4E4XA

Crystal structure of b-raf kinase domain in complex with a dihydropyrido[2,3-d]pyrimidinone-based inhibitor
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
274
structure length
267
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title The discovery of potent and selective pyridopyrimidin-7-one based inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 69
structure length 267
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4e4xA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4e4xA01
3SOAA 3MS9A 4RQVA 4DG2E 4DLJA 1WVYA 3Q4ZA 4BCFA 4EORA 5AR5A 2R3OA 3WZEA 3HVCA 2UZDA 3MH1A 3PXFA 4I6HA 4AOTA 3C5UA 3GGFA 3Q4TA 3WF8A 4XCUA 4PF4A 2JGZA 3EH9A 4QPMA 2WQMA 4EOJA 4RLLA 4XV9A 1PYXA 2PTKA 4FZFB 4JI9A 3O0GA 4CMOA 1R0EA 1OL2A 2OFVA 4FKTA 4OR5A 3SG8A 5FG8A 3R1SA 4YZNA 4PTGA 3WI6A 2PUUA 2W1DA 2WMTA 3NUPA 3Q9WA 3ZCLA 5M4UA 3QKKA 1V1KA 3U6HA 2RL5A 4RVLA 3WF7A 2IVUA 5AV3A 3NPCA 4BN1A 4JRNA 5EYDA 3DZQA 4C2VA 4TYJA 3TKIA 3U87A 5IPJA 4CGAA 3DAJA 3P86A 4ID7A 4FT7A 4IQ6A 2BZHB 4NUSA 4B99A 3A7HA 1ZOHA 4PPAA 4JDIA 2PE0A 1Q8YA 2ZV7A 3MH0A 4YHFA 1L3RE 4OGRA 4WSYA 2ERZE 3FXXA 4HZRA 3FJQE 3ITZA 3KEXA 3OWJA 3R7IA 3TJDA 4DFNA 3BYMA 4ZLZA 1NT2A 3BGQA 4J7BA 2B1PA 5JRQA 4RBLA 4NKSA 3ZUUA 4E6AA 2WMRA 4YPDA 3VVHA 1U4DA 3RCDA 1M52A 4AZVA 5AA8A 3P08A 5T68A 5M44A 2XNGA 3F5XA 4KSQA 3QX4A 2B52A 2PPQA 3OWLA 4BCQA 4GYGA 5LMAA 1UNHA 4X3JA 4IZ7A 4ZZOA 3S4QA 3C51A 5CNOA 3WIGA 4AW1A 3VBXA 4XMOA 5A3XA 5EQPA 2CHLA 4J1RA 3K5UA 3TZ8A 4UZDA 4M14A 1PXJA 5JMSA 1ZMWA 2ZOQA 4N0SA 4JBOA 3C4FA 4QPAA 3MFSA 4M0ZA 5T6KA 2KTYA 2RG5A 3QYZA 3KMWA 2O64A 4KIPA 4XRLA 1GIJA 1M7NA 3ZH8A 3BQRA 3UP2A 4C4JA 2R7IA 4C35A 2VWVA 3LXNA 4FTOA 4UMTA 3F2RA 4HNFA 2C1AA 2JAVA 2YISA 3DT1A 4QP1A 2FA2A 4J52A 4RRVA 4W8DA 5DIAA 3QD2B 5AM7A 3GCSA 3PIYA 4PUZA 4XOZA 3MIYA 4QT1A 4G3DA 4FI1A 3NUUA 4CQGA 3OY3A 4BTMA 2QOQA 4F08A 4HW7A 4R1YA 4MBJA 3CC6A 4UMUA 2PMOX 4AZTA 3NMUF 3HX4A 3P79A 4F09A 2XRUA 1ZZ2A 2VTPA 4YLJA 2C1BA 3KN5A 4HJOA 2KULA 3O7LD 4NCTA 5AX3A 2QODA 3F3ZA 4BC6A 3KXMA 2EB2A 3QRJA 3CSVA 4KABA 2XIRA 3G2FA 3W32A 4F7SA 2O3PA 4WHZA 1M14A 2H96A 3VO3A 5CEQA 5GIOE 2R2PA 4DBNA 4ALWA 4DFZE 3FPQA 5L2IA 3PVGA 3UYSA 5JQ5A 2QNJA 3TUCA 1APME 3FUPA 2XUUA 4FKGA 4FYNA 3SKCA 3UNZA 1DM2A 1CDKA 4LYNA 4EONA 4X2FA 5DT3A 4IX5A 4MKCA 1R0PA 2ITTA 3GP0A 4U43A 5CU6A 5L2QA 5KZ0A 3C4WA 2P3GX 2ITZA 3W2RA 4BDKA 4FSNA 4BZNA 5FBNC 1KUTA 3FMNA 4UYAA 5CALA 5I5ZA 2C0TA 4ITJA 5EOBA 2JFLA 3WARA 1SM2A 3HMIA 3PXYA 4E4NA 3DS6A 1WBVA 4YR8A 3A7FA 1ZRZA 5DWRA 4FEWA 5I9XA 2X39A 4YTFA 4MXOA 3LFFA 4XBRA 4YJOA 5FM3A 2GU8A 2I0VA 4GU9A 4L53A 5EM7A 2JC6A 4Y72A 4LOOA 3AMBA 2A4LA 3FMEA 3WBLA 3E7VA 2HY0A 4RIWB 5EFQA 3PRIA 3O8TA 3ZU7A 1ZMUA 4AT4A 3A8XA 2IVTA 2UW4A 2H34A 1U46A 4IJPA 4NEUA 5DOSA 1WMKA 5FEDA 5CU2A 5HG9A 1KSWA 1KE8A 3F5UA 4KINA 1RJBA 3A2CA 3DPKA 4CLJA 4MF0A 5DRBA 4D4SA 3LFAA 5IQHA 2DQ7X 4FNYA 2UW0A 4FTLA 4PY1A 4Z55A 5HIEA 1DS5A 1OBGA 4M68A 4BB4A 4NL0A 3EZVA 5DNRA 3FLQA 4GUEA 3GCPA 2JKMA 3ZMMA 3RAKA 1OPKA 4YC8A 2O0UA 3NIEA 4XG4A 4MYGA 2BRBA 3ZBXA 4GG7A 2FGIA 2J7TA 5IQBA 3NEWA 4EYMA 4AT5A 4K9YA 5JZJA 5BVNA 3A60A 2IVVA 5GNKA 1PY5A 2GNIA 4V0GB 3SDJA 3MV5A 4J96A 2OXXA 3R04A 4TNBA 3PE1A 4GT3A 1BX6A 3W2SA 4XG8A 4JNWA 4R8QA 4YO6A 4CZTA 2GFCA 4D55A 1JKLA 5EI6A 5JFWA 3QTWA 4I0SA 3R9DA 4BDGA 4JR7A 4FODA 3LXKA 5DR6A 3ZLWA 5KBRA 5ANJA 4QO9A 4FEXA 1XQZA 5HCXA 2XK9A 3TT0A 4IBMA 4FA2A 3D4QA 4CV8A 4ACDA 4ZY5A 2CCHA 3BYVA 4IVDA 3QQFA 1VYZA 3C50A 5G1XA 1SVHA 3V6RA 4YLKA 4C4FA 4PPCA 3MJ1A 4ZAUA 3S3IA 3PVUA 2XVDA 4FIGA 4FV3A 3RHKA 1J3HA 3VHKA 2W17A 3V5LA 5E8SA 2W1IA 3F66A 2G9XA 2OZAB 4YBKA 1TVOA 2J0MB 2WIHA 3EWHA 4FVRA 2ETRA 4FTAA 5D41A 5HESA 2B9JA 1GNGA 3MA6A 2OGVA 2PZYA 3JY9A 4KBCA 4FV5A 4MNEB 4FSYA 4LOQA 4WG4A 2CDZA 5C8NA 4ACCA 3FLNC 4MX9A 4DC2A 2DUVA 1H26A 3EQFA 4IZAA 4K0YA 3FQEA 5AV2A 3ZLSA 2FO0A 2VWWA 3MDYA 3AC5A 3VNTA 1XBCA 2OZOA 4X2JA 5IDNA 5AAGA 4HYUA 2XNNA 2WKMA 2HZ0A 4EBVA 1WZYA 5CNNA 2B0QA 3F3UA 5AR8A 3RPRA 2JKQA 4IC7A 4WKQA 4F9CA 4UMRA 5AP1A 3KULA 4E5WA 3NUSA 1ZOEA 4BHZA 1Q8ZA 3ZTXA 4YJNA 3W2PA 4FICA 4GMYA 4YMJA 3DXQA 4U79A 3D7TB 3MA3A 2WAJA 5DR2A 2BFXA 5LWMA 3FHRA 3WZDA 2XYNA 5CANA 2B9IA 3MFRA 4BHNA 4Z7HA 1YOJA 1Q8UA 3CQUA 1YWRA 2VO3A 3LXPA 3MVMA 4K2RA 4GV1A 4ACGA 3BU6A 2I0YA 3BV2A 3NX8A 5EM5A 3V8SA 3LKMA 1OL7A 3U6JA 3P5KA 3LLAA 4DEDA 4MXYA 1Q97A 5E1SA 2C3IB 3D15A 4F9WA 2GNLA 3DAKA 4ITIA 5A4CA 2CKQA 4MAOA 4QMQA 1PF8A 3FYJX 3P7AA 1PMNA 4G1WA 4BRXA 1OKZA 1XBBA 2Z8CA 3PWDA 3ULIA 4BYIA 3R2BA 3Q4CA 5GJGA 4FUXA 4J53A 2ZMCA 3E8NA 3UC4A 1YDSE 2OKRA 2XKDA 3F69A 2A2AA 3JVSA 2J0KA 4L52A 4O21A 5EI8A 2YCFA 3QCSA 5DT4A 4NTTA 3ET7A 2ITXA 3FLWA 3G5DA 3H30A 3MY0A 1IRKA 1Q8TA 5CY3A 4NCTC 2I0HA 3OW3A 3R6XA 3CJGA 2ZV2A 5CXHA 2J4ZA 3F5GA 1MRYA 2VWBA 3LXLA 4O7TA 3KRRA 3TUDA 4HPUE 5I3RA 3AQVA 4OUCA 5J9YA 3QQKA 1XWSA 3M1SA 4ANOA 1B39A 3R8ZA 2JIIA 3KMUA 4IE9A 2GQGA 2EU9A 4F1MA 3KXHA 4BVUA 3VIDA 3H3CA 3DTCA 1YKRA 2WQBA 4N6YA 2JDTA 4TTHB 3CBLA 4DFXE 1U54B 2UVYA 5HX8A 4FTMA 4HVIA 2XIZA 4C3FA 1SNXA 4I22A 1UU8A 4FL1A 3UIBA 2OJJA 3WILA 3MGYA 5TOZA 3EFLA 4DEIA 