4E5VA

Crystal structure of a putative thua-like protein (parmer_02418) from parabacteroides merdae atcc 43184 at 1.75 a resolution
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
280
structure length
280
Chain Sequence
RKPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDVDFVISPEQGKDMSGFVLDFSPYQLVVLDYNGDSWPEETNRRFLEYVQNGGGVVIYHAADNAFSKWPEFNRICALGGWEGRNENSGPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDKVHPVVKGLPLKWRHAKDELYDRMRGPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNARIFHTMLGHAGATTEDNIAMQCTGFQVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKDYKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative thua-like protein (PARMER_02418) from Parabacteroides merdae ATCC 43184 at 1.75 A resolution
rcsb
source organism Parabacteroides merdae
molecule tags Structural genomics, unknown function
molecule keywords Putative thua-like protein
total genus 92
structure length 280
sequence length 280
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06283 ThuA Trehalose utilisation
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4e5vA00
3B38A 1OX4A 5LIRA 1OI4A 4Y0NA 3OT1B 2IUFA 4OFWA 2VPIA 4LRUA 4WINA 2XF2A 1PDWA 2YWBA 3EWNA 3KKLA 4N12A 5IP5A 4B7AA 4QYTA 5K4AA 1QVZA 4ENRA 1QWSA 2FEXA 1Q2UA 3P9RA 2OR3A 2H2WA 4ENQA 1C3OB 4RKWA 1J42A 4Y1GA 1A9XB 2YWDA 4B5KA 4OGGA 3SF8A 3UOWA 4D1YA 1ONSA 4BFLA 4B40A 2WJZB 3MIIA 3NOOA 1P5FA 1IZZA 3B3AA 2VXOA 1VCOA 3M3PA 1GPMA 1N57A 3P9SA 4I46A 4MGHA 2ZUVA 5SYAA 2ZUTA 3TTSA 1FY2A 1GGHA 4L7QA 1FYEA 4P5PA 5SY9A 3UGJA 1KXJA 1P81A 3PQ2A 4Y1RA 2NV2B 3N7TA 3CZAA 1OX5A 1P7ZA 1P7YA 4GUDA 3GRAA 3TTWA 3R75A 2R1VA 4UZSA 4S0ZA 3PQ8A 1QVVA 3SF8B 4I2NA 4ENPA 1OX6A 3NOVA 4UOQA 4B31A 1KEEB 1BXRB 3PQ4A 1T0BA 4P34A 3NVAA 2RK4A 2AB0A 1SY7A 2VDJA 4GE3A 2YWCA 4L95C 3ZJ4A 3FIJA 4GE0A 3UMMA 1VCMA 4L78A 1CF9A 4ENUA 1KWGA 1PV2A 2RK6A 3PQ5A 3EFEA 3R74A 4OJYA 4OQ4A 4AUNA 5DFAA 4ENVA 3F5DA 4P2GA 1U9CA 4MTCA 1KA9H 1GGFA 4ENSA 2W7TA 3ZR4B 4E5VA 3CY6A 3B36A 1VCNA 4UNIA 3NONA 1QDLB 2VKTA 2YWJA 1G2IA 3ZJ5A 1S1MA 4JQSA 1I7SB 2LXNA 3ER6A 1WL8A 1IZYA 1PE0A 3EN0A 4N0MA 1C30B 3CNEA 4ENTA 5JZOA 1O1YA 1R9GA 1I1QB 1VHQA 2AD5A 2ZUSA 4Y1EA 3TTYA 4WXYB 2ZUWA 4ADSG 4ZGGA 4ZDIA 3P9PA 1K9VF 3D54D 1T36B 4E08A 4OIFA 5SY4A 3TTUA 1P80A 3UJNA 4BTEA 3L18A 4P36A 3UK7A 3EZGA 1M6VB 4ENWA 2ISSD 1GGJA 1Q7RA 2GHRA 4UCFA 3NORA 1GGKA 2ABWA 4L8YA 3RHTA 4MNTA 3TQIA 1JVNA 3F71A 1I7QB 3L4EA 4UOZA 1QF7A 3TTVA 1CE8B 1L9XA 3L7NA 2D7JA 3VU3A 2R1TA 2RK3A 1SOAA 3L3BA 4AJ9A 3CYFA 4L8WB 1CS0B 3SOZA 2V4UA 3CZ9A 1T3TA 5BV2P 4Y1RB 4RKYA 3TTTA 4L8FA 4QYXA 4ZDJA 3BWEA 3PQ6A 3TTXA 4R7GA 3BHNA 4Y1FA 4PXYA 2NV0A 1UCFA 3WFZA 3OT1A 5JZMA 2R1TB 4AULA 5SY6A 2ZUUA 3MGKA 4BIMA 4AUMA 4ZDKA 3FSEA 2VRNA 4XLLA 3PQ3A 4I4NA 4K2HA 2GK3A 1OX4B 3R76A 2R1VB 1JDBC 3NOQA 1QVWA 4P35A 4LGYA 1PDVA 4AUEA 1GG9A 2A9VA 3P9QA 1KWKA 1IPHA 1GGEA 2R1UA 4HCJA 5E9AA 3EJ6A 1OY1A 1GPWB 4B2YA 4OGFA 3PQ7A
chains in the Genus database with same CATH superfamily
5J4VA 1A8QA 1EK0A 1JLLA 1QS0B 1IQUA 2R79A 1MJNA 5TF4A 2ASEA 3MJHA 2VAWA 5KVAA 3GJ3A 1EFVB 2ORVA 4M8KA 4C08A 2F43A 3BE8A 2YOFA 1XTVA 4IMPA 1ZN8A 2OXEA 2E5WA 2ATVA 4K6HA 2XGSA 1JL3A 3QEMB 1Y5NA 2C07A 1ABBA 2CBGA 1JDUA 3FGPA 3EPLA 1D1PA 4GXRA 3ZDDA 3WLFA 2IU6A 3IP6A 3NNDA 4ARUA 2PZFA 4US1R 2OL4A 1XQVA 1FP4A 5KNLA 4WFQA 3PIRA 3I62A 4E0BA 1UKAA 4OFBA 4BJ1A 3BKXA 4U9HS 3H3FA 2YCBA 4NOMA 2Q2VA 1HO3A 2PX3A 2VPTA 2WF8A 3KEFA 3IP1A 4OQFA 1WPGA 1XD2A 3NVAA 2PRJA 1A9XA 2H1SA 2VTDA 3K0CA 3IEKA 2PUFA 2YWCA 2DWOA 2JH8A 4TROA 4EF4A 1WEKA 3VHXA 3AKDA 2PR7A 2FWAA 3T5BA 5ADVA 3T4EA 3F46A 3DE0X 2ECPA 2B34A 5THXA 3L7MA 2ACKA 3I3OA 3UV3A 2ZRKA 3L1UA 4YAFA 2EKZA 2H2AA 3C1AA 4GQBA 4RFSA 1QK4A 3OLYA 3RBXA 2WYIA 5AW4A 3VR6D 2FMUA 4WXPA 4RF4A 3KV1A 4RSMA 2NMVA 3PCTA 3QELA 4IHJA 2V7XA 2IPLA 3A58B 4JQSA 1G3IA 3BBLA 4GUAA 1BN7A 2B0JA 1UBNA 4MIEA 4U3JB 4Q48A 4KWEA 3VPDA 2QPOA 1PSDA 3AY0A 4TWBA 3FH0A 5TGDA 3UMCA 5EWJB 2B3TA 2ZPTX 1ZMTA 2P2SA 3MWEB 3PB3A 4LZNA 1A95A 1FNMA 2HPZA 1ENOA 5BSUA 4DLNA 4JI8B 4NNPA 2UZIR 1DS6A 1U04A 1P75A 5DNYB 3D43A 4N8DA 4URZR 3O2QB 1OYYA 5K3SA 4WW0A 