4E4YA

The crystal structure of a short chain dehydrogenase family protein from francisella tularensis subsp. tularensis schu s4
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
242
structure length
242
Chain Sequence
AMANYLVTGGSKGIGKAVVELLLQNKNHTVINIDIQQSFSAENLKFIKADLTKQQDITNVLDIIKNVSFDGIFLNAGILIKGSIFDIDIESIKKVLDLNVWSSIYFIKGLENNLKVGASIVFNGSDQCFIAKPNSFAYTLSKGAIAQMTKSLALDLAKYQIRVNTVCPGTVDTDLYRNLIQKYANNVGISFDEAQKQEEKEFPLNRIAQPQEIAELVIFLLSDKSKFMTGGLIPIDGGYTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a short chain dehydrogenase family protein from Francisella tularensis subsp. tularensis SCHU S4
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Oxidoreductase
molecule keywords Short chain dehydrogenase family protein
total genus 96
structure length 242
sequence length 242
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4e4yA00
1LU9A 5COAA 1PJLA 3U49A 2BGMA 3ORFA 4XIJA 9LDTA 3AUAA 1ZSYA 4PG6A 3C1AA 1BWSA 5L4SA 3N74A 1EBUA 5IDQA 3QP9A 1Z75A 3JD0A 4NFYA 2UYYA 5TIIA 1B7GO 3N58A 2X0NA 2ZJ0A 2P9CA 1ADGA 1YO6A 1ZK4A 4BB6A 4FGWA 3OH8A 1DC5A 1EUCA 1SB8A 2HO5A 2OO5A 2YZ7A 3Q9NA 3K92A 2CDCA 4PLHA 2NTJA 3E9MA 3LLVA 4PG8A 3ZWNA 4BO7A 1HYEA 4W6ZA 4BO2A 5JDCA 5IZCA 3RC9A 3BMQB 1QV6A 1IHXA 5ICSA 5CDYA 4YT8A 1KY4A 3B1JA 1C1DA 2FR1A 2FPIA 2I3GA 4J9VA 1A4UA 4YRBA 4HFJA 4KP7A 1KYQA 1HF3A 4BNXA 3KSZO 3Q2KA 4WOJA 5ICMA 7MDHA 3MJSA 4EUEA 1UUFA 4RVGA 1ISGA 4CLEA 4TKLA 2EEZA 1RM5A 4FFNA 5IZ4A 2BGLA 1GV0A 3PZBA 4I9NA 2Q46A 3O03A 1CQJA 5A06A 3WICA 4YQYA 4R69A 1PL8A 1IOLA 3PP8A 2Q4BA 4ND4A 2D5CA 2X6TA 1Y6JA 3I9KA 3E6AA 3VZRA 1Z74A 5TT1A 3AM4A 1AXEA 2F1KA 1FF9A 3BAZA 1SOVA 5KTKA 4FN4A 4KWHA 3BMOA 1W6UA 4QTZA 3DZFA 3EGOA 4CLRA 4DLAA 4H15A 1E6EA 1KOLA 3ONFA 1BW9B 1C0PA 2PKRA 2Q2WA 3ENNA 3NDIA 4IQGA 4I9HA 5B4UA 3PYLA 3I52A 5KJEA 5K0ZA 3BMQA 3KXDA 5EESA 5EPOA 4WLEA 4UUMA 1E0DA 3ON5A 4CPDA 1V3VA 1VSVA 2NU7A 3U4HA 2VOEA 1HDOA 3JQ8A 2QRJA 3GFGA 3U0BA 1NHWA 1MFPA 1Y5RA 5G0WA 4BNMA 3ITDA 2ZYGA 4AVYA 4XQCA 1GD1O 4CR7A 1K89A 3CKYA 2Q2QA 4UVDA 1MXFA 2JAPA 2D2IA 4DPKA 5IXSA 1WWKA 2A94A 2HK8A 4TRNA 3B6ZA 2O3JA 4CMEA 3ZI0A 3QSGA 1U3TA 3LT4A 3ANMA 3JD1A 2HRZA 2NU8A 4E2ZA 1R0SA 4WLOA 3LF2A 5TNXA 5TX7A 2JFGA 4XX0A 4R3WA 2NTNA 1PGQA 2BLLA 4FR5A 1PU2A 4WASA 1DC6A 3JQ7B 4R54A 1I32A 1VL0A 2E82A 4DQXA 2GASA 3KV3O 4E5KA 2HQ1A 3WYCA 4BIIA 5I8WA 4GI2A 1ZK3A 2WJPA 2X9GA 2YV3A 2HLPA 4ALMA 1PGNA 1VJ1A 4LVCA 2O48X 1DIRA 5GY7A 4YT4A 3MJTA 1LC3A 1TT7A 4XCVA 5JE8A 3WX0A 1GYPA 2ILTA 5BT9A 5T57A 4D41A 4Z3KA 2VRBA 3F1KA 5EQDA 3M1LA 1N5DA 1A27A 4MIOA 4E31A 1HDGO 2X58A 3GEGA 4B4UA 1I3NA 4R51A 1E6WA 1JKIA 1GU7A 2V6MA 2W8ZA 3A9WA 3K31A 3COSA 3JD2A 3RU9A 2YY7A 1MB4A 2O2SA 3C24A 4TROA 4BL5A 1WAMA 1YWGO 1VC2A 2UUOA 1ZO8A 4ZQFA 4XR9A 5BR7A 4HFNA 4JX8A 3QY9A 4PFJA 4C7JA 1CRWG 5T67A 4NPCA 2UAGA 4JP3A 5TRTA 1FDTA 2UVDA 2NU9A 3GVXA 4LRSB 2I99A 3ZHYA 1ONPA 4RVDA 3ZN2A 4OL9A 5DDIP 4J4HA 4CMEC 5KJ6A 3VPXA 4WJZA 5HWSA 3HE3A 3HDHA 4Z0PA 1H6BA 1WVGA 4XB2A 1PZEA 2J5KA 1UAYA 2NV6A 5HTOA 1S7CA 2ZTMA 4J1QA 2YFHA 4AG3A 4S3MA 1U2GA 1X0VA 1U5AA 3GGPA 4M89A 1L7DA 5HS6A 1QORA 3SEFA 3BYZA 5AYVA 3HSKA 4U0JA 5CEEA 4FCCA 3KYDB 3A06A 4R01A 4L75A 1KC1A 4R3NA 2SCUA 2DU8A 1QR6A 1B15A 4GVLA 2HK7A 1EUDA 3Q9UA 1B3RA 3DHEA 4E0BA 2ZK7A 4DWVA 2YQ4A 5DF1A 3JQEA 3GLQA 4NJOA 4UREA 5DN9A 1PL6A 4PVCA 1Z7BA 2A92A 1O9BA 4Y67A 4LRTB 3PHGA 1H0KA 4WNIA 5F3RA 1LLQA 3RUFA 1E1NA 1LQTA 2DTEA 4FC6A 1N8KA 2DKNA 3EC7A 1C0LA 3OEWA 3ETEA 5B1YA 3A14A 3K9QO 1M66A 4BO6A 4QT0A 2CF6A 1ZK2A 4ZQGA 2HMWA 4UVGA 1KVTA 3CZMA 4KZPA 4N5LA 2AE2A 4GH5A 2CVZA 1U4SA 5I9LA 3GHYA 2GSDA 4BMVA 3SVTA 3MWEB 3OJLA 4B7CA 1G0NA 3ZV3A 3ZV5A 5BNTA 1XWFA 2OP1A 2VYND 2YUTA 1LDEA 3BIOA 1A4IA 3DTTA 5JNLA 3NV9A 2VT2A 4Z9YA 5C7OO 4PG5A 1DEHA 1P1RA 4CL3A 3PHHA 4E32A 2CDBA 2ZATA 3GFBA 4QEDA 4YT5A 4YJFB 5IDWA 1QLJA 3GAFA 3PQEA 5CDGA 2GNAA 4CQMB 2HMTA 1SCUA 4Q3DA 2P5YA 1ENPA 2CNBA 1UZLA 4J90A 2XXJA 3D3EA 2JD2A 2BELA 1P1JA 3UF0A 4FJ0A 3OEYA 3S2EA 2EW2A 3UGKA 3AY3A 4Q3EA 1ENOA 1CIVA 1GADO 4INAA 4YJFA 4IQ0A 4KUEA 5MDHA 2DVMA 1X7GA 1AN9A 1DAOA 2J5RA 4NU5A 3K73O 4O5OA 2VYVD 3F9IA 1CF2O 1PSDA 1D1SA 3ADPA 4E3ZA 3ZZNA 1E3IA 4B7UA 4DA9A 2GPTA 4Q3AA 4GX0A 1JWAB 2X8LA 2FOIA 1B0AA 3AUTA 4QUKA 1GYRA 3WSVA 1JU9A 1ZMOA 3IQDB 3GDGA 3IP1A 1GEGA 1ONOA 2PNFA 3B1KA 4TRMA 4ZRNA 4NR0A 2HK9A 4ZICA 1N1EA 1GV1A 1QV7A 2PY6A 4FOOA 2I66A 4FQ8A 4YBZA 2NADA 1ISMA 3BXXA 3F4LA 5BSEA 1BMDA 4KMSA 4PG7A 1QP8A 2AG8A 3PQDA 4AJEA 4CR8A 3FBTA 2Z1NA 2W98A 3E48A 4R1SA 1T2FA 5I7EA 5EL0A 4A5OA 3I9LA 3TSCA 3TZQA 1LSOA 3HDJA 4ONEA 3UXYA 2VHWA 1YONA 1I2CA 3KYCB 5FI5A 3K96A 4NJMA 3DEYX 4CMIA 2EXXA 5JMWA 4HY3A 3JTMA 2PD3A 3IOYA 3ZNQA 3DQPA 1WMBA 4XDYA 3U62A 3AI1A 1NVGA 4J7CA 1U8FO 4PLTA 1KEUA 2DFVA 3UCXA 3HFSA 5THKA 3VPGA 3VPHA 3X2EA 2NSDA 5C37A 2VNSA 2H5LA 1WP4A 4CMIB 5CDUA 5JO9A 5T64A 3ETDA 3DFZA 1IB6A 4TZKA 4TZTA 4OXNA 1E3EA 5FWNA 3HJAA 2VWQA 1DDOA 3CPSA 1K2WA 3DTYA 4QFDA 3L6OO 3ROKA 4E5PA 2Y1OA 4D45A 1PZFA 4BV9A 3ZWOA 1HSOA 2WM3A 3DC2A 4GSKA 4RF2A 4LW8A 2ZQYA 1Q0LA 3C7DB 2BKAA 4XIYA 1YJQA 3MJEA 3VHRA 1VLLA 4URFA 4YDRA 4PN3A 4WCFB 1I8TA 5TC4A 3SC6A 2JD0A 