4E5RA

Crystal structure of frog dgcr8 dimerization domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
PPTEPLPDGWIMTFHNSGLPVYLHRETRVVTWSRPYFLGTGSIRKHDPPISSIPCL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MGC78846 protein
publication title Dimerization and heme binding are conserved in amphibian and starfish homologues of the microRNA processing protein DGCR8.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Rna binding protein
total genus 4
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2012-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 4e5rA00
1ZCNA 2JMFA 5AHTA 2XP6A 3NTPA 3KAFA 4QIBA 3LE4A 3KCEA 1K9QA 2DWVA 3L4HA 1YW5A 2XPAA 2ZQUA 2JX8A 1NMVA 2YSHA 2DMVA 3TDBA 1F8AB 2YSIA 2ITKA 3ODKA 3TCZA 1EG4A 3KAGA 3TC5A 2YSBA 2DJYA 1EG3A 3M7NA 3M85A 2XP3A 2M8IA 3KADA 2M8JA 2DK7A 1WR7A 2ZQVA 1K9RA 2Q5AA 2E45A 2L4JA 2JV4A 3CNGA 2XP9A 2XPBA 4U86A 2ZR5A 2BA1A 2YSFA 4E5RA 4U84A 3KABA 1O6WA 2XP5A 2ZAJA 2LAJA 2F21A 2MDIA 2KXQA 4U85A 5CQ2A 2XP8A 2JXWA 2XP4A 2EZ5W 2DK1A 2M3OW 3KAIA 2YSGA 3WH0A 2RE3A 1TK7A 2ZQSA 2XP7A 3OOBA 3KAHA 4REXA 2ZR4A 2ZQTA 1JMQA 1PINA 1I5HW 2ZR6A 1WMVA
chains in the Genus database with same CATH superfamily
1ZCNA 2JMFA 5AHTA 2XP6A 3NTPA 1FLCA 3KAFA 4QIBA 3LE4A 5E65A 3KCEA 5E62A 1K9QA 2DWVA 3L4HA 2OWOA 1YW5A 2XPAA 3MCBA 2ZQUA 2JX8A 1NMVA 2YSHA 2DMVA 3TDBA 1F8AB 2YSIA 2ITKA 3ODKA 3MQGA 3TCZA 1EG4A 3KAGA 3TC5A 2YSBA 2DJYA 1EG3A 5E66A 4GLXA 3M7NA 2QRVA 2WAEA 3M85A 2XP3A 3LKXB 2M8IA 3KADA 3FSCA 2M8JA 5E64A 2DK7A 2Y8NB 5U47A 1WR7A 2ZQVA 1K9RA 2Q5AA 2E45A 2L4JA 2JV4A 3CNGA 2XP9A 2XPBA 4U86A 2ZR5A 3LKXA 2BA1A 2YSFA 4E5RA 4U84A 1RP5A 3KABA 1O6WA 5E5WA 2XP5A 2ZAJA 2LAJA 2F21A 4A0TA 2MDIA 2KXQA 4U85A 3FS8A 5CQ2A 2YAJB 2XP8A 2JXWA 2XP4A 2EZ5W 2DK1A 4A0UA 2M3OW 3FSBA 3KAIA 2YSGA 1TR8A 3PQHA 3WH0A 2RE3A 1TK7A 2ZQSA 2XP7A 3OOBA 3KAHA 4REXA 2ZR4A 2ZQTA 1JMQA 1PINA 1I5HW 2ZR6A 1WMVA 3MCBB 3MQHA 2WADA
chains in the Genus database with same CATH topology
1ZCNA 2JMFA 5AHTA 2XP6A 3NTPA 1FLCA 3KAFA 4QIBA 3LE4A 5E65A 3KCEA 5E62A 1K9QA 2DWVA 3L4HA 2OWOA 1YW5A 2XPAA 3MCBA 2ZQUA 2JX8A 1NMVA 2YSHA 2DMVA 3TDBA 1F8AB 2YSIA 2ITKA 3ODKA 3MQGA 3TCZA 1EG4A 3KAGA 3TC5A 2YSBA 2DJYA 1EG3A 5E66A 4GLXA 3M7NA 2QRVA 2WAEA 3M85A 2XP3A 3LKXB 2M8IA 3KADA 3FSCA 2M8JA 5E64A 2DK7A 2Y8NB 5U47A 1WR7A 2ZQVA 1K9RA 2Q5AA 2E45A 2L4JA 2JV4A 3CNGA 2XP9A 2XPBA 4U86A 2ZR5A 3LKXA 2BA1A 2YSFA 4E5RA 4U84A 1RP5A 3KABA 1O6WA 5E5WA 2XP5A 2ZAJA 2LAJA 2F21A 4A0TA 2MDIA 2KXQA 4U85A 3FS8A 5CQ2A 2YAJB 2XP8A 2JXWA 2XP4A 2EZ5W 2DK1A 4A0UA 2M3OW 3FSBA 3KAIA 2YSGA 1TR8A 3PQHA 3WH0A 2RE3A 1TK7A 2ZQSA 2XP7A 3OOBA 3KAHA 4REXA 2ZR4A 2ZQTA 1JMQA 1PINA 1I5HW 2ZR6A 1WMVA 3MCBB 3MQHA 2WADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZCN A;  2JMF A;  5AHT A;  2XP6 A;  3NTP A;  3KAF A;  4QIB A;  3LE4 A;  3KCE A;  1K9Q A;  2DWV A;  3L4H A;  1YW5 A;  2XPA A;  2ZQU A;  2JX8 A;  1NMV A;  2YSH A;  2DMV A;  3TDB A;  1F8A