNDA 4D9BA 4INJA 1UMBA 4AVYA 2A9JA 1QZZA 1Z4JA 1AB6A 1W5AA 4Y18A 4N3BA 1JE1A 2VC2B 1GRVA 3UJ7A 1FMLA 3L7YA 1D2NA 4QPNA 4UHJA 1PWHA 2DLNA 4F71A 4R16A 3LBFA 1KYQA 3NT2A 4PSDA 1RNLA 2K2QB 2OPBA 1XJ5A 1Z0IA 3AHIA 4FVTA 3LC1O 4LEIA 3HXLA 1QKJA 5HF6A 5LA6A 4DUYB 3ZU2A 2JEZA 1QGUB 2ZLBA 1LW6E 2O2GA 3GN2A 3IQXA 4GSKA 3VR1A 4EJ0A 5KYXA 2ALJA 2EEZA 1Z56C 1NVUQ 2AFVA 1VDMA 1DC7A 2JJQA 1C14A 2LNDA 4NSNA 1LJ8A 2G9RA 3WC4A 1ZR4A 2O8VA 1KMIY 4PSKA 4QNNA 1TVEA 5I9NA 2I99A 4YRZA 2H17A 1DXHA 1Y8QB 5T41A 4TYNA 1KDTA 2Z04A 4WJKB 3RVBA 4UCQA 2WIFA 4CT4B 4CG1A 1K92A 4ZVQA 1J8FA 3TPFA 2X15A 4MW1A 4FKBA 2DPYA 3ME5A 2H9YA 1V6CA 2WV7A 4Y2YA 4J4TA 5FTNA 3NQ41 2Y3IA 1DAPA 2YXBA 4R8RA 1T4CB 4UUOA 2J3HA 1T5BA 3OZAA 2W2XA 2IYUA 4Z5XA 4DT1A 2QTTA 4Z86A 3M9WA 3I23A 3IULA 1ZUNA 4V0NA 5JDCC 3DZBA 1DO8A 3GIWA 3WR5A 1AS3A 2IEYA 2BGKA 1JXAA 4DA6A 3AHGA 2FQXA 1OBOA 1JQAA 3WIVA 3IP6A 5DCYA 4OG2A 3WB9A 1PP4A 1AC5A 1IOWA 2EAUA 2VJAA 4LY9A 4J2TA 3FWKA 5CT6A 2Y1CA 4ZQHA 3PEUA 3TLGB 3TXXA 1J8DA 5JW6A 5EUMA 4BLOA 3I6BA 4C6TB 5K2OA 3DG9A 3PYXA 3VJMA 2CUZA 1WU8A 3A7DA 2O8BA 1KY2A 1XALA 1T5IA 2G9ZA 3DFMA 5JS1A 4RTQA 2C0PA 5G0WA 4A2CA 2J6IA 3AY0A 1TO6A 2RGAA 4BUCA 3GLIB 2H1RA 3TWOA 2X3FA 1KQPA 4P3PA 5CEJA 3MUFA 1D2AA 2P67A 4V2IA 4BLTA 3MNFA 4L8GA 3GJ7A 3MHPA 3OPMA 2IU0A 4X61A 5LUBA 1T5HX 1C3EA 3DXXA 1EIZA 1ZK1A 5DNYB 4QOIA 4LVOA 3N8HA 5JSUA 4N41A 3OJLA 3PTZA 1HDCA 2VTVA 2HF7A 4JGBA 4M38A 1FVFA 2PXAA 2C1EA 5A9RA 3PZBA 1W8DA 3QWBA 3WBKA 4BMVA 4CQLB 1ZOLA 2ZIVB 1C3LA 3K6JA 1DBPA 1BKYA 1MIOA 2E4WA 4HN9A 4R2HA 1G2OA 3OX2A 5EKSA 1HT0A 2HIMA 1Z13A 3HXKA 4JJ8A 5CYGA 5LP1A 4TS4A 1ZU4A 1C9NA 1FDOA 1XJ0A 1TA0A 5K8TA 2XQIA 1SZDA 3FOCA 1E9BA 2QW1A 1K0UA 1BMQA 1T1RA 1I2BA 1OF1A 1TZKA 3IHTA 4IHJF 5TF0A 1HK7A 1XIVA 3MCUA 5F7XA 3FMGA 3WA7A 1ZA1A 1MRZA 3QU4A 3R41A 1JECA 1KI9A 4HNAB 4ITRC 4Q03A 4Q66C 4YAWA 3QXGA 5DLPA 1KA9H 1W1UA 4FLFA 3DT9A 3QPDA 3T12A 1OFUX 2ZBRA 1A8SA 4R0VA 1BJKA 3R8CA 4OGFA 2A57A 1FYXA 1JWLA 3PXCX 1TJ5A 5JAZA 5CCBA 3H5OA 1I36A 4FU0A 4WADA 1KZGB 2QVBA 4V38A 2AJLI 4RF5A 2QX6A 1U2QA 1B0ZA 2X8AA 3BKWA 3STYA 4KXFB 4W8GA 4YECA 2W0MA 2E85A 2WC1A 4GXRA 3RC2A 3AKEA 4F72A 5F9MA 6ADHA 2EQ5A 3R4VA 2G08A 1N2OA 3E8XA 4LE1A 4BGIA 5JYDA 2HY7A 4YASA 3FROA 3BIWA 4H3VA 3CLUC 5EMNA 1ZRHA 2RC5A 4BMYA 1ZN7A 4LDRA 2RI6A 4KLNA 3BTSA 4MWCA 1JG4A 3QITA 4FXPA 4YPVA 1OFGA 1X1AA 3DT6A 3QWIA 4X65B 4BE7B 2FVYA 5JV5A 4Q47A 3S0JA 1CJUC 1MO2A 1QO0A 4JLKA 3NHLA 3JRXA 1PVOA 1HH4A 1YBFA 2IX9A 4XYBA 4ENWA 5DXFA 5CLFA 3RU9A 5JRDS 3CVVA 3INRA 5HJ5A 1COWD 1WW2A 3M49A 2C54A 1RMQA 2P41A 1GZVA 5ICCA 1B4DA 4GH5A 4GPD1 4R6XA 3WP0A 2HF8A 5M29A 2PJDA 3A3YA 2NO6A 2O2JA 1U0NA 3QI2A 4UMFA 3SEZA 4CMIB 1Z7BA 3JAKB 3K5PA 4Q4HA 2H4YA 3HKBA 4BO2A 5HXAA 3QYAA 5JY6A 2C29D 4OOFA 2VPXA 1IIRA 3KAJA 4RK6A 4EJMA 2C5HA 1WCIA 2QM8A 1E9RA 2VDJA 3GJ0A 4LZPA 5JCJD 2PRZA 2V3VA 2H5JA 5KX5F 4Z8YA 4DVJA 4B80A 3KSAC 4F1JA 3PDHA 5DLDA 4I8XA 3OCYA 3SVZA 3W3AH 1RPZA 1G8FA 3FOWA 3PGJA 5CLIA 2P9ZA 4ECAA 4UUAA 5JCZA 4X60A 4EHFA 2YWXA 4LS3A 3SJBA 5H8WA 4RH1A 1YZHA 1NUHA 3QNMA 4RZ2A 3TB6A 2V1UA 1YUNA 1QIEA 1A7UA 3ECCA 1Z73A 4M6WA 4P6VF 1Y1QA 5AI8A 4A8HA 1PR2A 4TRJA 1TM5E 5CA0A 4L8VA 4OBXA 4NENA 2HLNA 4JC0A 1LBIA 3MTEA 4KWIA 1UJ2A 3FUCA 2ODAA 4JSRA 4E1AA 4AMUA 2C0QA 4RKQA 4G8BA 3RSOA 3AXTA 4UJ3A 1SKYB 4AJ1A 4PNEA 1T0UA 1NJGA 1NUTA 1R3UA 5DNAA 2QMEA 4W1PA 2WD9A 1ZMTA 2FZVA 2F59A 3FTCA 3K1YA 3TUJC 2Y1WA 5GM2A 3X2FA 3SQWA 2BR5A 4CDMA 4EVQA 1LLDA 5KIAA 5BSGA 2ERYA 1IRXA 1N1EA 1RR6A 5T6BA 3G2HA 4L9SA 3RC3A 3RVNA 3ZKWA 4A8JB 2GJ4A 4YMSA 2RJNA 3MG9A 4HL6A 4M8LA 2OO7A 3RREA 1Q84A 2PU7A 3LWBA 1UADA 3IVRA 3OJFA 1MX9A 3KSZO 4RH0A 3KJFA 4ZMSA 1ACJA 2TS1A 1GO2A 1F06A 2QXYA 4M0LA 5BQXA 1CUGA 4IJKA 3VPDA 3BDVA 1KTVA 3GMDA 5LQAA 2B21A 1XI2A 4M8IA 1CF4A 3TX2A 1AMUA 4R3NA 2FN4A 3VTKA 4RZQA 3ZBQA 2OV1A 5JFTA 2IEGA 2XITA 1ID1A 1I4TD 1YRQA 3HCPA 3O3NB 1LA2A 4LA4A 1QZUA 2Q4TA 4PIMA 3O1IC 3B2NA 1I2DA 4CHTA 4KRXA 3JV7A 3COWA 4DIBA 3OHSX 1P2DA 1OFTA 3G7SA 4JFAA 2FW9A 3IAS6 4FCTA 2G06A 3PFGA 5K0SA 5AM2A 1QIIA 3ASYA 1FUKA 2ZAMA 1VPEA 2UVDA 1M54A 1DLJA 1QLJA 3BCRA 1YL6A 3FCOA 4CETA 3EUAA 3V1TC 1RHRA 2FPMA 3PLAE 2QZSA 3NNDA 1XZMA 4QXRA 5J5AA 3IAAA 5EXSA 3B85A 1K2VN 3E9MA 1FUUA 2DCMA 2AHRA 2JI8A 3B7WA 3LUGA 4KQWA 4M53A 4NFSA 5J2TF 3H8VA 2XGGA 3AUFA 4IIEA 3KFXA 4PBRA 3VHXB 5ILOA 4CNBA 4GKVA 4ER3A 1KVRA 4KYIB 1KH1A 2O8NA 2XWPA 5DHPA 3L05A 2FVXA 1R9JA 5FP0A 4YRAA 1E6WA 5LYJF 1SCKA 3KL4A 1KP2A 1M1YE 1M2GA 4HGZA 4DN6A 3K1TA 2O3JA 4CFSA 1G21E 3GEDA 1C0KA 2RHTA 3QYJA 2NT3A 4XFDA 3QPBA 1OFIA 5H3HA 4B46A 5I5EA 3ILYA 1NDUA 5IJ0A 1K89A 2OY0A 2ZWOA 2WTAA 3IUEA 1TCCA 3TW4A 2VDMB 1PFWA 5FHQA 3CSUA 4HRYA 4U2CA 5DTMA 3S99A 1WMEA 2B7LA 2EP7A 2XGOA 4JEMA 5A9SB 1GUFA 5KKNB 2WR8A 4DT1B 1CNEA 5K0EA 1CWUA 2WB4A 3A8TA 4KQ9A 1XJCA 