2O3SA 5JPIA 1P0FA 1H93A 2RBEA 4HFMA 3ZV4A 1TA4A 1PZHA 2XAAA 1X1TA 2C07A 4BVAA 5AXAA 3PDJA 4BKOA 5A04A 4WEQA 3DDNA 1T26A 1P1HA 4MIYA 2HMUA 3HZZA 1YKFA 3L9XA 2YHUA 2WSBA 3M2PA 3ZV6A 3DMYA 3K2BA 3W6ZA 3IP3A 1A72A 1EFLA 4B79A 5KOIA 4TRRA 3DBRA 5IN4A 3GDOA 1FDSA 2W2LD 3D64A 2Z5LA 4IDFA 4KTVE 4BGIA 1ML3A 3ETGA 3CXRA 3DBLB 1K5HA 1R37A 4J7UA 4BO4A 5K9ZA 1MC4A 1QYDA 3GPIA 4XJSA 3I9JA 3I6QA 5EMHA 3LT1A 3DBHB 3JQ9C 2AEMA 1HSZA 3PJGA 3TDKA 2EGHA 3WIDA 2HRBA 2C2XA 3S2GA 3ROPA 4Y6PA 1R4NA 2PV7A 3HB4X 2Q2VA 4J1SA 3U5TA 2GO1A 4L74A 4MKRA 3DOCA 4K26A 4XB1A 4JROA 3KHUA 4DL9A 4IS3A 4IDAA 1P0CA 3FRJA 4Q3CA 1Y81A 1YOVB 1DHTA 3NUGA 1PJQA 1WDMA 4J4BA 4GL4A 3H2ZA 1KVQA 1DFGA 2HJRA 1XSEA 4N18A 4EZBA 2GN4A 3KETA 4I5DA 1F06A 4FB5A 5C5IA 4TVBA 4B8ZA 2JFFA 3C7CB 4FD3A 3RWBA 2R00A 2EWMA 1C1DB 4ZVVA 3SLGA 2OL4A 3F5QA 4BS9A 3RROA 3VZSA 3WG9A 1ZUD1 4JN6B 2O3UA 4GKVA 4JXKA 1GY8A 1VJTA 1E3LA 3IJRA 1EZ4A 1PGJA 4RPLA 1BW9A 3FWZA 4LK3A 3TF5A 1I01A 4RPKA 1U9JA 3B1FA 4R5HA 3TZKA 4DPMA 5IG2A 2C29D 1YBVA 2EP5A 5JAIA 1GUYA 3QE3A 4NK4A 3B20A 4DVJA 2AHRA 1IZ9A 1DBVO 1DHRA 2CD9A 5ILOA 2Q4EA 4F46A 1BTOA 3JQFA 2OBYA 4Y6SA 2AE1A 3G0OA 3DHNA 3L9WA 1PIWA 4O59O 4YJGA 2NVUA 4BKUA 1U28A 1RYEA 4A10A 4Z0HO 2X22A 2EKPA 4G81A 3V2HA 1AXGA 1LNQA 5GZ1A 4R1NA 4AJ4A 2AXQA 2UUPA 1XLTA 4ND2A 2OORA 2X5KO 3GMSA 1U3UA 3WFJA 1JKFA 2AG5A 1RYDA 1OC4A 4LGVA 4RLHA 5FYDA 3PWZA 2OHXA 2BI8A 3L6DA 1MFZA 2JHFA 1GAEO 1NPDA 4YJGB 3VKUA 1EQUA 1Q0QA 3PGJA 4W99A 2B0JA 5B12A 3DOOA 3K8ZA 2CMDA 4DXHA 3ONEA 3Q11A 3C1TA 2P2SA 3LT0A 4IMPA 5ENDA 3OFSA 4II2A 2WDZA 3ZWXA 3UCFA 5CDTA 1SPXA 4Q3BA 4BNHA 4QQRA 1DLJA 3LYLA 2JAHA 4OMUA 3UW3A 5KKCA 1B8PA 1J4AA 3GRPA 1QYCA 1WDLA 4GMFA 3R6DA 1E7YA 4D43A 2X0IA 1MG0A 2AEFA 1ARZA 2DTXA 3QV1A 3RUEA 5DP2A 3SXPA 2IDZA 3GPDG 1D8AA 1I3KA 1G0OA 5TLSA 4FFOA 3VTZA 3W8FA 4BO1A 4RPJA 1ZK0A 4BGUA 4YTEA 2BGKA 1NR7A 1JVSA 3IUPA 4LMPA 1BXZA 2IXAA 1E6UA 2ZTUA 1H5QA 1EK5A 3ZNOA 1N2SA 1A7AA 3WJ7A 3Q6IA 1DAPA 3DZJA 5FEUA 1LLDA 3OQBA 1GPJA 3K2EA 2G1UA 1IPEA 1TI7A 1ZSVA 5JCXA 1NVMB 2EJVA 2O50A 4YJHB 3TZCA 4EI2A 3GG9A 4XZ3A 3NRCA 2FZWA 2E48A 3WWZA 1NFFA 4IGFA 2VT3A 1GPDG 1ZXBA 1PJCA 3NKLA 4I8XA 5T8KC 5L9AA 3ZWAA 1E1MA 4J2HA 2AQ8A 2VNAA 2VYNA 1NFRA 4WECA 4J9UE 3VVBA 2QHXA 1GFSA 4CM9D 1EE9A 5FI3A 3MTGA 3H3FA 2XXBA 2Y1GA 4AJ1A 3EVTA 2BI7A 3DZKA 3H65A 2X5OA 4CL8A 4Z0TA 3GZNB 1A5ZA 1X15A 2Y1CA 3H7AA 3I5MA 3ZHZA 2POQX 4Y8VA 3AOEA 1NXQA 1H2HA 3E03A 3JD4A 3RAJA 2VZ9A 4IDEA 1M67A 1D3AA 1HDXA 4MVJP 3WBFA 2CSUA 4WKGA 1WZIA 1ULSA 4A73A 3FD8A 3FR7A 3OETA 3JQGA 3V2UA 1U3WA 3QQPA 4IGEA 4CLRB 1CJCA 4MVJE 4UAGA 1U5CA 2HUNA 3DWFA 3MOIA 2O3TA 2YDXA 1V3TA 2VHZA 2AQHA 5EINA 1FDVA 1GZ3A 3ZWMA 4LMRA 3ZU2A 1LBEA 5AXCA 1E1KA 3JQ8B 1JVBA 3KM0A 2R00C 2NQTA 1T1SA 5T8KA 3RCBA 1HETA 2B35A 3O8QA 1E3WB 2B37A 2O4UX 2Y1FA 3FNHA 4LN1A 2TMDA 1PEDA 4PLCA 1H6CA 3DZBA 3LDHA 2JHGA 4HXYA 5CDSA 3WTBA 4TWRA 1DRUA 1U8XX 1FDUA 2UV8A 3JYNA 2WE8A 3QVWA 4I5FA 2G76A 2PH5A 4J7XA 2EHDA 1KC3A 1PTJA 3DO5A 2BFMA 4ZHSA 4BO9A 1PQWA 2DPGA 4RCVA 5ITVA 3LVFO 4WLFA 2PGDA 1HZJA 4R1TA 5L7TA 2HU2A 4ND3A 1C0IA 4KOAA 3JQAB 2C20A 5JCJA 4IM7A 1GZ4A 4DRYA 1YDEA 3ZWVA 1VM6A 2P9GA 3BMNA 3RC2A 5I7VA 2EJWA 4J4TA 3NTOA 4IS2A 2IEBA 3RUHA 4BNUA 1M75A 5A05A 4BO8A 3AY6A 1T1RA 4EEXA 5L45A 1EQ2A 3GDFA 5A4DA 3WB9A 4BO5A 1ZNQO 4W7HA 4PCVA 4GGPA 2CF5A 3O8QB 4D7AA 1WDKA 3DR3A 4XYEA 3BTUA 5U9CA 1I3LA 4XYGA 1ZJZA 3V8BA 3UCEA 2OP0A 1PL7A 4FFRA 2FSVA 3DOJA 4R68A 5JC1A 3Q3CA 4MINA 4R41A 4ZQHA 2PFGA 4R9SA 4JCOA 5ER9A 1R6DA 4BNGA 4IJUA 5THQA 4QFCA 4GPD1 1BVUA 1DFHA 1JLLA 1T25A 1V9LA 3D5TA 3H9EO 5JSFA 4MP6A 1IYZA 3W4IA 2FY8A 5ADHA 4CUZA 4BO0A 2QQ5A 1B14A 5C3MA 1ZMTA 5IJZA 1PJSA 2CVQA 1JAYA 1UZNA 2EERA 4CQMD 1RKXA 3PZRA 1FJHA 2OXIA 1XG5A 1NP3A 3UUWA 1NWHA 2Y05A 4N54A 3L4SO 2J8ZA 5DCYA 3CMMA 3NT2A 2RHRA 3RI3A 3R1IA 5FF9A 3U9LA 2A35A 2NU6A 1PJ3A 4AJNA 2P5UA 1YB1A 2D1YA 3MTJA 3KYCA 4ZRMA 1ID1A 4J16A 4NQZA 2XF8A 1DRVA 4ALJA 4MO2A 2PD6A 1HWYA 1KERA 2AMFA 2OGUA 1UZMA 4WCFA 2Q3EA 5F21A 1SC6A 5BSGA 4NIMA 1YGYA 1ADFA 3LZ6A 3ONDA 1FMCA 4RQUA 1HLPA 4JJIA 4HFRA 2GF2A 3ZWCA 3AUUA 4RDHA 4L4RA 4GAEA 1SB9A 1X0XA 3HN2A 3TL3A 3U4DA 2EKLA 1ZXLA 2JJYA 4A7PA 2Q99A 5H83A 3JYOA 3CUKA 4L4XA 4CM8A 3OSUA 4NFHA 3SC4A 4XGNA 4J3FA 1NAIA 2QG4A 1L7EA 2EKQA 3GT0A 4W7IA 4HBGA 2WTBA 1P1KA 1EVZA 5KVQA 5L51A 3P19A 1Y9EA 4OAQA 1GQQA 4CV0A 2BFPA 4DTIA 5L40A 1J5PA 2D3TA 4MVJH 2GZ1A 1PJBA 3WTCA 2DC1A 3WGZA 2I76A 1YQDA 1ENZA 1R15A 5KWEA 5L4NA 3RC7A 3GRKA 4YAEA 1ADCA 3WXBA 3KYDA 1NYTA 4RVFA 5KNLA 3RU7A 1E5QA 1B26A 4MVJF 2ZB7A 2BFOA 1BG6A 2VTDA 4NBUA 2BMAA 5TQVA 4BGEA 1NM5A 4AJPA 2G0TA 2B36A 3G17A 3WMXA 3GEMA 2CY0A 4XEHA 4XQGA 5L7WA 4EJ6A 1EDOA 4BNKA 3HUDA 3D1LA 4DLBA 5IFLA 4HADA 2XOXA 2DBQA 3B70A 1NASA 3G1TA 1PX0A 1GR0A 2ZJ1A 3K30A 3L0DA 3VDRA 1E3JA 1U2DA 1XGKA 3AOGA 1HE4A 1ENYA 4L4SA 3WQSB 4ZQBA 3C3XA 1D4FA 1C3VA 1JN0A 4YAGA 1F8FA 4RORA 1MP0A 3FN4A 3KZVA 4LSMA 3AW9A 5JDCC 3GVIA 4AJKA 1GTMA 1YH3A 2WEKA 3QHAA 4CJXA 3IJPA 4CUJA 4YXFA 3A1NA 1BDMA 4MDHA 4PZEA 2J3HA 3QRWA 2Q1TA 1UP7A 5H82A 4EJ0A 4YPOA 3JQFC 3NEPX 2BH9A 3WGOA 2C7VA 3I6IA 3RFTA 3RSHA 1EEHA 3EVNA 2DQ4A 2O23A 3QWBA 