4JDKA 5IUHA 2G2IA 2V7AA 4BI1A 3ATTA 1W7HA 1L8TA 5I3OA 3ZC5A 3U9NA 4E93A 4IB5A 4O27B 3CCNA 3B2WA 4DGLC 2W96B 2CGWA 3IONA 4C58A 2XCKA 2VUWA 4CFUA 4X2NA 4TYHB 3IQ7A 3HRFA 4QQ5A 4ZOGA 4FL3A 5IG1A 2QHMA 4DINA 4JG7A 2R3NA 4D4RA 2C5NA 3SQQA 4QNAA 4TWOA 4ZSAA 2QI8A 3DBCA 1JBPE 4ZY6A 3O2MA 3FI3A 4EOKA 4C36A 3HV5A 2YIQA 3BYOA 3WYYA 4L01A 4GCJA 4K18A 4CFFA 5BVDA 3EKKA 3NCZA 3D5WA 4RMZA 4XHKB 4A9YA 2QHNA 4FOCA 3OFMA 1PXIA 3BWJA 4PDSA 3R02A 1O9UA 3BCEA 4BCPA 5KMKA 4FG9A 2E9UA 4I94A 5A6NA 2YA9A 3GXLA 4O81A 4XP3A 4RIXA 5LQFA 2OICA 4A4XA 3GC8A 3NYXA 4EK6A 4I23A 4HZSA 5HNIX 2GFSA 3C1XA 3FL4A 2V55A 3HYHA 4RG0A 3RK9A 4EK5A 4B7TA 4G9RA 2YAKA 2NP8A 3ZO3A 5KUPA 3RWQA 4WNPA 2W06A 3REPA 2B55A 5K4JA 1OBDA 3EN6A 5HKMA 4P2KA 1R39A 3O50A 2JDSA 3MWUA 3NYOA 1ZY4A 3CTJA 1K9AA 1WBOA 2QO2A 3KGAA 4MVFA 3QHWA 3I81A 4MXAA 5HICA 2R4BA 5LCJA 3SA0A 1Q8WA 5ETFA 1GIHA 3FSKA 3IGOA 3ZUTA 5FUTA 4RQKA 3UOKA 1BL7A 5IEVA 3DFCB 4C4IA 4O0WA 4J98A 2WFYA 3VBQA 3LQ8A 4G3EA 4XH6A 2UZLA 2F7EE 4XRJA 3FKNA 3UOLA 3AMYA 3QF9A 2WEVA 2XK8A 4IWQA 4A4LA 4C61A 4EI4A 4R3RA 4PWNA 2Z02A 4OLIA 3SXRA 1X8BA 2W9FB 3LVPA 5CEIA 3TL8A 4LRKA 4C8BA 4EOIA 4AWIA 3I0QA 3ZSIA 4D9UA 3F2NA 1UU9A 2VTAA 3H9OA 2UZVA 4RSSA 4LL0A 4TYEA 3ZZEA 3QTUA 5ANEA 2QKWB 2YABA 3V8TA 3L1SA 1NVRA 1BKXA 3ORXA 2C5OA 1RE8A 3DKGA 4YZDA 2W5BA 1K2PA 4AE9A 4GJ3A 4GRBA 4NFMA 3W2QA 3NWWA 5KHXA 3MVJA 4DE4A 2P55A 2SRCA 3H9RA 3PJCA 4FTRA 3MTFA 1QL6A 4O0XA 4IM2A 4AAAA 3AGLA 3UOJA 4DEEA 4U6RA 4MEDA 5CI6A 5KMNA 4DT8A 3EFJA 3F61A 4RT7A 4F99A 1IAHA 2Y4IB 4FSMA 4QMXA 2BZIB 4EQUA 2VWUA 5DH3A 4R77A 4FC0A 5HCZA 5LXMA 1BLXA 1YWVA 3C0HA 4UWBA 5GHVA 4M15A 4RJ5A 5IUIA 3MPTA 3VS3A 4B4LA 4R1VA 5HLPA 3MY1A 3GFWA 4WIHA 2GHGA 2VX3A 3VBTA 2C0OA 3AD4A 3OP5A 4CQEA 2CLQA 2W4JA 2X9FA 3FY2A 4D4VA 4EOQA 4YLLA 4H3QA 2PK9A 2R7BA 3OOMA 1YWNA 4CSVA 3KQ7A 5ANIA 4HYSA 3EN7A 3Q9ZA 3ZFXA 4ASDA 4CXAA 4RC2A 4QMMA 2F7XE 2Z60A 3OC1A 3P23A 4M8TA 3K3IA 4CKIA 1W83A 4DH3A 2QU6A 1BI8A 5JRSA 3RWPA 3TDVA 2Q0BA 3SW4A 3IOPA 4I5MA 2O63A 5E8UA 3LCSA 4ZTRA 3GENA 5IQGA 3UNKA 3FZSA 3TV6A 4Z3VA 3OBJA 2Y9QA 3OD6X 2WQNA 4C62A 4JBQA 3DQWA 4AOJA 2IW9A 4G6LA 4JBVA 3W18A 3DNEA 3TEIA 4C02A 1QPJA 4IWPA 1QPEA 3BELA 4F7JA 1XBAA 4WG3A 5ACBC 3TIYA 1UKIA 1PMEA 1XH7A 3D9VA 5K0XA 4I6BA 3OT3A 4HVDA 2X2LA 4R78A 4GFMA 4L3JA 3MTLA 3DLZA 2C6TA 5AR7A 1XH5A 4AZEA 5CEKA 4NFNA 4F64A 1KE5A 3IO7A 5DG5A 3G6GA 4KKHA 4NWMA 4P7EA 3GQIA 5FQDC 4CKRA 5JSMA 3B2TA 3ZRMA 1CKIA 3UYTA 4KIOA 2LGCA 2O65A 1U59A 5IA3A 1CTPE 3OWKA 2GS6A 2J51A 3KB7A 4A9UA 1R1WA 2Y6OA 4EL9A 3KVXA 4KIKA 3LAUA 1UKHA 2JKKA 3JUHA 3D5UA 2OXDA 3P1AA 4QP9A 4OAUC 2C6LA 4FTJA 4AUAA 3LIJA 4E1ZA 4FEQA 2QOOA 4GW8A 5K5NA 2BAJA 3IW5A 1ZXEA 4G6NA 3AXWA 5ETIA 3BU3A 3UZPA 4TYIA 4G16A 5M56A 4KKGA 3FI8A 3UE4A 5H2UA 4F7NA 3LMHA 2XIXA 4FF8A 5C27A 3DTWA 5F9EA 4CCUA 2ITPA 4E5BA 3UO5A 2WMXA 1P4OA 3ZRKA 4F9BA 4U44A 4E6DA 2GQSA 2W1FA 4FV4A 2FUMA 4D2SA 5AWMA 4O1PA 5FP5A 4IX6A 2R3MA 3DZOA 5JT2A 5CZHA 4GFGA 2Y6MA 4IW0A 3QRTA 2X6EA 5EDQA 5JFVA 4EJ7A 4FVPA 1SYKA 4PP7A 3WIKA 3HV3A 1OM1A 1OVEA 1QPCA 1URCA 3FXWA 3PJ8A 4M84A 4ZJJA 3WZJA 3MB6A 5FXQA 4BTJA 2FH9A 4XX9A 5AIRA 4GVAA 5CT7A 2AYPA 2QCSA 4YNOA 4XEYA 4YJRA 1OITA 3CQEA 4L6QA 3VULA 3G9LX 2ESMA 3ZSGA 4WA9A 2GNFA 4UX9A 1XR1A 3R22A 2QD9A 3BHTA 4J8NA 4YC6A 5CEOA 1GZKA 2A27A 5FXRA 2PVJA 2WB8A 3TZ7A 3FMJA 3ZRLA 4A9RA 3H4JA 2IW6A 2R0IA 4IB3A 3CJFA 4L9IA 4O82A 2HXLA 2ZDTA 1E1VA 2XKEA 3H0YA 4F9AA 2HK5A 2HXQA 5FM2A 5FTOA 1OL5A 4EH4A 4U5JA 3O71A 4CFXA 2WOTA 3QTXA 4QP2A 5HX6A 2CNQA 2XNOA 3DK6A 4HCTA 4QQJA 5AMNA 4AW0A 4WSQA 5GZAA 3DB8A 5L8KA 3IECA 4AW2A 2YLFA 4RJ4A 2OBJA 4EH3A 3DBFA 3PIZA 4X2KA 1Q61A 3A7JA 3FL5A 4FX3A 4EH9A 5AAEA 3EJ1A 3NZ0A 1MUOA 3PP1A 3W33A 2WMSA 3R1NA 5BVEA 1JSVA 3FWQA 2GTNA 4Y5QA 3VUMA 2QU5A 4OT6A 4QMPA 4AGWA 4D5KA 4EHGA 5CU0A 4YTIA 4KUJA 4X6QC 1NVSA 2OSCA 3AC8A 4YHJA 4KRDA 4F0FA 4IADA 2JDVA 2VGOA 4GH2A 4GIIA 4L45A 4OTFA 3AD6A 5CQUA 3RCJA 3WYXA 3BLQA 3JVRA 1YI6A 1WCCA 3OEFX 2JBOA 4Y46A 2QOBA 4BGGA 4WBOA 4KB8A 2JD5A 3RTPA 4BCOA 4E5AX 2WTJA 2UZBA 4M69B 3V6SA 5IF1A 2CNVA 2E2BA 5HNBA 3OTUA 4HVGA 3JS2A 4QRCA 3IW4A 2CSNA 2E9NA 5FRIA 3IDBA 4MXZA 5DT0A 2HZIA 4YC3A 2C3LA 3JYAA 3B8RA 5EI2A 5AAFA 2VO7A 4FSZA 1OKYA 3I79A 4OTGA 4NYEA 2WHBA 1KV2A 3ZSHA 3QTIA 3R30A 4GUBA 5AUXA 3QTRA 4CV9A 1Q41A 2BMCA 3A4PA 4JG6A 4WT6A 4EKKA 5D7VA 4RVTA 5KX8A 5I9WA 2PY3A 5DFPA 2PZIA 5I9ZA 1REKA 4RJ6A 2PVHA 2PULA 4QMVA 2YN8A 4NT4A 2O5KA 2WMAA 3FY0A 4O1OA 2WTCA 3NDMA 3CPBA 5AUUA 4XJ0A 5F94A 3TCPA 3QUPA 5IEXA 4PNKA 4EJNA 4CD0A 3SW7A 2EB3A 2BAKA 2BKKA 3AC2A 3GT8A 4WNOA 4S2ZA 4QNYA 3W10A 3EIDA 2CLXA 1G3NA 4C38A 4BGHA 4M7IA 3VBWA 4QTDA 3ROCA 4DGMA 3T9IA 1OGUA 3BZ3A 5DR9A 3CKXA 4Q5EA 2X4FA 3VW6A 3AMAA 5JQ8A 4I92A 4ZEGA 3TV4A 4DEHA 1J1CA 1Q4LA 1E9HA 2HOGA 2P2HA 2XKCA 3I6WA 1REJA 3SOCA 3T3UA 3VUGA 4DEBA 5IQAA 4AFEA 1P2AA 4JQ7A 4Y5HA 4R6VA 4FSWA 4ZTSA 3WF6A 2WMUA 2ZM3A 1YQJA 1YRPA 2WELA 3BYUA 5CSWA 4EHVA 5LOHA 1A48A 2HAKA 3LCTA 3UTOA 1B6CB 4JX7A 5EKNA 4UWYA 3VUKA 3UVPA 4PMPA 1MRVA 2YIRA 3B8QA 4CMUA 4D2WA 4O22A 5LVMA 4R3CA 3U55A 2F7ZE 3DV3A 4GT5A 3RNIA 3FV8A 2HW7A 