2FRDC 5DNEA 2C9ZA 2P4UA 1E5VA 3KJZA 1N0UA 3ND7A 3O3CA 4BLPA 4ZRDA 3F4BA 2R3SA 1MEJA 1YOBA 4QFCA 4F4UA 3P45A 5EIWA 3JVVA 2A1UB 2HRZA 2PGAA 1W2WB 3GEHA 5EXDA 1GU0A 1ACLA 2AG8A 5AKYA 5CFRA 1W34A 1OLXB 5BMOA 5J3JA 3HLKA 4GUAA 5ENZA 1P73A 3HBAA 3PPWA 4G6ZA 4LK2A 4F11A 5TVKA 3VOBA 4B81A 5JYEA 1I0IA 1E58A 3OF3A 2F9FA 1VMAA 4XB6B 5AUPB 4OJQA 4OJTA 4PG4A 1VMDA 4E21A 4G0WA 2ZUFA 1KK3A 3HR4A 4AJEA 5FTLA 1CS4C 3ZY2A 4DXHA 3BZWA 1TF5A 3IHLA 4O2BF 3AWDA 5KKAA 3WQSB 3RUFA 3OESA 1AT1A 1L5NA 1U3TA 3T3MB 4A6EA 2W37A 2P3OA 3GVHA 1E1CB 4XEHA 5C8YA 1ZNYA 2XQKA 1GZ6A 4EGCB 4BXOB 2HC9A 5J9FA 1B8UA 3WDLA 3AR6A 3CZQA 3D2CA 4MARA 4YXWA 3HP1A 3OX3A 3RK4A 4B7UA 1OLSB 2IKSA 1JAZA 2CF5A 4DWWA 1WMDA 2EHDA 1TF7A 3TJRA 5DK6A 3VHRA 4E5DA 1WPXA 5AI0A 4D2IA 4E13A 5DE3A 2MIIA 5K3OA 1UPUA 4DHWA 2PIDA 4J43A 4PPQA 4TS1A 3EFOB 3RIEA 1I80A 5ECYA 3TTUA 3LX6A 5F98A 3D6MA 3GDFA 1M34B 2UYCA 1GJRA 3KKNA 3R6LA 4IXNA 4G0QA 4R51A 3TDNA 4F97A 5BMVB 4NQZA 1MT0A 3E22A 4RKFA 4IOMA 2K5UA 4IUDS 1D9ZA 3G17A 2QY6A 5IJ9B 1VE6A 1RAGA 2KPOA 4KGDA 5JSKA 3T35A 2DFLA 3GGCA 4B6SA 5I7RA 4C22A 5JWRA 5BYJA 3ZCTA 3QQPA 1XB2A 3AR7A 5DYYA 1ZUIA 3PXEA 3ZDZB 3E3NA 2O7SA 3OH8A 4PPGA 2OSVA 3USES 4J9UE 3ZGNA 3WRYA 3CJTA 3OEED 4KQ6A 3U49A 3HCBA 2GZAA 4YUZA 2AVNA 3ZXSA 3NIWA 4KXUA 4TMFA 2EWWA 3WHKA 4DKXA 4DB2A 1EP1B 3D3KA 3Q7SA 4IVQA 1LVGA 1JIVA 1IDN1 4AICA 2P9CA 4K5QA 4B6OA 3WOHA 5T4BA 5TXGA 2Q49A 4DFDA 5BW8A 1FZTA 3ZK9A 3OLVA 4Z7JA 1PJBA 1ZH0A 5KYUA 4O2BB 5J63A 1GV1A 1EUCA 2GEBA 3MINA 2P6NA 2ZYRA 1XXHB 3UM9A 4M9ZA 2J3QA 3FLAA 1ES9A 4KPFC 4E5PA 3QVLA 3RYTC 4CG3A 2OQRA 1SU6A 4UU8A 3RH0A 5IUKC 3TLJA 1V47A 2XIQA 4EX6A 2BM0A 4N9QA 2JAOA 5P21A 3RRJA 2XE6A 3DC2A 4ZYVA 5K0CA 3LTNC 2Q28A 1Q0RA 1QOPB 2SKCA 3LQ4A 3CG0A 4OBBA 2BCEA 2WEKA 1USVA 4I4CA 3TCKA 4F0JA 1CZNA 3GF4A 4HX2A 3UYLA 4DQKA 4U7DA 5B7NA 3DLBA 1L5HB 2IYTA 2IW3A 4YUAA 4GLFA 1W85B 1ZK3A 2A0UA 2PQ0A 3MAAC 4JBLA 4MRPA 3EYAA 5G02A 4OV6B 5TPZD 3C24A 1U3DA 3N0XA 5EIOA 4PONA 5EERA 4M0PA 4NBRA 1DVRA 4ZANA 5JO9A 4IIJB 1FU7A 3ZWYA 4JB0A 4A8JA 1MB2A 2H4HA 1AKYA 1SCQA 2I4MA 3WGTA 4B7ZA 1NBEA 3G0OA 4RSGA 3JQPA 4LYYA 3O7WA 5H4HA 3HA5A 2IBSA 3OCJA 5JASA 3N6VA 4RSMA 4ZTBA 2G4VA 3AUAA 1W581 4LZOA 4BO8A 2OGSA 3A4IA 3TOXA 3WLQA 4XASA 1DS6A 1CJTC 1LCIA 3IVGA 1MO6A 2FH5B 5BSRA 4KU4A 2GSDA 1YZ3A 2Q5OA 4GEGA 1XDWA 3E9ZA 1ZPDA 2PMEA 5FOUA 4A8PA 4AJNA 4OB8A 5AXCA 1FXWF 1TK2A 1FYWA 4UQPA 4AZ0A 4CFYA 4CYMA 3R9XA 1IZYA 4C4YA 1L5OA 4LI3X 4ZHQF 3GJ8A 1JEOA 1L7XA 4IXDA 3W79A 3H1GA 4NCNA 2NU8B 5A9TA 4AO8A 8ADHA 5LOVF 4MSUA 3PICA 3LQYA 1S8FA 1CFJA 4O59O 1X14A 2FRVA 5F3DA 1I01A 4EITA 3BEOA 4MGIR 1QOZA 1X70A 1U2PA 1R12A 5K3CA 3S7ZA 4A2QA 1UODA 4IVRA 1TIBA 1BA3A 1Y9DA 3V32A 2XZOA 1Y1SA 1IN5A 3AERB 4GVPA 2G40A 4PO3X 2BZ1A 2C7BA 3OE4A 4YREA 5BOSA 4HEHA 2AX4A 1TU0A 3E9EA 3LPCA 4JVNA 2BC9A 4AROA 1Y9JA 2PMBA 3AQIA 5EYPA 5JH7A 3L6RA 2MCFA 1QTQA 3PYLA 4EKDA 1KP9A 1A8UA 1XRMA 2PS3A 2B8NA 3N7TA 5L9AA 3WAJA 2X40A 3BK2A 4MAMA 2VOEA 4KXXA 3PLRA 2N42A 1E5QA 3U7FB 1J8QA 4UU0A 3ZU5A 1AD2A 4JJZA 2FW6A 4CVNA 1JQJC 1WEHA 3BXGA 3N87A 3IT3A 4D99A 1AQ6A 5BV7A 3WJAA 3C4VA 2WJZB 5FUXA 3FFAA 3RAFC 4YYZA 3KTAB 5EWJB 1G8JA 1QIFA 1L7QA 2CSXA 3IEMA 2AFRA 1VE9A 1CY0A 3DUWA 3LT0A 5C8VA 1IMOA 1CRLA 3UWKA 1JXOA 3ZGXA 2CJWB 2P2CA 2PQ6A 2OO3A 1RZUA 4TTSA 2QVYX 3F6CA 3RD5A 3G1UA 1NULA 4MV8A 2B92A 4CV0A 4EYEA 1TZJA 2G04A 3JYPA 2O2SA 4R31A 4Q1DA 3T41A 4KUHA 4RQUA 2R7MA 4J0QA 4F2DA 2X5KO 1MXHA 3HWSA 1P7CA 1U0SY 1TQ2A 3PGMA 4EHAA 1UIRA 2IFTA 1CNFA 1MDBA 2H2HA 4UAJA 1GZSA 1XPUA 1P29A 4D9MA 1AZTA 1MIOB 2O5VA 1N7JA 2NVUB 3TTXA 1XNJA 4UDNA 3TQSA 4EI7A 2WMNB 5AJVB 2DY0A 2J9GA 3NWBA 1LI4A 3AIKA 3D3QA 5LMNB 1QTIA 2H59A 2EWVA 3S55A 4K9RA 2ZTHA 1ZIPA 1IHPA 1EEXB 3ET4A 4FGZA 5EHNA 4OQMA 1FW6A 2A4MA 4OA8A 4EY3A 1VDZA 5IDVA 5HSGA 4NYJQ 4DKJA 2YHIA 2KS6A 4Y8VA 5ITZB 1IYZA 4LHEA 2XTMA 2O3SA 2HA0A 2Q9AA 1P3Y1 1NIPA 1IWBB 1UZMA 1Z5GA 2CWWA 1OPXA 2QVLA 4XQ9A 3BERA 2R48A 4JR1A 5CTAA 3WRXC 4E51A 1QYXA 3RYFB 1NZFA 5DCWA 1DXOA 1F0NA 4TLMB 1A8HA 5HJEA 1GUAA 1QYDA 1VHLA 2ECOA 1JMYA 3AWIA 3T94A 1XRRA 3QMPA 4RTMA 1MOPA 3B5IA 5FTJA 4EI9A 1GCOA 2LPMA 2PE5A 1VSVA 2YN4A 1Q83A 1IBLB 1TM1E 3SK0A 3FLBA 5CT5A 1PFQA 1ZLYA 1QZXA 4KZPA 1QCCA 2PX0A 2VUIB 1KAOA 2I0FA 4LJ6A 4NZMA 3WE7A 2HMAA 4OX9Y 3Q9SA 4IMJB 4M99A 3EOZA 3I42A 4PYQA 2G80A 4BO7A 3MOSA 1Z0AA 2EJUA 4D9KA 4AWAA 2DT8A 3S2EA 1XVLA 5DOZA 1A8QA 3NIBA 3QX9A 4XARA 4MYHA 4W99A 1Y5MA 2A78A 3CPHA 4RTOA 3ZK7A 2J33A 2RH5A 3IBFA 3SNHA 3S2IA 3QXXA 4MUFA 2ZB7A 1G19A 1WUHS 3LBIA 4CWAA 5EHZA 4CM6A 3T5BA 4DTIA 1B41A 1GNLA 1Q1QA 4GZMA 3FZNA 1OBVA 4DQUA 3T5PA 2BGRA 5KJ6A 2Q6TA 2NVWA 1ULTA 2HNBA 4DCUA 3Q3IA 4QUEA 3FDZA 4LF5B 4ZO8A 4PYMA 2O2YA 4M7WA 1KYWA 4JYMA 5JZOA 5LZ4A 3DR3A 1VLLA 5TEWA 4RFSA 4WASA 3VJLA 2WMYA 3VU1A 3IJ5A 4DDVA 4MKRA 