4HNGA 4FGLA 2Q1YA 4BWGA 5K8VA 3L7NA 1K98A 4QODA 1NJ6A 2HQOA 5DPMA 4UEJA 5EJ4A 2IS6A 1FFHA 6REQB 1I30A 1FCJA 1E79D 2OO7A 2WT8A 3FPAA 4TS9A 4G09A 4B85A 2ATCA 2PUWA 1PJSA 4WOPA 2ONCA 4QXAA 1G8MA 4IINA 1JSLA 4CQLB 4D5GA 1IRXA 2ASVA 4H7JA 3T3HA 1IJBA 1E7SA 2BKVA 4OYYA 1C2YA 4IXWA 4UVDA 5FTNA 2X1LA 4G36A 3ADCA 3QVOA 1YS4A 1FYDA 1ENPA 2GYWA 2Y8EA 3U7QB 1WS6A 3ZDEA 1GY8A 1TGVA 4Q39A 4W8GA 4K0KB 1IDOA 2P2GA 2DFNA 4D9MA 2D0IA 5ALXA 3B9PA 3MCTA 4L4YA 1Y8RB 4BJHB 3UT6A 2FV8A 4Q21A 1X1AA 2Y6VA 1NNSA 5FO0A 5CDFA 4YUAA 3F7NA 2FLVA 4IILA 4IZHA 5HJ2A 4GLJA 5BW6B 2P3OA 2Y1DA 4C7XA 3IODA 1Z5OA 5DNUA 4MLPA 4RVSA 1J1IA 1H0HA 2GD2A 2ZG6A 4DR7B 1J1UA 4HNRA 3T9FA 3JXEA 3UUFA 3ZI7A 4KYIB 2WD7B 3FOAA 3KZOA 4XR4A 2IP2A 5FB3A 5AKGA 1O96A 5FHQA 5PGMA 3HCBA 3E61A 4CKCB 4H6PA 2BE7A 1J5PA 1XD2B 4MA0A 1I2MA 3IAFA 1C9YA 4I6GA 3PFGA 3UGJA 3AF4A 4DUYB 3AP1A 2D2XA 1MAWA 3JU3A 5CCEA 1ACMA 3WGZA 4MGIR 3C6QA 2XWJI 1Q7EA 2P11A 4RPLA 2WI8A 1Z7WA 1SUAA 4QD3A 3CUSA 4WK6A 4OHKA 4YCCA 1MO2A 2XJ9A 3LP5A 4LA4A 4EMBA 3MAAC 1VYHA 1DWUA 2XUOA 3CUYA 1WMSA 4FOSA 1N6RA 2F59A 1XZMA 3NW9A 3EAFA 4KFSA 4RQAA 1QVRA 5AKIA 3VOTA 9GPBA 3UAZA 5JFOA 1JLRA 1IEVA 3IAAA 3I09A 4KI0A 1H2WA 4GE0A 3CSDA 3G1TA 4UMEA 3ZV3A 4YAGA 1NI4B 3X1KA 4Z8YA 1CJBA 2HIGA 1KVUA 3LUFA 3PJFA 4KUHA 4Z0TA 1PZFA 2YJGA 4WL0A 1U7DA 1EG7A 2DLDA 2W43A 4RHUA 3KJZA 1LXCA 2NZWA 3GK3A 1RXUA 3ROTA 3WQQA 3ZWDA 3BT7A 1BE8A 4JT2A 2WFAA 1P1BA 1UDAA 2NSYA 5CLGA 3ZR4B 3H1GA 2FWIA 5TC4A 2WNHA 4XDYA 3EDMA 3PD0A 1LX6A 2BISA 1ZYUA 1LTKA 1GRVA 1JT9A 4ZVLA 4P4SA 4MV1A 5FUWA 2CLCX 3Q5GA 1WKVA 4QLAA 2Q8NA 3IRVA 2GCOA 2O9JA 4JDUA 2YXLA 2GAOA 1X77A 4M46A 4YJGA 4JI3B 3ZHSA 4DLKA 2CLIB 1K8RA 4OYLA 3K0EA 1V5WA 1OWOA 1WY5A 3HC7A 1KYWA 3DPSA 3JVDA 1FBTA 1PRYA 1R8YA 4IIEA 5J2TA 5BN4B 2P40A 2FU5C 2NXCA 2WAMA 3D8TA 3WSWA 4BUZA 1CUYA 4FX5A 4BVJA 1Z4MA 5JHGB 1F0NA 1VI2A 3QU4A 2BH2A 4QL3A 1AKMA 2RHDA 2GN0A 2WUDA 2GCNA 2FTKE 2PTGA 5CM2Z 1ESCA 3TVYA 1XG5A 1WMDA 4AMUA 4EBFA 4ED9A 3LUBA 5I51A 1JQAA 1VG9B 3GEHA 4BO4A 2JFNA 1HE8B 2QXUA 4HAVA 4DCOA 1DAHA 1CV2A 2YMQA 5EHXA 5LOVA 4Q7KA 3T6KA 4BVGA 1IY2A 1DQYA 3E81A 5AXCA 2HF9A 4G23A 1SXJC 1NLUA 3UT5B 1O5IA 1P4HA 5HFNA 1ISRA 3TTXA 5BMVB 4YIHA 4L4XA 1QRTA 2V3CC 3AT1A 4BU1A 1VQ1A 3I9KA 5IJWA 5JC8A 1D04A 4TVBA 1OFUX 2A35A 2WOOA 4JLVA 4JR2A 4RL6A 1E61A 1Z0KA 5BV7A 1MQAA 1RC8A 3H4MA 3NHZA 5F23A 4MQFB 5I4KA 2QU7A 2W58A 2O1EA 3BF7A 5AVVA 3FE2A 3FOBA 4ZVNA 1JFTA 1E62A 4K9OA 2VYVD 3ZHOA 1FVHA 1PG0A 2IU0A 1L0BA 3RFXA 3TCNA 2EDAA 4LDPA 3VVMA 4DXAA 2BLNA 2Z56A 3OZGA 2G9RA 3B78A 4Q1EA 4RLFA 1X7DA 1OMOA 5IM5A 4C6HA 4HLUC 3AHIA 5LU8A 3A3YA 4JBWA 2GFIA 3M1AA 4AY3A 4EB6A 1P8JA 4TMYA 2BFFA 3EA5A 3I2HA 2SBTA 1NY6A 1KIFA 1Y7IA 3PFBA 3KZCA 5E6RB 5HEKA 5LQDA 3O4VA 5FI0B 1RHQA 3ZHBA 2JC3A 4WCFC 3B5IA 1YS2X 3OA2A 3WGUA 4LTDA 2NU6A 1AB6A 3JAWB 2H4WA 5KKCA 1SPXA 2REQB 3OPYA 4HOYA 1IXSB 1NXVA 1P6UA 2GBIA 3BCHA 1PWHA 4LG1A 4Q3EA 1ZNQO 4U2EA 3RK0A 3ML1A 3ZHVA 4YJ2A 3GGDA 1PIWA 3GJRA 3DE5X 1M7GA 1XEWX 2O06A 2F3RA 3L1HA 3CUWA 4O02B 1Q1NA 3P9XA 2JBWA 3KOZA 2F6RA 3QFRA 2JFPA 4PNPA 3X1YA 1FXSA 1YOBA 1G8KA 1NPYA 4JUIA 4TLCA 5GV7A 3RRYA 3R9WA 1FJHA 3BXXA 4ML3A 4DL9A 4X95A 2HW8A 3DLTA 2D3TA 3HA2A 2WAOA 3NIWA 2G9QA 3QE0A 4JLSA 4EUSA 1XTSA 4D3ZA 3BTVA 1DSSG 3PUJA 2YFKA 5TNXA 1SU4A 3KOUA 2J7PD 4EA9A 2PZKA 5GJWC 5EKTA 3ELDA 2W70A 2C7PA 1EDBA 2EJBA 3CKMA 1V1MA 1YUBA 2KBFA 4TXMA 2BGWA 3BWYA 4B83A 3COVA 4BE4A 1E3QA 3IP3A 1OH6A 1SOMA 5J5CA 3ESCA 5KSPA 1UPCA 4RVOA 5CT4A 4EZEA 4FJ1A 3WLOA 3P4UA 5AHOA 4UAGA 3PUIA 1Z62A 4M60A 4Q9IA 3K72B 2QAIA 5BV1A 1KI6A 3AVYA 4ZI7F 3W5UA 3AR6A 2JL1A 4MEJA 1NVWQ 3FVWA 4H3SA 3RC1A 1X80B 4JT4A 4R1LA 3W8DA 3GJ5A 2YRWA 4NCXA 1XX6A 4RIEA 5ALFA 5J4LA 5K8CA 3FPGA 3O1IC 1Y6GA 3LDHA 2PX4A 4B6RA 1GWNA 2B4TO 3W4IA 1GZ7A 2YJZA 1VP3A 2H1WA 1K6EA 4JT9A 3HA5A 3RIHA 3DB2A 1PZXA 3LPDA 2VAPA 4A0FA 5F1YA 1U0EA 2FMKA 2NO7A 5FOWA 3ZE6A 4NE9A 1IG3A 2GWRA 3H3JA 4PGGA 1QRRA 2O0LA 4O4JF 3U4HA 2WFZA 4I8DA 3RBVA 2H29A 3ZTTA 1P5RA 2J5KA 1ZG3A 2FRVA 2G1KA 3J7AC 3MQFA 5DTRA 1I3MA 2CNWD 3DZBA 4N7RA 4MINA 1E6MA 4YCAA 1H2EA 3VTZA 4RABA 1XCJA 2IYAA 4HEJA 5DGIA 5BYJA 4DMCA 1V9LA 4J6FA 