3FSFA 4JIAA 3U9CA 1W98A 5CVHA 2LAVA 4CCBA 3QXPA 2AC3A 4BCIA 5CWZA 1UNGA 2ITYA 4L7SA 4OTRA 5K0KA 4RC3A 3QYWA 4A7CA 3HAMA 4RJ7A 4ZTMA 1J7UA 5I0BA 3EQIA 3DAEA 2BDWA 1OKVA 3UPZA 4EH2A 4ANNA 3EL7A 1MRUA 5L6WL 4BCHA 1LEWA 3RBWA 5L2SA 2Q0NA 4RA4A 4I6FA 3CS9A 1DI8A 5HQ0A 1VR2A 3IG7A 5IA5A 2E9PA 3Q3BA 4CFNA 2HYYA 2WZJA 4G5PA 3PA5A 4O96A 4O83A 3QZHA 4A07A 3GU7A 5IA0A 4I5PA 4EHEA 3R01A 4O0SA 3QBNA 4LG4A 3BV3A 1B38A 2PMNX 3JY0A 4C4EA 3COHA 3E92A 4AZSA 4V05A 5B0XA 5HG5A 3VRZA 4B0GA 3OOGA 5HG7A 1IR3A 4FKSA 1ZZLA 4QP3A 2QOFA 2WD1A 3MW1A 4QYFA 4Y95A 3E5AA 5IEYA 3UP7A 4O91A 4QPSA 2IN6A 3MPAA 2JKOA 3BBTB 4FV0A 3ZONA 3U6IA 3N4UA 2BAQA 2HCKA 2X8EA 5E8WA 3RPSA 1Y6AA 4ACHA 3Q53A 4NZWB 5HE2A 2WU6A 1ZOGA 4C59A 4YGAA 5D7AA 4EOOA 2BDJA 3DGKA 3NR9A 1OI9A 4BDCA 3HA8A 4BR3A 5E4HA 4UBAA 3OROA 1UVRA 3RNYA 5AP6A 4IXPA 4UWCA 4DHFA 5AA9A 4R3PA 1SNUA 3TM0A 1GZNA 1UV5A 3G9NA 4GIHA 3CGOA 2C69A 4RC4A 3QTQA 4IAIA 1CKJA 5D12A 2VO0A 3RPYA 1OPJA 2YITA 3R2YA 1NA7A 4M3QA 5E7RA 4U80A 5KMLA 3DFAA 3R28A 4W9WA 2WTKB 2GNGA 3R7YA 1JOWB 3BE2A 2CKOA 3GB2A 1T45A 4NU1A 2HZ4A 3ZFMA 4AA5A 2ZDUA 5J1WA 4U45A 4FG8A 3QA8A 4JXFA 4H3BA 2G2FA 2W1ZA 4F0GA 3RZFA 1QPDA 1H24A 2EWAA 1Z9XA 5LMKA 2W7XA 3Q4UA 3OUNB 3C4ZA 4PV0A 3T8OA 3HP2A 5DGZA 4HGTA 3EQBA 1H1WA 3LZBA 3QKMA 2Y8OA 1FBNA 2XA4A 5KMOA 3VUIA 3KC3A 4EC8A 3H9FA 2C3KA 4DTBA 4IX4A 3OW4A 4F1OA 3DBEA 4JL9A 5ANKA 3LQ3A 4R5YA 3OY1A 5HBJA 5LVOA 1QMZA 2OH4A 4ZTNA 2FYSA 1M17A 5ETAA 3ATSA 3PXRA 1URWA 5E1EA 4IIRA 4BKYA 3MH2A 1TKIA 5L8LA 2VX0A 2HY81 3UIMA 4V04A 5GZ8A 4MD8E 2DS1A 3HUBA 1KOBA 4NIFB 1VYWA 5IQFA 5CAQA 1P5EA 4RX8A 3W2CA 4I5CA 3FMKA 3VJOA 5BUEA 4J8MA 4RIWA 4IAAA 1A06A 4AOIA 3OCGA 4WO5A 5C8MA 2A1AB 3GI3A 3QHRA 4DN5A 5DEYA 2B54A 4FV7A 5ITAA 1PXMA 3ZBFA 2W1EA 3MVLA 2NNWB 3PY1A 2BHHA 4CTCA 1HCLA 3FKLA 3D7ZA 2RFNA 3WZKA 3Q6WA 4BBMA 1PRYA 5AFVA 1CSNA 4RPVA 4IC8A 4FIFA 3KRWA 3RPVA 2OU7A 1PMVA 4GK3A 4PL4A 2XB7A 4EOSA 4C4GA 3PJ2A 2OJ9A 3FKOA 5HD4A 4F63A 1VZOA 3IW6A 3PY0A 1HOWA 2FVDA 4O0UA 5ANOA 5HNGA 5BNJA 4V0GA 3HRBA 5C8KA 5K5XA 3HEGA 4M13A 3F3WA 1PJKA 5DE2A 3SX9A 2BRNA 2VD5A 3KF4A 4X3FB 5GIPE 3QCYA 3TWJA 2C6EA 4AGCA 3ORNA 2BTSA 3DOGA 4FUYA 4FGBA 3O51A 2WPAA 3UIUA 2C4GA 5CAOA 4RVKA 2YM4A 1YW2A 1YXVA 4ACMA 1NXKA 3DNDA 3QU0A 3PE2A 4YJTA 4YZMA 4CRLA 5CLPA 4G6OA 5GINE 4TT7A 3R9NA 1WBWA 4AU8A 1H0WA 1WFCA 2CPKE 3TUBA 4ASEA 3A62A 4YTHA 1M7QA 5J95A 2E9OA 3NUNA 4AQCA 1WVWA 1AGWA 2OZAA 3LFCA 4IZYA 5FEEA 4JJRA 3VS7A 3PXQA 4CVAA 3FHIA 4DH8A 5L3AA 1ZY5A 3FMHA 2IJMA 1W0XC 2EXCX 4MNEA 4N70A 2C6OA 4E20A 2W5HA 2YDJA 4QMSA 4FEUA 4FTIA 2X4ZA 5IKWA 3FC1X 4RFYA 4J95A 4FKQA 2ZAZA 1VEBA 2XM9A 4O2ZA 4RJ8A 3RMFA 3P7CA 2WQOA 3W55A 5M55A 3PPKA 3VAPA 5IA2A 5HOAA 5L6PA 4DITA 3UMWA 3SXSA 3VBVA 3DBQA 3ODZX 1PXNA 4CT1A 5I9UA 3KRXA 2IZUA 4BCJA 5BVWA 3ZDIA 1IG1A 2YM5A 3GNIB 3VS5A 3LM0A 1MQBA 4BBFA 4ERKA 1G8AA 3CLYA 3D7TA 1IA8A 3EQPA 1SMHA 3I7BA 4FKJA 4HGLA 3FC2A 2CCIA 3KRLA 2XBAA 2G01A 4LRMA 5FBOA 4UN0C 4F9YA 2ITUA 5FP6A 3P9JA 4BCKA 3UO6A 1LUFA 5DI1A 1GZ8A 2YM7A 4NSTA 3R00A 4FKIA 3P0MA 4FYOA 4RWLA 3S2PA 4S32A 2OWBA 3QWJA 2YWVA 5AADA 3A61A 3NSZA 4XG2A 3R7OA 3EN4A 5AP3A 5GJDA 1ZAOA 2YACA 3NW5A 3ROYA 2EXMA 5L2TA 2JBPA 3BQCA 5M4CA 3LMIA 5A54A 1W82A 5C26A 5M06A 3KCKA 3LLTA 3PXKA 3E87A 3NVMB 5KKRC 5C4KA 4DH5A 3SRVB 2XF0A 2YM6A 2PYWA 4ENXA 4K8AA 5DRDA 5CQWA 4QP8A 3GFEA 2X2MA 4BDEA 5F20A 3MESA 3D5VA 3SVVA 4ZS0A 4AA0A 4UMQA 4FT0A 1DAWA 1FMOE 5AP2A 4KS8A 2F4JA 2EVAA 2J5FA 4H1JA 1FINA 4TWNA 4G3CA 3G51A 4OBOA 5D1JA 4M12A 5EW8A 3PVBA 5EDPA 4Q2AA 3HV4A 4ANLA 4YO4A 3N4VA 2PUIA 3PG1A 4USFA 3BGZA 3KVWA 2WQEA 5IUGA 1W8CA 2XEYA 3ZM9A 4W9XA 2X8IA 5LMKC 4FVQA 4Y8DA 2BVAA 3QLGA 2BRHA 3AOXA 4NM5A 5E8VA 4D2RA 1H00A 4O7LA 1FGKA 1U54A 4NW6A 3UJGA 3KXGA 4I6QA 4DH1A 3SD0A 4O0RA 4A9TA 1H1SA 3D2IA 2PVNA 3HDMA 3ORPA 4HYIA 2BR1A 4WBBB 2RFEA 4D0XA 3NNWA 4LGHA 4FZ7A 4B8MA 4LM5A 5LWNA 1XH8A 2C6DA 3PPZA 4QD6A 5CZIA 3QUEA 5HBEA 4GKIA 4ASZA 1PXOA 1Q5KA 3PJ3A 1Q24A 4TYHA 2ZB1A 4AP7A 3QGYA 4YTCA 5J8IA 4BCMA 4BZDA 3CKWA 2PVRA 3LM5A 4FV8A 3CTQA 4CFVA 5JH6A 1LPUA 4BIDA 4DLIA 2QR7A 2QG5A 3JPVA 3R21A 1OL1A 4NM3A 4WNKA 1LEZA 3FI4A 4N6ZA 5I9VA 4L42A 4JAJA 3BKBA 3THBA 2DWBA 4ONAA 4PTEA 5E8ZA 3TNHA 4D4YA 4FE2A 3Q04A 3V5JA 1O6KA 2JEDA 2PMIA 2R3GA 4GL9A 4DFLA 2F2UA 3FZRA 2R64A 2X1NA 4UMPA 4QMUA 3LQ5A 4LFIA 3POOA 1PW2A 3EHAA 3PVWA 3DXPA 4YUQA 4FSUA 1NVQA 2VTJA 4L44A 4JOAA 3FZTA 3OXZA 3H0ZA 2GTMA 3IW8A 3EQGA 1Z57A 3R8PA 3ZHPC 2RSVA 4EUTA 4FTCA 3FXZA 2R3QA 4LRJA 3QUDA 2XJ0A 5FWKK 3Q2MA 3UVQA 4IH8A 4FKLA 4MQ2A 4ALVA 4EZ5A 1OUYA 1BI7A 1TQPA 4BKJA 1H1QA 3C4EA 3FZ1A 3ZO1A 2PU8A 3PP0A 5LVLA 3HAVA 4QMYA 2Z7LA 2PVKA 1XJDA 3DJ5A 4D2VA 4YBJA 5KE0A 4DYMA 1CMKE 4UXLA 3TTIA 1M2QA 1UNLA 4NTSA 2YLEA 2PE1A 2QO9A 4L43A 3UQFA 2R3KA 4U3YA 3BBWA 2C5YA 2YZAA 2C68A 1H8FA 3ANQA 4GK4A 4BYJA 5CU3A 3HMPA 5A4QA 2F9GA 3MYGA 3R7VA 3MH3A 3DXNA 1JSTA 3QA0A 2QOHA 2VNYA 4UYNA 2I0EA 5EG3A 5AUWA 5G6VA 3UO4A 2I7QA 3G33A 2IG7A 3DJ7A 5A4LA 3CY2A 4BKZA 4AF3A 4PPBA 4LGGA 2GNJA 2IZRA 4O86A 5CAVA 4HYHA 4YU2A 5EYCA 3E3BX 3MI9A 4RGJA 4E6QA 5A9UA 2QQ7A 1JPAA 3LFQA 3VUDA 3R1YA 4ERWA 