4S2UA 4NYMR 4L4YA 1BA2A 1ULUA 2ZI7A 3RAGA 1IXYA 3TDKA 2ZUCA 4XJXA 3BXFA 4G1FA 3RVRA 1NUSA 2RGEA 1R5BA 3T1VA 3FHCB 1F4PA 2CJYA 1C4KA 1JHYA 4YLYA 5EMLA 1NDHA 1AGPA 2BUBA 2ZUDA 3DFZA 3KEOA 5HTOA 4OHUA 2OYSA 4UE2A 2ZSJA 5KYGA 3TJMA 1RLJA 3TI9A 1QH1A 5JC8A 1NF3A 2VK1A 4GRAA 1EVKA 4S24A 3WO0A 2ATEA 4CU5A 2LIVA 2WJIA 1PT6A 4QFDA 2X4LA 1C30A 1JKJA 3K72B 2RDMA 2ZZKA 4P58A 5U9CA 1FMJA 5FFNA 1E6CA 3DS8A 3EW9A 3R7DA 1ZM3A 5C7IO 1V5IA 1V1RA 2PWYA 3HUDA 1R0KA 2PTHA 4LPKA 4RKYA 3FTEA 3HYNA 2J67A 4BBJA 1I7SB 4F9TA 1XEXB 1KDPA 4G24A 4RAOA 4BBPA 4PR3A 4F91B 1ULHA 1A5SB 3UMSA 1R27A 4DW8A 3ZYZA 3F98A 4RJLA 1L5QA 3TD6A 3U3MA 2IUTA 2OAEA 2XKAA 4MWBA 4R8VA 3AJ8A 3DLCA 1AGNA 3LHSA 1IMJA 5ELXA 3JWIA 2QEQA 3AHJA 3BRCA 4KMMA 1EVYA 2QL6A 4FR0A 3EPKA 2JJ2A 4RAQA 5L3ZA 3AVVA 1DAOA 3R3YA 4H3KB 4KG7A 4MLPA 4RWZA 3A6ZA 1LDMA 3O31A 3BN3A 5BR1A 1Q3KA 1WMSA 2JD0A 2OFOA 4OHCA 3U3OA 1H2XA 5AVQA 5IKMA 5AUOB 2JBAB 2QTWB 3VR3A 3QF4B 5EQFA 3A1DA 2C59A 4RA9B 4DQDA 4HRVA 1ETUA 1EM6A 1MN6A 4G97A 1USWA 3BSWA 3JR3A 2VP5A 2VPIA 3QVUA 4FMDB 5FEMA 2WYVA 2Y68A 3C6BA 2BMVA 3NHYA 1ZCZA 3PCRB 4L8LA 3L4KA 3DPIA 2CBGA 5EYPB 4J3NA 4WFKA 5KI6A 4JZKA 1XUOA 2QRKA 1U0OC 3K94A 4I1IA 4IKEA 1OTYA 2WB2A 3LC7O 4EW2A 1SD1A 3BMQA 4LDJA 2FWMX 1CU1A 1IH8A 2EFDB 1CR1A 4JC4A 3SZRA 3Q7TA 4CLDA 5KYYA 4CEJB 4HWRA 2DJ5A 3STUA 2XIJA 1WEKA 2IOQA 4M49A 2LZ0A 2C58A 3LW8A 4G0VA 1HDIA 2OBXA 1NJ2A 3RVQA 5A6VA 4ZJYA 2WT9A 5IAGA 1T5OA 4ZOBA 2H4WA 1LK7A 4NAVA 4RPLA 2EW2A 4DQ0A 4UUQA 4R41A 3IQHX 3E9NA 1M66A 2MINA 5FI3A 1OV6A 4TOIA 1VG1A 2GPSA 3I9KA 5TX7A 4INOA 2R9VA 4C0QC 1E1YA 1T8SA 5KSZA 4YJGB 4C4AA 1GM5A 1N2XA 2BFEA 3O8QB 5UKDA 3WJ7A 5HZKA 4N6OA 2NU9B 3UHAA 4OXYA 1DPFA 1ORTA 1Q22A 1TK3A 1UZUA 2HX1A 2VHCA 3KL2A 5CCDA 2B5WA 3LT5A 1VGQA 3GA7A 4H17A 4C4PA 2FW8A 1QC5B 4EB8A 3AR5A 3OA0A 5EWMB 5ELMA 2GEJA 3HVJA 4Z7QB 2XYVA 4B3SB 4YIHA 3BGVA 3L5KA 3VH3A 3W05A 1LDGA 1A82A 2XECA 3A1UA 3JVIA 3QLUA 3QU5A 4KQJA 1QV7A 2I4RA 2VF8A 2GNAA 4GBGA 1XVTA 1IVYA 4QQ8A 3ZCXA 2P3LA 2X9GA 3E5NA 1WUYA 3FVRA 4EW6A 3DMHA 3HXOA 1G2QA 2HA6A 1T4MA 3CHYA 2XX3A 1YMUA 5HCNA 4B3CA 5CB8A 4ZHQA 5JMOA 4FYIA 3VYTB 3L8EA 4ND3A 5BUSA 2YUTA 2O0JA 1XTPA 1MGOA 2H51A 1KEEB 2F00A 1UKEA 2JCXA 4QOEA 1A95A 4FJ0A 1RYNA 4JS0A 1U9JA 4RVCA 5IPFA 1TJPB 2QGZA 3HB5X 2JZOA 5JATA 4J0DA 4J75A 4ARCA 3CX6A 1YHYA 1RAAA 2GILA 3L7CA 2OV2A 2VZEA 1OROA 4KYTA 5FPKA 4H7IA 2P1ZA 1Y3DE 2V5VA 3M4YA 4KXLA 1QAQA 3ZV3A 3CB4A 3N39C 2GBFA 5JH7B 2KHZA 3HVHA 1HKHA 2WTBA 1QRAA 4OTZA 4PV7A 2OORC 5FQNA 3LQFA 3KQLA 5LQDA 1EIWA 2AMYA 4LDAA 3FWZA 3DCYA 5IVIA 3NUZA 4BN5A 1BE6A 4FHFA 3UKDA 1XQYA 3ESXA 3WLHA 4OBEA 1X0XA 2W2TA 3RI3A 4B4WA 2HRCA 3FDJA 1G9TA 1CK4A 1O6CA 1VJ5A 3ED1A 3R24A 2X8LA 3DHWC 4HNGA 4UAGA 4UQOA 1L4HA 2C9OA 4XSGA 4Q9DA 4TUYA 4UOZA 4Q4LA 2VSOA 2W8BB 4I1SA 1LNSA 4Z53A 5KINB 4OHZA 1FBNA 5K8JB 1OGJA 1Z3CA 1SURA 3LLCA 2PNJA 5IJ9A 4CR7A 2IH2A 3UWDA 1MXFA 2F3PA 2PL3A 3DZCA 3SSMA 3U4IA 1ODJA 4P4NA 1EX7A 2GO1A 2QJOA 5TV2A 2UYQA 2NYRA 3EAFA 4B31A 1KI7A 3ETCA 1Y3BE 5B3LA 1TFUA 1MJGA 1ZL0A 3A4YA 4X93A 1KPHA 3H2JA 4BEJA 1P0MA 3PR3A 4GQBA 4OXXA 1Z2OX 2YJ5A 4YJ3B 3TG8A 1IAVA 2QI9F 3AX6A 3DMDA 4L02A 4EVRA 2FWAA 3QPWA 4BRZA 1AMNA 4D25A 2BHNA 1PL7A 4RY0A 4UD6A 5CXXA 1XE3A 1Q7GA 3W7AA 1ADGA 3IEXA 1PJ3A 4BWVA 2IELA 3C98A 3TH5A 4E5NA 1KVUA 4JI6B 5KU1A 1N3IA 3R20A 2J3MA 2BBSA 4NVRA 5IH7A 3M0EA 3G0GA 3RFVA 2NUTB 1SUCA 4R98A 1FSGA 3U2QA 4EYGA 3R3HA 5T64A 1DKQA 4JXJA 4LY3A 2PT5A 1OT3A 1YVDA 4B33A 3UY4A 2F1HA 4KC0A 3T7KA 3OMXA 4A26A 4WXYB 4C3OB 3KJQA 5BSFA 1XTUA 3HYSA 1Z0JA 3I4CA 4NEGA 1O08A 2CVQA 5JNSA 3HM9A 1SVLA 3OE7D 1FP6A 3R0ZA 4DG5A 2PUDA 1HNWB 4P7GA 2PL9A 3ACCA 2ZJ7A 3DMGA 3RF7A 4MLCA 1DEXA 2CK3A 3A4NA 1GQYA 4GMFA 1Y34E 4KUGA 2QORA 2FR0A 1E69A 2P5UA 2PU5A 2ZJ2A 2XKJE 1KJ9A 3AJAA 3OEWA 5CW2A 1BE1A 3HXMA 2QRNA 1ECJA 4EYSA 4P4UA 2Z1MA 2A9PA 3WB2A 1U2GA 3DBRA 5M3BA 3V2HA 5IK2D 2EC5A 2YOGA 2J41A 4ARBA 1PSWA 2RGUA 2FG7C 2XH8A 4IV0A 3IOMA 5CDYA 1ZD1A 3DEZA 3IXQA 4N7BA 3CCBA 1ML3A 2ENWA 2ASVA 3I9V6 4FFBB 4N47A 3UAVA 4MQMA 3VKHA 4EB3A 4A0FA 4B3DA 1EXMA 1VLQA 2FFHA 4P8RA 1Z4IA 3D8HA 2BRUA 3EXEA 3NBYC 4C4TA 1L7MA 2XB2A 4NPHA 2EBHX 1ADYA 4DSZA 2X6TA 3ECAA 3HKEA 3ND9A 2QX9A 2D59A 1TUGA 2XYQA 2CCGA 2RAVA 1MP0A 3BAFA 1ENPA 1MNQA 2JLSA 1FS5A 1I3KA 1MUUA 1OC4A 3ACBA 4KKVA 3EDYA 4LYGA 3MF4A 2RAUA 2JIZA 2ADFA 2BJWA 3OIGA 3VNSA 1UEXC 5AKIA 5FOWA 1W7AA 2GHRA 5CURA 1I7NA 2I4LA 1AMOA 5TY0A 2E9SA 1LK5A 1U8FO 2OV4A 4M36A 1EINA 2C1ZA 2QDXA 1CHNA 4E5SA 3NALA 3K9LA 4EYQA 3QLUC 4Y30A 5HKOA 2XYGA 5DSXA 1MCZA 1Z0UA 1Z6TA 1XAGA 1WB4A 1XLUA 3BEDA 1JXQA 4LE2A 3VZPA 2DWCA 1KY4A 4OQYA 5FADA 1ZGJA 1QWSA 1WUJS 3H5AA 2P5YA 4M88A 2B0CA 4A23A 3RU7A 3BTOA 4BFUA 1PR3A 3D8UA 2DQ4A 1ZGHA 4E11A 2UYHA 5LR6A 4NMXB 4GOOD 4F4IA 3EZXA 1PV2A 3A7EA 3EGDB 2PKQP 4K26A 4BQNA 