4LXGA 1JHZA 5F9FA 1CG6A 3LBFA 3O8QA 3QMWA 4EL0A 3CV3A 3OY7A 3MZ0A 4K86A 5IKXA 2I34A 3D7MA 5LUAA 1JR3E 3C74A 2M6SA 3DE4X 4PXYA 4DE5A 3VZSA 5JZ9A 4JEMA 5K09A 4ZANA 2I2DA 2V7TA 1L4FA 3O7MA 4RSRA 3ZU5A 4AB1A 4LZZA 2PX5A 1H9BA 2ZYUX 1WU7A 1L7QA 2IU4A 4BNKA 2J0QA 5IDXA 1UJMA 4OA8A 2CMDA 1SZPA 4E32A 1CZLA 1WHTB 4RWZA 4UARA 4Z86A 3SM9A 5EQDA 4UE2A 1NQVA 2NXJA 3ELYA 3H0EA 3H7AA 1G20B 2Y0EA 2RKWA 2P9ZA 1MB4A 1NPTO 1XWFA 3BGOS 1YQUA 2EZ4A 3MYYA 2H92A 2JLBA 2PBZA 5HE8A 4Z1MD 1RACA 4ZDWA 3WMXA 3HABA 1DQRA 3QHQA 4XJTA 4NARA 3OEHD 2EBHX 2JLZA 2WKQA 5C8YF 1F4PA 3L79A 3LI2A 3RRZA 2D1FA 1HYQA 5FTJA 2PH7A 2GPAA 5JSHA 1V25A 3VO8A 4HF7A 4J0JA 2OYRA 1QYRA 4FMCF 3RRJA 1G5QA 2O2ZA 1KDVA 1HGXA 3P2JA 1MB3A 5EMJA 1C9JA 2CHUA 4HVAA 3TR0A 5DBFA 3CPHA 5ALLA 5LOVF 1P62B 3AGPA 1X7GA 1ZS9A 1HRKA 2PBFA 3CX8A 3L4SO 1YF3A 4I46A 3AFMA 2XNJA 5EP4A 4XQEA 1E1CA 5JAZA 2A14A 3M8KA 4PZ9A 4UUPA 3KDAA 4IDNA 1C1YA 5KX5B 3H4VA 1Q0QA 1LRJA 2O8VA 2ZAOA 4YDQA 4AKIA 3R3ZA 2H4YA 4CVNA 2DETA 1XEXB 3GGGA 4GUDA 2MCFA 4DABA 2VZEA 1TVCA 4X3PA 1RAGA 3MPUA 1GA1A 3DC7A 2GAAA 3DHVA 5HIJA 2QY9A 5CIWA 1Z8FA 5AXAA 3TBHA 3Q6IA 4XTCS 4MXDA 5EKSA 1JXQA 2DTDA 4GF5A 3V2UA 3TGPA 2C8LA 4JGGA 4GE3A 4Y0VA 4ZREA 4B7UA 2JJYA 1U0HC 4B4KA 3AFNA 3I2IA 4GC9A 4Q1FA 3JQ9C 2FPOA 3B9QA 4GBED 2DQKA 3QUAA 1W5AA 2JLSA 2Q3JA 3IOYA 4R01A 3UHAA 1OC2A 2BKEA 1U0NA 1Z0JA 3VPBA 1N2ZA 3A1EA 4DLBA 1B8UA 3VZPA 3DZ8A 1JHAA 4WSOA 5LWHA 1OGJA 4ZCTA 4ISBA 4JWTA 4IICA 2UZ3A 3QF4B 1TF2A 5FULA 2CL0X 4E11A 1B6RA 1AHHA 2HUPA 2TYSB 2VF7A 3HI4A 4OAQA 3K05A 1D09A 4FR2A 4KO3S 1ETUA 5HFAA 2ZFUA 5BNIA 4FWTA 1VKJA 4Z51A 1USUA 5AKXA 2PN1A 3VR4H 1KZYC 1EQAA 1QU2A 3LT4A 3A1VA 3Q98A 4HATA 4FS8A 3ET5A 2C5FA 3PUKA 4FC7A 4MW1A 5BNWA 1XFDA 5KWJA 1PR5A 3OQ6A 1RHMA 1XTJA 3PYXA 1Z9BA 3OPXA 3UKOA 4XPIB 4QU9A 1FNNA 4P7KA 4ZARA 1QIEA 2YY6A 2WDPA 1GJRA 4HJRA 2HGSA 1XV5A 2MWMA 3CH4B 4E14A 2AXPA 3JD3A 5K4HA 3GRCA 3O74A 4MKZA 1KEWA 1YIDA 1T6YA 2DU8A 1JLSA 5FTKA 1PL7A 3DEJA 3HVKA 3I2JA 3HJTA 5A03A 4X93A 2HCJB 5JFTA 4F92B 5DW0A 3W2TA 4RVUA 1TTTA 1TKCA 1WMEA 2CMGA 2C9BA 4XSVA 1SXJB 4PCUA 5B58C 1YKFA 2IV7A 3TLJA 3DFFA 4EHHA 5KJEA 1C3LA 2GPYA 5GIPE 1WXQA 4JBNA 2OPHA 5CFLA 3KTAA 5M5BA 1JQJC 1AA9A 4YQYA 1L1EA 3EWIA 5CG2A 1FBNA 4BAZA 4BVLA 3H6GA 3T15A 3LLSA 4G89A 3KKQA 4Z4GA 2P9JA 1R2QA 3C8DA 2G0AA 3KUDA 2XDWA 2YTZA 5ITSA 1P0PA 5H9VA 4BKRA 1EMDA 1Q17A 1ISMA 2ZI4A 3ZQKA 1VE9A 4P7GA 1CR1A 2EFCB 4IFEA 4INAA 4QDJA 2W2QA 3NWOA 3ZWMA 1THMA 2ZIFA 3DZKA 4LSZA 2B1JA 2GWHA 4M9UA 1JLKA 1GTVA 1QP0A 3G7UA 4MJLA 4NYIQ 3G2KA 3R75A 1M1XB 1Z7GA 4B3DA 1ZU5A 3T9DA 3V1NA 3RROA 4D8YA 3FNHA 3RK1A 1XK6A 2XOEA 5LYJF 1Z4LA 1WIWA 2NSHA 2XA1A 3VKVA 1XLVA 1LDMA 4NMMA 1QAMA 3WJ7A 1CFZA 4Y1GA 1KBOA 4YBRA 5ICCA 1I2AA 1NBHA 4QIHA 4AXBA 2Q5OA 3E1KA 5HX7A 5KZMB 1ZJ4A 2ZUTA 5DTMA 4E1AA 2ZR0A 5A3JA 1L3CA 4J4HA 4CTOA 1GQ2A 3Q1KA 1QFMA 1UBOS 1CERA 4OJQA 3SQLA 1CUJA 5P8WA 2NZVG 3ESQA 2JGFA 2C97A 2EP7A 2R1VA 4C4XA 1NQXA 1M66A 4XWKA 3ZDYB 1WBJB 1WY7A 3UXMA 3SFTA 2H5JA 2OFFA 1M8GA 2VK2A 3ROZA 5KSOA 3LDFA 1RR6A 4G4IA 5DHRA 5A2GA 3PIIA 2DFKB 1C8KA 2I8CA 2XKAA 1NATA 5I4IA 3AVUA 2C9DA 1S2NA 2I8LA 2MIIA 4RIHA 3N0RA 5B4TA 5BYAA 5I7WA 1Y3BE 2IZOA 1SM4A 2IY8A 2QG9A 1PV2A 3FJ1A 1QNLA 3GDOA 4E21A 1NZJA 4OM8A 3FGZA 2X3UA 4G5GA 1NJGA 3K0KA 3O1HB 1MOPA 1Q1QA 1ZA1A 4XSGA 4E5VA 1JF8A 4A0SA 1W48A 2QPLA 4YMLA 2J6BA 4ZTZB 3V4SA 2PMEA 1ZPDA 3RVSA 2XHZA 1MJ5A 3L06A 5EZYB 5DYGA 4DJTA 3S8YA 1QGYA 1TRHA 3FKSD 2VS1A 1T0HB 2CXSA 3W05A 4XKJA 2LWIA 2I4LA 5KS2A 4LF4B 4DW8A 3EQ7A 3OZUA 4EG4A 4PIMA 3EBOA 5EPOA 3HTXA 5AOVA 1HI9A 3LFHA 1E5LA 2RHOA 3C1OA 2GUGA 5JFGA 1XA3A 3O84A 3QW2A 3EVDA 4P36A 5JLAA 2HXSA 4M8IA 4RCZA 5K3FA 3TCKA 4DUGD 2GGSA 2CMKA 3DKKA 5HSGA 1P5HA 1TD9A 2P41A 2IYRA 3VU8A 4DDHA 3RLIA 5IJXA 5KQSA 1TLTA 1E1DA 3ZIAA 5I7OA 1QHSA 5IBQA 5I48A 1RLJA 2ZUDA 1DINA 1PT5A 2FCAA 1ULZA 2Z30A 3SU8A 3UTDA 3IEVA 4QYSA 1EIWA 2H1CA 3AL2A 4B6EA 2FKAA 2OFOA 3EVFA 4HDCA 3VVLA 4OLAA 1JA1A 2CSUA 3BHNA 4U6QA 3HJRA 2EC5A 4ESEA 4WWHA 1G3UA 2Q6OA 3ENQA 5DB4A 4B4UA 5BR7A 2QP3A 4J0DA 1LBQA 4WVFA 2GBCA 5L3ZA 4RTSA 4JBLA 2FFAA 3DV0A 4R1NA 3D6UA 5IAGA 2B20A 2JLQA 2BBTA 