1HCKA 4BDFA 3ACKA 4IHPA 4L3PA 3TI1A 3VS6A 3NW6A 3LPBA 3A8WA 2ERKA 3KKVA 2QKRA 2X7OA 4V01A 2YERA 4ZLYA 3JR1A 5HVYA 4CFMA 3DA6A 3GC0A 4JDJA 1VJYA 2NRYA 3E64A 4WRSA 3LJ2A 4IVCA 2XK6A 3L9NA 1OECA 4OW8A 3TNPC 2GDOA 3NLBA 4TY1A 4KWPA 5TF9A 3D2KA 4U8ZA 5KO1A 2ZVAA 2VGPA 4DT9A 4H36A 3R7EA 4AT3A 5AUTA 4DBXA 3OS3A 3SXFA 3GOPA 3II5A 3OZ6A 4U40A 4EZ7A 4O7YA 2J50A 3NAYA 1JLUE 4P5QA 5AV0A 5IMXA 4Z7GA 5C4LA 3OWPA 2GHMA 4M0YA 4DGGA 1P14A 1SZMA 1ZYDA 3IGGA 4NJDA 3R73A 3T3VA 4D2PA 4X21A 4ZSEA 3V04A 2HENA 2IWIA 4Y83A 1J7LA 1IA9A 2CKPA 4G3FA 2JFMA 5E91A 5IA4A 3QWKA 3DCVA 3BRBA 5C9CA 3T9TA 4BDJA 4PMMA 3BU5A 4NW5A 4X7QA 2ACXA 3ZDUA 5B7VA 3DK7A 3LCOA 4PDPA 1UU3A 2XM8A 3QD0A 3M2WA 4LL5A 3MB7A 5IQCA 4TNDA 4QMWA 1I44A 4ARKA 2WNTA 3F7ZA 2J0IA 4XV2A 3VS1A 4ZIMA 3WOWA 3O7LB 3UDBA 4AACA 4WOVA 4JQ8A 3KL8A 3KFAA 3OVVA 1GOLA 3F6XA 4I4FA 4C33A 5CENA 3TN8A 5CYIA 4AN3A 5AV1A 3MVHA 4ANMA 2YM8A 3DK3A 5EK7A 5TT7A 2V62A 3ZLYA 3HECA 3L9PA 4DFBA 3P7BA 1RQQA 5EH0A 3O17A 2X8DA 4JRVA 1R78A 3R71A 3TZ9A 4DEAA 2R0UA 2YCSA 4RZVA 4QP4A 1PKDA 3R9RA 3EOCA 3LW0A 1F0QA 5TO8A 3PSCA 4RFMA 2OH0E 4I41A 1JQHA 3AD5A 4CYIA 4RIYB 1JNKA 2BPMA 1WAKA 5ACKA 3RVGA 4IAYA 3FBVA 3BEGA 4FEVA 2OW3A 1Q62A 4CMTA 3FLZA 5IZFA 4CKJA 4TRLA 3A99A 5DHJA 1LR4A 4OT5A 5H8GA 4U3ZA 2W9ZB 2YAAA 5HCYA 4C2WA 4YHTA 4PL3A 3FMMA 5HI2A 4EWHA 1RW8A 3COMA 3DB6A 3SG9A 4X2GA 4CFWA 4F1TA 5AX9A 1ZYLA 5HE1A 3D5XA 3I1AA 5C03A 1TQMA 4MWIA 5I9YA 3ZUVA 4G34A 5CEMA 1I09A 5JFXA 3Q52A 4IACA 3GU8A 5GZ9A 1H27A 4BL1A 5JFSA 2XJ2A 1XKKA 5E8XA 2C6IA 2J6MA 3V5WA 4HOKA 5DN3A 2VTHA 4KAOA 1MQ4A 4FGRA 1JKTA 3AC3A 5HVJA 3UG1A 3QQHA 3OCBA 4G3GA 3D0EA 3HV6A 3MN3A 3PRFA 4ZLOA 3BI6A 5A4EA 5FTGA 2X6DA 4BCGA 5IQDA 3V8WA 2ITQA 2QOCA 3LMGA 3L8PA 3EZRA 3ERKA 3QFVA 4H1MA 4BGQA 3KY2A 4IFGA 4BWKA 3HKOA 3DY7A 4MNFA 2OLCA 4O7NA 4XV3A 2WMQA 4FL2A 4WRGA 3VBYA 1FGIA 2PUPA 1ZMVA 3ORIA 4G17A 3S95A 1G5SA 4OTWA 4JS8A 3ZM4A 4IVAA 4E26A 4EUUA 3BHUA 3MSSA 5JK3A 2C5VA 3Q96A 2YIWA 1YI4A 3O96A 2XK3A 4I4EA 3FMDA 3VWAA 2XBJA 3AT2A 2PHKA 3IDCA 5CF5A 1PXPA 3HLLA 3UQCA 2P2IA 4N4SA 1YHVA 5AP4A 2RFSA 4BDHA 4QMNA 2BZKB 5BUJA 5HLNA 4AFJA 4MCVA 5H3QA 3VUTA 1KE7A 4S33A 3VS2A 4LV8A 5K3YA 5BVFA 4OAVB 4P90A 3ZS5A 4NJ3A 4FTNA 4TPTA 4XG3A 5CX9A 1MP8A 5J9LA 2QURA 3DKCA 5AR2A 2IVSA 4PP9A 4ZTHA 3E8DA 5D10A 2UZTA 2NO3A 5FGKA 3R7UA 3VW8A 5KMMA 1AQ1A 4GKHA 2Z7RA 3ALOA 3MJ2A 5DMZA 5HEZA 2XZSA 5AR4A 5F4NA 3UIXA 1OIYA 4FIIA 5EDRA 3UODA 2QOKA 4TW9A 2VTIA 3IOKA 1OPLA 2I40A 4QYGA 2ITNA 3TDWA 1Y8YA 4PRJA 2Z7QA 3ZYAA 4GS6A 3EYHA 3VUHA 4K77A 5EHYA 4W4XA 4GU6A 5AIKA 3M42A 2W1GA 4YP8A 3V5TA 3WE4A 4O0YA 3OMVA 4EOPA 3BEAA 3A7GA 4BWXA 2XKFA 1J7IA 2ZV9A 2DYLA 2HW6A 1U5QA 4EH5A 4DA5A 2OIBA 3ORLA 4GJ2A 5K9IA 1S9IA 3QZGA 4PMTA 4S34A 3OUKA 4O7RA 3PLAE 3E62A 1H08A 3L8SA 4JIKA 4FV2A 4UALA 2XRWA 3KU2A 3I0OA 4LMUA 4PX6A 4IVBA 4C34A 5IQIA 4H39A 2XEZA 3OTVA 5IA1A 5AM6A 5CT0A 1Q3WA 3R9OA 2C0IA 3TACA 5BVOA 3NYVA 4ANSA 4I1ZA 4F0IA 3F2AA 4JQEA 1P4FA 2C6MA 4CRSA 2RKUA 4M69A 3TNQB 2WTWA 3UBDA 4B8LA 3S00A 1Y91A 2BIYA 3Q9XA 3H10A 4ITHA 1KE6A 3QCXA 4AG8A 1YVJA 2Y4IC 3PG3A 3VQHA 2UZWE 3JXWA 3TIZA 5JGAA 3GBZA 3ELJA 1JKKA 3KMMA 4FSRA 4RWIA 4UZHA 1JSUA 3BIZA 3R63A 3NGAA 4JLCA 4KNBA 1IAJA 3PY3A 5DBXA 4KS7A 3WF9A 2G2HA 4DGOA 3RPOA 4O0TA 3EL8A 2XYUA 3DKFA 3E63A 1F3MC 3QTSA 4FNZA 4KKEA 3G90X 3GCQA 4BZOA 4ZXTA 3LJ1A 2Y4PA 3UPXA 5GJFA 1XO2B 3F7WA 1DI9A 2XNBA 4GVJA 4WG5A 5IH4A 5KMIA 2ITOA 3BHYA 3GQLA 4XG9A 4HGSA 3QX2A 1GAGA 3NNUA 2OXYA 1V0PA 1YXSA 5HORA 3OG7A 4FT5A 4O7ZA 3TJCA 3UQGA 1T46A 2OIQA 5CAPA 3UVRA 4APCA 2OK1A 1F5QA 2C6KA 5J79A 5CASA 3C9WA 4FNXA 1CM8A 4XG6A 5AUZA 2J0LA 5H8BA 2HIWA 4N57A 1ATPE 2QR8A 3QCQA 4YJVA 5BQ0A 5JEBA 2BTRA 4DAWA 5I4NA 1H25A 4QMOA 3R8LA 3BX5A 3EMGA 4U0IA 2UW8A 3DQXA 3P78A 4LI5A 4RVMA 3I60A 2V7OA 4QP7A 2JLDA 1SVGA 5EHOA 2JITA 1IASA 3CR0A 5DEWA 3BLRA 1E1XA 3AC4A 3Q9YA 4D0WA 1JKSA 3C0IA 4E4XA 5M4IA 5FXSA 2X2KA 1UWJA 3QD3A 3IDPA 2H9VA 3LFDA 3I4BA 3I5ZA 1OIUA 2XCHA 4JVGA 5CSVA 3MIAA 4EBWA 5LJJA 3KA0A 3COIA 2BIKB 4EK4A 4E3CA 5IU2A 4EZ3A 5HVKA 4EK8A 2O2UA 1STCE 4I3ZA 2VTSA 4D58A 4D1XA 3PSBA 3TKUA 2F57A 2WMWA 3GVUA 4JT3A 4APPA 4RZWA 3PJ1A 5HU9A 4B9DA 5C01A 2BZJA 4ORKA 1BUHA 3QLFA 2FSLX 3SHEA 4UV0A 2EUFB 3RINA 3TG1A 5CTPA 2XIKA 4H3PA 3COKA 3C5IA 2VTOA 2ZM1A 2J0JA 3VRYA 4A4OA 4HVSA 5AEPA 2BUJA 3ENHA 3V51A 3CP9A 2QOLA 4F7LA 2FB8A 5IQEA 4K33A 2XMYA 4AGUA 4EH8A 2H8HA 1WVXA 4QYYA 3DKOA 4ZY4A 4X6RA 5E92A 3WE8A 5FDPA 5J9ZA 5JGDA 5KKRB 3KXXA 3RAIA 1OMWA 2BRMA 3Q32A 5CVFA 4JX3A 1ZYJA 2OJIA 4QMTA 3V01A 2XS0A 4FBXA 4XG7A 4FZAB 5CVGA 2UZNA 4FIEA 4FSTA 4MBLA 1LP4A 2BCJA 4AN9A 2GMXA 1DAYA 4AZWA 2GCDA 4XLVA 4B6LA 4I93A 3OXIA 4RWJA 5EQEA 3D14A 5J5TA 5B2KA 3PXZA 3SC1A 4ZTLA 2F2CB 4KBKA 5KCVA 4YSMA 5A14A 4UB7A 5DLSA 3AT3A 5FD2A 5K4IA 2JAMA 4R5SA 4KD1A 5EW3A 5EQYA 3MFTA 3LE6A 4GFOA 5DVRA 1KE9A 4L46A 3I6UA 5AV4A 3VQUA 4YZBA 1R3CA 2RGPA 4FK3A 2ZYBA 3VC4A 3U4UA 2FSMX 4NKAA 4C37A 4EOMA 5J7HA 3I5NA 4DCAA 3VHEA 4FKUA 4QQTA 3PA3A 2Z2WA 4IDTA 4AN2A 3KK9A 4JR3A 4HVHA 4MXCA 4NK9A 2J90A 3QQUA 3RI1A 3TNIA 3MY5A 3GEQA 2XK4A 4BCNA 5BMMA 3UZRA 5HIBA 