3I5XA 5E2AA 1IXZA 1U8EA 2NZ8A 2MSLA 4XWWA 1TCVA 1L2TA 1SUBA 1KEVA 2XWQA 4FFRA 2R4UA 5KAMA 1ESNA 3V8MA 4HADA 1GLGA 3O9MA 4H6XA 4UKDA 5E6UB 1VSBA 4C0SA 4PZDA 4YJHA 5T7BA 1TO2E 2GX6A 2H6EA 2CD7A 3IUJA 4DXAA 2XNHA 2EZ8A 2FUNB 3FPFA 1PV1A 2A0XA 1U4OA 3HBNA 3C8UA 3LTEA 2Q5IA 2POCA 5EVJA 3GLGB 2E55A 1M6EX 5U4QA 1XFDA 3CT6A 1SUPA 4Z9XA 2AG1A 1BGVA 2NP7A 1SUIA 1XZBA 4X24A 1E1QA 1SAYA 2W4MA 3KEMA 3KYIB 4I4LA 2XCSB 3A2KA 1JQBA 2G3YA 3TIFA 3W4KA 2P4SA 1HI9A 4AI6A 3KC2A 3T7EA 1G2IA 1X1RA 1J5EB 1F8FA 2NU7B 4RPHA 5L45A 1K1EA 5B2ZA 2XY4A 2HJHA 3LPDA 5JVDB 2PZMA 1IBMB 4YRPA 4PNZA 2C20A 3TSZA 1TOAA 2VK2A 5AJUA 5GIPE 4F21A 1RCTE 5TIIA 1AF4A 4RIIA 1A9SA 1FRQA 5HKKD 1RC1A 3U1VA 3GLFE 1V8DA 5L3RA 5ECGC 1HZZA 2DETA 1RJWA 5HTKA 3RT9A 4DWJA 3M9XA 1GPBA 2HF9A 1HDGO 1EE2A 1V3VA 5J59A 4MA0A 1RKQA 5L6LB 3W3ZB 2J48A 3ER8A 3JAWB 4LJKA 4JOCA 4Q39A 3SXUB 4XM1A 2W6MA 1IU9A 4IO1A 3MBIA 4JX8A 3BIOA 1G0OA 5B36A 5BNWA 1QHNA 3L1IA 3NOQA 2AQKA 2O7VA 3TMAA 1JFFB 2WJWA 3B6MA 2ZR0A 3TM5A 4PU0A 1W2HA 3CSDA 3I32A 1ISPA 1JHOA 1KO4A 2QROA 3H8SA 1L6IA 2R8RA 3EMBA 4PNPA 4J3FA 3V4LA 1AKRA 3FWHA 3TEMA 4WBNF 2G1KA 2GRUA 3AI3A 1GAXA 1GZHB 4OD0A 4KPGA 2WABA 2P7IA 4HDRA 1EJ2A 1CY2A 1W96A 2A3NA 2D1QA 3C3BA 3H1FA 5FOXA 4ZTZB 1D03A 3RJTA 4PF1A 3DO8A 1VCMA 3HZOA 5FJJA 3ZWPA 4XWTA 3IIIA 1R5JA 5FD8A 2ID4A 4AP5A 3VNAA 5AVZA 3S44A 4OOEA 4C0JA 1CQJA 4OHRA 1H1LB 1TYCA 3ACDA 4P3NA 4WJZA 1AS2A 4K03A 4C06A 4Y1RB 3KT3A 4JSTA 3EUWA 2AE1A 5AJHA 5K6RA 3UQYS 1YB6A 4J49A 1W4BA 5F4BA 4J0HA 4F5ZA 1JKJB 3IUQA 3BMCB 4GF5A 4R1TA 4UZFA 1AF7A 5EUBA 2J08A 4BVBA 1P19A 4ZEWA 1IWOA 1EDEA 2IITA 4R81A 2J9ZB 4C07A 4MLDA 1IPFA 2QB5A 3FLEA 1C4XA 3FH0A 3NHPA 2ZJ4A 4MW7A 5C1PA 3KR0A 4KO4S 1L1EA 1XAIA 2GO7A 4U02A 4WCFC 3CLHA 1SIUA 3RYHA 3A3OA 4L51A 2JIBA 2QU7A 3N2KB 4KOEC 1JHVA 2IVZA 4LRSB 5TRTA 1Z6XA 2HKIA 2VWHA 3QVKA 1X3SA 3IR6A 5HGJA 4ESOA 3DOHA 3JTEA 1TXGA 3B9RA 1YRAA 2QNIA 4QARA 1FNNA 1P1JA 1TX4B 2VEDA 3FYCA 3LHFA 2ERXA 3L7OA 3N5KA 4AY5A 5FBKA 1DADA 2H8KA 1DZIA 4TWRA 2DUMA 2FW1A 4QJ5A 5HM6A 3ZDDA 2QUZA 1QGAA 2ONZA 2V1XA 1WDKA 2GARA 1GA4A 1LS1A 3GJSA 2GYWA 5LSAA 4KR2A 1NVWQ 1MH9A 2IIQA 2RBKA 2VNSA 5K99A 3NPMA 1ZMBA 4Q3OA 2C2ZA 2CNNA 2VDQB 3H4MA 4DLYA 2ID7A 1EP3B 3TKAA 5B4UA 1GWNA 2QT1A 3DXYA 1DKRA 3ZNOA 2BF7A 1PVDA 2CNWD 2FCRA 3PHLA 4KHZA 4N8DA 4L6IA 1UL1X 2D06A 5HEKA 2YVQA 3AP1A 4Z0NA 1R4NA 3E9QA 3T7JA 2QUHA 3U56A 1FFYA 2BFDB 1RLOA 4X8MA 3L01A 4DLKA 3SHVA 2HA7A 1J6UA 1T5TA 1B6RA 2VJKA 1MO4A 2DJIA 2HMUA 4QU8A 5C7YA 3BULA 5KYYB 1BVRA 2EKLA 1V8BA 4RD3A 3H83A 5FULA 1EUQA 1H6DA 2JATA 4B3GA 2GD2A 4B82A 1J97A 4Y6SA 4MCAA 3V8EA 3U9SA 1SMKA 2ETVA 3D1JA 3FCSB 4XVCA 4ABYA 3HCWA 5B57C 1X74A 2IHJA 2GCOA 5LB4A 4OSOA 4BO9A 1U7WA 2W42A 4Z6KA 4MWGA 3PQFA 1K7FB 2ZCVA 2BE9A 2IPOA 2ZOSA 4N5NA 3Q6MA 3FKJA 4OLFA 1CIJA 1WXGA 2W2PA 2CZQA 5EI5A 1M2NA 4Q01A 3RARA 2Q3EA 4RE6A 4B3TB 5IJ0B 4EW3A 1P2SA 4HWKA 3K6SB 4DUZB 1QU3A 5B53A 3GCDA 1DJMA 3M8KA 3KALA 5AI9A 4NJMA 3INGA 1D09A 2IDKA 2WF6A 2Q21A 5F7ZA 1Z08A 1CUIA 2AQ8A 4TTJA 2PPLA 3PF8A 2G0NA 3NBAA 4JC8A 3A6DA 1ZJ6A 4PLCA 5CMLA 4OXRA 4UE3S 2D7DA 1VSQA 1PT5A 1L5ZA 3N75A 1U2RA 1K86A 2QYHA 4DNQA 1AQNA 1P2GA 1R9MA 5EP2A 1EK1A 2QTMA 3C8MA 5DV9A 2XNKA 1U0EA 5AXAA 4DQXA 4RSRA 1BJTA 2WHPA 2XTJA 2IXEA 4LVNA 4NONA 5BVGA 3W06A 5FUQA 3U44A 1BC5A 3D9QX 2DQYA 1J09A 4B73A 1Y6RA 5KSWB 3DLIA 4NXMB 3PV0A 5JJ5A 1VLZA 1AQLA 1JB1A 3DCIA 3KLBA 3HU3A 2UUBB 3GK3A 4W5TA 2DPHA 1TQDA 4L4ZA 5IDXA 1FFWA 4QJ4A 3NIDB 3I2YX 4LIPD 1M7BA 2UZ3A 3TECE 1QUFA 3IDZA 3DTNA 3H5VA 1XZKA 2X5JO 5KQSA 1RQRA 4MO9A 3THYA 3EWAA 3NRJA 2HO5A 3BBLA 4IY1A 2JJ1A 1FP2A 2PUWA 3FMVA 1X15A 2P9EA 3MJHA 1PS8A 1K98A 3H9BA 3R0QA 2GN0A 1NMEA 4WXRA 3TBFA 1DNPA 4NE7A 4KITB 4RVSA 3VBEA 3LD9A 2RI1A 3A6LA 5BR8B 2O5CA 4LJ9A 2XDYA 3NR2A 2DWOA 1O6GA 1L4MA 1W59A 2C8JA 2Q6IA 1FXSA 1YFKA 3KWFA 3M6VA 4KXWA 4RLFA 4ZAWA 4KR9A 2MT9A 3QWFA 2A1TS 2ACWA 1ZICA 3O1LA 5AJYA 1WVGA 3V34A 1QF9A 4E03A 1ONNA 3FPEA 4GVXA 4F2WA 1EVZA 2BEWB 1ZW1A 3WL4A 3RHSA 1PHPA 4NXNB 3W8EA 3GPCA 1KQFA 1WJGA 4W4TA 2OCYC 3THSA 1EUZA 2J6HA 4TRMA 1YO6A 4G0UA 4DUGD 3E7WA 5FX2A 4EG3A 5JJKA 2J8ZA 4QXMA 3GAZA 1YUBA 2ZYGA 4KDCA 2FPWA 3ODPA 1BXRB 1VB5A 1EFPA 1OXVA 3NBMA 3E15A 4YGYA 3SJ7A 2XWBF 3K71B 4L0MA 1U3UA 4ZVMA 1VA5A 4RUKA 3STXA 5FQOA 3FVWA 3I72A 2QL5A 2VF7A 3PRKE 2R8EA 2VBGA 3EXIA 2EERA 4CM7A 5CFOA 1G8GA 5CA0F 3H11A 3GLQA 1J0EA 2EFYA 1E3IA 5FYQA 4AMZA 1XLVA 2R47A 5U1PA 4UTZA 2HHHB 3MXTA 3PDWA 4B87A 4B09A 4ZN6A 3IURA 1GZ5A 2VCEA 5ALGA 3CWCA 2B4AA 3ZEIA 4QBGB 1X42A 2YQZA 3PUYA 1CYEA 1Z4QA 2WMDA 1KTIA 3D3EA 4C7OA 1LSSA 1S2NA 2HTFA 3FCXA 4WXHA 2OLKA 3QNWA 4ISCA 3AUXA 3LJKA 1N2CE 4HUTA 3CN7A 4A7PA 5C2JB 3UH1A 1OLOA 3GRAA 4P4LA 1X1EA 2VTEA 4TSFA 3KXPA 4BNXA 3C16C 5KSOA 2Z57A 3IIMA 3L0SA 1PBTA 3WYNA 1LBEA 1J0AA 1AGXA 2DPXA 