3HKDA 1KOGA 2XYQA 4UUQA 2NGRA 3T7RA 3NYQA 3PFNA 4A27A 2NO5A 4QDKA 1GCGA 1KMMA 1OA1A 4F4JA 1UK8A 1UBLS 1Y4SA 1CZRA 5I3ZA 1Z17A 1J70A 2W6PA 2AZMA 5IVKA 1CEXA 2YVQA 1CKEA 2P5TB 2PS1A 13PKA 1IY8A 3LUCA 1JHDA 2JZNA 1TM5E 3OZTA 2ZP1A 4M1MA 1XL1A 4NZYA 3RQIA 3WL6A 1SD5A 1F1BA 4YCSA 1UBMS 3TRDA 4F2GA 1C3OB 1OB2A 1HK7A 5HS6A 2GXSA 3R2JA 4D1YA 3SEAA 3L0IB 2H2HA 2M2IA 3WADA 3RAPR 5IC5A 2BM8A 4TVOA 1I2BA 3RRNA 1W2HA 1UQUA 3MXOA 3TD6A 3WJ1A 2J0SA 2H5IA 2NQ8A 4G84A 1TZCA 1QCCA 4TS4A 2OAEA 5DYWA 4L7QA 3JQEA 1YOVB 4E6PA 4KQFA 1KXJA 1NAIA 1YV9A 1JDTA 3BREA 3V3KA 4E22A 2ZRIA 1EE2A 4PX2A 4OGWA 1X8JA 2VT2A 3AR4A 4GBJA 3PL1A 2RIPA 3B1XA 4TZ0A 1XVLA 1RJ9A 3DBOB 3O2SB 4WNAB 1T8PA 1UADA 3UYLA 1PJZA 2AOUB 4HLCA 1U65A 2ZSBA 2GYUA 4DSAA 5IM4A 2JEYA 5JCJA 5CDSA 4MARA 1RRKA 3LNTA 3ZK8A 5DBIA 3H11B 2XLBA 4ZD6A 4WOKA 1E6CA 4FONA 2ECOA 3ETHA 3FVTA 1U3CA 4G1UC 5JDCC 3RTGA 2PUJA 4ID3A 3VHLB 2CFCA 3G0BA 2JCSA 5B7NA 3E7XA 4OGKA 3T34A 4OFXA 4MDEA 1VSVA 1VZ2A 3WZ2A 4YQEA 1NUUA 4HD8A 4MRRA 2GD0A 3ZXYA 1M73E 3HCWA 4LDAA 3ZQ4A 1W2WB 1U8FO 2EZUA 1O1YA 2V1XA 1APBA 2M6RA 2WTEA 2UUBB 1WD7A 2MHCA 2DEUA 4YVFA 4CNBA 4JHLA 5A0TA 4HH1A 1DFIA 5C18A 1AOXA 4C0WA 3LUKA 1B3BA 1JALA 5CFOA 1XL0A 1YL7A 3Q2KA 4HXGA 3FCYA 4U00A 2BCJQ 2WABA 5HJEA 1ZR4A 4UCFA 5ED0A 4EZBA 5GP1A 3H1TA 2C42A 4YO8A 4GPBA 3DFUA 1IXZA 1RDFA 1TK2A 4UFOA 3ITKA 1ODCA 4CHGA 1QYVA 3CZ9A 5HF6A 1N3YA 3Q0EA 3PZRA 1VSQA 3BE5A 3U17A 3KDPA 1JMKC 3A6EA 5COAA 3P0IA 4I19A 2VCHA 2WV7A 1U8YA 3OU6A 4HQNA 3VHXB 2J5XA 4MP3A 2DE0X 1KTIA 5BR4A 4EG6A 2XSZA 3VC7A 2LDBA 4LOJA 4F5DA 1PS0A 2GNAA 5AUQA 1XTRA 4UOEA 1C9DB 1RXYA 3U4QA 4ND8A 1G7SA 4PG5A 4WA8A 4BNXA 4RTJA 4CUKA 3HI6A 4UDYX 3RVMA 2PUCA 2QN7A 3PGKA 4PCLA 1NAHA 8ADHA 4DJFC 2C9MA 2JLAA 3GLHE 4I7EA 4H7EA 5A0FA 4B0OA 4D5EA 4B9AA 3BIWA 1FFYA 2WD8A 1N6HA 2GYVA 2AG1A 4N9WA 1E0JA 4MI3A 4LJ5A 4E09A 1HE1C 4FYYA 1NY5A 2X22A 4BNGA 1OI4A 2D5LA 1TT7A 2J09A 2VG8A 1ONPA 3BH6A 3HYNA 3PSHA 4H2DA 2QL6A 2QUBA 3AH8A 5IC6A 3ND8A 4RIGA 2W2VA 1UJ2A 1C14A 3KSDO 4O5OA 3WLKX 4ABYA 2UVDA 5H83A 2H48A 5JLJA 3O92A 5THKA 1D03A 1JBKA 2GZ3A 5F2KA 2B8WA 3ZWWA 1S3SA 1KL7A 5B36A 1NBME 2FP4B 2VPPA 3W5BA 2SECE 3DWIA 4DKXA 4DLAA 4NE7A 4QT0A 4TQUS 2EKBA 1RNLA 1A8UA 4OSPA 1NDHA 2VRWA 4EFLA 3JR7A 3TF5A 4IIHA 5B7QA 1GAJA 2VH2A 1PK8A 1G21B 3GEMA 3O3OB 1E6EA 3EHDA 5TJHA 3WZMA 2IXTA 3VBCA 3C4QA 1EI9A 3ZX4A 4DWJA 4H6XA 4Y1RA 5JVDF 2ZTHA 2EZ9A 5IYZB 4UCWA 4JAVC 4H3VA 1QRDA 2Q45A 3H1BA 5DWQA 4HGZA 3X1DA 3OZCA 4RVFA 4ERNA 2FGJA 1LW7A 2W2TA 4KW7A 1XCBA 2HJSA 2HJ9A 1WDLA 2IVZA 3A4IA 1PEYA 3NNSA 3GJSA 3KSAC 3ABRB 3ZWKA 1I2DA 3VKWA 2GAIA 1M34E 3QFHA 1MC8A 3RPEA 1LLDA 3GUCA 3SC4A 3SQDA 5JNUA 1BMTA 4B2IA 3LZCA 5ITZA 1JU3A 1QQ5A 3V7UA 4H60A 4ARVA 4JYAB 3U40A 4ENVA 1R0BA 5AVYA 1AGYA 3FG9A 1V45E 1DU4A 2AXEA 3CISA 4QPZA 1BROA 1J56A 1TFRA 2ACVA 4RAQA 2PRZA 4XOIA 3B36A 3TX2A 2F8SA 4FFLA 2DKNA 5HOQA 3ZPXA 1WHTA 1GZ4A 1NOIA 1P0FA 1Y37A 4N65A 2IV3A 3RUFA 1SURA 1IQ0A 2JCBA 1K5HA 3DDWA 3FCEA 1JILA 2G1UA 1JI3A 5EXEA 3ZLUA 2B8NA 5FR1A 2CXQA 1W44A 4N5MA 3ZEIA 1K97A 1R4AA 3JAMA 2VJMA 4GMFA 4FW8A 1LFAA 3EGCA 4OHMA 3DZIA 1KQNA 1O0SA 4L76A 1CIJA 1EM6A 3TSYA 2IDMA 1ZHHA 3B52X 4DDMA 1PR4A 1B6TA 1DKOA 4M86A 4MYRA 1N3BA 1T2CA 4XZ3A 1TUGA 4LZLA 1KZ7B 3CVJA 3MLAA 1SUEA 2AV6A 1NXPA 4PZEA 4TV9A 3RVNA 1N2HA 2FZKA 2XAUA 5A9SA 5IANA 4O0MA 4AICA 2J30A 2A5JA 3RO7A 3TB4A 1WBDA 3W6NA 2OO5C 1YS7A 1Z6PA 1KAOA 4YAEA 4ETMA 5CBPB 1GEEA 1MO6A 1NKSA 2NTJA 1P0MA 5K0NA 4B6GA 4DNOA 2ZI9A 2OFPA 5YASA 1ZXXA 3FGNA 3G5TA 4DTCA 4EVQA 4ZCLA 3JASB 2E37A 1E9RA 2OVFA 5E9QA 5ANRB 3KZNA 4DDVA 3FZQA 2F8TA 1BE1A 1U0SY 3T0IA 3TKAA 1E1QD 3R5JA 4BMOB 3RUCA 2RBGA 5JTUA 4OKNA 4XIJA 1XU9A 3KQUA 2ZYIA 5CX4A 3LPCA 2X1HA 2ZT7A 4QHSA 1UJ5A 4V0SA 2MSLA 2C94A 1ULBA 2FZ4A 2COEA 2G67A 4EVRA 4Y0AA 2PA0A 1X7XA 3GVCA 4Y2SA 4PVCA 2WQ7A 3GLFE 2CHFA 1NPDA 1B0ZA 1NUAA 1Y1TA 1GNLA 2HDNB 3P2EA 5AM2A 4RTMA 5K5EA 3JQQA 1QGUA 4I9NA 2BTEA 4XVHA 5DXAA 2O7SA 4HCJA 4D96A 4WZAE 2GCPA 2VHYA 4WGGA 1ZOSA 1U31A 2YHIA 1T0JB 5FPPA 4L8VA 1OFUA 2EXXA 3M1IA 1NUPA 5JJ5A 5TT0A 5A6VA 2XVYA 2Y76A 3I34X 1CYEA 2PL3A 1Z2OX 2V7EA 2YXDA 3ELBA 1Z83A 1MF7A 3GZ4A 