4O7VA 5HZNA 5L4QA 3E7OA 1XH9A 2OG8A 3FZOA 4UEUA 2Z7SA 5EYMA 2OF4A 4LUEA 4EKLA 3Q2JA 2VWXA 3GOKA 4AX8A 5CSHA 4FT3A 4Z16A 3BHVA 4IEBA 5JN2A 4CEGA 4O7SA 3ORTA 4ZZMA 5M57A 1YXTA 2NPQA 3RAHA 5HE0A 2C47A 3V5PA 5J5SA 2VRXA 3GCUA 5CSPA 1ZYCA 2QC6A 4MH7A 3L9LA 2PVFA 3PUPA 4XS2A 5ANGA 5LARA 3I7CA 2X9EA 3FYKX 5HG8A 5ANDA 2VO6A 2GQRA 4K11A 4NH1A 4R7BA 3CEKA 3PDTA 3BHHA 2BILB 3HUCA 3IK3A 3N9XA 3U51A 3LHJA 1Y6BA 3F82A 3QQJA 5L8JA 4P4CA 2W5AA 3HZTA 1M2RA 3QD4A 3CGFA 4DG0E 3QZFA 4K6ZA 4QTEA 4DEGA 4DTKA 3TXOA 3VN9A 2VX1A 4IWDA 2P33A 3F5PA 4FIHA 3RAWA 2VAGA 4DFYA 2UW6A 3KN6A 2UW5A 5HO7A 5JKGA 2CNUA 5IISA 2ZV8A 5EHLA 1BYGA 1WBTA 4FZ6A 4O6EA 4MTAA 3F9NA 5H8EA 4ZJVA 2YCQA 2W1HA 4C3PA 3GC9A 4FKRA 4NIFA 2IW8A 3ACJA 3NNXA 3ZO4A 1K3AA 2PVMA 1EH4A 3R7GA 1FPUA 4L3LA 2WEIA 3HV7A 3ENMA 4L7FA 1J1BA 3KULB 2VNWA 4MWHA 2WMVA 4QOXA 2WIPA 2UV2A 3TNWA 2UZUE 4U7ZA 3AG9A 2XNMA 3Q6UA 5AJQA 3ZZWA 3UGCA 4ZSGA 5DYJA 1YDTE 3F3TA 5HD7A 3GU6A 5CI7A 5IDPA 2YCRA 3Q5IA 1IEPA 4FG7A 3SLSA 4G31A 5E8YA 3WZUA 4FV6A 4DGNA 1YI3A 3EKNA 3LFBA 4C57A 5A4TA 4QYEA 3VF9A 2VWIA 4II5A 4F6UA 3TKHA 3R0TA 4IMYA 1W84A 4J99A 5BMSA 4DFUA 2JDOA 5E8TA 2XIYA 1AD5A 3ORMA 4YZ9A 3RP9A 1V0OA 3NYNA 4Q9SA 3LCKA 3RM7A 2X7FA 1H07A 3ZC6A 4HGEA 3D83A 5TE0A 5L2WA 3FQHA 3L8VA 5J7BA 4FKPA 4MXXA 4USEA 3QQGA 4PNIA 3BPRA 4R7IA 4X3FA 3GC7A 4XV1A 3W1FA 4ZS4A 3AT4A 5FDXA 4F65A 2EXEA 3CTHA 3A4OX 3K2LA 3FZPA 2G15A 2IZSA 4ZMFA 4J97A 4JBPA 3VS0A 2B9FA 3NUXA 4CT2A 2B7AA 5HO6A 3R8UA 5HTIA 3U8WA 5IH6A 2UZOA 3G15A 4U41A 4ENYA 5KMJA 3LCDA 3RK7A 2BRGA 4FOBA 5FTQA 3KRJA 1GZOA 4OBPA 1PMUA 4TWCA 4RIOA 3W8LA 2W0JA 3EFWA 3EYGA 4EC9A 3S1HA 2G1TA 4M67A 2I1MA 2RG6A 3RHXA 2X81A 2BHEA 4UXQA 4EH6A 5KHWA 3HP5A 3QC9A 5CF8A 3NUYA 1WBNA 3EQRA 2ZB0A 4FKVA 4UY9A 2XNEA 4XBUA 2R3RA 1WBPA 2GNHA 3PLSA 4C3RA 5CF6A 1YOLA 3NAXA 3E88A 1YDRE 4PDYA 4FTKA 3ZXTA 1PXKA 2R3IA 4XNEA 2PSQA 4F6WA 3PZHA 5KNJA 1A9UA 4XOYA 1YOMA 2FSTX 2PZPA 4GYIA 5TKDA 5LVNA 1YXXA 3R8VA 4QMZA 4AGDA 2UVXA 5EM8A 2PVLA 4QTBA 5CU4A 2VWZA 4GG5A 5AUVA 3BGPA 5ICPA 4HNIA 5M08A 4FNWA 4IM0A 5CAUA 4D2TA 4ZMEA 4CZUA 5A6OA 1FQ1B 4BBEA 4WD5A 4IB1A 3ZFYA 4BDBA 2W4KA 4ZK5A 3QRIA 4GK2A 4BI2A 4I24A 4D28A 2R3PA 4H05A 4OTIA 4FZDB 4MF1A 4ZP5A 3GUBA 5HU3A 3SV0A 4GT4A 4WUNA 2V5QA 2QONA 4RWKA 2WTIA 3ODYX 4OBQA 3HMNA 4E6CA 4TKSA 1YXUA 3QC4A 2YIXA 1GIIA 2CKEA 3QZIA 2CN8A 3QGWA 3FQSA 2OFUA 2YFXA 3EFKA 1FVTA 2WU7A 2YEXA 4A9SA 3QL8A 3QXOA 4JG8A 3FE3A 2BDFA 3PZEA 1OKWA 4RLKA 3DDPA 4FKOA 4RIXB 3GU4A 4G9CA 4Q5HA 3RZBA 2R3FA 4D5HA 3IW7A 4TYGA 3SRVA 3BWFA 3OF0A 4EWQA 2W99B 5D11A 4M97A 5T3QA 2Y0AA 1OL6A 3K3JA 3UZTA 4X0MA 2A0CX 1H28A 2V0DA 3V3VA 3ZOSA 3BE9A 4PTCA 4I21A 5EOLA 1SVEA 2WTKC 3FEGA 2ITWA 4BI0A 3ORKA 2CGVA 3TZMA 5EM6A 5LMBA 2Q83A 1ZARA 3KXNA 4IANA 4YURA 2ZM4A 4L67A 3OCSA 1JWHA 2ITVA 3EN5A 4D9TA 3N51A 5C1QB 2YIYA 5HBHA 2PZ5A 3NRMA 4J71A 5BYZA 4L00A 4U42A 1ERKA 1RDQE 3A7IA 3PFQA 3CY3A 1OUKA 4BDAA 4OTHA 4AZFA 4G5JA 4D1ZA 4FMQA 4W4YA 3L8XA 3PA4A 5M09A 4ASXA 2UUEA 4BTKA 2X7GA 4IAKA 3NVKI 1GY3A 2W1CA 3UC3A 4AW5A 5M53A 4QTAA 1OZ1A 1ZYSA 4GSBA 4IM3A 1NW1A 4YPSA 3W8QA 2VU3A 2B9HA 4DF3A 4BIEA 2OF2A 5D9HA 4ZZNA 2ONLA 2ZJWA 4I5HA 5AUYA 3ZLXA 1H0VA 4EQMA 4BY9E 4K1BA 4XUFA 4LOPA 2XK7A 2J2IB 3QALE 2C3JA 5LCKA 2F49A 4L68A 5J1VA 3FAAA 4CTBA 3RALA 1J91A 4HCUA 1Q99A 3G0EA 3FPMA 3W2OA 4ANQA 1TQIA 4QP6A 5B2MA 3L9MA 5FEQA 2P4IA 4CG8A 3VF8A 4QYHA 4A06A 4KA3A 5CS6A 3Q5ZA 2OI4X 4U9AA 4PQNA 3UNJA 2I6LA 3GCVA 2WOUA 4W4WA 4YZCA 4TZRA 4NM7A 4P5ZA 2IPXA 3Q60A 3CE3A 5H9BA 4S30A 5KBQA 4O7WA 1O6LA 4LV5A 4TN6A 4RX9A 4O38A 3QAME 1UWHA 1Y8GA 2ETMA 2J9MA 3EQCA 1XH6A 4I20A 4IJ9A 1NY3A 3OEZA 3CD3A 3QRUA 4IWOA 5CSXA 4ANBA 3RJCA 3OBGA 4IAFA 4LQMA 1KOAA 4ZSJA 2VTRA 4RX7A 5HTCA 2H6DA 2YHVA 2CGUA 3NCGA 2JDRA 5BX0A 5EKOA 2VTLA 4RX5A 2GS7A 1U5RA 2AC5A 3LOKA 3NUAA 3QRKA 4USDA 3TV7A 4PMSA 3ETAA 4FR4A 3RKBA 4Z9LA 1PXLA 2R9SA 4WUAA 4D1SA 4EEVA 4CLIA 3IS5A 3W16A 2UW3A 4OTPA 3E8CA 4AE6A 4ALUA 4X3FC 2UZEA 4F70A 1PKGA 4LMNA 2UW7A 4RFZA 3HMOA 2J5EA 1V0BA 2A19B 2REIA 2O8YA 1QCFA 5BUIA 1OIQA 3LFEA 2AUHA 2ETKA 1OIRA 2VTMA 2ZMDA 4FT9A 2VTQA 3CD8A 1PHKA 2R3LA 3KCFA 1GJOA 3S0OA 4FSQA 4E8AA 5A46A 2RF9A 3AGMA 5AP0A 4FIJA 3UMXA 5JZNA 2QG7A 5E9EA 2YDIA 2B4SB 1YHSA 3ULZA 4TXCA 5CEPA 2PMLX 4XP0A 3TTJA 5F1ZA 3V5QA 4C4HA 3QTZA 4KRCA 4BICA 3MPMA 3ID6C 3C4CA 4L8MA 5LVPA 3EN9A 5ETCA 3N4TA 3U54A 2GSFA 3UOHA 3KREA 4Y85A 2CMWA 4PL5A 1XH4A 3C7QA 3OHTA 2OJFE 4JDHA 4FTTA 2WGJA 2E9VA 2PE2A 4EOLA 5L6OA 3CQWA 4FV9A 4CG9A 5AP5A 1ZWSA 5DPVA 4FV1A 4KIKB 3R83A 5IMEA 4MQ1A 1H1RA 2GPHA 3DLSA 4DCEA 2JIUA 4E7WA 4IAZA 4PDOA 5HHWA 3P4KA 1KWPA 4NM0A 4RA5A 1JAMA 3ORZA 2BKZA 4BF2A 2YM3A 3FMLA 4CZYB 3WF5A 4F4PA 4MD7E 2BFYA 5E90A 2FSOX 3SAYA 2X0GA 4Y73A 4O2PA 3SGCA 1JVPP 3O8UA 5AP7A 3E93A 3KK8A 3PIXA 4U97A 5BYYA 2HWOA 3F88A 3BYSA 2QO7A 4W8EA 4CNHA 5HO8A 2CN5A 2CGXA 4C7TA 2OJGA 3IKAA 3DBDA 3HDNA 4TWPA 3RK5A 3K54A 3G6HA 1BL6A 1BMKA 5HTBA 4OTDA 3MBLA 3R1QA 4KIQA 4MK0A 3ZEWA 5BPYA 2HZNA 4MHAA 1XHAA 3FLYA 4QMLA 4XLIA 4BIBA 4KBAA 4TL0A 3OXTA 4AA4A 2PVYA 2PL0A 4BWPA 1G8SA 4O6LA 5HGIA 3O8PA 2CJMA 3FLSA 2R3HA 