4KDFA 4QXMA 4ID9A 1I33A 3JYPA 3ST7A 1Q2XA 4PLFA 3S8MA 5A9SA 3W4JA 1PGPA 3UHAA 2NNLD 3F3SA 3ANNA 3C8MA 1UDAA 5ER6A 1ULUA 2EP7A 3LT2A 3O4RA 1H6AA 2FPGA 1WPQA 1EMDA 2DBRA 4XD2A 4OOEA 3V1TC 5BQFA 3H6KA 3H2SA 4FS3A 1T4DA 1P74A 3V1UA 3QW2A 2VUSA 4J1NA 3MOGA 3VH4A 4ESOA 4RDIA 4LSWA 3CTMA 1B2LA 3OA0A 4BNLA 3GG2A 4YEDA 3TRIA 2W90A 4PZCA 4MVJI 2B4TO 3KBOA 4WLVA 3A4VA 2GN8A 4MKZA 1IY8A 2BRUA 3HG7A 1HL3A 3AU9A 4HUJA 1WZEA 3DHYA 2Y68A 4ZA2A 4K9DA 3GEDA 5IAAA 4IXWA 2I6TA 4DLLA 4HX5A 4MVJA 1LDNA 3SBOA 3GNQA 3RVDA 3WGGA 4RGBA 2IZ0A 2I67A 2WE7A 3P5SA 4YR9A 1ISJA 3MJCA 4KQXA 1QLHA 1CEQA 1GYQA 5I9MA 5I7FA 1DJQA 5I7SA 3M6IA 3V1YA 2OFPA 1DPGA 1N92A 3WGIA 5T5QA 1B16A 4WCDA 3WYBA 4ALKA 3T7CA 5DULA 1ISIA 1XDWA 1YJ8A 1YBMA 4E2YA 1JAXA 4RVUA 2Z1MA 3UOGA 5DP1A 4DGSA 2HMSA 4IMRA 4EDFA 1E92A 3PXXA 1M2WA 2EG9A 1A71A 2NVWA 3PQFA 4M49A 4ROSA 3TJRA 4D42A 3RUDA 1MGOA 4GVXA 1SEVA 2PGLA 5JYEA 2C54A 4EGFA 3FF4A 4WE3A 1RM3A 1Z7EA 2Q1WA 3AJRA 2GN6A 4OGWA 2PWZA 3NGXA 4BNZA 3GN2A 1JDJA 3PTZA 3TL2A 2J3IA 3OBBA 3TOZA 1KIFA 2G17A 1YDWA 4WLNA 5JY6A 1P77A 1M76A 1W0CA 5G2OA 3ZU4A 1F14A 2CDAA 3TNLA 4CM5A 3ZW9A 5I9NA 1U1IA 4DMLA 4IDBA 3PHJA 3NT5A 3WYEA 4EUHA 1YOVA 3ZGYA 5F1OA 2Q45A 1OMOA 1DIAA 3DZIA 2FZEA 2GLXA 3MEQA 3LC2O 2OMEA 3OIDA 3I9NA 1PWZA 3GZNA 3WMWA 1HDCA 3GY0A 1I36A 5A5FA 4B4WA 4I1IA 1QKIA 3AY7A 1N1GA 3G79A 1R16A 1VPDA 2C82A 4JP2A 5EERA 4H3VA 1KBZA 3L07A 4K6CA 2W2LA 1IE3A 3DFUA 1LA2A 2B69A 3JQGB 3WLFA 3ABIA 4ZN6A 2GYYA 1ZEJA 3OIFA 2YV2A 3F4BA 4BO3A 4S1VA 2C59A 3OJOA 4FPXA 4L73A 2FMUA 2W2KA 1Y1PA 2PA3A 4HKTA 1U7HA 4J0EA 3K5PA 4JK3A 2R6JA 4HWKA 4XGKA 4XQ9A 4O63O 3HADA 5B4TA 1XKQA 1GCUA 2WYWA 5AOVA 3GMDA 4BNYA 3LC7O 4ZU3A 4WGGA 1HEUA 2W2KB 5AQ1A 4AL4A 2F00A 3DZGA 2CFCA 2PR2A 4RV9A 4XJTA 4XQEA 2NVUB 1U7TA 1K6XA 3E9NA 2V65A 3AM3A 1L1FA 1DC4A 3WGYA 4DUPA 3KLPX 1OBFO 1R4NB 2X86A 4TKMA 1DIGA 3GVPA 4G2NA 2VQ3A 5EJ2A 4NHEA 3ADOA 1ZCJA 2GZ3A 3L6EA 1KEVA 4DMMA 1UXKA 3GOHA 4IJVA 1WNTA 5LCXA 4E2XA 2P9EA 3LSYA 1KVUA 1YS4A 3PIDA 4RPHA 3PWKA 4HP8A 1E3WA 2NTVA 4YAIA 1D1TA 3EW7A 1O0SA 4B7XA 5JBIA 3FTPA 4CMAA 3PJFA 2EF1A 3ZWWA 3WGQA 3CIFA 1B3BA 1HYGA 1LXCA 1UP4A 2ZIZA 3EUWA 2AA3A 4OH1A 2QIOA 4OJNA 4YWJA 1T4BA 2H6EA 4MP8A 3DONA 1HE2A 1IPFA 3Q0EA 3JQ6A 3SJ7A 3PFWO 1TLTA 3GQVA 4U8GA 3JQAA 3ROMA 1SZJG 2YDYA 4PVDA 4PLWA 2NQ8A 2OZPA 1KVRA 3NTRA 3O38A 1ZSNA 4CR6A 1EBFA 1LC0A 3WDSA 3GF4A 1UXGA 4PLZA 5G4KA 1ZH8A 1T2EA 3H5RA 3F46A 2ZQZA 1AUPA 2ZTVA 3BHIA 4P4GA 1VKNA 5DBFA 2YHIA 2QW8A 4Y9DA 1PR9A 1NNUA 1MLDA 3RASA 3VZQA 2AQIA 4QX6A 3TZ6A 5IXYA 1FXSA 1YBAA 3QWFA 5COQA 4RQTA 1O94A 3DMTA 1QRRA 3WQQA 1XEAA 2FR8A 2DUWA 5KIAA 4K1LA 5K6AC 3VKVA 4M87A 2B4QA 2JCVA 1Y8RB 3TQHA 4D0SA 3BMCA 1B8UA 3U4IA 1Z6ZA 2VUUA 2YHIB 3RJ5A 1RPNA 1LRJA 1C14A 1PS9A 2RCYA 4BNFA 4RLSA 4RJTA 5IDXA 4Y98A 3E5RA 4UVHA 2PD4A 3PVZA 4GX5A 3LK7A 1JA9A 3PHIA 1EK6A 1O5IA 5MGBA 5L4LA 1YE3A 2WYUA 3S55A 3JQDA 1VKOA 1Y8RA 3LLSA 4WOKA 4NU6A 3OJ0A 3IKVA 1CWUA 5JS6A 5BNFA 4E4YA 1XR3A 3BTVA 1K0UA 2BHLA 3LC1O 3IAHA 3GGOA 4R9RA 4BV8A 2AQKA 1C0KA 2NVBA 4DC0A 4ND1A 4AJOA 1DFIA 5TF4A 3DAGA 4NZ9A 4YJHA 5C7IO 1LDMA 1V6AA 4CLOB 2E6UX 1Y5MA 4G65A 2BF7A 3G3EA 8LDHA 4PGFA 1PWXA 3EMKA 5F5NA 2LDXA 3IC5A 2O7QA 5HM8A 4P22A 4FW8A 4UEOA 1FDWA 3M1AA 1LEHA 2V6BA 5K6AA 1Q7BA 1R66A 2ZYDA 4E6PA 4D79A 4BQPA 4RF5A 1Y7TA 1EVYA 4NI5A 4E13A 4IJWA 2ZB4A 3UVEA 2J3KA 2R2GA 3AFMA 1K3TA 4N5MA 3WNVA 4CM8B 2X4GA 1W4ZA 4E5NA 4OXKA 4CLXA 1X13A 5T6BA 3ZNPA 2GDZA 5U1PA 4CMBA 4IUYA 5BSFA 3HQ4O 1SMKA 1ONNA 3G1UA 5COBA 3C7AA 4R4JA 4YACA 4CV1A 1SNYA 1ZFNA 4DYDA 1O89A 4PLGA 2JCXA 3WWYA 1QYWA 1ADBA 1EE2A 3GNTA 4G5HA 5L95A 4BNWA 1ZZEA 3AOEC 2FP4A 4U7WA 4DQUA 3ICPA 4DC1A 3QVXA 4A0SA 1XHLA 3FWNA 3JSAA 1TVEA 1UJMA 2QYTA 3EK2A 1UXHA 3PYMA 1P1FA 1VRWA 3ZHBA 3PPIA 2B4RO 3AM5A 4AJHA 1PJTA 4I5GA 5JAZA 4N5NA 5H81A 3DBVO 1GUFA 3FPLA 4K28A 1OOEA 4RVHA 3E18A 2GGSA 3KYBA 4DREA 1MV8A 2VHVA 5JO0A 4JJGA 1V0JA 5A9RA 3GAZA 1ISHA 5AXDA 1OZAA 8ADHA 4B3JA 2DPHA 1ZIDA 5TJ9A 1HYHA 5A9SB 1ZJYA 5L53A 1I2BA 2PK3A 2AW5A 3ZNNA 5BSHA 4W82A 1LUAA 2DM6A 2IYPA 2IODA 5IF3A 3DB2A 4IBOA 3LF1A 3JQBC 2OBNA 3I1JA 4CM4B 1MUUA 1ISFA 1T2CA 4BUCA 1BDBA 1GUZA 2HMVA 5FFFA 3DAPA 4IIUA 4XRRA 4Z3DA 4GWGA 4BKQA 3VC7A 2EW8A 1JWBB 2HDHA 1K6JA 3I4FA 4M54A 1YQXA 1MG5A 4BHTA 3FTNA 5JDIC 4MPDA 1A9YA 2ZTLA 3FNGA 3N7UA 3RKRA 3NAQA 5G4LA 1OFGA 5G4KB 1TT5B 4BQRA 4P8RA 4CMKA 6ADHA 2VZ8A 4L9RA 2X23A 4RF3A 2GD1O 2IYOA 3H9JA 3KLMX 1XQ6A 1IHYA 3OJEA 4FDAA 4HNHA 3RQSA 1VE9A 4TVOA 4BOYA 4UUOA 2PGJA 4M86A 3PDUA 4FC7A 3WBBA 3PRJA 3AK4A 3ZWBA 4Q9NA 3GVCA 4Z9XA 3IUSA 3CZRA 2PH3A 1NHGA 1NVTA 3JYQA 1TEHA 3RFXA 1IUKA 4DPLA 5IDYA 5DOZA 3RUAA 5JC8A 1GZ6A 3VH3A 2HJSA 1F17A 1XIVA 3DMTC 3NDRA 4IDDA 4TRJA 4W4TA 4E30A 3HDYA 4NBTA 1SEPA 1X7DA 3RUIA 1PS0A 4BNIA 4YRAA 5HRUA 1BXGA 3WGHA 4F45A 4RVSA 1NBOA 3T4EA 4E12A 2YJZA 3OM9A 3QVOA 3GHHA 5KVVA 4B8WA 1E7SA 4ILKA 4YAJA 3NGLA 4IDGA 4FSHA 4PG4A 4BNJA 1J0XO 1LQUA 2C2YA 1DLIA 2PZKA 1P3DA 1XU7A 1R12A 4XA8A 4XYMA 3KTDA 2HAEA 4UUNA 1RJWA 2H1SA 4BKRA 1HLDA 4ALNA 2ZYAA 1E7MA 1RM4A 2CVOA 2WMDA 3LQFA 1AHHA 5JW6A 5CPBA 3P7MA 3BHJA 2QYSA 1F0YA 1JTVA 1YB5A 5EQFA 3UICA 1P33A 