1BAPA 3PQDA 2XVZA 4YCMA 2D54A 1IY9A 1H0SA 1NRJB 1YJCA 2YIDA 3KT8A 1I7PA 2ZVJA 2QGNA 2YRFA 1P4SA 1PQWA 2VJDA 4HZGA 1E3WA 2WYOA 4OLFA 1G8PA 1W8DA 5BO5A 4ITVA 3UJ8A 4QM7A 5FBVB 3WIOA 1RFGE 5L9AA 3LG2A 5CAEB 2QP4A 2XLCA 5DDIP 5JECA 4J9UE 4QRIA 5KNBA 1QTQA 3L1JA 1QV7A 2RHLA 1EFKA 5J2TF 4LXIA 2PKWA 4K05A 2XMGA 5HTKA 3RSZA 4XRGA 3OIDA 1L4KA 5DO9A 3B1WA 1QHHB 3PQFA 5IMBA 2C4WA 1KH3A 4FZJA 1G21A 2WSYB 2C4UA 3AVPA 3KKNA 3HVJA 2EJUA 2PGXA 4KXNA 1XN1A 1ZM7A 1SEVA 3DGEC 5LQJA 1EWRA 4AWBA 2OCXA 2Q0HA 2WG1A 4E88A 3G5LA 3IVGA 3D3WB 3UKJA 4D79A 1SCUA 1ULSA 4M0UA 1RXVA 4FNGA 1RYEA 1Z2AA 3D7KA 3O03A 4BN0A 3AXTA 1ZR2A 5P21A 2VTKA 2ODTX 2K7FA 2A9KA 1ZLXA 1AUVA 1T91A 1U5BB 2GBLC 2XRYA 2GN9A 2YL2A 3BICA 3IQXA 5ER6A 5L6LB 1HG1A 3O8OA 4XYEA 5HDQA 9MHTA 2I2AA 1I7NA 3V1KA 2NQ2C 2BKXA 1EK2A 4ZK6A 3ABSB 3GLSA 2DPXA 2HLDA 3WY9A 5HM8A 3W6ZA 1ZL0A 2YZKA 3BMNB 1IM8A 3DKVA 2VHJA 1L5OA 2DH6A 4KVAA 5BVHA 1JDZA 4NU6A 4CUJA 1UPXA 3DNFA 4DVJA 5JALA 1SHKA 1QB8A 3ASVA 3MFQA 3GFPA 4GYKA 2P9TA 3BFKA 1Y3HA 4Z2AA 2BGRA 2H8KA 4RH3A 4E2ZA 1N7GA 3NUQA 1JR3A 1E1LA 1DARA 3IBFA 4CWAA 4HNVA 5JS7A 3G8BA 2GRAA 4KDFA 1W35A 2VJMB 4EMSA 3NT4A 5GONF 2QDXA 2C3PA 3H86A 3K6JA 3WL3A 3ONNA 4A6DA 2C8VA 1PSWA 3AINA 3SK0A 4B48A 4ZMRA 4MVJI 1W1UA 2VJPA 2UUCB 4URXR 1AK1A 2JBAA 5HXAA 1GPJA 1JAZA 2ZYWX 2VNHA 2P30A 3IO5A 3MTGA 2VSYA 1S3FA 2QRPA 1RXEA 4QXQA 1MO4A 1XXHE 4ZPJA 4JFRA 4TS3A 5EESA 5KU1A 1REQB 4ZEMA 1NJFA 3TW6A 1QH9A 2A7XA 2B8TA 2JI6A 2V7QA 5DRTA 3VPXA 3NZEA 2AUNA 5JH7A 4D9EA 2RJNA 3EDYA 4EHFA 4DS3A 3EVAA 2PXXA 2PLRA 2FW8A 3SN6A 5IBPA 1J33A 2WKRA 2B9EA 2G82A 2WZQA 4IRMA 3LE8A 3ND7A 3U6KA 4I4NA 4C07A 3C24A 1Y6JA 2XIJA 5FR2A 4B84A 4FYVA 3GELA 1Q0LA 4MKHA 2IHZA 4RF2A 3SE0A 4DY4A 5B30A 1AHIA 1DBVO 2NOAA 1F2DA 1OTYA 1OILA 5EIHA 1WB9A 3T7CA 3W9UA 4NJMB 3JS5A 1FF9A 2GOYA 3C3JA 3IILA 4GKAA 3R6WA 4N3CA 4GQAA 3M83A 3EWNA 4RZHA 1VE6A 3R6GA 4TX1A 2XQFA 1UAGA 1XU7A 1W5SA 1BU5A 1KJZA 1NWCA 3D6FA 3O75A 3PRHA 3QM1A 2D74A 4ZHQF 3HJUA 4F3RA 4F1JA 3DM5A 4DCPA 1NUTA 3H2ZA 1A8IA 4Q19A 1Y8AA 2VUTA 4FK8A 1PJ4A 4A2CA 3QE2A 4HH3C 4R7ZA 4GMHA 1ZMXA 3KYDA 4XYMA 2DERA 2ATIA 2BEVA 3N87A 3AETB 2VTBA 3U7IA 2FFHA 1PGQA 1WNFA 2OD9A 4QJ4A 2Z5FA 4XD7A 3ZE7A 1EGHA 4KFUA 1QLHA 3AUYA 1TQ6A 3KLBA 4X20B 1P2FA 2Y2UA 1OI3A 5AJHA 3V6MA 3HK2A 1UAYA 4BLQA 3UK1A 4EOGA 1CUIA 4D41A 1OWNA 4OKSA 5EIAA 2OBFA 4XD2A 1EVYA 2YIMA 3DVSX 5ALKA 1D4FA 3VM6A 3VU9A 2PUHA 5LQUA 1P7CA 4B3JA 1U2GA 1WB6A 3UBTA 3VNBA 2XCLA 1D2MA 1EK5A 3OPYI 3M6MD 1B1AA 4FHFA 4ENUA 4RKFA 3RJ5A 3E6AA 2DLNA 5AD1A 1A9RA 4U5QA 4W6QA 5HW0A 3X1ZA 3O8NA 1KH2A 2PGAA 1FDWA 1K0UA 2GSDA 3EXG2 4MUGA 3VDRA 4D99A 1AQNA 5JYEA 1KMHA 1J09A 1CZUA 3AHHA 5LZ7A 4AJHA 2QF7A 4GS5A 3REFA 2NTEA 3VNVA 2R6FA 4CKXA 2JAXA 4E5YA 2BUBA 1J5XA 1ESMA 1O9HA 1TGYA 1WMAA 3QKIA 4Q34A 3OFKA 4XUDA 1JBQA 1XXHA 5AQEA 1UK7A 2CNOA 4MB6A 4V39A 3ZW8A 4Z53A 2O2CA 2GFQA 2EV9A 3WFIA 2RG7A 4ALMA 4NF2A 1SB8A 4CZ2A 4DA7A 1OQAA 1JAIA 1KZGB 3ZKAA 4DJDC 4EX7A 1E5XA 4FINA 4EJFA 1BS1A 1S3GA 3ICPA 2QUIA 2G76A 3R3UA 5K6AA 1GQYA 3TR5A 4R1TA 4WXEA 4MQ4A 1YDEA 3NM4A 3P0RA 5IH7A 1HE3A 2W90A 4C76A 4JL6A 1J2TA 1U2DA 4RS4A 4EMUA 5BW4A 2JW5A 4Q9NA 1T3HA 1E1YA 4CFZA 2J9RA 2VHQA 5DSZA 3WA7A 3AR5A 1II0A 4IHKA 3A9UA 4JQOA 4OG2A 5FNVB 5FA6A 2XVXA 4GFDA 1BA2A 5FWYB 5BV2P 4QYXA 1N2BA 1ZW6A 1JSXA 2PHZA 3DEKA 2OLJA 1N34B 5FI5A 2CCJA 3L8GA 5JJIA 2EP5A 2PWYA 1DKNA 3JQAA 2P35A 3IDFA 4JKOA 3KXDA 1PTKA 3RSQA 5EIEA 1CTQA 3CNOA 2AE2A 1VL8A 2IEIA 2Q1SA 3ASYA 3E0QA 3QPDA 4LFCB 2QR3A 5I45A 4YY3B 3NP7A 5ALHA 4WEOA 3WNZA 1RRCA 4M1TA 1IBRA 1P5ZB 3MBKA 3DB1A 1O57A 5KHAA 1NFRA 4DQXA 3IB6A 1CSEE 2LCQA 1CS4C 1K7SN 3Q41A 4FW9A 4L1KA 1LC3A 4OD0A 2O2GA 1IPHA 2O8FB 1FIUA 1F8FA 1SUBA 2WDZA 1QHGA 1YZKA 5CIYA 2BDUA 4JUAA 3FOZA 1P74A 2JASA 3RVQA 1LVUA 1EZ4A 3AW9A 3V9AA 2JJQA 3GYGA 1UXIA 3PVCA 1C4OA 3SZGA 3WIDA 3C2QA 5E6SB 1K92A 1QP7A 4IEFB 3OOJA 1G8HA 3Q40A 2UZ1A 4LXYA 3A4MA 2Q6LA 4NX2A 3FMGA 4FFBB 3GLVA 4P93A 1E2IA 5BUZA 1ODTC 1FLNA 3AERA 1FTQA 1P9OA 4FDUA 1ONSA 4KIGA 1R0WA 4HWRA 5TVGA 1GZ6A 3WLHA 4CR6A 2Q0SA 4S12A 2ZRHA 1B1CA 4Y6LA 1B00A 1G291 2H2FA 4BKOA 1M2NA 3I9V1 3FPJA 4D6XA 4DBVO 