2WZCA 2G5GX 4LG1A 5DIZA 2V4MA 2XB6A 4BQSA 4HKTA 4LYJA 1RM5A 1HRKA 4W7IA 3U09A 5L4SA 4ZOLB 3KJNA 3RUPA 2AJ8A 1L4UA 4S0ZA 4K6GA 2VTBA 2QN1A 3TLKA 1RXIA 2GI4A 1I4DD 2RHHA 1EJ0A 2NAFA 5IZCC 3BORA 3VPBA 1HEIA 4UXIA 2CWDA 3LY8A 4MS4B 4WOCA 3FHTA 5JLAA 3QKTA 4KSBA 3RFTA 2Z6VA 5FHRA 1E1RD 3F5MA 3L5OA 3JQ8A 5JVDA 4KREA 3ZGYA 1RRPA 3JWHA 4DZRA 3AM4A 1C3OA 2J1LA 5JXWA 3IODA 2GEFA 5K8CA 1H6AA 5CEFA 2KMLA 2A0KA 3LUBA 4AQ7A 4KYUA 4BUJA 4I36A 2JVJA 2ZR7A 3FOBA 1QFJA 3LUKA 2RMKA 3LV8A 1FVHA 3O26A 3PI7A 4QGGA 5FWYB 5HIAA 5KNDA 4DJFC 3UT6A 3O92A 1E9AA 3HACA 1Z0FA 4RC9A 3H0EA 1IK4A 4GP9A 4L3WA 1L8XA 3PIRA 1QVRA 3FNHA 1O87A 4Q9HA 4YT5A 4BJHB 1YK1A 6AT1A 2RI0A 2FN3A 4J0JA 2HTEA 3A1VA 4H1HA 4P84A 4OF4A 4PX2A 1NW7A 4BEVA 2V55B 1QZ3A 3G89A 4TXHA 1Q16A 2ZATA 1Z4LA 5CFNA 4RNDB 4Q3CA 3NTXA 4EJ2A 1TVKB 3H9CA 3AEKA 3CFYA 4XIIA 3FDIA 4BP3A 4KSYA 1TA4A 5BQOA 2O1XA 4UBOA 4G1EB 5AI6A 3QX8A 1Q12A 4ISBA 4AC9A 2HXSA 4TWBA 1GTRA 2GPAA 2YZNA 3D8RA 1TT5A 5KX5A 2FV8A 4P92A 3H8WA 4YWHA 3KSBC 2C03A 4CM8B 2JH8A 4MINA 2GVNA 4G1BA 4MJLA 5HWSA 5HFAA 4MI6A 4DPMA 3O8NA 4RO0A 2G9VA 3ZQKA 3EPJA 2JAPA 4TT3D 4MKGA 2R7NA 4C88A 5JS6A 4TXMA 1UP7A 2F1KA 2N0SA 2KBEA 2A0FA 1Y7PA 3GRZA 3LCJA 4XFKA 1TQ8A 3M6MD 4JLJA 5BSTA 3OFKA 4FMCB 3WNZA 3U16A 3BMNB 3CV3A 4ZJUA 2NW6A 3ZQUA 4X3CA 3L7MA 1M8PA 5JHHB 4E5UA 3GZNB 1GNSA 3CEAA 5GVRA 4AKIA 1DDOA 4Q9IA 5LKAA 1TQ4A 4G36A 4LJ8A 3LHDA 3WI7A 4QULA 5H68A 4ZQIA 3OQNA 4HB2A 1E9FA 1N6IA 3NUGA 3RUAA 1AUQA 2YV5A 3L0OA 1YZUA 2B1GA 2P40A 1BE0A 1TVMA 5SYNA 3H9EO 3PVSA 3GZTB 1DKOA 1P7ZA 1XZDA 4DLSA 2H4JA 4OREX 4WBXC 4YC7A 1HQDA 2XMBA 1BEUB 4V1CA 2WJGA 3OZ7A 1KP3A 2JLCA 5LIRA 2GASA 2V7TA 2XNCA 2PBFA 3DBHB 3EASA 4E12A 2HK6A 1P9WA 1JVNA 5BSHA 1Z0ZA 2DWPA 4DC9A 3O73A 2YXNA 4R1UA 3DL2A 1PJ2A 2H2AA 2PUCA 2AN5A 3NIGB 1S0UA 1PK8A 2FQWA 3KJIA 1H6BA 2X8JA 4WNCA 4B32A 5HZHA 4JKOA 4W5RA 2OGZA 5U4XA 1B43A 3MLBA 7REQB 5I7VA 3BJRA 5MFPA 3PA6A 1M10A 1EP2B 5IKOA 1WXDA 2YVLA 1DWPA 3C6MA 1T8WA 1TKAA 4M8KA 3TNLA 2FZWA 3NGXA 2P6MA 2D54A 5JNWA 3CR3C 5ICGA 3U7HB 3ZHQA 5K6AC 2XR1A 4A0SA 4N48A 2DSTA 2WU0A 4PR0A 3GJRA 5JT1A 4LJ7A 3SYNA 1AE1A 3ENWA 4BWFB 3PB3A 1KE2A 2ZSFA 4Q1VA 3TGPA 3WLIA 2AXEA 3BQMB 3O8OB 4FYXA 3UG6A 3ZI4A 1WETA 1YJXA 4CEJA 4D9NA 1WV0A 2LKDA 3BE5A 5EHQA 3TQTA 4G9GA 1KH2A 1T1IA 1D8TA 4EG8A 1WBBA 2ZRIA 1VE1A 1OBFO 2PRIA 5T8KC 4IINA 1U6IA 3E61A 1PG5A 4UNQA 5E9QA 3SHOA 4N7RA 4EYOA 5HQTA 3K0AA 1JFRA 2FTKE 5HNKA 4GSLA 3LY7A 4DCVA 2R86A 3Q88A 1Q91A 2WAOA 4LHWA 1Z5NA 4Q05A 5IW8A 3C5HA 2VZ0A 3ZGZA 3FPKA 4AW9A 1Z17A 1GNRA 1SQ6A 1NUUA 1GILA 3ROQA 3K20A 4KL8S 5ELLA 2OEPA 2R7AA 1RMYA 1T8RA 2W22A 4R84A 5JC1A 1FLNA 3G1TA 4AS2A 2QP4A 3OOWA 1PVVA 4PEVA 3VPXA 1RWXA 3M6WA 3QBTA 2Z5FA 4DZTA 1TUBB 1V9SA 4DIUA 4POOA 2QLMA 3MGKA 1GSHA 1SHLA 2B7CA 2BDEA 2NVBA 2BWJA 3S2ZA 3B1YA 5JJBA 2CLSA 4CBVA 4ZFNA 1T3ZA 4TWIA 1FTWA 1KAHA 3IMEA 4WY2A 3ONWA 3EDQA 1PLJA 3DVAB 4QO7A 1IHOA 1Q0PA 3AEUA 1NLUA 3ORYA 2BGIA 3PFKA 4UUNA 1G60A 3Q2OA 4MYTA 1Q6YA 5DOVA 4G26A 4KAFA 1ISRA 4OI2A 2ANCA 1SBCA 2VCYA 1TT5B 3KQQA 4OMDA 5D87A 4LCEA 3X1ZA 3L41A 2FPLA 2XB8A 2B35A 3RIYA 5EIXA 1I5RA 4W9MC 3NYRA 3PNKA 2EX4A 5KCMA 3T9CA 3W0LB 4QKQA 1YJ8A 3OHMA 4RZXA 3RS2A 2V8BA 2W6OA 1GQRA 3EIXA 1W9MA 3EFEA 5AIAA 4ZPJA 1R0ZA 3OFSA 4DSTA 2EFGA 2JFFA 4X7MA 4CF3A 3PTAA 2HXGA 4AWXA 4ZDJA 1VIVA 4KVGA 3Q72A 3V4OA 1NVFA 1RQPA 3IT2A 3NKLA 1KBQA 4FSDA 4KWHA 4QJIA 5J5VA 3RV4A 3VPSA 5F77A 3W8FA 1SKYE 3E03A 1LXCA 1RXEA 2DKNA 3N5CA 4L08A 3L7JA 4D3SA 1UKZA 3ELYA 3PP8A 2YYYA 5D3KA 3TG2A 4QD3A 3A58B 2VSFA 4W82A 4CKYA 3K0FA 4FOTA 1IONA 1LFAA 2RKWA 3CX4A 4D8XA 1TMOA 1TUBA 3IBGA 3ENVA 1GUYA 4B7AA 4WD3A 3OSUA 1JG3A 4NK4A 1RLIA 3H3JA 2WILA 3NJ4A 3BRWD 4JQSA 5IDWA 3DBLA 3SX4A 2R5NA 3NYQA 4GI5A 4RFSB 4XXHA 4FFSA 4L2IA 2ORIA 4TV9A 3H4IA 3KEQA 4FCWA 4JB8A 3CU5A 1SQ0A 4HR7A 3KB8A 3W1WA 4M1OA 3TR6A 2GERA 5L3QA 2CHGA 3DONA 1NNI1 2ZBEA 3IQFA 3NASA 1M2OB 3O4HA 2FKAA 1Y80A 1X92A 4J1TA 3S68A 4NWIA 3TLEA 1T1SA 2FEMA 2E6UX 3HI6A 1L4KA 1CD5A 3WRXA 4FLEA 3AJDA 2VJDA 4GFDA 4AYTA 2UVPB 1W94A 1F12A 1RBQA 3A14A 3DPSA 3E6AA 3QVVA 4LZLA 4RPGA 1P5HA 3CEMA 3SQXA 4UCWA 5HGXA 5AM0A 1ZD3A 2MYUA 4EPXA 4BX8A 1YMQA 4OQEA 4LY6A 3R5XA 5JSFA 1D6NA 1JILA 2L0XA 3HBFA 1Z2DA 1NT2A 3VDRA 1WABA 2XF2A 2XXJA 3OEHA 1P61B 2QAIA 5LA6F 3W1VA 1O4VA 1H69A 1U0BB 1G5HA 2Y1FA 1A4RA 1NIJA 1CJBA 2HWKA 2QQGA 1M9NA 4L3VA 1XTKA 3H11B 4MPTA 1Z6ZA 2QG4A 3GUCA 3LP8A 4UREA 3ZE0B 3D3NA 4X90A 1N78A 4EKGA 3X44A 3KOUA 4M83A 3VZBA 2A30A 2WHYA 3Q11A 4CDNA 5IFKA 2VXYA 3DEHA 2EIHA 3JVDA 4UAVA 5ESRA 4X63A 3IO5A 3O8CA 2XUZA 4ILKA 3CX7A 5HIIA 5F35A 1IOZA 1IB6A 2AWNA 2FE1A 3IPYA 1UC4B 3HDJA 3ICVA 3HY4A 3JARB 4DCCA 3U7GA 1G21B 3HI4A 5I45A 2F3QA 3L7KA 3OM0A 2WW8A 1NVBA 1RRVA 1D5CA 4L9WA 3SZGA 4ARAA 3TRFA 2KI5A 3F78A 4XPIB 3RS5A 3ERCA 2OYRA 3AU9A 