4E33A 3HWRA 2A4KA 3VVCA 2DUUA 7ADHA 1VL8A 2FPPA 2RIRA 2O3QA 3GUCA 4WNCA 4DIOA 2O2YA 1O8CA 1MC5A 4X54A 4CV3A 4D46A 2DLDA 4KTTE 1R4MA 1QSGA 2C5EA 3ICCA 2JFHA 1UXIA 1WMAA 2IZZA 2Q1SA 2V6FA 2E49A 4WPGA 2YW9A 3VZPA 3GGGA 4GLLA 3ZU3A 3PJEA 1KVSA 2IRWA 2QX7A 3GR6A 3GK3A 1ORRA 3KEQA 5JLAA 1E7WA 1O95A 4FJ2A 1I24A 1UDCA 4MKXA 3HHPA 2WD8A 2H9IA 2XPCA 1JKJA 2QZ9A 4CV2A 5KVSA 3IIEA 3QA9A 1IULA 1Q7CA 2I9PA 4A2CA 3HB5X 2OUIA 1GDHA 5KJ1A 5BNIA 1KEWA 3M2TA 3KVOA 3Q2IA 1J6UA 2PZLA 1LDYA 3PLNA 5JMPA 2B83A 2FR0A 5B37A 2X7HA 1BXKA 1PQPA 1Y8QA 4KDEA 5TT0A 2X1HA 4YAKA 1QYVA 6LDHA 3ULKA 4GSLA 3D4PA 1V8BA 3JQ9A 5DOVA 4EW6A 4ZGWA 1T2AA 2GCGA 1DRWA 4MVJG 3GH3A 2DBVO 3PGXA 3PI7A 3INGA 4IPTA 1DO8A 3RJ9A 2Y0CA 5TGDA 2VWHA 4D44A 1Y8QB 2Y1EA 3RD5A 2IXBA 4B3HA 1Y9AA 4PIVA 3D7LA 2JCYA 3CEAA 3HNPA 2P4QA 4D0RA 2FHSA 1CERA 1OC2A 1Z45A 3KSDO 3D4OA 2HSDA 5JXWA 1O6ZA 2W4QA 3ANLA 3MJ4A 4H7PA 5JAQA 3UH1A 4WCFC 1TB4A 5F1PA 1LJ8A 1Z73A 2HKIA 4W9NC 4KUGA 4EJMA 3QWAA 4N7RA 1X14A 3VAZA 1PQUA 3U4CA 3JQ7A 3K6JA 1R0LA 4C4OA 5A3VA 2Y66A 1PJ4A 3GVHA 5DT9A 2RAFA 3ENKA 3FSRA 1YL7A 2NWQA 1GL3A 3DL2A 5A03A 4EEZA 1C1XA 4J49A 1LX6A 2V7PA 1LSJA 1E7RA 2I5PO 1Q7GA 5CP8A 3AUSA 3CH6A 4IZIA 2J6IA 4D3FA 3RUCA 5B4VA 1E5LA 2QRLA 1M6WA 2VZ0A 4M1QA 1E77A 4FFLA 3ITKA 3JQCA 5DNAA 3NYWA 3JCZA 3SX2A 3GUYA 2X9NA 1W8DA 3AU8A 4E5YA 5A9TA 3W8EA 4DQVA 3JQAD 2OOSA 2NLOA 3IMFA 4CM3A 1QG6A 4PZDA 4I08A 4CM6A 4CMCA 1T2DA 3WLEA 4XYBA 3OICA 5CPFA 3KB6A 2VRCA 3CSDA 5LDGA 3D0OA 3RKUA 3KSUA 3W6UA 3NJ8A 3R0IA 1BXGB 3EDMA 1Q0HA 3HN7A 3INRA 1PR3A 1RM0A 5JY1A 4CODB 4QSMA 2VWGA 3MWDB 2BD0A 1UP6A 3LU1A 2FRDA 4IINA 1EVIA 4UEKA 5ES3A 5L7YA 4ALLA 5AXBA 4H16A 1CETA 3TFOA 4Q3NA 4F6CA 2GERA 4JBHA 3H9GA 1MXHA 3S2FA 2VYVA 3TZHA 2H63A 2YFQA 1HRDA 5F1KA 4BNVA 4FGSA 1LRKA 4OSPA 3IL2A 1V35A 1XQ1A 3DXFA 4MP3A 4CQLA 4IJKA 3ZWYA 2O4CA 4L0QA 3UKOA 4LCJA 1N7GA 1K6IA 3SLKA 3EZLA 1ZKMA 3OJFA 4R5MA 3VPFA 3QWIA 4I9UA 2GZ2A 4KQWA 3E8XA 4U5QA 2WD7B 1YVEI 4OHUA 4RF4A 1NPTO 3ZW8A 4XGIA 3D3WB 4J2OA 1UAGA 2PKQP 3F5SA 4FOSA 1H6DA 3T7EA 2C0CA 1EFKA 3P2YA 3PIIA 4WUVA 5JCJD 1NQOA 4R1UA 5G0TA 4JGBA 4YVFA 1BVRA 1I0ZA 2X0RA 1D7OA 3O9ZA 4YB8A 3PYXA 4XR4A 2YYYA 3CE6A 3EHEA 3FBGA 3H8VA 2DAPA 1NX6A 5TJHA 4WK6A 1N9GB 3C1OA 2I65A 4Q39A 3CINA 4FFMA 5TSDA 3DZHA 1PS8A 1E7QA 3V2GA 4GX1A 1XA0A 1G6KA 2DBZA 2TMGA 4R16A 5LC1A 4BKPA 3FI9A 1YXMA 4BGVA 3OHSX 3PHLA 4FJ1A 4MVJM 4UVIA 3JV7A 4O6VA 5GZ6A 1XU9A 1AGNA 3GN1A 3L77A 3WOHA 4DBVO 4QO8A 4ND5A 2Q49A 2WD7A 3H4VA 3WFIA 1I5RA 2FWMX 1YL6A 3D3WA 4ITUA 2VUTA 3HFGA 3VH2A 3ZDFA 4RO0A 3RBVA 3BMOB 1VI2A 3WIEA 2DTDA 1DIBA 3KEOA 3R3JA 2JKVA 4M8SA 3QVSA 1ZW1A 2Y0DA 3H3JA 3BTOA 3FR8A 1DC3A 4YA6A 3RIHA 2D59A 1YL5A 3O26A 1U3VA 2ET6A 3STHA 3WGTA 2NM0A 1CYDA 2NUAA 3I23A 1XYGA 3L4BA 4GWKA 4HV4A 3D4NA 4UEJA 4JNKA 4JJFA 5DBGA 3OQ1A 3IDSA 3PWSA 1N9GA 5EN4A 1AHIA 3OP4A 1P31A 4GLOA 3NDJA 2PZJA 4A03A 1FK8A 4W9NA 3OQ6A 3WNQA 1X7HA 4YCAA 4Z9FA 1ZBQA 4UUPA 1S6YA 1NAHA 2Y99A 1SAYA 4GMGA 4II3A 5A5EA 1NQAO 3H5AA 4F6LA 4MVJD 3S1LA 1J49A 3SJUA 1C1XB 4IQ8A 2VRCD 4CMJA 3RBXA 1EVJA 5G0SA 2D8AA 5ENVA 4GGOA 3NJ4A 2WYVA 3V5NA 4GBJA 1SBYA 4AICA 4CM4A 1LLCA 4NJMB 3EY4A 2BFAA 1A9ZA 2G5CA 5C7LO 3EYWA 3MZ0A 1BSVA 3BMNB 1GQYA 3E9QA 4BMNA 1LDBA 2WWRA 4NBWA 4BB5A 5G0VA 1HDRA 1XELA 1P45A 1H9AA 1ZK1A 2I3AA 4MOWA 3L4BC 1G1AA 3GC6A 1PGOA 4CMGA 4NDNE 4NFSA 4OOFA 4JIGA 3BMCB 4NNJA 4BMSA 4GQAA 5A02A 1LSSA 2O3RA 4OQYA 4IXTA 2PKQO 4NBRA 4XYLA 4FIZA 4J0FA 1I10A 1LLUA 2RH4A 1QMGA 2NACA 2A9FA 4TMFA 1H2BA 4TQGA 4AJIA 4XRGA 1WLYA 1ZEMA 5F5LA 3ROQA 2JD1A 4LVUA 4OKNA 4AFNA 4YRDA 1W73A 4EYEA 9LDBA 5CHEA 4CQLB 1R0KA 2QRKA 3ASVA 2ZCVA 2AEJA 2HCTA 3GZ4A 2FSSA 5GMOA 5HA5A 4J6FA 5U4QA 4A27A 1SOWA 4E5MA 1HE3A 1OAAA 3E1KA 4DBZA 1JW9B 2ZB8A 1GQ2A 2Y0EA 1BHSA 3OA2A 3TFQA 3NT4A 4TSKA 4YT2A 1F8GA 4XDZA 4RZHA 2PTGA 2GRAA 2YQ5A 2CUKA 1HKUA 5A3JA 5JFOA 1JQBA 4J1TA 5KKAA 3E5MA 5KVCA 3RBZA 4F3YA 4UVEA 5CG1A 5IN5A 4AJ2A 3OIGA 5LDHA 1NPYA 1NFQA 3FCOA 3DBLA 4CM9A 1QXSA 2Y67A 4LISA 1P44A 3AWDA 2ZCUA 1F12A 2JL1A 3F6YA 3ZHXA 3ZU5A 3U09A 2VOJA 4GKBA 4B3IA 4E21A 2G82A 4BNNA 2EGGA 3EAGA 2VHYA 4JBIA 3W1VA 2VWPA 5JYDA 4E2WA 3KO8A 2D0IA 2RH8A 4XKJA 3T4XA 1NQ5A 3WR5A 5EIOA 1KEPA 1WW8A 4OKIA 4JBGA 1HDYA 4D3DA 2UDPA 1R4MB 3RFVA 2DT5A 3QIVA 3AFNA 4BNTA 3VTFA 3QLJA 4CUKA 1I2ZA 1UR5A 2P4HX 1I30A 2V6GA 2VHXA 3H9UA 4RL6A 4PLYA 3OMLA 1DOHA 1WXDA 2O7SA 3WQRA 3PEFA 4A26A 1DSSG 4J43A 1H9BA 4PRKA 3VPSA 5KJFA 1NR1A 2E4AA 1EDZA 3KUXA 1E1LA 2GN9A 3ASUA 1LI4A 4YJDA 2CZCA 1GEEA 1TXGA 1PJ2A 1VL6A 4EUFA 1DIHA 1SO8A 1HZZA 4OYRA 2J3JA 4WLUA 4B4OA 3VDQA 1ZVMA 4U6QA 4CMHA 4NG5A 3IKTA 5CEJA 5IZCC 3QWHA 4DIBA 2Q1UA 4OO3A 3OF2A 1VSUA 2EV9A 4CLOA 5JDIA 3JD3A 1E3SA 3DBRB 4NMHA 3ZWPA 1NQTA 1UXJA 4IZHA 1DXYA 4MJLA 2ZB3A 5L3ZA 3TN7A 1YQGA 3X2FA 3NX4A 5GZ3A 2B5VA 2E37A 5ILGA 4ZQEA 2P91A 4OSOA 5G0UA 3BZUA 2QZZA 4FFPA 4DIFA 4Y6RA 2GR9A 1X1EA 1H94A 5ITWA 3PLRA 4ALIA 4ZJUA 2P68A 4I5EA 3TWOA 1MX3A 2DFDA 2X0JA 2EIHA 1BGVA 3DBHA 3U3XA 1Q1NA 3BTSA 3I9OA 3FNFA 1T24A 1XCBA 4C7KA 4CQMA 1EUZA 1HDZA 3I83A 2LDBA 4FBGA 2YV1A 1DJNA 5KJCA 5HBRA 5DBIA 4PLPA 1M6HA 1KY5A 2J5QA 4RPGA 1IZ0A 3E82A 2IZ1A 