5CF4A 2VN9A 2WTVA 4W4VA 3ZXZA 4U81A 2C30A 2QLQA 2VTTA 3HRCA 4FKWA 5BYLA 4IDVA 1H4LA 4YJQA 3IPHA 2W4OA 4Q9ZA 2V22A 4IFCA 5EYKA 4MD9E 2R3JA 4YSJA 4GEOA 2HELA 5HE3A 2PUNA 1FVRA 3KF7A 4RIYA 2PWLA 3G0FA 3VS4A 2WMBA 3HGKA 5IH5A 4LUDA 2BALA 3EQHA 3RGFA 3CPCA 1M2PA 4I0TA 3ALNA 3U4WA 1CKPA 5JGBA 2YZLA 3UG2A 4G2FA 2B53A 3QQLA 5TR6A 4AXAA 4RJ3A 2HWPA 2VWYA 2YJSA 3LFNA 2RFDA 4S31A 5AR3A 3D94A 4C0TA 2GS2A 4WNMA 4H58A 2BROA 2YWPA 3M11A 3CIKA 3OT8A 4FTQA 4IZ5A 4ZTQA 3ZEPA 4O0VA 3EQDA 4OTQA 3C4XA 1S9JA 3KXZA 4IB0A 3BLHA 2Y7JA 1FVVA 2R5TA 2ONLC 2XH5A 4R7HA 2JIVA 4E73A 1WBSA 3DU8A 4ZJIA 1Y57A 5M51A 3ZO2A 2IZTA 4E4MA 4EH7A 3NNVA 2XJ1A 3AC1A 4O84A 4BTFA 3POZA 2WO6A 3FI2A 3NIZA 1Q3DA 2XP2A 4QQCA 2PZRA 2VZ6A 3E3PA 5B2LA 2W05A 3PWYA 2IO6A 2RIOA 3PSDA 2C5XA 4FTUA 4XP2A 2VV9A 4M66A 1UU7A 3EB0A 1FMKA 4XYFA 2NRUA 4HPTE 4JAIA 1ZLTA 5F95A 3QKLA 3FDNA 3DDQA 1ND4A 2QLUA 3C13A 5FLFA 3GU5A 3MFUA 5M07A 1YHWA 2P0CA 3ANRA 1H01A 3O23A 5EW9A 5M4FA 2QVSE 4EHZA 2YDKA 4YNEA 3OCTA 4E4LA 3HL7A 5HIDA 3RM6A 3F3VA 4BDIA 3NW7A 2XNPA 4F6SA 4I0RA 3LJ0A 4YJUA 5J87A 2OO8X 3HNGA 4YJSA 4DG3E 2UW9A 4MBIA 5DA3A 1Z5MA 5CXZA 4QTCA 4YJPA 3CXWA 4IX3A 3NS9A 5HLWA 3E8EA 3PTGA 1PYEA 3HA6A 3R8MA 5KZIA 4EK3A 4EQCA 4DH7A 1H1PA 2WTDA 2GHLA 1UA2A 2QOIA 4HCVA 2VTNA 3VJNA 3DJ6A 4CYJA 4KSPA 4LGDA 4AS0A 4EYJA 3R9HA 2OIDA 3LFSA 3C0GA 2YJRA 4BDDA 1FOTA 1KV1A 2UVZA 4ZSLA 4DTAA 3K5VA 4FK6A 4BFMA 2WXVA 5BVKA 1OB3A 3PPJA 3HMMA 3PYYA 1O6YA
chains in the Genus database with same CATH superfamily
3SOAA 3MS9A 4RQVA 4DG2E 4DLJA 1WVYA 3Q4ZA 4BCFA 4EORA 5AR5A 2R3OA 3WZEA 3HVCA 2UZDA 3MH1A 3PXFA 4I6HA 4AOTA 3C5UA 3GGFA 3Q4TA 3WF8A 4XCUA 4PF4A 2JGZA 3EH9A 4QPMA 2WQMA 4EOJA 4RLLA 4XV9A 1PYXA 2PTKA 4FZFB 4JI9A 3O0GA 4CMOA 1R0EA 1OL2A 2OFVA 4FKTA 4OR5A 3SG8A 5FG8A 3R1SA 4YZNA 4PTGA 3WI6A 2PUUA 2W1DA 2WMTA 3NUPA 3Q9WA 3ZCLA 5M4UA 3QKKA 1V1KA 3U6HA 2RL5A 4RVLA 3WF7A 2IVUA 5AV3A 3NPCA 4BN1A 4JRNA 5EYDA 3DZQA 4C2VA 4TYJA 3TKIA 3U87A 5IPJA 1XMLA 3DAJA 4CGAA 3P86A 4ID7A 4FT7A 4IQ6A 2BZHB 4NUSA 4B99A 3A7HA 1ZOHA 4PPAA 4JDIA 2PE0A 1Q8YA 2ZV7A 3MH0A 4YHFA 1L3RE 4OGRA 4WSYA 2ERZE 3FXXA 4HZRA 3FJQE 3ITZA 3KEXA 3OWJA 3R7IA 3TJDA 4DFNA 3BYMA 4ZLZA 1NT2A 3BGQA 4J7BA 2B1PA 5JRQA 4RBLA 4NKSA 3ZUUA 4E6AA 2WMRA 4YPDA 3VVHA 1U4DA 3RCDA 1M52A 4AZVA 5AA8A 3P08A 5T68A 5M44A 2XNGA 3F5XA 4KSQA 3QX4A 2B52A 2PPQA 3OWLA 4BCQA 4GYGA 5LMAA 1UNHA 4X3JA 4IZ7A 4ZZOA 3S4QA 3C51A 5CNOA 3WIGA 4AW1A 3VBXA 4XMOA 5A3XA 5EQPA 2CHLA 4J1RA 3K5UA 3TZ8A 4UZDA 4M14A 1PXJA 5JMSA 1ZMWA 2ZOQA 4N0SA 4JBOA 3C4FA 4QPAA 3MFSA 4M0ZA 5T6KA 2KTYA 2RG5A 3QYZA 3KMWA 2O64A 4KIPA 4XRLA 1GIJA 1M7NA 3ZH8A 3BQRA 3UP2A 4C4JA 2R7IA 4C35A 2VWVA 3LXNA 4FTOA 4UMTA 3F2RA 4HNFA 2C1AA 2JAVA 2YISA 3DT1A 4QP1A 2FA2A 4J52A 4RRVA 4W8DA 5DIAA 1OGYA 3QD2B 3TYKA 5AM7A 4AAYA 3GCSA 3PIYA 4PUZA 4XOZA 3MIYA 4QT1A 4G3DA 4FI1A 3NUUA 4CQGA 3OY3A 4BTMA 2QOQA 4F08A 4HW7A 4R1YA 4MBJA 3CC6A 4UMUA 2PMOX 4AZTA 3NMUF 3HX4A 3P79A 4F09A 2XRUA 1ZZ2A 2VTPA 4YLJA 2C1BA 3KN5A 4HJOA 2KULA 3O7LD 4NCTA 5AX3A 2QODA 3F3ZA 4BC6A 3KXMA 2EB2A 3W0PA 3QRJA 3CSVA 4KABA 2XIRA 3G2FA 3W32A 4F7SA 2O3PA 4WHZA 1M14A 2H96A 3VO3A 5CEQA 5GIOE 2R2PA 4DBNA 4ALWA 4DFZE 3FPQA 5L2IA 3PVGA 3UYSA 5JQ5A 2QNJA 3TUCA 1APME 3FUPA 2XUUA 4FKGA 4FYNA 3SKCA 3UNZA 1DM2A 1CDKA 4LYNA 4AXCA 4EONA 4X2FA 5DT3A 4IX5A 4MKCA 1R0PA 2ITTA 3GP0A 4U43A 5CU6A 5L2QA 5KZ0A 3C4WA 2XANA 2P3GX 2ITZA 3W2RA 4BDKA 4FSNA 4BZNA 5FBNC 1KUTA 3FMNA 4UYAA 5CALA 5I5ZA 2C0TA 4ITJA 5EOBA 2JFLA 3WARA 1SM2A 3HMIA 3PXYA 4E4NA 3DS6A 1WBVA 4YR8A 3A7FA 1ZRZA 5DWRA 4FEWA 5I9XA 2X39A 4YTFA 4MXOA 3LFFA 4XBRA 4YJOA 5FM3A 2GU8A 2I0VA 4GU9A 4L53A 5EM7A 2JC6A 4Y72A 4LOOA 3AMBA 2A4LA 3FMEA 3WBLA 3E7VA 4AQKA 2HY0A 4RIWB 5EFQA 3PRIA 3O8TA 3ZU7A 1ZMUA 4AT4A 3A8XA 2IVTA 2UW4A 1W2CA 1U46A 2H34A 4IJPA 4NEUA 1WMKA 5DOSA 5FEDA 5CU2A 5HG9A 1KSWA 1KE8A 3F5UA 4KINA 1RJBA 3A2CA 3DPKA 4CLJA 4MF0A 5DRBA 4D4SA 3LFAA 5IQHA 2DQ7X 4FNYA 2UW0A 4FTLA 4PY1A 4Z55A 5HIEA 1DS5A 1OBGA 4M68A 4BB4A 4NL0A 3EZVA 5DNRA 3FLQA 4GUEA 3GCPA 2JKMA 3ZMMA 3RAKA 1OPKA 4YC8A 2O0UA 3NIEA 4XG4A 4MYGA 2BRBA 3ZBXA 4GG7A 2FGIA 2J7TA 5IQBA 3NEWA 4EYMA 4AT5A 4K9YA 5JZJA 5BVNA 3A60A 2IVVA 5GNKA 1PY5A 2GNIA 4V0GB 3SDJA 3MV5A 4J96A 2OXXA 3R04A 4TNBA 3PE1A 4GT3A 1BX6A 3W2SA 4XG8A 4JNWA 4R8QA 4YO6A 4CZTA 2GFCA 4D55A 1JKLA 5EI6A 5JFWA 3QTWA 4I0SA 3R9DA 4BDGA 4JR7A 4FODA 3LXKA 5DR6A 3ZLWA 5KBRA 5ANJA 4QO9A 4FEXA 1XQZA 5HCXA 2XK9A 3TT0A 4IBMA 4FA2A 3D4QA 4CV8A 4ACDA 4ZY5A 2CCHA 3BYVA 4IVDA 3QQFA 1VYZA 3C50A 5G1XA 3W0OA 1SVHA 3V6RA 4YLKA 4C4FA 4PPCA 3MJ1A 4ZAUA 3S3IA 3PVUA 2XVDA 4FIGA 4FV3A 3RHKA 1J3HA 3VHKA 2W17A 3V5LA 5E8SA 2W1IA 3F66A 2G9XA 2OZAB 4YBKA 1TVOA 2J0MB 2WIHA 3EWHA 4FVRA 2ETRA 4FTAA 5D41A 5HESA 2B9JA 1GNGA 3MA6A 2OGVA 2PZYA 3JY9A 4KBCA 4FV5A 4MNEB 4FSYA 4LOQA 4WG4A 2CDZA 5C8NA 4ACCA 3FLNC 4MX9A 4DC2A 2DUVA 1H26A 3EQFA 4IZAA 4K0YA 3FQEA 5AV2A 3ZLSA 2FO0A 2VWWA 3MDYA 3AC5A 3VNTA 1XBCA 2OZOA 4X2JA 5IDNA 5AAGA 4HYUA 2XNNA 2WKMA 2HZ0A 4EBVA 1WZYA 5CNNA 2B0QA 3F3UA 5AR8A 3RPRA 2JKQA 4IC7A 4WKQA 4F9CA 4UMRA 5AP1A 3KULA 4E5WA 3NUSA 1ZOEA 