1NW9B 1V5FA 3DDUA 4I14A 4RHCA 5JXWA 3O38A 4UC0A 4D6YA 1PNTA 3OX1A 4ZV7A 3ICEA 5BSMA 2FUKA 5IT5A 3WK5A 4DADA 2N47A 5KOJA 2R0QC 4DLVA 3ZGNA 1QQAA 2IOFA 2NLOA 1B3RA 3P9KA 5H1YA 4U0KA 4H0NA 5HJ5A 3INRA 1HYEA 1XHLA 3NXSA 2YICA 1GFZA 1RAHA 5J63A 4ABTA 1RRFA 3J80A 1G9SA 5JQGA 1FP2A 2XUZA 2AUMA 3K09A 2BJHA 3B8HA 4AJPA 4WADA 5EMHA 3RVOA 4WBNA 1KA9H 1LVGA 3FYSA 2W2NA 3HXTA 1RWMA 4EG8A 1H2HA 2AMLA 2WUEA 1Z13A 2B78A 4JB3A 3UY4A 4ASUA 1R5OA 1T9KA 1KZ9A 1G2IA 1Z2DA 1UMKA 4DRXB 1IJEA 4HNUA 1X15A 4OQEA 1ISSA 1YA8A 1F4VA 2FN3A 2Q4DA 2XZPA 3HKCA 1RM0A 1U7OA 5GPBA 4HNQA 4ZFNA 1RAEA 1NBWB 2GCGA 1ISPA 2GN4A 3CLHA 3GIDA 2IEAA 3M2PA 2QQGA 4ZOLA 4YDHB 4JH0A 3GLGA 2W0SA 4WZAB 2VNIA 1VPEA 1IIBA 1IXKA 4N1AA 4IV8A 4D4KA 2IYNA 4D81A 2D3WA 3FMIA 4U2KA 3KG2A 3GT7A 4JU8A 4K87A 3GBVA 4UTZA 4UTVA 4AKGA 4U7WA 4MUXA 4CG3A 2AOVA 4CIBA 5LQAA 4Y1RB 3BWVA 3LKVA 1J0EA 1F0PA 3BCRA 3D5TA 3DXXA 2V4ZA 3V32A 9LDTA 2EFJA 4IF4A 3FPKA 4CL3A 1SEPA 1V16A 3INNA 2A33A 1T4DA 1CZNA 2FDXA 2YWHA 4ZA2A 2W2LD 3LRPA 4R69A 1UBHS 4RACA 3HKEB 4IOKA 3UPUA 3AKYA 3V1MA 4ZQCB 1J9ZA 5ADHA 2PD6A 3KR1A 1JQ5A 3ZDZB 4MS3B 1PNRA 4P5EA 2UUAB 4JJAA 4L08A 5JATA 3A1TA 4KHZA 4NJEA 5AK3A 5AW2A 4KV9A 3B5JA 5F5XA 2CYAA 2IXDA 3UJDA 1DP4A 4EB8A 5U4QA 1CB0A 1Z12A 2CVZA 4IZOA 3KB1A 5F64A 5K51A 1P9LA 4EDFA 2QGFA 5AJTA 3C8ZA 4UUNA 3VYUB 4CU2A 2RGXA 3EJWA 3G2QA 4I9HA 3BTSA 1E9VA 2I9PA 3PNOA 2GH1A 2O19A 3VOBA 1UF9A 3IT3A 2JIRA 1M2GA 2EBFX 3AR8A 4FHCA 4NCNA 4FOLA 3UWPA 1HV8A 4JYZA 5CG1A 1UBRS 4X1YA 1ND6A 2IQ5A 3CWCA 1E6LA 3QOWA 4FMDF 3PXEA 4WD3A 1KDRA 5LB4A 5KYYB 5KU7A 1S3IA 4GT1A 1IBLB 3QXCA 2EFEB 3ZGZA 3DV2A 1FFEA 2CNDA 2DZDA 5B55A 4LXXA 4FFBA 4F5YA 5DXJA 3OF3A 3OZSA 1KU0A 4D9BA 2X4DA 1AF7A 3H5LA 3LDGA 1XVIA 2VPWA 3GEEA 4ZYTA 1RYFA 3I6QA 5A5GA 4NZ9A 4DTIA 3AUKA 3ICVA 1PTJA 3NM6B 3H6KA 1VJRA 3TFQA 4OJKA 4U9IS 3I8XA 2IBSA 2I29A 1DAFA 1F1JA 1EFPA 2VRCD 3TOCA 2FUG1 1GVHA 2E4UA 3I0NA 4NFYA 3AUUA 1SN7A 3OM9A 4M55A 3UGKA 4HXEB 3HDJA 4MH0R 4L95C 2GZDA 5JIBA 3O4GA 3FMOB 4MSUA 3IPCA 1CF9A 1MDFA 4KPUA 4C6RA 3QA3E 4QT4A 1UEIA 4CQMA 3KLOA 4RVDA 2B92A 3KWMA 4J0IA 3KD3A 3OBIA 4M0FA 1GN8A 1G8GA 4J9VA 2VAXA 4TLBA 3K70D 4P2GA 4NTZA 1LD3A 1U7PA 3H4IA 5K6AC 2FXVA 1YNSA 2RHMA 2JATA 1G21E 4DV4B 2YNMA 1PR6A 5SICE 1DOAA 3DZHA 2F1RA 2Q4BA 2V55B 3VJLA 1KK0A 2I65A 2DR0A 1IHXA 1DCKA 1PX2A 4G0QA 1KJ9A 4P9NA 1QM5A 1Y5LA 2XWBF 3NO4A 4MLZA 4FT2A 4LX8A 4RAOA 3EN0A 2OLKA 1C30B 2Z9CA 3JWJA 1ECCA 1L5HB 2IS4A 2C5SA 2QRQA 3B5EA 3RYFA 3PVZA 1W0CA 2YWXA 1MC1A 1W4CA 3D8NA 4EB0A 3ZGOA 1DJNA 1OI2A 3HYRA 2ZB2A 4U7GA 3X2EA 2HJVA 3DKPA 6CHYA 2VL7A 4HGQA 4JR0A 1TF5A 2QA5A 3SCZA 3ME5A 5HCUA 4ENWA 4IHQA 1O97C 3DMTA 4X1IA 3TBFA 3A2NA 4IXMA 1CIVA 2WJJA 2OLEA 2D7JA 4UHCA 1LQUA 4Y2XA 4HYYA 1CUCA 1WVMA 2QVXX 2WK1A 1OE0A 2Y9PB 5BN5B 1ZCJA 1O2DA 1OXKB 2QB5A 4MAFA 4ND2A 4XX0B 5AK4A 3SICE 721PA 1MT0A 1FB5A 1L4YA 2VSOA 1KORA 3T5PA 4YMIA 3WSVA 4Z4HA 3BGIA 1RZVA 4IGEA 3EGDB 2C1EA 4RADA 4EVSA 1KZHA 1W88A 1PGJA 3NATA 2ID4A 1SCUB 4GI5A 4GW3A 4F3CA 3KKMA 2BIFA 4HT3B 1SXHA 5KHLB 2CLSA 2GBFA 4HN2A 3MWJA 3MOSA 3DA8A 4E1BA 2PRIA 1GZ3A 2QIPA 3CGWA 4CMKA 5ARDA 2Q6KA 4JI5B 1GVNB 1GR1A 4UU0A 4B2YA 5AW3A 1U1EA 3BS4A 3KCNA 1G7CA 2Z6VA 3ON5A 3QQ5A 2YVLA 4IW3B 2IYQA 4N3GA 5NLLA 3U3MA 3MT9A 3MLBA 4CKZA 4HTAA 4INPA 2C4VA 2PUDA 2QSUA 1N5IA 3GJXC 2HK9A 3ZVKA 3GAFA 5BOSB 3NGXA 3ETNA 1FJ2A 2FN7A 4MZDA 5F4BA 3U80A 4AVYA 4BEWA 1RRMA 5ADWA 1UZMA 3U19A 2I55A 3G13A 5ENZA 1OTXA 4LBWA 1UBGA 1RKVA 1T1RA 2GZAA 1W52X 2P9HA 2W2XA 3PVSA 4HHEA 5A5EA 2V6BA 1JH8A 2GN8A 3YASA 2E7ZA 3DXYA 4K9QA 4PSKA 1Y7LA 2AC2A 4JUFA 4XXHA 3WBFA 4E15A 1U28A 3DULA 1VLJA 2FW9A 3D59A 1RP1A 1EP3B 3KAQA 4RH0A 3VUEA 3WLMA 3EZNA 5CURA 4BC0A 1C7QA 1GOTA 2IC5A 3A70A 3DJFA 4PS1A 1MJGM 4CM9D 5SV2A 3B60A 1XQWA 4EW1A 1SC6A 1X87A 2XX3A 1YZLA 1PBTA 1X86B 1XA0A 2BEWB 4JGIA 1WP9A 3E53A 3G8AA 1PUIA 3BK1A 1U0OC 4A0GA 2PZGA 2QG6A 1V43A 4CEIB 3JQ8A 4JSTA 2A4KA 1FMTA 1NHGA 3LVRE 4PZZA 4E31A 2J9XB 3L0ZA 5AKHA 4HVLA 1PGNA 5KNCD 4RJJA 4C4SA 1AKQA 1SCAA 1UC5B 3CM0A 3KE9A 3W8FA 2DBQA 2VATA 2EG9A 3LW8A 2NTVA 4OQQA 4RZ2A 4O63O 4DLZA 3FB4A 1CJSA 2JGMA 1RMQA 1AO0A 2ZREA 1KDPA 1NT2A 