3N9IA 4ZGGA 1FDRA 1Q14A 3HL4A 1V6AA 2JS7A 1JA9A 1P45A 4I81A 3K0SA 2WIBA 1V0JA 3D7MA 1W4CA 1SELA 1G7CA 2JFOA 3WL3A 4ALIA 3Q3EA 4EG1A 3UO8B 2V4ZA 4EEKA 2RK6A 3OY2A 3K15A 2MSWA 6NULA 2E49A 4IOJA 3DV2A 4O5AA 5IVHA 4AECA 2GZHA 5CX1A 1XZLA 1MX3A 3PA8A 4EP1A 3B9BA 2Q1TA 2EJVA 1SBNE 2NN3C 5FPQA 3RKRA 3RVDA 3VOAA 4V24A 1NR1A 2IS1A 3R6DA 1AIPA 5D84A 3K8OE 2YFQA 1TLLA 4DR1B 3DBOB 3UA4A 1MJHA 3EBPA 2G0AA 3B5EA 4HWOA 4WKNA 1NV8A 1PHRA 4X91A 4E09A 1WSBA 4ZI3A 3EA0A 4HXFB 3ROKA 1PCXA 3GBPA 1L7AA 1HT3A 1T0HB 1U7ZA 4OHKA 2IP2A 4MW2A 2IW1A 3EZFA 3PC2A 3N05A 2ZJ1A 3ZU4A 1V16A 2ZJOA 4LZNA 3M4ZA 3TM4A 3EVBA 1G3RA 2OZVA 3OJ0A 1PIWA 1CY8A 3WLLA 3L6OO 3WGVA 1N2JA 1D07A 4DCGA 4ERNA 2PNFA 4YCCA 2JGDB 2Q8QA 1N0IA 4BFSA 1S2GA 1GCIA 2P2GA 2D8AA 1T35A 4IIJF 2WHPB 2H2GA 2Z9DA 4IZIA 4MEJA 3U44B 1TD9A 4QYIB 3OIWA 3FMOB 4TV8A 2B0JA 2COEA 4UBJA 3RS0A 1KOGA 3V2IA 5JFOA 4QXAA 1LWOA 2P77A 3GPDG 4ZQFA 1SN7A 1YBAA 4LHXA 2X0EA 2B1RA 4MRMB 2BGGA 5IFLA 5ADHA 2ZSDA 3QTTA 1XMQB 1PBNA 1QLWA 5G2OA 3I2GA 1E7SA 2Q3JA 4ZVNA 2GPTA 1KU6A 4X0EA 1E5DA 2I7TA 1DXYA 4P80A 2AD5A 3P5SA 1IIBA 1HETA 2BIFA 4B7CA 2CZGA 2P6PA 3GT3A 4CTJA 4E2FA 5BWCA 1G17A 1XZNA 3QV1A 4I1VA 5BN5B 1BGWA 1A5ZA 4AMGA 1A77A 5CFQA 3M89A 1CQXA 2DBYA 5LBTA 3TZHA 1G9XA 5F7OA 3A28A 1OTHA 2HJ9A 4F6RA 2WWVD 4CCYA 3PR2B 4N6NA 4PZYA 2REQB 4NK5A 1KZHA 1YSCA 1D04A 4DJTA 1FDIA 4BEWA 1UM9A 3FHLA 3S8EA 2M1XA 2PDAA 3RROA 4EUHA 5JJIA 1GG2A 3C6ZA 5JCXA 1BDIA 1YZQA 2CBXA 1QHHB 3T9DA 2OCPA 1QTNA 3RC9A 1PQ4A 4ON9A 2JBWA 2V03A 4MQBA 1JRLA 2X7JA 2VA9A 1HPLA 5LDGA 4PANA 4PFJA 4RFLA 3K0EA 2PGLA 5CH5A 3NEAA 1NMZA 5AKGA 5BR7A 5C80A 1EQUA 2BAGA 2WF5A 4FUTA 1E4EB 3SC6A 1UDWA 5JH7F 2BFCB 4FP9A 1AOXA 2P6OA 4DJJA 1NBMA 2C7PA 2L2QA 1XG5A 2AWOA 1EK0A 3IQDB 1CUBA 3UOAB 1G38A 1BFDA 1C9KA 1YKGA 2AFIB 2QE6A 3EBLA 3K6KA 1YCFA 2QQFA 3GN1A 4N03A 5JISA 4Z9BA 2P2NA 1M8JA 1RAEA 4KR3A 4YP1A 3EGEA 4QGSA 1U3VA 3IFSA 1JDVA 1RXSA 1N8NA 1UBTS 1Y8AA 3CH4B 4MRAA 1KPIA 7ADHA 4UFOA 3UJ6A 1VIDA 3IBCA 3QBDA 4LWQA 3WLOA 4EKIA 4FZRA 4EMUA 4G0XA 1LBSA 4BJ6A 4H3SA 4QUHA 1O03A 3KJHA 1HOXA 4CMBA 2ZB2A 4G1VA 2W90A 5TNXA 2NXCA 1SUDA 3BXHA 4NCJA 4JYPA 1G3QA 4EF4A 2VJNA 5EIHA 4BO6A 1AK2A 1Q2UA 2NUAB 1W0KA 4NNOA 2COUA 4WZAA 4Q93A 5F1KA 2OVBA 4DRXA 3IPCA 3W5CA 4MTLA 3CLRC 3WL6A 4REQB 3RYIB 2ISSD 3FPSA 1W6RA 3DZKA 1SBYA 3QVTA 3PFIA 1FUIA 4R54A 3NGMA 5TVGA 3MSCA 1E2IA 4J2OA 4N12A 1QB8A 1SR8A 2VP4A 5IAOA 1EXNA 2JGDA 1KR2A 2HRDA 4XAQA 5D85A 1RRFA 3W6PA 1KJNA 4P86A 3TW8A 3WSVA 5BN3A 3W9SA 4EDFA 3T1OA 1EXWA 1RKVA 1GA1A 1U9ZA 2QU8A 3LL4A 4G1MB 1L3BA 2B8WA 4DABA 4BNDB 3KVRA 1A71A 3KXLA 1U28A 2WG2A 2BE7A 4X54A 3BFKA 3IE1A 3IP1A 5B55A 3I1YA 3L6DA 1DQPA 5KYTA 4QQFA 3CO5A 2R66A 3AHDA 2MR5A 5LMUB 3RRMA 1LKZA 1OSNA 2AF4C 3R9WA 2L42A 2YHUA 3NRBA 1KERA 2BM1A 3KLOA 3Q3JB 1QO7A 1VL6A 2NZWA 2X76A 4LXQA 3SHTA 5FKJA 3V7FA 1TVKA 3CH6A 4F12A 3LUPA 1JHMA 4TMTA 5LQCA 3MUEA 5L4LA 3A9RA 2PY6A 1QJCA 4FGUA 4WX2B 1GG8A 5MHTA 1JEQB 1BU5A 2X2EA 2AH5A 4WLVA 2VRNA 3K9BA 3LMKA 4G0PA 3D4IA 4FFVA 2QAGC 2QM3A 3M1IA 3QSYA 5SICE 2JFWA 1VCOA 4LK3A 4OIFA 2J0UB 1LVUA 2ZRMA 4WKPA 1I33A 1Q1BA 2YINC 4H7PA 1MAHA 2BTQB 4Q4AB 2JJ1D 4FOPA 4YBRA 5AYVA 2P30A 4RZUA 2ODPA 5CGZA 5B3AA 3OP1A 2JA1A 1INLA 1QK4A 2O57A 2PYZA 2Q6OA 1NT4A 2BKXA 3ESRA 3LE8A 1CQIA 1C8KA 2QR5A 3AF2A 3IDSA 1A50B 3H1TA 4CM1A 2J3LA 5DX8A 2AIRA 4IF6A 5AKHA 2I3DA 4LTMA 1K4YA 1PWXA 1CUUA 4GBMA 1CF2O 1KPGA 4LCBA 2DWUA 4HJRA 1JIUA 2JRCA 1XN1A 3A31A 5DGHA 5FL7D 1NQUA 3SEQA 5CNKA 4ZV4A 1YAJA 5F7JA 2DULA 2DXIA 5JWOA 4BNVA 4IAOA 2CFRA 2JBHA 3K16A 5BW6B 1C7FA 1GLVA 5HZMA 2HRQA 4K05A 3WLAA 2AUTA 5H16A 4ENVA 4IF4A 3BSSA 3USCS 4RA9A 4NBTA 1XNQB 2DPGA 3DHVA 3K9CA 3I58A 4OGLA 1DKMA 3WKBA 4B8WA 3QE4A 3CUEF 3H2HA 4L27A 3WDKA 1OYVA 4AJOA 1M2EA 1OYOA 2NT4A 2ZKLA 4PHGA 3DE0X 2VKQA 5DNVA 3W2TA 2DR2A 1IBSA 1RWPA 1MQSA 1WSDA 2IBMA 3CPSA 3FYTA 4K40A 4K8OA 2UVPA 5KDOA 3KS9A 3TIVA 5LZ7A 3LPLA 3ZD9A 1SZJG 1K2WA 2XUOA 3B36A 4Z49A 2OBMA 2JFYA 2X8BA 1KIFA 2VPZA 1FX1A 3I28A 3R3JA 1TJ3A 2O8BB 1Z12A 2IP4A 4BV9A 4RTNA 2IYEA 2O54A 4GXNA 4IIFA 4YJFA 3TI7A 4QICA 2GZ3A 4NOJA 2BTQA 4Q4AA 3VQTA 2H65A 2FETA 4B79A 3D81A 3W2FA 2H00A 3PGKA 3GP5A 3EGWA 1AUOA 4R2MA 5DNCA 3DTYA 4PRLA 5HF8A 3WGHA 5B1HA 3B7GA 3VPCA 2C5SA 2W6ZA 5F12A 1S2DA 5IUNC 2A59A 5BN3B 1MABB 1DV2A 1P0PA 4OVKA 1EQ2A 4QGBA 3DFFA 2HBZA 5K3SA 4IEIA 3ANNA 3Q2KA 4DV4B 2JHCA 1P7VA 4AX4A 4HUJA 4CPDA 1N92A 3G1WA 3VKUA 4FNAA 1KDZA 4ZGBA 3VAZA 2TMKA 5EGNA 1Q0QA 1VHQA 2GR9A 3EIFA 3ZOKA 5J4VA 2WKPA 1GTZA 1DQNA 1ZKMA 1JJFA 3M3PA 3QH4A 4ER7A 2J85A 3VDMA 2ZBFA 3V8BA 1IHYA 3I39X 3MQFA 3O4IA 3R6GA 1D4FA 3CGWA 1H5NA 3CWZA 4ZOCA 2PSSA 4LHYA 1WB9A 3LKVA 3BAZA 1T8YA 2I6XA 2J45A 2N1BA 1KXZA 4URUR 1UDCA 3OZUA 3AP2A 4KKXB 4N0EA 1AHNA 4U6QA 1YI1A 1FSFA 1GARA 3H1AA 3IAM6 3T1TA 3OU7A 