4BHZA 1Q8ZA 3ZTXA 4YJNA 3W2PA 4FICA 4GMYA 4YMJA 3DXQA 4U79A 3D7TB 3MA3A 2WAJA 5DR2A 2BFXA 5LWMA 3FHRA 3WZDA 2XYNA 5CANA 2B9IA 3MFRA 4BHNA 4Z7HA 1YOJA 1Q8UA 1YWRA 2VO3A 3CQUA 3LXPA 3MVMA 4K2RA 4GV1A 4ACGA 3BU6A 2I0YA 3BV2A 3NX8A 5EM5A 3V8SA 3LKMA 1OL7A 3U6JA 3P5KA 3LLAA 4DEDA 4MXYA 1Q97A 5E1SA 2C3IB 3D15A 4F9WA 2GNLA 3DAKA 4ITIA 3KIOC 4AXEA 5A4CA 2CKQA 4MAOA 4QMQA 1ST0A 1PF8A 3FYJX 3P7AA 1PMNA 4G1WA 4BRXA 1OKZA 1XBBA 2Z8CA 3PWDA 3ULIA 4BYIA 3R2BA 3Q4CA 5GJGA 4FUXA 4J53A 2ZMCA 3E8NA 3UC4A 1YDSE 2OKRA 2XKDA 3F69A 2A2AA 3JVSA 2J0KA 4L52A 4O21A 5EI8A 2YCFA 3QCSA 5DT4A 4NTTA 3ET7A 2ITXA 3FLWA 3G5DA 3H30A 3MY0A 1IRKA 1Q8TA 5CY3A 4NCTC 2I0HA 3OW3A 3R6XA 3CJGA 2ZV2A 5CXHA 2J4ZA 3F5GA 1MRYA 2VWBA 3LXLA 4O7TA 3KRRA 3TUDA 4HPUE 5I3RA 3AQVA 4OUCA 5J9YA 3QQKA 1XWSA 3M1SA 4ANOA 1B39A 3R8ZA 2JIIA 3KMUA 4IE9A 2GQGA 2EU9A 4F1MA 3KXHA 4BVUA 3VIDA 3H3CA 3DTCA 1YKRA 2WQBA 4N6YA 2JDTA 4TTHB 3CBLA 4DFXE 1U54B 2UVYA 5HX8A 4FTMA 4HVIA 2XIZA 4C3FA 1SNXA 4I22A 1UU8A 4FL1A 3UIBA 2OJJA 3WILA 3MGYA 5TOZA 3EFLA 4DEIA 4JDKA 5IUHA 2G2IA 2V7AA 4BI1A 4O4BB 3ATTA 1W7HA 1L8TA 5I3OA 3ZC5A 3U9NA 4E93A 4IB5A 4O27B 3CCNA 3B2WA 3W0SA 4DGLC 2W96B 2CGWA 3IONA 4C58A 2XCKA 2VUWA 4CFUA 4X2NA 4TYHB 3IQ7A 3HRFA 4QQ5A 4ZOGA 4FL3A 5IG1A 2QHMA 4DINA 4JG7A 2R3NA 4D4RA 2C5NA 3SQQA 4QNAA 4TWOA 4ZSAA 2QI8A 3DBCA 1JBPE 4ZY6A 3O2MA 3FI3A 4EOKA 4C36A 3HV5A 2YIQA 3BYOA 3WYYA 4L01A 4GCJA 4K18A 4CFFA 5BVDA 3EKKA 3NCZA 3D5WA 4RMZA 4XHKB 4A9YA 2QHNA 4FOCA 3OFMA 1PXIA 3BWJA 4PDSA 4LDTA 3R02A 1O9UA 3BCEA 4BCPA 5KMKA 4FG9A 2E9UA 4I94A 5A6NA 2YA9A 3GXLA 4DHZA 4O81A 4XP3A 4RIXA 5LQFA 2OICA 4A4XA 3GC8A 3NYXA 4EK6A 4I23A 4HZSA 5HNIX 2GFSA 3C1XA 3FL4A 2V55A 3HYHA 4RG0A 3RK9A 4EK5A 4B7TA 4G9RA 2YAKA 2NP8A 3ZO3A 5KUPA 3RWQA 4WNPA 2W06A 3REPA 2B55A 5K4JA 1OBDA 3EN6A 5HKMA 4P2KA 1R39A 3O50A 2JDSA 3MWUA 3NYOA 1ZY4A 3CTJA 1K9AA 1WBOA 2QO2A 3KGAA 4MVFA 3QHWA 3I81A 4MXAA 5HICA 2R4BA 5LCJA 3SA0A 1Q8WA 5ETFA 1GIHA 3FSKA 3IGOA 3ZUTA 5FUTA 4RQKA 3UOKA 1BL7A 5IEVA 3BL9A 3DFCB 4C4IA 4O0WA 4J98A 2WFYA 3VBQA 3LQ8A 4G3EA 4XH6A 2UZLA 2F7EE 4XRJA 3FKNA 3UOLA 3AMYA 3QF9A 2WEVA 2XK8A 4IWQA 4A4LA 4C61A 4EI4A 4R3RA 4PWNA 2Z02A 4OLIA 3SXRA 1X8BA 2W9FB 3LVPA 5CEIA 3TL8A 4LRKA 4C8BA 4EOIA 4AWIA 3I0QA 3ZSIA 4D9UA 3F2NA 1UU9A 2VTAA 3H9OA 2UZVA 4RSSA 4LL0A 4TYEA 3ZZEA 3QTUA 5ANEA 2QKWB 2YABA 3V8TA 3L1SA 1NVRA 1BKXA 3ORXA 2C5OA 1RE8A 3DKGA 4YZDA 2W5BA 1K2PA 4AE9A 4GJ3A 4GRBA 4NFMA 3W2QA 3NWWA 5KHXA 3MVJA 4DE4A 2P55A 2SRCA 3H9RA 3PJCA 4FTRA 3MTFA 1QL6A 4O0XA 4IM2A 4AAAA 3AGLA 3UOJA 4DEEA 4U6RA 4MEDA 5CI6A 5KMNA 4DT8A 3EFJA 3F61A 4RT7A 4F99A 1IAHA 2Y4IB 4FSMA 4QMXA 2BZIB 4EQUA 2VWUA 5DH3A 4R77A 4FC0A 5HCZA 5LXMA 1BLXA 1YWVA 3C0HA 4UWBA 5GHVA 4M15A 4RJ5A 5IUIA 3MPTA 3VS3A 4B4LA 4R1VA 5HLPA 3MY1A 3GFWA 4WIHA 2GHGA 2VX3A 3VBTA 2C0OA 3AD4A 3OP5A 4CQEA 2CLQA 2W4JA 2X9FA 3FY2A 4D4VA 4EOQA 4YLLA 4H3QA 2PK9A 2R7BA 3OOMA 1YWNA 4CSVA 3KQ7A 5ANIA 4HYSA 3EN7A 3Q9ZA 3ZFXA 4ASDA 4CXAA 4RC2A 4QMMA 2F7XE 2Z60A 3OC1A 3P23A 3P5JC 4M8TA 3K3IA 4CKIA 1W83A 4DH3A 2QU6A 1BI8A 5JRSA 3RWPA 3TDVA 2Q0BA 3SW4A 3IOPA 4I5MA 2O63A 5E8UA 3LCSA 4ZTRA 3GENA 5IQGA 3UNKA 3FZSA 3TV6A 4Z3VA 3OBJA 2Y9QA 3OD6X 2WQNA 4C62A 4JBQA 3DQWA 4AOJA 2IW9A 4G6LA 4JBVA 3W18A 3DNEA 3TEIA 4C02A 1QPJA 4IWPA 1QPEA 3BELA 4F7JA 1XBAA 4WG3A 5ACBC 3TIYA 1UKIA 1PMEA 1XH7A 3D9VA 5K0XA 4I6BA 3OT3A 4HVDA 2X2LA 4R78A 4GFMA 4L3JA 3MTLA 3DLZA 2C6TA 5AR7A 1XH5A 4AZEA 5CEKA 4NFNA 4F64A 1KE5A 3IO7A 5DG5A 3G6GA 4KKHA 4NWMA 4P7EA 3GQIA 5FQDC 4CKRA 5JSMA 3B2TA 3ZRMA 1CKIA 2IF8A 3UYTA 4KIOA 2LGCA 2O65A 1U59A 5IA3A 1CTPE 3OWKA 2GS6A 2J51A 3KB7A 4A9UA 1R1WA 2Y6OA 4EL9A 3KVXA 4KIKA 3LAUA 1UKHA 2JKKA 3JUHA 3D5UA 2OXDA 3P1AA 4QP9A 4OAUC 2C6LA 4FTJA 4AUAA 3LIJA 4E1ZA 4FEQA 2QOOA 4GW8A 5K5NA 2BAJA 3IW5A 1ZXEA 4G6NA 3AXWA 5ETIA 3BU3A 3UZPA 4TYIA 4G16A 5M56A 4KKGA 3FI8A 3UE4A 5H2UA 4F7NA 3LMHA 2XIXA 4FF8A 5C27A 3DTWA 5F9EA 4CCUA 2ITPA 4E5BA 3UO5A 2WMXA 1P4OA 3ZRKA 4F9BA 4U44A 4E6DA 2GQSA 2W1FA 4FV4A 2FUMA 4D2SA 5AWMA 4O1PA 5FP5A 4IX6A 2R3MA 3DZOA 5JT2A 5CZHA 4GFGA 2Y6MA 4IW0A 3QRTA 2X6EA 5EDQA 5JFVA 4EJ7A 4FVPA 1SYKA 4PP7A 3WIKA 3HV3A 1OM1A 1OVEA 1QPCA 1URCA 3FXWA 3PJ8A 4M84A 4ZJJA 3WZJA 3MB6A 5FXQA 4BTJA 2FH9A 4XX9A 5AIRA 4GVAA 5CT7A 2AYPA 2QCSA 4YNOA 4XEYA 4YJRA 1OITA 3CQEA 4L6QA 3VULA 3G9LX 2ESMA 3ZSGA 4WA9A 2GNFA 4UX9A 1XR1A 3R22A 2QD9A 3BHTA 4J8NA 4YC6A 5CEOA 1GZKA 2A27A 5FXRA 2PVJA 2WB8A 3TZ7A 3FMJA 3ZRLA 4A9RA 3H4JA 2IW6A 2R0IA 4IB3A 3CJFA 4L9IA 4O82A 2HXLA 2ZDTA 1E1VA 2XKEA 3H0YA 4F9AA 2HK5A 2HXQA 5FM2A 5FTOA 1OL5A 4EH4A 4U5JA 3O71A 4CFXA 2WOTA 3QTXA 4QP2A 5HX6A 2CNQA 2XNOA 3DK6A 4HCTA 4QQJA 5AMNA 4AW0A 4WSQA 5GZAA 3DB8A 5L8KA 3IECA 4AW2A 2YLFA 4RJ4A 2OBJA 4EH3A 3DBFA 3PIZA 4X2KA 1Q61A 3A7JA 3FL5A 4FX3A 4EH9A 5AAEA 3EJ1A 3NZ0A 1MUOA 4F78A 3PP1A 3W33A 2WMSA 3R1NA 5BVEA 1JSVA 3FWQA 2GTNA 4Y5QA 3VUMA 2QU5A 4OT6A 4QMPA 4AGWA 4D5KA 4EHGA 5CU0A 4YTIA 4KUJA 4X6QC 1NVSA 2OSCA 3AC8A 4YHJA 4KRDA 4F0FA 4IADA 2JDVA 2VGOA 4GH2A 4GIIA 4L45A 4OTFA 3AD6A 5CQUA 3RCJA 3WYXA 3BLQA 3JVRA 2XAOA 1YI6A 1WCCA 3OEFX 2JBOA 4Y46A 2QOBA 