4RM2A 2WKSA 3FAZA 1TQHA 2NSLA 5D51S 3UHOA 3G2PA 3G0HA 2AFHB 1AVTA 3TCXB 1OLSA 1VJTA 5J1TB 5TPWA 3WXBA 5J2UF 3G9TA 4TVKA 4NNOA 2LDXA 4IQ4A 4MQFA 5JAHA 1W19A 3QY9A 4PSDA 3FVRA 5LSAA 1IHUA 1AUQA 3IUEA 1U0RA 2WP8J 2AYXA 1YB7A 2I7XA 3F8TA 3HJBA 3SC6A 3BXOA 3TS1A 4K8RB 4KFTA 3E8MA 4TMZA 1ZXBA 5KNDA 2RGNC 2LD4A 4J2HA 4MUFA 3RVLA 1EUDA 3P96A 4BP3A 4XYGA 4A03A 2Y99A 1QTIA 1DJLA 2X8BA 4L3WA 1O0CA 2W93A 3DONA 1PUXA 4GVXA 4UJ3A 4E08A 4L9WA 2VYQA 4Y6OA 1QGAA 3W1VA 5IT9A 5FXMA 2MYNA 3GRVA 3RI3A 4ZOBA 4W7IA 4M88A 4DNQA 3LUGA 1YJBA 2QWXA 1GKIA 2DT8A 3ADKA 3N2LA 1FP4B 1XTQA 3QBJA 1GUFA 3UICA 4XWWA 1AKWA 4FDAA 1TZBA 4UEKA 1CUBA 2PZAA 5H9WA 3RIXA 4D26A 1Y34E 1U8XX 3UO8B 2ORWA 4IJ6A 4C3VA 2CBZA 3U49A 2CNLA 4QWMA 1F4LA 1SKUA 4LQ4A 4M9SA 4OH7A 3GT4A 4PLPA 5C7YA 5DU2A 1X2EA 1ODKA 2ZW9A 3IPXA 1EX1A 4J29A 4C7VA 4DIKA 3LIPA 4GGMX 4BUJA 4RHTA 5DIZA 2G4LA 3QOYA 4JSRA 5ALYA 5T7BA 3QKRA 1T9HA 3DEZA 5D00A 1HT2E 2QBYB 4YT4A 4F72A 3PEYA 1GRRA 5J2UA 1J8VA 1VIMA 2C59A 1N5OX 4ALLA 2UXDB 5JNWA 2IYUA 3KYCA 2GK3A 2PO7A 2ZR7A 4L72A 2QL7A 4KSBA 5JTTA 3PNQA 3HL4A 3E70C 3LBYA 1SCKA 3O9MA 1WHSA 1D2HA 2IYXA 2BMWA 2Q3LA 4FYHA 2NZ8A 3P19A 4DHEA 3T7EA 8ABPA 1E9DA 2ZQ5A 1DIBA 3OSZA 3UC9A 5CD1A 4EQZA 3O2JA 5LIRA 5B57C 4NATA 2EZTA 4OI0A 4AY2A 5ARBA 3GPLA 2C03A 2OBMA 3AFOA 1LCIA 3U09A 1H66A 1B7GO 5IWCA 1QWSA 1YJQA 3GL9A 3ND5A 4G5SA 1U1CA 3ESBA 1IUNA 1N5MA 2H2WA 4BQRA 1L5LA 3W3AA 3C5EA 4JP2A 4BAUA 1PR1A 3UQYS 1WU8A 1IN8A 4FT4A 3IB3A 4J0EA 2FMIA 5E4JA 2O8FA 2J3JA 3KAKA 1Z56C 4LOKA 4S1PA 3ZTYA 4A10A 2OZVA 3COSA 5E7JA 1U8UA 2HL6A 3PTAA 1SCJA 4EKEA 2QM3A 4UMVA 5IBCA 4J0KA 3HYTA 2V1UA 3BILA 3CZRA 5DM1A 2NU8A 1JAHA 1R16A 1U28C 2PLWA 3IEXA 3P7MA 1UPUA 3PIDA 4RGVA 16PKA 4NPHA 2HPHA 2ZSAA 2ZRQA 1OBCA 4ESVA 3H2BA 4MMYB 4TN1A 3HCPA 3F5SA 2VN8A 1ENYA 2IITA 3GR6A 5AVWA 3QJGA 3E22B 1KAHA 3IMGA 5HR5A 5KBYA 3A1NA 3KCQA 5EGNA 2A1UB 3RS3A 2J7PA 2VJYA 4JR1A 4NP6A 5MFZA 5C5DA 4CQMD 2NNWB 2BBWA 2G08A 2V45A 4LMRA 2QYSA 2PBRA 4O8ZA 3NLLA 2XWSA 4FS3A 4E5PA 3N2NA 2X2OA 4LTMA 4IUBS 4TV8A 5FFFA 3EC1A 2WU1A 2OAP1 1N0VC 2VHVA 3ZGVA 5BVHB 3PCRB 1YRAA 1A5BB 2NZXA 2ORIA 3I9NA 5A9TA 4E4TA 5JRJA 1CK4A 2FA9A 2FOIA 1I3NA 2B21A 2ODEA 5AOBA 4BQOA 2C04A 1YDWA 1S1MA 3L8CA 4OO3A 4B6JA 1R6VA 3IKJA 4R5HA 3PTZA 3JAKB 3GD5A 4J2TA 3T7DA 5DHSA 4BNNA 1JHPA 3R23A 3PNKA 2WD7A 4Y1EA 4U7FA 2NZ2A 5H16A 2ZRGA 4OCZA 3F4BA 4PRZA 3UHPA 2H4HA 3AUFA 5TLSA 3I5UA 4J94A 1UMDB 2O3QA 1NW5A 1TCAA 3DHNA 3PT9A 3CNLA 3SJUA 3VAZA 4ZKDA 4PZPA 4LK3A 2R00A 2FPGA 3AB8A 1F2UB 4NENB 2FZVA 2HSZA 2PYZA 3GW8A 2O4UX 3WP1B 2KQUA 3AIIA 1LRLA 4LWZA 3D4PA 5I6DA 2L18A 2ODPA 5KQPA 2GAJA 3AGQA 4EW3A 4LISA 1U9IA 1JHRA 4N48A 5JH7B 2P4HX 5AP9A 3I64A 3BG5A 3NFYA 3BBPA 3DVAB 4DYHA 3EVTA 4M1WA 3K0AA 1IUPA 1UT6A 5K3FB 3UMFA 3QEBZ 3RE1A 3ZD6A 4HUJA 4ARCA 2WU0A 4MV5A 2Q1TA 3ZD7A 4B3SB 2YXBA 4X45A 4Z0PA 1M2WA 2IZ0A 3EF1A 4O2BB 4TSFA 2DSTA 1Y1QA 1KO7A 2QZZA 3ENVA 5KTSA 1VCIA 2V97A 4TRNA 5I7SA 3ND9A 1I4TD 2ENUA 3CKKA 1QX3A 2FETA 4FU0A 3MFYA 4G81A 4PICA 3W77A 1A4IA 4D9HA 4Q1AA 5HRAA 3S81A 3DPIA 4BCDA 1XTZA 4K81B 1KETA 4OGFA 3D6TB 2VYND 3AIMA 1WZIA 1RIFA 3LUJA 2WWVD 3RC9A 4EYGA 3D4NA 2FDRA 3JQPA 2ZS7A 3ELWA 1CVIA 3FOWA 3N0TA 5CHYA 2IOHA 5FL3A 3ZKWB 4UM9B 1Z3IX 3WSTA 1Z22A 1A4RA 4QUKA 2VSFA 3KJGA 5A4MS 1A9XB 3HEAA 4BX8A 1UJCA 2GJSA 5CFNA 1ZN7A 1TYAE 4V0LA 1E9BA 2ZRMA 2AJTA 3RFVA 4MA5A 3FR8A 4C6TB 4GLBA 1XCPA 4DM3A 1N8KA 4QULA 3HEMA 3ZYZA 4D25A 1E60A 4KK4A 4GPZA 5EZSA 2VDWA 3M1LA 4MVJA 1YWGO 1CT9A 5EJ7A 2YYYA 1MNQA 3NV9A 1S2OA 3NKVA 2CZGA 1E9CA 3F49S 1EJ0A 2Z98A 3HH8A 1WVIA 1GKLA 1VSUA 4MYCA 1L1RA 1L4UA 3GJ7A 5D3ZA 4EFDA 4MGEA 3D0KA 5EHNA 2P5SA 1KEEB 2IGTA 2IZZA 4C20A 3TOZA 3ACCA 2F1IA 3EQ6A 3I5XA 1HYHA 1Z7YA 2F48A 4X64B 1S8OA 2WHEA 3HMQA 4IKEA 3VPSA 2LCFA 3CGGA 2BEUA 3Q7TA 1W94A 1V2HE 1A3CA 3MT8A 1TTPB 1WW3A 2BL4A 1E8NA 1DIAA 1XZAA 2E4XA 1Y4AE 3DAFA 3WRYC 4F6RA 3OMLA 1QGDA 4U0JA 1XMOB 4KDEA 4KNYA 3LLUA 1STOA 1UXGA 1T8WA 3ZHCA 2XTNA 2ZCUA 3CVXA 5KI6A 1HORA 4YQZA 4ZCQA 2JHCA 2FJPA 3HV2A 1KC3A 1Y5RA 2QX4A 3UXYA 5BV0A 1EDOA 2WR8A 4GC5A 4PAWA 5KINB 1HR0B 2AOXA 2GLTA 3IUMA 1FXUA 1AKVA 4UHEA 4D42A 4IGAA 