1PZGA 5AVOA 4ZD6A 3MCVA 1LDGA 1MA0A 1UDBA 1Z82A 3VH1A 3WS7A 1CDOA 4M55A 3R3SA 4P4LA 3F1LA 5DCUA 2X5JO 5TS3A 4OM8A 3QJ5A 4J91A 1NTOA 2IE0A 1LSUA 3H9QA 3GNSA 4L8VA 1KETA 1KS9A 1GCOA 2Z95A 2RHCA 3UFXA 4PRLA 4CM7A 3D5QA 4NH4A 4XWYA 1YB4A 2VTEA 5JAMA 3EZYA 5DZSA 5DCWA 1UH5A 3CMCO 3C85A 4CLDA 1B8VA 4L76A 1LRLA 3UAGA 3VOSA 3AI2A 4HNGA 3W8DA 4GX2A 4YQZA 3H5NA 3W4KA 1HT0A 4IIVA 5CEFA 1CQIA 3DAFA 4KUHA 3QVTA 1HE5A 2PZMA 1I3MA 4RZIA 1AE1A 4AJJA 5J23A 5HS4A 2GUGA 2Y93A 4K6FA 4Z6KA 4O1MA 1DB3A 2IEDA 3P2OA 4WEOA 3AI3A 4MIEA 3TPCA 1U4OA 4B4VA 1HTBA 4OIMA 4OQZA 4EBFA 4NBVA 1OI7A 3A28A 2C5AA 2Y1DA 3F47A 3PFFA 2PLAA 2Q50A 3JQBA 3BA1A 3G49A 3I3OA 5CG2A 1RWBA 5I8ZA 3GA0A 2FN7A 3NTQA 1P1IA 4NK5A 1HXHA 1IL0A 3ZH2A 1A7KA 1BRMA 3INTA 1TT5A 2D4AA 2VN8A 3FNEA 2VCYA 3PJDA 3OECA 2ZKLA 4O0LA 4UULA 4JLWA 4U6SA 3HDQA 1NWCA 3ZCXA 4IY1A 4KWIA 4OXYA 3BHMA 3KRTA 3TOXA 1N7HA 4IDCA 5CFZA 3IS3A 4YYZA 5A1TA 3WJAA 4CM1A 3UN1A 1VJ0A 3KOUA 5CAEA 1LTHR 4P38A 2B5WA 3MJVA 3FPCA 3Q1LA 4QECA 3WSWA 4AJLA 3PK0A 5KCZA 3I9MA 3RC1A 3S2IA 2C7GA 4P4NA 1YRLA 2D5AA 4QO7A 3FHLA 1P9LA 1QYXA 4LCEA 2X9VA 3JYLA 4PLVA 3I4CA 4JQCA 1V3UA 4CLHA 4D3SA 4EITA 4DYVA 4U0KA
chains in the Genus database with same CATH superfamily
4IIJA 2O0KA 4RHTA 3JW8A 1ISPA 2LR0A 1R4AA 4JJ8A 3ZCQA 1SQGA 4DLXA 5BYAA 3ORFA 3QKSB 1N0IA 4GI1A 4HRYA 4DOMA 3AUAA 1ZSYA 2AK3A 2IS6A 3C1AA 5ARBA 3UXEA 3LDGA 3CKKA 5BWCA 1PEAA 1JFFB 3KKPA 5AVQA 5E4FA 2AWOA 1QC5B 1M74A 3QP9A 4FE3A 3AFIA 4EAQA 4K9RA 5JH7A 3JD0A 5SZKB 1H85A 2UYYA 4RPIA 4AXXA 1B7GO 4C20A 1XD9A 1ADGA 1SXPA 3OC6A 1L5HB 1G42A 3KL2A 1RI5A 2WWGA 1KI6B 1ZJ5A 3OM0A 4FGWA 4HAOA 1JG3A 1NV8A 4QOIA 4BECA 3Q9NA 4EW2A 1QIEA 1JHZA 2CDCA 4LG1A 2P7IA 2PZGA 4M38A 1UM9A 3HRIA 4EYGA 2CLDX 3JAMA 4O2RA 4BO7A 5AI9A 1HYEA 3GCXA 4W6ZA 4HEA6 1J99A 4ERXA 1GJRA 1IHXA 1WSBA 5K0LA 3W5SA 1F4PA 3LK6A 1WPGA 4L95C 2H1FA 3P9IA 4WFQA 2QM0A 2H4YA 4K2HA 3NAGA 2FR1A 5DEIA 2FPIA 3FYUA 1A4UA 1KO8A 4WFIA 1T4MA 4IEEA 3AXTA 3Q2KA 1JBEA 4HVLA 3I01M 1E2FA 2Z58A 3R7BA 4YXWA 2HPAA 3T4PA 1ZUNA 4H4EA 4C0BA 5TS2A 4XD7D 4E08A 1R4ZA 1X3SA 4AKGA 2XHEA 5GM2A 3QEOA 3KKQA 1YDGA 4KAJA 4FFNA 3ACDA 1FFCA 1P2DA 1YDHA 4UPDA 3RAFC 1GV0A 3LIPA 4RYDA 4B4KA 4MR7A 1IUNA 1MABB 2C4WA 2JLCA 1GUDA 4QGBA 1I0LA 5A06A 3LQ1A 1CY1A 3WICA 4WZAE 4R69A 3H04A 1LZLA 1IOLA 1IAQA 5AH0A 4L8LA 1UMDB 4LDRA 1GO2A 1L7QA 3CO5A 3LHIA 4I46A 3E9ZA 3MJDA 1KAEA 5JJLA 2ZUDA 3AM4A 1RW4A 2PUDA 4JJEA 3X44A 4E4RA 5KTKA 3BMOA 4LYHA 1W6UA 4QTZA 3PF8A 2GB4A 2Z8XA 3DZFA 1USGA 4BMOB 2V0GA 1R9JA 3EXFA 3O73A 1E6EA 4H15A 3ONFA 5E0KB 4DLAA 5IULC 4LZPA 1NVXQ 2PZEA 1C0PA 2JRCA 3ES9A 4KR7A 1VLVA 5DNWA 5KJEA 2GEFA 2HA5A 3F5MA 4AD8A 5JPCA 4WLEA 1XE3A 2WJIA 5KDDA 4UUMA 1M1ZA 2VT6A 5C1PA 3CUEF 1JQ5A 3IERA 4CPDA 2NU7A 4XSHA 1HDOA 1SQ6A 4LZJA 1Q0SA 2Z1DA 3QUCA 4LY6A 1H23A 4IX9A 2ZWPA 3O8RA 1OLXB 1CRZA 5C1OA 1DWPA 2ZWMA 1TU4A 1HQCA 4GI5A 4M8LA 4RY2A 2GNPA 4XQCA 4R2XA 4UVDA 1MXFA 2CFOA 5FEMA 3GGDA 2D2IA 2XT0A 1GZ5A 2EKZA 2F8LA 3L8MA 4C01A 1PW5A 3B6ZA 4TV8A 2OWDA 4KNVA 1RPZA 2AOWA 2OV6A 3CVJA 3ISVA 3LPCA 4V2UA 1I6LA 4G1MB 4WZBB 5MFPA 3ANMA 2JKZA 2R5FA 2AF3C 2JLZA 3TLKA 3I1FA 1R0SA 1ZD2P 3QPWA 1YUNA 4FDMA 1DQPA 4QAQA 4U2EA 5J5VA 4DJTA 5HGXA 2AFVA 2LWIA 3OQIB 3OPXA 4KYUA 1XDZA 4FFSA 4ZALA 4RSGA 4MR9B 5E6UA 1W5TA 4LWPA 4R54A 4EY5A 4ILEA 2IHZA 2GASA 1U2QA 1Z0KA 4BVJA 2W6JD 2G4LA 3D6NB 4IVPA 1B74A 1VE3A 4MWBA 5I8WA 3C87A 1ZK3A 2WJPA 1U80A 2X9GA 2YV3A 4ALMA 4CTJA 1Q83A 1VJ1A 1IDN1 1VCNA 2H1WA 2O48X 3B8EA 2RC5A 5GY7A 3RIEA 3MJTA 3WX0A 3EPHA 2FF5A 1GYPA 1MAUA 4D41A 1XTQA 2JFZA 2VRBA 3BQMB 3W6OA 2AVDA 1VE1A 1TK9A 4M1YA 4P32A 4RMGA 2ZETA 3W8RA 3GLFE 4RD1A 3GEGA 4B4UA 1I3NA 1GKIA 3QU5A 1C4KA 1X7XA 2V6MA 1Y1LA 3OZWA 2PBLA 3K31A 2DFNA 2R1VB 4HQ6A 3RRMA 3RU9A 3KWLA 3PWTA 4XDGA 3DO8A 3M4YA 1VC2A 4ZQFA 3RBAA 4CWAA 4XR9A 2F9MA 5BR7A 1JDZA 1PW7A 5EP3A 3DUFA 4Q4HB 4TSRA 1Z2DA 2DSNA 1BE8A 2BP7A 1RKUA 3EDYA 1XZLA 3FTQA 1X39A 1N0HA 4IOMA 4BU0A 5AJZA 2H0AA 1Y33E 2NU9A 2OCKA 3G85A 2C3MA 2X0KA 1MNQA 1M5RA 2D1FA 3CZCA 4WTOA 1MORA 1JMVA 1MC8A 4V3CA 2F59A 3JVVA 5DDIP 4DR2B 2H5JA 4YHBA 2ZUWA 4ZFNA 1E2EA 4J4HA 1Z2AA 1JHMA 1EWVA 2WVGA 8AT1A 3HDHA 1GG9A 4QPJC 1PJRA 4XB2A 2J5KA 3BFPA 1JTFA 1H3NA 1YB2A 5B2FA 1U2ZA 1YASA 4J1QA 2RJNA 3D1JA 3Q7EA 5CBKA 5H80A 3V4VB 2I78A 4DF3A 3GQBA 3ZHTA 4QDJA 4B46A 1L7DA 2KYRA 3AFHA 4GEKA 1QORA 1SG0A 3J80A 2F64A 2FMXA 1LCIA 1RADA 2SNIE 3GJQA 4FQ5A 1OREA 3JATA 1XAGA 4R3NA 1AUOA 2H4WA 2SCUA 1KU0A 2DU8A 4C29A 4LOKA 1EUCB 1SC4A 1B15A 2YOGA 4GVLA 1ZP6A 2HK7A 2VDUE 4BUJA 4E0BA 3DHEA 3OZXA 1J8MF 4W5HA 2ZK7A 1YQTA 4KKXB 5GIOE 2CNNA 3IP8A 2YXBA 2P2YA 2AHOA 1RKQA 3LXUX 4YIKA 3RK4A 4ZYUA 3DZCA 4UREA 5DN9A 3KBBA 4B3FX 1ACLA 1Z7BA 4Y67A 3OCWA 1H22A 4LRTB 5F3RA 4LYEA 3NHPA 5LBTA 3DDUA 2XGGA 1H8HD 1N8KA 3HJTA 2I1VB 3QEBZ 1M1UA 1AKNA 4UUQA 2Q8PA 4N12A 4ARAA 4BO6A 1B8NA 2BEVB 3RHSA 2CXOA 4OQEA 4QUBA 4V02A 4X1KA 3QXSA 3DEHA 3JQQA 4MULA 1KVTA 3E4DA 4YCDA 2RGNA 4BLOA 5C53B 5A5GA 4N5LA 1QAOA 1IM2A 2ESRA 2UZ3A 2CVZA 1KEKA 2INGX 2M6SA 3GHYA 4EW6A 3B1YA 1KKMA 1G0NA 1NBEA 3ZV3A 3NOOA 1XWFA 3OCZA 4RSRA 1P91A 2ZYRA 1ZAYA 3KKMA 3BB1A 3UV7A 1YDMA 