2GM9A 4DCOA 3KQMA 4ZOEA 4F2GA 2V7QA 2ZRCA 3RB8A 5IJXA 1L7RA 2W2MA 4BNLA 3R5FA 3W8NA 4C4ZA 1W1WA 4B75A 2CFSA 2X4GA 4ZEVA 3F8WA 1HKUA 1KZ9A 1SY7A 4BS9A 3SF8A 2WYWA 2Q0QA 1EM8A 2B78A 4MB0A 1KMMA 1G64A 2PSFA 2NSLA 4LYDA 5TF4A 1P2FA 4QOSA 3R7SA 1N2ZA 4NOKA 3DZHA 3RE1A 1B0PA 1LDNA 1HOTA 2Q3BA 3HTXA 1XN4A 3AVOA 1UDAA 4MW9A 1VHJA 2JI4A 4UM9D 2OHGA 3ADPA 1NC3A 2QBYA 1P72A 4O2AB 3GFFA 3I6QA 3PS9A 2VF4X 2E4UA 3Q3VA 1FXWA 1XWIA 3QVGA 5CA0B 4ZVTA 3N8GA 1UPCA 2C9DA 2CNWA 4HSGA 2W71A 3TKYA 3UT5B 4Z4GA 2X9QA 2O0KA 3L07A 4NCXA 5AM5A 2FNAA 4MVYA 3MRTA 5JE8A 3FB4A 4C7XA 1KWKA 3O8RA 3QW2A 3B1KA 4ZCSA 5GGXA 5LIPA 5EHIA 4BX9A 4E5YA 1JIJA 1A2BA 1A7KA 2OZKA 2ZI4A 3NNNA 2XF8A 2ZRJA 1OXUA 3D31A 3HGQA 4FN5A 2ZBDA 3F9CA 4EARA 2JB9A 2WKRA 1X6VA 3V1LA 1RZRD 4I4TF 4X1YA 5I9SA 3IT0A 5ABPA 1BSVA 3DCNA 1XWWA 4NMHA 4B8ZA 1GL7A 4QOFA 5BT9A 3K0FB 4U6NA 2E6KA 4HXEB 4BKPA 3ZHSA 1J2UA 1DIBA 3IEUA 1SG9A 4E5MA 1LB1B 3O82A 5K6AA 3QXSA 2XOKA 3OOJA 2GFQA 3VPGA 1V8ZA 2BBTA 3WNVA 1M8FA 2NZUG 2I6SA 2BGWA 3PQCA 1R5NA 4GOLD 4ZAGA 2R1VB 1XRQA 3RV3A 2FPPB 5EZYA 3MTBA 1T29A 1YS7A 2Z08A 3THWA 4MKIA 1J22A 2PL5A 2A84A 4L16A 4ZARA 2DR0A 4JVMA 3ROZA 4K0KB 1OLUA 3BH7A 4JP8A 3GMIA 5HIMA 3SF0A 4Z54A 4MRSA 1ORRA 1P4RA 1XZGA 2F4NA 3LBAA 5GP1A 1T91A 3UHPA 3DKVA 1AZSC 4WXPA 2H16A 3S5JA 3SLKA 3U7RA 3AH8A 10MHA 5CH3A 1TU3A 1EWVA 3BWVA 5TQ2A 4A5SA 3MAGA 2D2VA 1JEAA 3RVJA 1ZR2A 3LRPA 3V2GA 4JFRA 4ENSA 2WTNA 4KRFA 5HCIA 1ZCJA 4B6EA 2ETXA 2VL7A 1VG8A 3CZ4A 3HGTA 3T4EA 2ONYA 4BMPB 5AVYA 3P9XA 4AYXA 2D2IA 1D2GA 3LBHA 4NY1A 3QVWA 5ERXA 3WK5A 5LPNA 3D7KA 4A91A 1PEKE 1M1UA 1OFHA 3DNFA 4U3JA 4KQGA 3FFTA 3HHPA 3EWSA 2FHSA 1PK9A 3HRKA 1H9AA 4I6GA 4TTQA 3LGAA 1GXSB 2B5VA 3KVOA 4P7JA 2ZUEA 2VAMA 2CBZA 2WKSA 5EA2A 3ZXIA 3BRWA 1DDGA 4PZCA 2VH1A 3QXJA 2R11A 4BASA 4MYUA 4CQMA 3OQPA 4UW9A 1T36A 4I1YA 3ADKA 1PEAA 1K6XA 4WBNA 3BFXA 3CJRA 1GKUB 1FPMA 2PKEA 3OAAA 1A4IA 3W5BA 2R8BA 1Q20A 5LP6B 4RTRA 4H7FA 2HF2A 4L85A 1R6TA 3ONFA 5JJLA 1CEYA 2GZ1A 4JLWA 2QRLA 5L3VA 3MCTA 4NJMB 4R7ZA 2G1PA 1F38A 2IHVA 4PYOA 4HLCA 4MCJA 3H13A 1KJZA 3BK7A 1Q5PA 2H4ZA 2DHQA 3PL5A 5DZSA 3UWOA 1VL0A 4DG9A 2D2EA 3H4VA 3H6GA 4IGKA 4IDEA 1CQWA 4PHFA 1E2HA 3FB1A 5CHYA 2IPXA 2VBIA 2YUIA 2ZTUA 2WTMA 3FPLA 4IG4A 1WVMA 4I3HA 4O2RA 4B0PA 1O9BA 2JD2A 3K8QA 6Q21A 5SZJA 3I5YA 1F7UA 4RFVA 4AF7A 2HSDA 2BSQA 4J90A 5BWMA 2MSEB 3VNRA 4YHHB 3PC7A 2R8XA 3HO1A 4PGMA 3H5WA 3R3VA 1ZK4A 3FYUC 3R75A 1F0YA 1LU9A 1P1RA 4TMYA 3UAOA 2H29A 1VFPA 3DZJA 3OT4A 1G16A 5CDFA 3UV7A 4BL5A 2L82A 5CVEA 3IOBA 1C0EA 1YS9A 3RW9A 4EHBA 4GYYA 2QTVB 4OYRA 3SD7A 4MKXA 4GPIB 1D0SA 2F6RA 4JQCA 1JYFA 2VIIA 4GPZA 4ND2A 3NTRA 1O0BA 2BEVB 3PFWO 3NI2A 1SD2A 3P2MA 1G41A 2D1SA 3L0YA 1Q3HA 3KZXA 4L6CA 4ZYUA 5IC4A 1MG0A 1PSDA 1T2UA 1MENA 4X1IB 1GKLA 2H85A 1XYYA 2V96A 3R5HA 3T4XA 2J0UA 1U2DA 2OC4A 2ZYAA 1K6IA 1PJQA 1ZX1A 1N9ZA 4DA0A 2CDCA 3CEPB 2AKEA 4H4EA 2YCLA 3K0HA 3T5AA 2DOKA 2ET6A 4LYEA 3TS1A 4OHFA 4RV9A 1SEVA 4YMUA 2DHRA 5A4AA 3MN1A 3QLVC 1G3MA 3B3AA 5DCLA 2XYPA 4GM4A 1BAPA 3T38A 4AQDA 1AXRA 3C87A 4GBED 4JENA 4EW1A 4R1LA 1COWA 1QRUA 1TJNA 4BDSA 1GAQA 3M6LA 1JVSA 4HMQA 5JS8A 3TTTA 1DI0A 2WD7A 1BE8A 3KDPA 3MLEA 3WHIA 3D4OA 3OKPA 4ED9A 2HLDD 3C97A 4PC1A 1G3IA 4LXHA 5LMCA 3BC1A 3F4LA 3QM1A 1X2EA 2QUJA 3WGQA 4V1CI 3QEMB 4HEQA 1DRJA 4K6HA 4BNFA 1J00A 1SVNA 2D1RA 4EGQA 4HN4B 4HPWA 3BXZA 5KTOA 4EJSA 4MQEB 4GKJB 3L2OB 1P6XA 2IBTA 3EXHB 3L40A 2CXXA 4DQLA 1OI7A 3CY6A 3K8ZA 3KTOA 1Y6FA 1N33B 3TVTA 3S29A 2BUCA 3DNMA 4QPDA 1IPHA 2C4MA 3IJPA 3EGIA 4GX0A 1ZBDA 2LUOA 1L5VA 4IJUA 3DWEX 1NURA 2O3TA 3EA4A 5GIOE 1YOVA 4BMSA 2EP5A 2OZLB 4KFSA 1NPYA 1SFRA 4CT5A 1KVTA 1C7ZA 2MYNA 3PWZA 1ZP6A 4YK7A 5CNJA 4DR5B 3SE7A 5ESXA 1GPMA 3EGVA 3O90A 2G09A 3LT2A 1AGRA 4TTAA 1JDSA 4RD1A 3KZCA 3ZWXA 3W3AA 3DTVB 2J7PD 1CS0A 3NV7A 1WNFA 2PL1A 2A33A 3A9CA 2W6NA 2APJA 4A73A 4ZVKA 1J42A 5AVXA 3HBJA 1ZN8A 5BRAA 4IS3A 3FNFA 3TIIA 3V8PA 1W46A 1H05A 2ZYSA 4HVTA 2JGEA 1QIKA 5K3BA 2Y27A 1KSHA 4JUAA 1DPGA 2I6FA 1Z47A 1SJ9A 1B7GO 2DBQA 1EG2A 2WAMA 3JQGA 4EY4A 2GN6A 4HAUA 1Y5LA 3QE0A 5H83A 5IBRA 2QE7A 5EOVA 1DAGA 1Z5VA 3K3PA 4WERA 1YL5A 5E6SB 1NR7A 3EY4A 4MVJG 2GZ2A 4XI9A 1FC0A 3AR4A 4EELA 2DPLA 5GONF 5HQ3A 3THRA 5KNDD 1HM5A 1URPA 1P3DA 4HWPA 4DS3A 3O8LA 4FOSA 1KAMA 2A5JA 1U7UA 2GBLA 2A2ZA 4QO8A 1UOQA 1ECPA 2BPOA 4BVLA 3ILVA 1N1GA 1OLUB 2QE7D 2C00A 3AFNA 4HXGA 3T1QA 2XB4A 4LV6A 4M37A 5DIFA 3O9ZA 1KYVA 4JJ7A 3W5AA 1MPTA 2X1HA 1XTVA 2FA9A 2R44A 4MHSA 4PZZA 5TARA 4CQLA 4NG4A 4PZAA 2Y9PB 4BX0A 3BIXA 3EIHA 3MBKA 5IMBA 2P9FA 3GG9A 3ORHA 3P9SA 4IHKA 2OENG 3RO7A 3KU4A 2V7PA 1DIAA 5ALNA 4I19A 4IDQA 4ZDWA 3O8BA 1CT9A 3RBAA 5SZHB 3E9YA 4AT1A 1HFJA 4ZVOA 5B7GA 5EIEA 1K27A 1P9OA 3MSXA 3PSHA 3AR3A 1ZL2A 2E3JA 4LX8A 1JV2B 3AVUA 5K03A 3UJPA 4JHLA 4XX0B 4UVDA 1HNNA 2Y2UA 1SBZA 