4BGGA 4WBOA 4KB8A 2JD5A 3RTPA 4BCOA 4E5AX 2WTJA 2UZBA 4M69B 3V6SA 5IF1A 2CNVA 2E2BA 5HNBA 3OTUA 4HVGA 3JS2A 4QRCA 3IW4A 2CSNA 2E9NA 5FRIA 3IDBA 4MXZA 5DT0A 2HZIA 4YC3A 2C3LA 3JYAA 3B8RA 4O4FA 5EI2A 5AAFA 4I6LA 2VO7A 4FSZA 3TMOA 1OKYA 3I79A 4OTGA 4NYEA 2WHBA 1KV2A 3ZSHA 3QTIA 2IEWA 3R30A 4GUBA 3QTRA 5AUXA 4CV9A 1Q41A 2BMCA 3A4PA 4JG6A 4WT6A 4AXDA 4EKKA 5D7VA 4RVTA 5KX8A 5I9WA 2PY3A 5DFPA 2PZIA 5I9ZA 1REKA 2XALA 4RJ6A 2PVHA 2PULA 4QMVA 2YN8A 4NT4A 2O5KA 2WMAA 3FY0A 4O1OA 2WTCA 3NDMA 3CPBA 5AUUA 4XJ0A 5F94A 3TCPA 3QUPA 5IEXA 4PNKA 4EJNA 4CD0A 3SW7A 2EB3A 2BAKA 2BKKA 3AC2A 3GT8A 4WNOA 4S2ZA 4QNYA 3W10A 3EIDA 2CLXA 1G3NA 4C38A 4BGHA 4M7IA 3VBWA 4QTDA 3ROCA 4DGMA 3T9IA 1OGUA 3BZ3A 5DR9A 4AXFA 3CKXA 4Q5EA 2X4FA 3VW6A 3AMAA 5JQ8A 4I92A 4ZEGA 3TV4A 4DEHA 1J1CA 1Q4LA 1E9HA 2HOGA 2P2HA 2XKCA 3I6WA 1REJA 3SOCA 3T3UA 3VUGA 4DEBA 5IQAA 4AFEA 1P2AA 4JQ7A 4Y5HA 4R6VA 4FSWA 4ZTSA 3WF6A 2WMUA 2ZM3A 1YQJA 1YRPA 2WELA 3BYUA 5CSWA 4EHVA 5LOHA 1A48A 2HAKA 3LCTA 3UTOA 1B6CB 4JX7A 5EKNA 4UWYA 3VUKA 3UVPA 3NFGB 4PMPA 1MRVA 2YIRA 3B8QA 4CMUA 4D2WA 4O22A 5LVMA 4R3CA 3U55A 2F7ZE 3DV3A 4GT5A 3RNIA 3FV8A 2HW7A 3FSFA 4JIAA 3U9CA 1W98A 5CVHA 2LAVA 4CCBA 3QXPA 2AC3A 4BCIA 5CWZA 1UNGA 2ITYA 4L7SA 4OTRA 5K0KA 4RC3A 3QYWA 4A7CA 3HAMA 4RJ7A 4ZTMA 1J7UA 5I0BA 3EQIA 3DAEA 2BDWA 1OKVA 3UPZA 4EH2A 4ANNA 3EL7A 1MRUA 5L6WL 4BCHA 1LEWA 3RBWA 5L2SA 2Q0NA 4RA4A 4I6FA 3CS9A 1DI8A 5HQ0A 1VR2A 3IG7A 5IA5A 2E9PA 3Q3BA 4CFNA 2HYYA 2WZJA 4G5PA 3PA5A 4O96A 4O83A 3QZHA 4A07A 3GU7A 5IA0A 4I5PA 4EHEA 3R01A 1TFFA 4O0SA 3QBNA 4LG4A 3BV3A 1B38A 2PMNX 3JY0A 4C4EA 3COHA 3E92A 4AZSA 4V05A 5B0XA 5HG5A 3VRZA 4B0GA 3OOGA 5HG7A 1IR3A 4FKSA 1ZZLA 4QP3A 2QOFA 2WD1A 3MW1A 4QYFA 4Y95A 3E5AA 5IEYA 3UP7A 4O91A 4QPSA 2IN6A 3MPAA 2JKOA 3BBTB 4FV0A 3ZONA 3U6IA 3N4UA 2BAQA 2HCKA 2X8EA 5E8WA 3RPSA 1Y6AA 4ACHA 3Q53A 4NZWB 5HE2A 2WU6A 1ZOGA 4C59A 4YGAA 5D7AA 4EOOA 2BDJA 3DGKA 3NR9A 1OI9A 4BDCA 3HA8A 4BR3A 5E4HA 4UBAA 3OROA 1UVRA 3RNYA 5AP6A 4IXPA 4UWCA 4DHFA 5AA9A 4R3PA 1SNUA 3TM0A 1GZNA 1UV5A 3G9NA 4GIHA 3CGOA 2C69A 4RC4A 3QTQA 4IAIA 1CKJA 5D12A 2VO0A 3RPYA 1OPJA 2YITA 3R2YA 1NA7A 4M3QA 5E7RA 4U80A 4O4CA 5KMLA 3DFAA 3R28A 4W9WA 2WTKB 2GNGA 3R7YA 1JOWB 3BE2A 2CKOA 3GB2A 1T45A 4NU1A 2HZ4A 3ZFMA 4AA5A 2ZDUA 5J1WA 3VONA 4U45A 4FG8A 3QA8A 4JXFA 4H3BA 2G2FA 2W1ZA 4F0GA 1TZDA 1QPDA 3RZFA 1H24A 2EWAA 1Z9XA 5LMKA 2W7XA 3Q4UA 3OUNB 3C4ZA 4PV0A 3T8OA 3HP2A 5DGZA 4HGTA 3EQBA 1H1WA 3LZBA 2AQXA 3QKMA 2Y8OA 1FBNA 2XAMA 2XA4A 5KMOA 3VUIA 3KC3A 4EC8A 3H9FA 2C3KA 4DTBA 4IX4A 3OW4A 4F1OA 3DBEA 4JL9A 5ANKA 3LQ3A 4R5YA 3OY1A 5HBJA 5LVOA 1QMZA 2OH4A 4ZTNA 2FYSA 1M17A 5ETAA 3ATSA 3PXRA 1URWA 5E1EA 4IIRA 4BKYA 3MH2A 1TKIA 5L8LA 2VX0A 2HY81 3UIMA 4V04A 5GZ8A 4MD8E 2DS1A 3HUBA 1KOBA 4NIFB 1VYWA 5IQFA 5CAQA 1P5EA 4RX8A 3W2CA 4I5CA 3FMKA 2A98A 3VJOA 5BUEA 4J8MA 4RIWA 4IAAA 1A06A 4AOIA 3OCGA 4WO5A 5C8MA 2A1AB 3GI3A 3QHRA 4DN5A 5DEYA 2B54A 4FV7A 5ITAA 1PXMA 3ZBFA 2W1EA 3MVLA 2NNWB 3PY1A 2BHHA 4CTCA 1HCLA 3FKLA 3D7ZA 2RFNA 3WZKA 3Q6WA 4BBMA 1PRYA 5AFVA 1CSNA 4RPVA 4IC8A 4FIFA 3KRWA 3RPVA 2OU7A 1PMVA 4GK3A 4PL4A 2XB7A 4EOSA 4C4GA 3PJ2A 2OJ9A 3FKOA 5HD4A 4F63A 1VZOA 3IW6A 3PY0A 1HOWA 2FVDA 4O0UA 5ANOA 5HNGA 5BNJA 4V0GA 3HRBA 5C8KA 5K5XA 3HEGA 4M13A 3F3WA 1PJKA 5DE2A 3AKJA 3SX9A 2BRNA 2VD5A 3KF4A 4X3FB 5GIPE 3QCYA 3TWJA 2C6EA 4AGCA 3ORNA 2BTSA 3DOGA 4FUYA 4FGBA 3O51A 2WPAA 3UIUA 2C4GA 5CAOA 4RVKA 2YM4A 1YW2A 1YXVA 4ACMA 1NXKA 3DNDA 3QU0A 3PE2A 4YJTA 4YZMA 4CRLA 5CLPA 4G6OA 5GINE 4TT7A 3R9NA 1WBWA 4AU8A 1H0WA 1WFCA 2CPKE 3TUBA 4ASEA 3A62A 4YTHA 1M7QA 5J95A 2E9OA 3NUNA 4AQCA 1WVWA 1AGWA 2OZAA 3LFCA 4IZYA 5FEEA 4JJRA 3VS7A 3PXQA 4CVAA 3FHIA 4DH8A 5L3AA 1ZY5A 3FMHA 2IJMA 1W0XC 2EXCX 4MNEA 4N70A 2C6OA 4E20A 2W5HA 2YDJA 4QMSA 4FEUA 4FTIA 1VLRA 2X4ZA 5IKWA 3FC1X 4RFYA 4J95A 4FKQA 2ZAZA 1VEBA 2XM9A 4O2ZA 4RJ8A 3RMFA 3P7CA 1ST4A 2WQOA 3W55A 5M55A 3PPKA 3VAPA 5IA2A 5HOAA 5L6PA 4DITA 3UMWA 3SXSA 3VBVA 3DBQA 3ODZX 1PXNA 4CT1A 5I9UA 3KRXA 2IZUA 4BCJA 5BVWA 3ZDIA 1IG1A 2YM5A 3GNIB 3VS5A 3LM0A 1MQBA 4BBFA 4ERKA 1G8AA 3CLYA 3D7TA 1IA8A 3EQPA 1SMHA 3I7BA 4FKJA 4HGLA 3FC2A 2CCIA 3KRLA 2XBAA 2G01A 4LRMA 5FBOA 4UN0C 4F9YA 2ITUA 5FP6A 3P9JA 4BCKA 3UO6A 1LUFA 5DI1A 1GZ8A 2YM7A 4NSTA 3R00A 4FKIA 3P0MA 4FYOA 4RWLA 3S2PA 4BJJB 4S32A 2OWBA 3QWJA 2YWVA 5AADA 3A61A 3NSZA 4XG2A 3R7OA 3EN4A 5AP3A 5GJDA 1ZAOA 2YACA 3NW5A 3ROYA 2EXMA 5L2TA 2JBPA 3BQCA 5M4CA 3LMIA 5A54A 1W82A 5C26A 5M06A 3KCKA 3LLTA 3PXKA 3E87A 3NVMB 5KKRC 5C4KA 4DH5A 3SRVB 2XF0A 2YM6A 2PYWA 4ENXA 4K8AA 5DRDA 5CQWA 4QP8A 3GFEA 2X2MA 4BDEA 5F20A 3MESA 3D5VA 3SVVA 4ZS0A 4AA0A 4UMQA 4FT0A 1DAWA 1FMOE 5AP2A 4KS8A 2F4JA 2EVAA 2J5FA 4H1JA 1FINA 4TWNA 4G3CA 3G51A 4OBOA 5D1JA 4M12A 5EW8A 3PVBA 5EDPA 4Q2AA 3HV4A 4ANLA 4YO4A 3N4VA 2PUIA 3PG1A 4USFA 3BGZA 3KVWA 2WQEA 5IUGA 1W8CA 2XEYA 3ZM9A 4W9XA 2X8IA 5LMKC 4LV7A 3UDSA 4FVQA 4Y8DA 2BVAA 3QLGA 2BRHA 3AOXA 4NM5A 5E8VA 4D2RA 2XARA 1H00A 4O7LA 1FGKA 1U54A 4NW6A 3UJGA 3KXGA 4I6QA 4DH1A 3SD0A 4O0RA 4A9TA 1H1SA 3D2IA 2PVNA 3HDMA 3ORPA 4HYIA 2BR1A 4WBBB 2RFEA 4D0XA 3NNWA