3BIOA 1P5HA 2YW2A 1N0VC 2JAOA 3DTTA 5D86A 4U1RA 1LW6E 3GDHA 1IU9A 2EL9A 3A6LA 1Y3BE 2VT2A 4QQKA 3VSEA 1UT6A 1YZNA 3IIIA 2WG2A 4R2WA 2AFIA 1WQ1R 2HSJA 4YT5A 2VPXA 4CHGA 4MLDA 2GNAA 2ZDHA 1NC3A 5FPPA 2ZB2A 3ED5A 4TGLA 3ZEIA 1RP7A 2HMTA 2BM1A 1SCUA 3TW8A 4CQMB 3F8WA 3RYTC 1Z5WA 4D81A 5KYUB 2JGDB 1OILA 5BWNA 1KFKB 3D3EA 4CCAA 1OYWA 1VG0B 2OORC 4NATA 3UF0A 4FJ0A 3T1QA 3G2QA 2WYOA 3S2EA 5CD9A 5KMGA 3UGKA 5HZGA 1BN6A 1ENOA 3LUJA 5T3YA 3E70C 3HKCB 1CIVA 4DZRA 4YJFA 4PCUA 4IQ0A 1X8LA 1WR8A 3ABZA 1QP7A 1K68A 1DAOA 1XN4A 2FH5B 2PX0A 3K73O 4O5OA 5IBRA 4JV5B 1CUJA 5BSMA 3DL0A 4RFSA 1PSDA 2JLXA 2VRNA 4COKA 1KZ6A 3BQ9A 1JHYA 1KYVA 2BM9A 4E3ZA 4P86A 4HL6A 3IQEA 4B7UA 3ZKWB 4N03A 3RYCA 4CTMA 1Z4PX 4YK7A 5K8JB 1T5TA 2D2FA 3LY8A 2VSYA 1AO3A 3UFXB 1XJWA 1G21A 2BGRA 2JPDA 3HBLA 1UF9A 3AIMA 1JEYB 1GYRA 2ZWOA 5DCLA 2CC2A 1OZGA 2VQSA 3GDGA 3GXOA 5KWJA 2AMJA 5F7ZA 2PNFA 2CL0X 2GZHA 2WHEA 3B1KA 3PUJA 4NR0A 1F60A 2OZKA 2HK9A 4TRMA 2I55A 2O1EA 3GIWA 1N1EA 2XSZA 1MT3A 4FOOA 3R4CA 1NIPA 2PSJA 1XK6A 3QFTA 2IPMA 4V0OA 3P9ZA 3BXXA 4MQUA 4TLAA 2FLKA 3N75A 2WFAA 5LP6A 1RWKA 2CXHA 1E59A 2GCOB 5SV2A 3GWZA 4ER5A 3I61A 1U2PA 4R9VA 3UHJA 3DDWA 1PR0A 2SKDA 4R1SA 1G20B 4TV8F 5EL0A 1YE8A 5I7EA 2NP6A 3LUFA 4V1CA 3TZQA 1F6BA 3HDJA 2WIGA 4DCTA 1I2CA 3KYCB 1CY7A 3R4VA 2VAPA 3K96A 2BFDB 3TMYA 4NJMA 1WULS 4Z4QA 1J56A 3UJ7A 2A86A 5JQGF 2C4NA 5HUJA 1YA8A 2YVAA 3JTMA 1KH1A 3IOYA 1Y7IA 3ZNQA 1RHMA 1EFRA 3DQPA 4ES6A 5IUJC 5A7HA 3RADC 1U3CA 4MARA 1WUHS 2HBYA 4ZGGA 3R75A 3PNOA 4JD5A 2WY2D 4ENSA 1NNLA 1AHPA 1UEJA 4UTPA 1FNMA 4EVQA 3VPGA 2V97A 4F92B 3RAGA 1FUIA 3W7VA 3REGA 2VCHA 2VNSA 3LIIA 4N5HX 4MYUA 4YPVA 2UYCA 1KJNA 1BEZA 5DYGA 2CLKB 4TZTA 3DFZA 4PHHA 5T64A 4ER7A 4OXNA 1E3EA 3HJAA 3KCQA 1E4YA 3ROKA 4KAAA 4E5PA 1MKYA 2B7LA 4Q37A 3LCRA 4BV9A 1YFLA 4DLWA 4GSKA 4C3ZA 4H35A 4DMHA 3TSWA 3L01A 3V4ZA 4MLZA 2HA6A 3O3NB 3BXEA 4GMHA 4IFBA 5HCUA 1KQGA 4AMBA 5EZ6B 1B73A 2OQIA 1A9RA 2GN1A 3CCBA 4PM4A 4TLBA 3SZ3A 4ARVA 4PN3A 1E9BA 1NBWB 3Q0IA 5EXTA 2O3SA 5JPIA 3CPJB 3U6BA 1H93A 3PGVA 4QOFA 3F74A 3UMCA 4BFUA 3VHQA 3G0IA 3D43A 2C07A 3LP8A 1AM4D 4H27A 5ECYA 5AXAA 1F6DA 2AL7A 1LI7A 1X74A 2DFLA 1TM3E 2IPAB 3HNOA 5LUBA 4ZYZA 4B3GA 1W46A 1P1HA 4XCQA 2YL2A 2WQ7A 3M2PA 3D0QA 3PFHA 1Y37A 2AN9A 4AF8A 4C2TA 4YV1A 2Q8QA 2VK8A 1A72A 1EFLA 1THMA 1JPVA 3HCEA 1PJZA 5DH9A 2CXRA 3ZE6A 4ER6A 4JASB 5CFMA 4HQFA 4M0KA 5KREA 4I6JA 1R0WA 4RL4A 2R8ZA 5ALHA 1EGQA 4QM7A 4F5WA 2Y3IA 3CXRA 4YFYA 4BO4A 1T0UA 4UBNA 2XH8A 3TEJA 5K9ZA 1ILWA 4LZNA 5I45A 1VYTA 4HYYA 2BM0A 3M9XA 1AQIA 3BKXA 4XJSA 3I9JA 2Q5FA 2NPOA 2ES4A 2M98A 3OHPA 5EMHA 1OH8A 1NMEA 3LT1A 2OGSA 1PD1A 3CX7A 3B2NA 1E5VA 1HSZA 5JH7F 2HQSA 3TECE 3ONVA 2N3ZA 1D1PA 3KPWA 3GP5A 2KS6A 3IO3A 4W9RA 2MR5A 2JATA 5DTJA 3IEMA 3BBLA 3NC1C 3AILA 4L74A 5IM4A 2UVPA 2AFHB 2F3UA 2XHZA 3OPQA 4Q18A 3SGLA 5AK6A 3VI4B 3W5DA 1OX5A 4O2AB 2GJKA 2HEGA 3WQHA 3KWMA 1I4LD 1BC5A 1TZCA 2NO7A 2ST1A 4LRQA 1Q12A 2OENG 1ZU5A 5BUZA 1R10A 3PXGA 1QDUA 4GL4A 1OLUB 1KVQA 4KR2A 1KI6A 1DFGA 2HJRA 4IVQA 4KQ2A 5M7EA 1FXWA 3WL5A 4Q3KA 3DSRA 1Q7RA 4N18A 3B38A 3HO6A 4EZBA 2GN4A 3TIGA 4S1TA 4LFAB 2DPLA 1RYNA 4TVBA 3FH0A 2AI1A 2JFFA 3UT0A 2Z9BA 3DVAA 1OXSC 4QUJA 5J2UA 1C41A 4HOYA 4IEFB 4JX9A 1TUGA 2TSYB 4ZVVA 4BXOB 3EG5A 5BV0A 4BS9A 3VZSA 3HYTA 1JMKC 1XOIA 4NE9A 1P2VA 5D51S 4EY6A 1T8TA 4GKVA 1TJYA 3B1ZA 3MGAA 3IJRA 5DHFA 4UCFA 3RSSA 3TYXA 1BW9A 1R18A 3EZ2A 1VHTA 3FWZA 4LK3A 3UB4A 5JOQA 2VYCA 6REQA 1Q17A 1PTKA 4W5WA 2CLIB 4P34A 3IKJA 3TZKA 5BR4A 2QV7A 3T3MB 1GXSB 1SVIA 4OGLA 3HXMA 3ZUGA 5JAIA 1CUXA 2VF8A 2XCUA 1P17A 3OPYA 3T6KA 1E1DA 4NK4A 2QUJA 1R5BA 4DVJA 2AHRA 1GDDA 1A9SA 1WDTA 3ABRB 4RW0A 1IRXA 1EX7A 1EWQA 2Q4EA 4F4UA 4Y2GA 5EVCA 3ACBA 3MCZA 1KI2A 4P3PA 4BX2A 5JFTA 4HN2A 1PIWA 4P4SA 4A6PA 2NVUA 4ARSA 4YREA 1U28A 2Q41A 1I14A 2CB9A 1WF6A 2FFHA 3I2FA 5DNDA 5DRTA 1SURA 1BYUA 2YASA 4LZZA 4ZTZB 2ZUTA 4OQPA 1E60A 2R1UA 2DZDA 4NENA 3CC8A 3PU6A 2QRHA 1QHIA 1ZIOA 1R8JA 4I55A 4RLHA 3DCIA 4Q1FA 3N3AC 1MRZA 5IPFA 3VO9A 4UPVA 1R5NA 4LJ5A 3JZDA 3PGJA 3KU1A 3O1IC 5GAJA 4MUAA 4P6VF 3LBIA 3SE7A 3PR1A 3L40A 2IJGX 1OLXA 5BNWA 4XOUA 2P2SA 3LT0A 1EFPA 5ENDA 4YV7A 1C80A 1FU4A 3ZWXA 3A1WA 2QJRA 3BD6A 3HXTA 1K9VF 1QS0A 4CGZA 3M9LA 3LYLA 4DWOA 3RIGA 2QS9A 5CLGA 4C0HA 1GPUA 1WDLA 2WWIA 1UJ5A 4NCXA 1A8IA 3PD7A 5DP2A 4H1UA 1SUBA 2QE7D 2OY0A 3NDPA 2PAFA 3TD9A 1I3KA 2SKEA 1FIUA 1SHJA 2RGUA 4FFOA 3OQIA 5ECDA 2IUYA 5GJVC 3RFFA 2ZVPX 1XCJA 3GRZA 3W8FA 4LDJA 2Q9CA 2Z3WA 3AMVA 3IUPA 5EYPA 5G1OA 3K2QA 4YJ2B 2I2FA 1JG4A 1CZOA 1E6UA 2J3DA 2ZTUA 3BPSA 1YU6A 3MGKA 4LF5B 1A7AA 2FKNA 3EXAA 4MKGA 4FYXA 1IHDA 1E6KA 3Q6IA 4E5UA 2UZ0A 1V26A 3PXEA 5DGDA 2LZ0A 2HIGA 4NYJQ 4X65B 2J0UB 4KREA 3K2EA 3SICE 2F4NA 2G1UA 2O0JA 3LBAA 2J3LA 3ICOA 2HNAA 2PKYX 5JCXA 5EI5A 2O50A 4ZCLA 1YQWA 1RWXA 1WKBA 2Z6AA 4XZ3A 1JH8A 1URPA 3Q9LA 4K6KA 3NRCA 1I6WA 4KXVA 3WWZA 5JCOC 5HKAA 1JYEA 2QM7A 1XEWY 1BHJA 3OFKA 4KO3S 5IBPA 2FWPA 3L7BA 1Z4MA 4KVFA 3ZWAA 1RQGA 1NXPA 5FL3A 4WECA 3ROTA 3VVBA 1B6SA 2QHXA 3L0PA 1ZM9A 1E3QA 3IQFA 3MTGA 2ZBFA 3H3FA 4O4LB 1A2KC 5KSZA 1XXLA 1WUYA 4LECA 1KEZA 1KHTA 2A67A 3H65A 1AUVA 1WXGA 1M34E 2NUPA 