B;  2YSI A;  2ITK A;  3ODK A;  3TCZ A;  1EG4 A;  3KAG A;  3TC5 A;  2YSB A;  2DJY A;  1EG3 A;  3M7N A;  3M85 A;  2XP3 A;  2M8I A;  3KAD A;  2M8J A;  2DK7 A;  1WR7 A;  2ZQV A;  1K9R A;  2Q5A A;  2E45 A;  2L4J A;  2JV4 A;  3CNG A;  2XP9 A;  2XPB A;  4U86 A;  2ZR5 A;  2BA1 A;  2YSF A;  4E5R A;  4U84 A;  3KAB A;  1O6W A;  2XP5 A;  2ZAJ A;  2LAJ A;  2F21 A;  2MDI A;  2KXQ A;  4U85 A;  5CQ2 A;  2XP8 A;  2JXW A;  2XP4 A;  2EZ5 W;  2DK1 A;  2M3O W;  3KAI A;  2YSG A;  3WH0 A;  2RE3 A;  1TK7 A;  2ZQS A;  2XP7 A;  3OOB A;  3KAH A;  4REX A;  2ZR4 A;  2ZQT A;  1JMQ A;  1PIN A;  1I5H W;  2ZR6 A;  1WMV A; 
#chains in the Genus database with same CATH topology
 1ZCN A;  2JMF A;  5AHT A;  2XP6 A;  3NTP A;  1FLC A;  3KAF A;  4QIB A;  3LE4 A;  5E65 A;  3KCE A;  5E62 A;  1K9Q A;  2DWV A;  3L4H A;  2OWO A;  1YW5 A;  2XPA A;  3MCB A;  2ZQU A;  2JX8 A;  1NMV A;  2YSH A;  2DMV A;  3TDB A;  1F8A B;  2YSI A;  2ITK A;  3ODK A;  3MQG A;  3TCZ A;  1EG4 A;  3KAG A;  3TC5 A;  2YSB A;  2DJY A;  1EG3 A;  5E66 A;  4GLX A;  3M7N A;  2QRV A;  2WAE A;  3M85 A;  2XP3 A;  3LKX B;  2M8I A;  3KAD A;  3FSC A;  2M8J A;  5E64 A;  2DK7 A;  2Y8N B;  5U47 A;  1WR7 A;  2ZQV A;  1K9R A;  2Q5A A;  2E45 A;  2L4J A;  2JV4 A;  3CNG A;  2XP9 A;  2XPB A;  4U86 A;  2ZR5 A;  3LKX A;  2BA1 A;  2YSF A;  4E5R A;  4U84 A;  1RP5 A;  3KAB A;  1O6W A;  5E5W A;  2XP5 A;  2ZAJ A;  2LAJ A;  2F21 A;  4A0T A;  2MDI A;  2KXQ A;  4U85 A;  3FS8 A;  5CQ2 A;  2YAJ B;  2XP8 A;  2JXW A;  2XP4 A;  2EZ5 W;  2DK1 A;  4A0U A;  2M3O W;  3FSB A;  3KAI A;  2YSG A;  1TR8 A;  3PQH A;  3WH0 A;  2RE3 A;  1TK7 A;  2ZQS A;  2XP7 A;  3OOB A;  3KAH A;  4REX A;  2ZR4 A;  2ZQT A;  1JMQ A;  1PIN A;  1I5H W;  2ZR6 A;  1WMV A;  3MCB B;  3MQH A;  2WAD A; 
#chains in the Genus database with same CATH homology
 1ZCN A;  2JMF A;  5AHT A;  2XP6 A;  3NTP A;  1FLC A;  3KAF A;  4QIB A;  3LE4 A;  5E65 A;  3KCE A;  5E62 A;  1K9Q A;  2DWV A;  3L4H A;  2OWO A;  1YW5 A;  2XPA A;  3MCB A;  2ZQU A;  2JX8 A;  1NMV A;  2YSH A;  2DMV A;  3TDB A;  1F8A B;  2YSI A;  2ITK A;  3ODK A;  3MQG A;  3TCZ A;  1EG4 A;  3KAG A;  3TC5 A;  2YSB A;  2DJY A;  1EG3 A;  5E66 A;  4GLX A;  3M7N A;  2QRV A;  2WAE A;  3M85 A;  2XP3 A;  3LKX B;  2M8I A;  3KAD A;  3FSC A;  2M8J A;  5E64 A;  2DK7 A;  2Y8N B;  5U47 A;  1WR7 A;  2ZQV A;  1K9R A;  2Q5A A;  2E45 A;  2L4J A;  2JV4 A;  3CNG A;  2XP9 A;  2XPB A;  4U86 A;  2ZR5 A;  3LKX A;  2BA1 A;  2YSF A;  4E5R A;  4U84 A;  1RP5 A;  3KAB A;  1O6W A;  5E5W A;  2XP5 A;  2ZAJ A;  2LAJ A;  2F21 A;  4A0T A;  2MDI A;  2KXQ A;  4U85 A;  3FS8 A;  5CQ2 A;  2YAJ B;  2XP8 A;  2JXW A;  2XP4 A;  2EZ5 W;  2DK1 A;  4A0U A;  2M3O W;  3FSB A;  3KAI A;  2YSG A;  1TR8 A;  3PQH A;  3WH0 A;  2RE3 A;  1TK7 A;  2ZQS A;  2XP7 A;  3OOB A;  3KAH A;  4REX A;  2ZR4 A;  2ZQT A;  1JMQ A;  1PIN A;  1I5H W;  2ZR6 A;  1WMV A;  3MCB B;  3MQH A;  2WAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...