1M33A 4GX1A 4RPKA 1N2HA 3AB8A 3TNFA 3CE6A 2I34A 2I7XA 2Z5VA 4F5DA 4UM9B 5BP7A 3RSHA 3ZU6A 4M8SA 4B40A 3AEXA 4OGWA 1I3NA 3P0RA 4HZIA 4P54A 4LWZA 1MC8A 3CPEA 1GTMA 4E88A 3ZDYB 3UMJA 2Y92A 1TAUA 3GFOA 1IB0A 3GJ4A 2WM3A 2W2NA 2WM2A 1B42A 2IYSA 1DEKA 5BUQA 4Y1GA 1QHSA 1R9NA 2R5WA 2VRCA 4A03A 1J8VA 1VP9A 4HDAA 3VR2A 1ZMRA 1TEXA 1SVMA 2OESA 3QOYA 3FMIA 1ZGAA 4MZXA 5B3JC 5ILGA 3FNQA 4QU5A 5FXMA 3UXEA 4FB4A 1NQVA 2DFDA 2CUNA 3LUFA 4OFBA 3VO9A 4QFMA 4MOWA 3D1LA 3UJ8A 4OGGA 2RFLA 2X86A 4EENA 1GRQA 5C4MA 1CQIB 3RVSA 1IHUA 5CPFA 4L6AA 5A4IS 2PUGA 1PEYA 1X1SA 2PT9A 3IBTA 2OSBA 2PSDA 4PX5A 1NYLA 4LXUA 3I5MA 1SUAA 4XWAA 4BAUA 1VJ0A 5JNTA 1EFTA 1WMFA 1WPGA 4X6LA 3M6FA 1VECA 3DSRA 3GVPA 5DEIA 5AXBA 4A9AA 1UJ6A 3E8SA 2ODQA 3TQFA 4NYIQ 3BDAA 2YV1A 4HWSA 2NACA 1RRMA 1BOFA 4CM4A 1HG1A 4JT4A 2Q7OE 1GG5A 3N2YA 3ZV6A 3TPZA 4KN9S 4BMCA 5C35A 1ZVMA 2ZFUA 4IDFA 1IUKA 2QTLA 1TU4A 1IY8A 2ILTA 3G79A 3NM5A 3UMCA 3KPJA 4E3WA 1VCNA 2BEUA 2C42A 3NVDA 2Q5QA 1WPRA 2C7GA 5LP6C 5KVCA 2YXDA 1TO1E 2LDBA 1UXIA 1KAEA 2P2YA 3EZYA 3OZGA 2CXRA 2G8NA 1ZRNA 2ZS9A 4WXEA 1XCGB 3QA3E 4FGKA 4FJ1A 2FKNA 3D2LA 4G09A 2K7ZA 4XUDA 1T36B 4C7MA 3GT0A 2DKFA 3E3AA 2JL1A 1N8SA 3B1WA 3ENZA 2HSGA 1I6KA 5E95A 4L1KA 4A15A 2XKBA 2GAAA 4K46A 2I3AA 1FPQA 1QIMA 2GN2A 1T6XA 1FP1D 3CXUA 4WE3A 4FYMA 1IATA 3T7DA 4ZCMA 1GSAA 3E8MA 4PC3A 4CTKA 2BCJQ 4KO1S 3GNQA 5DM2A 3R09A 3REOA 3EA5A 1OIWA 5KMGB 4LF4B 4A36A 2OCLA 2NZXA 2YWHA 3GI1A 1E96A 1JAYA 1P2BA 2VQDA 1N25A 1THTA 2ZJYA 3IIJA 4V0KA 1E0JA 3SY8A 3HYCA 3TLCA 3VJKA 4G5XA 4KTVE 3L8FA 1XU7A 1EU1A 4FE4A 1V37A 2PEZA 4DJEC 4JWTA 1HDOA 2R1TA 4DDMA 1T9BA 3ABZA 1GPNA 2ZSUA 3LDGA 5JDIA 2B1QA 3BD9A 3P0FA 4TQUS 4CQNA 1OQAA 2N1MA 3COVA 1N9GB 3HR8A 2REOA 5CHEA 1U0JA 3DZ8A 5JAPA 2XCIA 3VC3A 4ZPXA 1N36B 3Q5GA 1L4EA 4R1NA 2XEDA 2YL2A 3EC7A 1EDBA 1TYBE 4IBOA 5C8ZA 5L7YA 4B2IA 4CKBA 4QQKA 2YWFA 2IU4A 3LX4A 2FSVC 1N5MA 4RTJA 1CZUA 4PRKA 4I5EA 2VHUA 2ORVA 2X58A 3QUCA 3X1XA 3ZY3A 1CUEA 2QZPA 2C78A 1LH0A 4FYHA 3WTBA 2Q3FA 1DQYA 1WCV1 3JQFA 3MYYA 3H75A 4IWXA 4LBVA 1KZ1A 3TLBA 4E4TA 2ZQYA 1Z26A 4GYJA 4F8JA 3ZJUA 2ZG6A 4F6RB 1LV8A 4B2PA 2QV7A 5EQJB 1N2SA 1OFUA 2WFLA 1WDWB 3B2QA 4RY9A 3EXIB 5EJFA 5SV2A 1O94C 1XLTC 3IUNA 4ID3A 3HSKA 1ULZA 4AK9A 2CYBA 2ZIZA 3FNRA 1Q0UA 3L4BA 1QAOA 1NYRA 2C77A 2QVXX 4QU0A 1OV4A 4M1EA 1O57A 5ANRB 2YDXA 3KQVA 1FRFS 1YIDA 4X64B 3MMZA 4TKUB 4BB0A 4B3HA 2B25A 1N1DA 5JAHA 1R8QA 2P90A 2XCRB 1KI6B 3WKDA 2QM0A 5MN4A 4HDNA 4ZI5A 1W49A 3MJSA 3HN2A 3GLRA 3OU2A 1AA9A 1P9RA 1QDUA 2W2VA 5A6SB 1V95A 2O2IA 2RAFA 2E21A 2VVTA 2WAAA 3GA0A 4WZ6A 5LLTA 2A58A 4QXPA 2QBYB 1KSFX 3KWLA 3VR6H 1GITA 2FMFA 4DYDA 4ND1A 2IIPA 4HDSB 4JJ4A 3R77A 4J1QA 4JJGA 3QEKA 1U04A 2HNAA 2VPPA 4F4CA 3VZDA 4U8GA 4F4HA 4JB3A 4GI2A 5CB4A 1H4SA 2ZVPX 4HC4A 4K6KA 5ERYA 5A3SA 3AYXB 1RVDA 3DOOA 3THXA 4CM5A 2RGXA 4YROA 3SHWA 2XCUA 2CW5A 4F1WA 4F96A 1V16B 3K6RA 2HBRA 2ZSHA 4Q9NA 1TECE 1OILA 1U5BA 1V4BA 2DECA 1PV4A 4Z0PA 3P9PA 4UHDA 5EINA 2G83A 3AEUB 3ASZA 3GZJA 3OWXA 4YPFA 1QZTA 3E0XA 1K6JA 1NBWB 1P1BA 3VGPA 3QFHA 3HRIA 3S28A 1XMOB 2NYVA 421PA 3ANTA 4GWKA 4X6XA 3GYGA 4B84A 4WOPA 5D2CA 4QFBA 3AIOA 3S4YA 3H84A 2C9YA 1FOEB 2O2EA 2VZLA 2ZRQA 4QLOA 1J9EA 1QG6A 2G77B 4OJMX 4Q37A 4COKA 2ECKA 3IPRA 1BCRA 3NO4A 3Q7RA 1IE3A 1T2VA 2ZBGA 3ZWNA 4I1OA 3F6PA 4BPRA 4CMEC 2PUEA 1XVVA 2B30A 4A2WA 4LF9B 2ZJ6A 4JEIA 4XGQA 1O3YA 5FJIA 3OT1B 3S2GA 5EEGA 1R0BA 5A6SA 5ADUS 4UNIA 1OHHA 5EXEA 1REQB 2OUKA 3IUBA 1CEXA 1EDOA 3OPXA 5KC9A 1L6RA 1ZN2A 5KOYA 5IH3A 4EGFA 1ZGCA 3ETJA 4KXQA 2GGSA 3AC0A 2G76A 3A4LA 1EPUA 3H2GA 3H2YA 5DMXA 3NRCA 4WOJA 5D1HA 2MR6A 1PR0A 2I71A 1JPNA 2KE5A 3LUJA 1U7DA 3L1HA 2BFBA 1UBOS 1GCAA 2WUWE 1GRRA 2GCGA 4V0RA 5C5IA 1P77A 2H48A 3PC8C 1LRLA 5C37A 5HBRA 1SG6A 2MU1A 1UXHA 3NP7A 1Y4DE 4XRRA 3KCQA 5B6IA 3FKQA 1E79A 2O2DA 3SQDA 4IJWA 4CQJA 1JNYA 1Z82A 3ABSB 1ZK0A 1GRNA 5HKKA 1W36C 5DHAA 3NTOA 5TC4A 2V7EA 5FDFA 5F3WB 4PZUA 2ZANA 4ZDIA 3LYAA 4KLZA 4E6EA 5DI9A 5E9JA 1F1JA 1Z6GA 2QRUA 2BDTA 3ELWA 1Z0SA 4HY3A 2BZSA 1YR7A 2BFCA 3D0RA 3MCVA 5IN4A 4ZRNA 3ELBA 2Q1SA 3DO5A 1ZUNB 1OKKD 2XJ4A 4FW8A 4AJHA 2JIOA 3GLHB 4RIGA 5E7MA 4XD7D 4DLVA 3OTOB 2FSFA 2CMDA 2JJ2D 4MCIA 3GCGA 2C97A 1FJ2A 4MWEA 5INTA 1M8KA 1Z28A 3EGCA 5A0TA 3A6FA 4PFQA 1ISSA 1V71A 3FRJA 1E6UA 2EKBA 1ZY2A 4M1ZA 1JMKC 1WXHA 4MIKA 1G59A 5LWHA 2HWYA 3ZX5A 2Z95A 2QMHA 4IKPA 1LI7A 1UT6A 3FFBA 5JO0A 3F9IA 3OZSA 3CNEA 2UU9B 4IG9A 2GZMA 5BSUA 5A4JA 1MB0A 3TE6A 1S3GA 4CLEA 5KO2A 2BEKA 2YHIB 3NTQA 3TZEA 1VE5A 4JASB 4ARSA 2PYIA 1DC5A 4ZHSA 2AXQA 3S5UA 4YCLA 1Y89A 3OIUA 3PPVA 4O8CA 4D42A 1XPRA 3G7UA 1YB7A 1CY7A 1QH8B 1YR3A 1OXSC 1E8NA 1T5LA 4FMDF 2V7VA 4GEKA 4CIVA 4BC1A 4HOYA 1KOJA 1W87A 1RHMA 4EZBA 1OY1A 1ZO8A 2GTPA 4L5IA 3ZDFA 4CUJA 2PUFA 3BJEA 2IZ5A 4KBYA 4C78A 1G20E 4CKCB 2TYSB 4YXWD 1ND6A