4M9CA 2XDYA 4FS8A 1RXSA 3A6GA 3NP9A 2P4EA 4Q6BA 4Z0TA 4XUEA 3U7RA 1T2VA 3AOEA 4FYMA 1NXQA 2NO4A 1BRTA 2ACWA 5IUNC 5JJKA 4H9GA 4HDKA 4R2MA 2VF4X 3NS7A 3FPJA 4OAPA 4MDYA 1GIAA 2QW0X 4KV7A 5B1DA 3TR5A 4DEYA 3FYUC 2QE6A 2QY6A 1ESMA 2JIBA 4C04A 2GFQA 3LH5A 1S3GA 2R8YA 1G5RA 3MWFA 1PK7A 3V2UA 4FB4A 3DHVA 3CSSA 1QWSA 3VRHA 3MWEA 4DQLA 3EXFB 3QQPA 4GOND 2JJ1D 3Q6NA 3OFND 5E6RA 4QHTA 2QYHA 3USZA 3TDNA 5EIBD 3WLRA 1UEIA 2GPJA 4B74A 4URHA 2J33A 2C5SA 4HEA1 4X1YB 1MX5A 4QJ5A 1M7HA 3MOIA 3LT5A 3AFOA 4YAUA 4C14A 4RZSA 1DBSA 4PHCA 3O21A 2O0LA 2IXTA 2VHZA 2Z09A 4UHKA 5AK0A 1WQ4A 3EGXA 5EINA 2XB2A 1ORTA 2H2GA 5AIAA 3ZU2A 5AXCA 1KO4A 3RGGA 2F67A 3WGLA 2R00C 1N0UA 4XJVA 4ENRA 3NM6B 4UQOA 3JZMA 1TGYA 3N8NA 1KDVA 5B3JC 5JHGB 1UM8A 2I4MA 2IP4A 2IYYA 3NC0C 4WWHA 3LYAA 2R5NA 3C6BA 1PEDA 1SIWA 1HZZC 3H5IA 1CQZA 5EWLB 1TAQA 4DEVA 3CH7A 3F71A 1YVUA 1XDUA 1ZC3A 2JHGA 3UB3A 4LJ7A 4M53A 1QHHB 4GOLD 4HXYA 1YA4A 4X62B 5CDSA 2ZUVA 3WTBA 2BEKA 1FDUA 2UV8A 3K35A 2PL3A 2LP4Y 3ZY2A 2PWAA 2PH7A 2WE8A 4PYKA 3FLMA 3QVWA 3SIWA 5HPYB 3CA8A 4TTJA 4X9XA 3E81A 2PGXA 2QRZA 4HAXA 2BFMA 5GV7A 4BO9A 4ZHSA 3WYDA 4PYQA 2DPGA 1FTNA 5E6UB 2AI2A 3TQTA 2HQOA 1TECE 2K4MA 4EJSB 1FP4B 1EB8A 2YMPA 3LD9A 3LVFO 5L7TA 2P6RA 4CF5A 1G55A 2HU2A 1FA9A 2BFEB 1P5ZB 4ND3A 3F5FA 2ZBGA 4V2IA 4YS6A 1RXIA 3OIYA 5JCJA 3HKBB 1RIIA 1H9CA 3FWYA 2XXAA 1DCMA 2IWHA 3SC2A 2P9GA 2Y27A 1NUPA 3TNFA 2B30A 1QONA 1OA1A 1SBCA 1U8YA 3NTOA 1Q21A 1EGAA 2IEBA 4HH1A 4UASA 1RNLA 3HSYA 3SKYA 1HQKA 1JHDA 3AETB 2A6PA 1RXVA 4MWZA 3ZG6A 1EQ2A 1P8JA 3IMKA 2WPDA 1NV9A 1JAIA 2ZSIA 3FDFA 3R0ZA 3QXCA 4KSCA 4JI8B 3I39X 1N5MA 4F9EA 4PCVA 3VYWA 1R5OA 1N9KA 1FRVA 1FYXA 2W11A 3B1XA 5JWRA 4EH1A 3TS1A 3THXA 2LE0A 5FBWB 5C8YB 4HLUC 1W36C 3WIBA 4E5SA 1NLMA 5DMHA 3V8BA 3UCEA 1PL7A 2VEOA 1DVRA 3OU2A 1QGDA 3T9EA 5JC1A 3MRVA 4R41A 4ZQHA 4AO6A 2QPAA 3OIUA 3RVPA 5KU1A 2MYPA 3CLUC 3A6HA 5ER9A 1P75A 3DE5X 3RTEA 4DCNA 2DE0X 1QOZA 1NZDA 5FB3A 3PRKE 3NV7A 1PT9A 3IEXA 4AYXA 3V8QA 3L0CA 1WVMA 2FG7C 1JFSA 4KQJA 4RELA 1JLLA 5JSFA 3GLKA 1HE1C 2R1TB 3E2MA 2K7FA 4I66A 1IYZA 2COKA 1EYZA 2XGMA 4EY8A 2WMNB 1YTUA 5LBUA 1B14A 1QIGA 2O2XA 2Q29A 3IUYA 4G8BA 1PJSA 1NRXA 3NCHA 1IBLB 4P3KA 5I9IA 5JS8A 1WM1A 1SVMA 2OXIA 1FJHA 2YZNA 4ZARA 2YWXA 3O6VA 5LZ5A 3T3GA 4LGYA 1C3XA 3UUWA 2X1VA 3NHKA 2X8JB 1P4RA 4N54A 4FMBB 2ZRFA 3ZQ6A 4ANFA 1XALA 2J8ZA 3LXRA 2B3TA 1OTHA 1D4ZA 1VJGA 4UFPA 4EM6A 5FUXA 2P5UA 4MR8B 2HDOA 3G5MA 1TLLA 2XZPA 3KYCA 1UIRA 4LI3X 4AX8A 1ID1A 1C9MA 1J0AA 3TJMA 3UMFA 3VJMA 3P4XA 1EFCA 2KJQA 3U1VA 4ALJA 1Q1BA 3MILA 2KB0A 4NPAA 1UZMA 2C78A 4M1WA 2WJGA 4AY6A 2X77A 5BSGA 4M1TA 5ARCA 4NIMA 1H2AS 1YGYA 1ADFA 3LZ6A 1LK5A 3NPMA 3ONDA 5CH8A 3UJBA 2HV8A 2HFKA 3NTXA 1PG2A 4RQUA 5AKEA 2C2OA 3T5MA 3J7TA 2WJAA 2XQFA 1A9TA 1AD2A 5BSRA 4F93B 2RHTA 2K5UA 3SQNA 2XUJA 4CEHB 2H08A 3OTHA 3PUXA 1A1VA 2NZ8A 3HN2A 3U4DA 4I8DA 2CYCA 4D9FA 1JT9A 2XX3A 2I2BA 2JJYA 5FHRA 2J0SA 5LU9A 4QXPA 4M1EA 1F48A 3DT8A 1RAIA 4TMVA 3ZJUA 1RP1A 2FWAA 3NATA 1BROA 3ML1A 2AD5A 4UU7A 3JRNA 4JBNA 3WRXC 5EJMA 4JVMA 5IH7A 3BWCA 2EKQA 4HBGA 2WTBA 5LD2B 5K3DA 5KVQA 4OQMA 3C0KA 3P19A 1GQQA 3HP7A 2H16A 1GPMA 2AX3A 2GILA 2D3TA 1KR2A 1VHDA 3K0FB 5E95A 1KO7A 2GZ1A 3O74A 1SCDA 3MINB 4FVTA 2DC1A 2WJ4A 4O4JA 2I76A 3WGZA 1XV5A 3H5LA 1YQDA 4KI0A 4D6PA 2AEEA 3FPBA 4DAEA 3FDJA 1ENZA 3IMEA 3U3JA 3AR8A 1U65A 1REQA 3NXKA 5L4NA 3GRKA 3TGPA 5D3KA 3WXBA 3KYDA 4XTCS 1T3ZA 1NKSA 1OZHA 5BMVA 3S40A 1B26A 4CKXA 1ZOSA 2ZB7A 4RV4A 3VZDA 3ZIAD 2VTDA 3UM9A 2OR3A 4X41A 1NM5A 2X1MA 1CFJA 5AW3A 1U9IC 2VI5A 3G17A 3QI7A 4NE7A 4OYLA 3DLHA 2FQXA 2A1UA 3GA5A 1M73E 1YR7A 1PLLA 4IF6A 4NV1A 2GD0A 1J9EA 1EDOA 1EDDA 1DAEA 2YN2A 3PQ4A 2A0FA 1RAGA 3D1LA 4DLBA 3B3GA 4HADA 1J2JA 4Y3UA 4PTZA 4CFSA 1OXKB 5EFOA 1PX0A 3PB3A 2ZJ1A 2GAFA 2X3FA 1U8UA 1U2DA 1XKXA 2F7SA 5TXGA 5EIEA 2RG1A 3AOGA 3PFNA 1HQYE 4CF4A 2I6UA 2JI7A 4L4SA 3ZQJA 3WQSB 4ZQBA 4RKFA 2AOUA 1XMSA 5HIMA 1F8FA 4MUGA 2CCGA 1Z4LA 3DLCA 4EKIA 2P3LA 5ECWA 3JVIA 3FN4A 1AZSC 2D2XA 5TQ2A 4MHSA 2H0QA 2DLCX 1JALA 3GVIA 4AJKA 1KYXA 1JX6A 2Q0XA 2WEKA 3KB1A 1BS9A 3QHAA 4RA6B 2WIAA 1RLUA 3I6YA 3MTBA 3FGNA 4NBLA 3AUJB 3QU2A 3IJPA 4H3HB 4UCWA 4HSEA 5HCIA 5SYAA 4F06A 2Q7XA 2J3HA 5DTEA 4M0FA 1UP7A 4KXMA 2JFBA 2OBBA 4R1OA 3BK7A 2I1WA 5H82A 1IY2A 5HOQA 3JQFC 4EHAA 3NEPX 2BH9A 4NVRA 3AB7A 2C7VA 3WGOA 1N2OA 3RFTA 4WX2B 1X9HA 2CWDA 2DQ4A 1IQUA 3V32A 4C7XA 1A2OA 2GLUA 4ID9A 2VBCA 2E5FA 5C1BA 2PS0A 1K66A 3CG0A 5D3MB 5C5DA 2PU5A 3UHAA 3C8MA 2NSJA 5J2UB 3LT2A 2EP7A 2JGMA 2OV2A 4XB6B 3V1TC 3GFRA 2DPYA 4GBGA 3R6GA 1T4DA 5CA0F 3K1AB 4HDSA 1SCIA 4QNNA 3IHLA 2FSVC 4J1NA 5IW8A 4HEQA 4CDNA 1IJBA 3CTMA 2R751 4AI6A 4JQYA 1K06A 3PRYA 3TRIA 2B2CA 1QG0A 1U6IA 2LNDA 3NHJA 4WLVA 1IY8A 5JASA 2BRUA 2UU9B 1LTKA 4LBVA 3AU9A 4JU9A 1RMTA 1QKJA 5EWMB 1XN1A 1Y3CE 1SD2A 2OHGA 3A6JA 4ZKEA 4ESVA 2Y68A 2P41A 4PR3A 1K1EA 4ZA2A 1DUSA 2JJ2D 4FINA 4A6XA 4IXWA 3GLGB 2Q0QA 2I6TA 3NIGB 5CLHA 1T29A 3KAQA 1NMYA 4ICIA 4P4SB 4IUBS 2I7VA 4GUAA 1THTA 3RVDA 3TRJA 4RGBA 2IZ0A 4YRMA 5B53A 2FUCA 3HHEA 2WE7A 4EELA 1CDEA 1NYQA 3P5SA 5FUMA 4K6OA 5FFNA 5D3ZA 1ISJA 1GGKA 3MJCA 5K3CA 1R88A 3HEAA 3TW4A 3V8MA 1RBZA 1CEQA 1SCKA 2PXXA 4HLNA 4ADSG 3ZHOA 3MSCA 1M6NA 2OFPA 1DPGA 1MH9A 1XD2B 3F78A 3FZNA 4G5XA 4F1KA 3AF2A 5HOEA 1JSRA 1PYDA 4YX9A 2HI0A 5HQJA 4ALKA 5JD4A 3T7CA 2X2EA 2HHHB 4IDHA 4RGQA 3D6JA 3IOBA 1CR0A 1DBQA 4BMZA 4E2YA 4W5NA 3OZGA 2A1TS 1GG8A 2Z1MA 2NO0A 1G291 3A0RB 2BDTA 3UWDA 5K1ZA 2HMSA 1KORA 2BE9A 1FE8A 4B2IA 4BKMA 4DGSA 3O8CA 5P21A 1FFEA 3LZCA 4JIMA 4PC3A 3FCCA 5IS2A 1YJBA 2WF5A 4OJYA 4Q00A 1OH6A 2YHSA 2BKVA 2O0HA 2ALJA 2MDTA 1Z5GA 3PXUA 4UDOA 2JDIA 5SZIA 5JALA 4GVXA 1DX4A 2G08A 1FTQA 1SEVA 5J4LA 1VKJA 4EGFA 2VP0A 4B75A 1QVAA 4DSNA 1Q3HA 4PYMA 3JASA 1Z7EA 3EBPA 1Z38A 5HUQA 4OGWA 1W88A 3NGXA 4X6LA 1M1YA 3GN2A 4P31A 1JDJA 4HD8A 4G0QA 4QPNA 4NBSA 1HNNA 1SPBS 3TOZA 1KIFA 1GG2A 1W4LA 3KC2A 2JF0A 3O1LA 1YDWA 2J67A 2GZAA 4EA7A 1X8XA 4XD7A 1U5BA 4UM8B 1M76A 4ODIA 2R7NA 3SBXA 1PVVA 4OQQA 3ZU4A 2V6IA 2B1IA 1JQKA 3E58A 3HPRA 1U1IA 2VXBA 1YRQA 3P2IA 2OQVA 4XQ0A 3SZGA 3B7WA 4DMLA 3NNDA 3DW3X 4BX0A 3R0QA 4NOJA 5CB0A 5IJ9A 2FA9A 1ODIA 4V0SA 3MEQA 2FZEA 1VQ1A 3UMSA 1W0KD 1UXOA 3LC2O 3OIDA 4U3JA 2VQ6A 1VL5A 1O6FA 2J46A 5EQJB 1I36A 5A5FA 2R6ZA 2OB1A 1L5VA 3AH8A 1PV1A 4D8XA 3ZW9A 3THYA 3A4YA 4KQFA 2IPXA 4B83A 1IBSA 3B3JA 1ZI8A 2VDVE 2WU1A 4KQ1A 4DDUA 1E1CB 4JP2A 4LKRA 5KC8A 2VHJA 3V00A 3M6XA 3Q8MA 3RSZA 1RRGA 2H4ZA 1IEWA 2W2LA 4ZT6A 3EIXA 2RFLA 4N0MA 1CB0A 3JQGB 4FQ7A 3RYIB 5J9FA 3ABIA 4ZN6A 5L8VA 2GYYA 5FDFA 1G66A 4S1VA 4Q9JA 3GJRA 3N05A 3QVMA 4OHPA 4TLDA 1JEDA 2WIDA 4KSYA 4U8HA 3P52A 4DQKA 5DBOA 1CR2A 3T7AA 4MS1B 5KOHA 4QGHA 4TZ0A 1QF6A 3CUUA 2PA3A 1U7HA 4I1RA 4J0EA 5FPYA 4JK3A 2R6JA 3MJFA 3RFUA 3RT1A 4DHEA 4HWKA 1QVRA 1XDDA 2BL4A 3O91A 4HB0A 4MV4A 2GH1A 4YAWA 3GZTB 2L19A 3U3KA 2GEDA 3IQIX 5B4TA 4KLCA 1UJCA 4S2UA 4B0OA 4RJJA 4MWCA 4DS3A 3KZCA 3RVRA 4ZU3A 3QVLA 1I80A 1ZH2A 4O3FA 2G77B 4I6GA 2W2KB 3DZGA 4XJTA 3OQPA 3GYBA 4RV9A 1M0WA 2WZQA 4BZXA 1TO2E 1TCCA 3FOZA 4UNRA 2HCJB 4A92A 5LVAA 1W76A 2ZJOA 3I5AA 1R4NB 4OA5A 2VQFB 2X6RA 4G67A 3VR2A 4C07A 1ZW6A 1WB6A 4OB7A 2JHPA 5GV8A 3VU9A 4FDVA 5EJ2A 2DFPA 4DCVA 4N47A 3RS4A 2Y2VA 3L6EA 4F38A 221PA 4UBOA 3WAJA 1GNQA 1A98A 3GOHA 1WNTA 1QP0A 3WWOA 3B12A 4KRYA 1Y7HA 2ZIFA 1JPUA 3LSYA 1YS4A 4NS1A 1COWD 4AZ0A 4QJ3A 4Z5XA 1NBMD 3UAVA 2ONZA 4PO9A 1NLZA 3PWKA 3I5YA 5FPHA 4BKRA 3HEBA 4YAIA 3N2KB 2DSTA 2RBGA 3ITEA 3M4ZA 9LDBA 4YO7A 3EW7A 1CUHA 1LPAB 4WKCA 1BEUB 5JBIA 2RD2A 3QUBA 1O5OA 1QPBA 5F2EA 1EWRA 3FZYA 4MQEB 3LHFA 2BYTA 4EG5A 3ICQB 2ISSD 1LXCA 1UP4A 2RONA 3PFIA 1WJGA 1TMKA 4YWJA 3FNBA 2CVHA 4OD0A 5GONF 1NQXA 2H6EA 1OJ7A 1C4XA 2D0OB 3KOWA 2Q0SA 3PG5A 4MP8A 1BDIA 1GPKA 5IRCD 1IPFA 1Z47A 3JQ6A 5G40A 3PFWO 1WEKA 4FNMA 4QDZA 5AVJA 5T41A 4NS4A 1JJVA 3DG9A 1A8SA 5KSWB 3NEJA 2J0UA 2D74A 2EZ4A 3IELA 5CXUA 2NQ8A 3A6ZA 4ZRDA 1JAZA 3VU8A 2IH4A 1RWQA 5E7JA 2ZBUA 1DG1G 2YY5A 3DXZA 3HWSA 3WDSA 3IOCA 1KR5A 1T8RA 2BMWA 1ZH8A 1UAAA 1YQ9A 1PE0A 1D2CA 1GL7A 1GNVA 1VKNA 2AMYA 5DBFA 4NZNA 5LZ2A 1MLDA 3VZQA 4FFBA 3I6BA 1FXSA 2V7WA 5DNVA 3B1VA 3CURA 5GJBA 2CXPA 3C3WA 2FPKA 1NKVA 1XRMA 5CT9A 4BYMA 3UIEA 1JU3A 1G3UA 2PWYA 3CRZA 3HCOA 4PANA 3VKVA 4GMDA 4HRVA 4NQRA 2IOFA 2VJAA 4M88A 2NPIA 2QL7A 5AJXA 5H5JA 4Q01A 2FW7A 2QX9A 3B9QA 5IJ0A 4KH0A 3UPTA 2VUUA 2YHIB 3RJ5A 4DY4A 1RPNA 1PS9A 2YJ5A 4RJTA 5E3IA 3JRWA 4UU1A 3FOBA 2OD9A 5LQDA 2QTGA 1II0A 3CEMA 5CK4A 2FAXA 2PD4A 3DCJA 3OAAA 1BE0A 1ZMRA 4QRDA 3PVZA 4UZFA 2ZROA 3DE3X 1DAIA 2DP4E 3LK7A 2QSJA 1L4YA 4XW2A 2EC5A 4HLCA 5MGBA 1YE3A 1I4DD 2WYUA 2I2CA 4F1WA 5DSTA 2RARA 4WOKA 1UFQA 4NU6A 3TIIA 4KQGA 1CWUA 2D54A 4FP9A 2XGJA 3HYNA 2PS1A 5CIWA 4YP5A 1L1QA 1P9NA 1L1EA 2PX8A 3D3NA 4N8SA 4KBGA 4UFNA 1X3LA 4V3BA 5JTTA 3VSDA 2O14A 5J59A 2P2NA 2O8BA 1K0UA 3RE1A 4BWYA 2J30A 2ZE6A 3LC1O 5ALIA 3HU3A 3MT8A 4UXHA 3UMMA 1WUTA 2FUNB 3GGOA 3H2HA 1Y9DA 1C0KA 3N5KA 2NVBA 2XMRA 5H9VA 4ND1A 4U6NA 1G2IA 2HQRA 3EARA 3R0JA 4B6OA 5BR1A 1N5LA 3AR9A 1RQXA 4YJHA 5C7IO 2E6UX 5E3JA 2J6CA 4H7HA 4WNAB 3ZLTA 4PGFA 5DM70 2V96A 3VNQA 4ZIRB 1XZJA 3IC5A 4PGAA 2X7JA 4P22A 3UJ9A 3H0EA 1NUTA 1Y7PA 3W34A 1QUFA 3FTDA 4NCBA 2BJWA 2ZP1A 3M1AA 4RHEA 5J2TF 2JI6A 3HO1A 3KWFA 1S2OA 4MJ7A 3ORRA 3PQ8A 4E6PA 3JYHA 1W49A 2XDWA 4PZ9A 1Z6TA 4RF5A 3RWMB 3NOVA 5BR8B 2H51A 1DMRA 4IJWA 2ZB4A 4J6EA 3S0JA 1SU4A 2ON6A 1BWQA 3EPPA 1K3TA 3IIJA 1VJCA 1TIKA 3E27A 3H8SA 3WNVA 4FHDA 1K88A 4JYPA 4CG1A 4E5NA 3GJ8A 4OXKA 4QDXA 4RBNA 3ZNPA 2GDZA 4TXNA 2PRJA 3DKRA 4IO0A 2OXCA 1VXRA 4YDHB 1E18A 5GM1A 1GGNA 4YDQA 4KK3A 2FF7A 3IUEA 3Q6MA 4UXIA 1NMQA 4WKBA 3U7JA 3K1YA 1NKTA 1NSYA 2PMWB 1SNYA 2ZIUB 4CKWA 1D09A 3CR7A 2PSFA 3LGAA 1EE2A 4BLUA 3AGQA 1WXXA 3WAGA 4G5HA 5L95A 2P6PA 3AOEC 4DQUA 1K97A 5EHXA 1AS0A 1JFVA 3PEVA 2R6AA 4KVZA 1XHLA 2E1PA 2AG0A 3JSAA 2QYTA 3PYMA 4MMYB 3L0BA 3RDPA 3UC5A 3ADCA 1P1FA 4LX8A 4P3NA 4UJ3A 2JW5A 4FI3F 3EQ2A 1EXNA 4Z2AA 3LA6A 3I0MA 4Y2VA 3B6MA 4I5GA 5KEIA 5D5HA 1Z6GA 3KOOA 3DBVO 1TKCA 4IXMA 5K4HA 1A9XA 3FPLA 4I36A 4K28A 4EGQA 3E18A 3D6FA 3MPOA 1XNHA 3PNLA 1I7DA 1YRAA 3LLMA 1S8NA 1I7LA 4JJGA 1BE1A 2J9XB 1LFAA 3HLYA 5A9RA 1TADA 4HS4A 2OD2A 1ISHA 4C7MA 3ZZTA 3G2JA 1T9HA 3RRJA 3T1OA 3UJ6A 2CVFA 5I7HA 3M1IA 2A33A 3LKZA 2VP6A 2WJVA 3SJCA 4IRUB 1HYHA 4HZGA 1OX4B 3O9MA 1ZJYA 5LYYA 2ADFA