3L5KA 4C3ZA 2BELA 4IJQA 4YFYA 1V4VA 1YS6A 3EGIA 3NASA 3SYRA 3EXEB 4OATA 3ZV7A 3AM1A 3LLVA 4DBZA 2QZ9A 1Z6ZA 1HTBA 1I4LD 1X8KA 4DXHA 4A73A 1QR2A 1ZX1A 2WLTA 1WSAA 4DQDA 1Q16A 1KMNA 3A6DA 4W5JA 5HQJA 1X6VA 1XJWA 1UPBA 4MQLA 4BV2A 1YDHA 2ZZKA 3I5AA 5IKPA 5MGBA 5T5QA 2PT6A 3SVLA 1EFTA 3BQMB 3SIXA 3TL3A 3B3FA 2ZSEA 5ALRA 1B93A 4L6IA 3LWBA 1GADO 1P60A 4IMJB 3LP8A 4PZYA 2P68A 4PLCA 4BZPA 5INTA 2I0FA 1FTGA 4XDHA 4GX5A 5DRYA 1E2BA 2L42A 2QN9A 4LDJA 3L4JA 2LV8A 2PQ2A 4BS9A 4JROA 4M1YA 1XT6A 2Z4TA 3IMCA 1WW2A 4IDOA 4JB0A 3TLGA 3KELA 1CX9B 3QKSB 5MN5A 4TXNA 4TL6A 2A6PA 4P0PB 1WO8A 3JZFA 2QRVA 1KVTA 4HNSA 3QUCA 4REQB 2GM3A 3GG9A 2W83A 1MCZA 5DM4A 3G82C 3UFXA 3NRJA 2VEOA 2NG1A 5FYDA 5JHHB 3WJAA 5KWSA 4DB4A 1YGYA 1YR7A 2D0OB 5LD2B 4GGOA 2B61A 2X76A 4HWKA 5FWXB 1JQKA 1EWTA 4G24A 2QHXA 2ERCA 3ENNA 1W1WA 2WSSA 3K3PA 3LECA 1FDUA 4YA6A 2BM0A 3RUDA 4WLUA 3ZDAA 1AS2A 2JDIA 3T9BA 4AG3A 4BNDA 1CF2O 1H8HA 1MMFB 2WTUA 3SG0A 2X0DA 2GJ8A 4MGHA 4CDMA 3B12A 1L7PA 3KU4A 2CMHA 5E7MA 3FFAA 1ZESA 2RB4A 1QHYA 3W34A 4C0AC 4CKBB 4XOUA 3GRZA 2JAHA 1RQXA 2YUIA 4HFNA 3ANYB 1WPQA 2WJ6A 3O26A 4TRRA 1DJQA 2J0UB 3MOIA 2BM1A 3WISA 1FRNA 1GAWA 4H7FA 1NMQA 1VJGA 2QJOA 3EDQA 2FRDA 3H9QA 2IPNA 2WZCA 1R6XA 3AI2A 4UTNA 5LQSA 1C29B 1AZLA 1C4WA 3K0BA 4II2A 3RS0A 4CL0A 3QVSA 3TXXA 1CJCA 1OZHA 1RCFA 1XVTA 1KWGA 4CTMA 1I01A 3UGQA 3ZD9A 1ZNWA 2AN3A 1IQPA 2WU8A 1S2LA 2PV0A 2ZDGA 2AVNA 3LDUA 4K40A 1MEOA 1G2OA 1MXHA 1C7JA 3E9DA 3KHUA 4X44A 1IK6A 3A37A 3CH7A 3SBDA 2ZUFA 1PO7A 3I52A 1NASA 3W5VA 3FHCB 3PDJA 1JZSA 1T3LA 3QVGB 5I7RA 2G09A 5CX1A 1DX6A 4K6OA 3UJ6A 3A6PC 2OORC 2QAJA 1FYVA 1Y7TA 3K4HA 4QHTA 4Q3BA 4XB1A 2W42A 1QNFA 1PE0A 1BD4A 3IURA 3DDCA 1UWLA 1VHQA 3GQVA 3N2ZB 2D13A 1LA2A 2HJHA 3KJQA 3DUWA 5HG0A 4YT8A 1BW9A 3D4IA 4GX1A 4OXQA 2W6OA 4OBXA 3LO5A 4Y2RA 4LVCA 4BU0A 4GL4A 2J48A 2NYUA 2JLUA 3L4BC 4BO9A 3SNHA 2WLSA 3S0JA 1UDXA 2HK8A 1UT5A 4MWEA 2GPBA 3SJBA 1H9AA 1DRUA 2MSDB 2B7LA 1M8PA 3TK1A 1D2CA 2A9OA 4OA5A 2C2GA 4YT2A 1Y81A 4FVTA 5IAAA 5E1OA 1CD5A 3OT4A 5EQFA 2Q2NA 1EK6A 3CC8A 1IOLA 2PO5A 1Z36A 3DV9A 3OA0A 4INZA 4REQA 2ZTLA 5AI0A 3ZDQA 3PQ6A 5B6JA 2QTNA 1XDZA 4BZWA 1MBZA 2C88A 1QCDA 2OWDA 1QO0A 2Q41A 1GUDA 2R3SA 2RGWA 3KXPA 4XJSA 5DVZA 4BEJA 2O8NA 1LPNA 3W6PA 2APJA 1Z8DA 4RFLA 5LZ9A 4K0RA 4HMQA 4URUR 5J4YA 3LPAA 3AR2A 5IX8A 2D8MA 4P80A 4FJ2A 3DG9A 4BMXA 1VXRA 2XNCA 3A31A 4HWTA 4LYDA 4P4GA 1G8SA 4W99A 2ZBFA 1OUMA 1P73A 5CB8A 4RQBA 2QLBA 2VP3A 5DBEX 5LKAA 1N5DA 2OV8A 4PAGA 3ZV6A 2YKGA 2IYLD 1ZWKA 4V0QA 5DNVA 1X42A 5TEVA 1JFFB 1NMYA 5LP6A 2ZRLA 3KJFA 4HQOA 3B48A 1D2NA 4MUHA 2ZCJA 4MGKR 3EA0A 3TUIC 4RPGA 1FFAA 5K8TA 1BE0A 3LIIA 3OU7A 3DWFA 4MYTA 1TW2A 1AQIA 2IKSA 5MF6A 1IC6A 1Q2UA 2W4IA 4FGZA 2Y2VA 5KCMA 4CNQA 4WJLA 5HBRA 3BPSA 3K8ZA 3LBAA 3SF0A 3DBLA 1UFVA 4LY6A 1JAXA 5LXTA 3A9VA 1E0SA 2YZNA 5I01A 3HB0A 1X0XA 1D1QA 2VXOA 3H16A 3KT6A 1X1DA 5HWSA 1PF7E 2OGUA 1GGHA 4R2IA 2OMEA 5FUQA 2WQZA 4M4SA 4LN1A 3WL7A 3IIMA 5LBUA 2HHAA 3G2JA 4N5IX 1MX3A 1FS4A 2Y1GA 5D7BA 1EIZA 3I2FA 5DP1A 1WLSA 3S68A 3QLUC 1MIHA 4L5BA 1VIDA 3NOVA 1SG0A 1ZH2A 3M6AA 1J7JA 4ALJA 1UWCA 2GHTA 2PXCA 1SBQA 3E1GA 3JD1A 3MT0A 3AF2A 3QBEA 4KPUB 3H65A 1E2KA 1M0SA 1LJLA 3V48A 4BJ3A 1RJ9B 2WZBA 1C0KA 1DXYA 1T24A 2NYRA 3NDBB 2XT9A 3H83A 4OJMX 5REQA 1QH8B 3DOUA 3GLIE 1NG9A 3ETLA 3I5YA 2JFWA 1RFLA 3GZJA 2P9FA 4PSCA 1TJNA 2WEKA 3JQ6A 1I4OA 4MTCA 4EGQA 1U7ZA 2VXBA 2QLFA 3KQOA 3ROQA 4B44A 2EBWA 3DO6A 5A4DA 4UEWA 3MBOA 5CA0F 3QNMA 3OOEA 4B79A 1PEKE 2XTJA 4RZIA 4DDKA 4D9GA 2QRLA 2WUVA 4ND1A 4QUEA 4GZLA 5TEWA 3QE3A 3L8YA 3OBBA 4I4LA 4IUYA 4P2BA 5JNTA 5HIAA 5BRNA 4F4DA 1MAHA 4NBSA 1B73A 3IPLA 5ERGB 3LX5A 3Q2OA 4G0MA 4LKOA 2I4IA 2O52A 3ZG6A 1MZPA 4LRWA 4DPLA 2IEYA 3R5FA 4B1FA 1CQIA 2WJIA 3D3WA 3TTUA 1P80A 3UJNA 1TCVA 2GZMA 3G2NA 3L1VA 4BTEA 1QK3A 4KQCA 4URWR 1Z3CA 4PLGA 2F64A 4URVR 4W82A 4AP9A 1ZSNA 2RJOA 5KSYA 1WBBA 3HCCA 3MMSA 4NDAA 3SZUA 4HGRA 2GJ4A 4BPBA 5KTYA 2AS0A 4PO1A 3DE3X 4PQYA 2Q3MA 5J5AA 1IVNA 2NU9B 5LIPA 2AK2A 3OH8A 1ULAA 2OB1A 3CRVA 3OZAA 5AFSA 5ICGA 4K6FA 1W4BA 2EGHA 4KWCA 4R7GA 2PJDA 2YHUA 5BN4A 1NM5C 2JI4A 1NHWA 2AR7A 3OX2A 4P3OA 2GK7A 2J07A 1FK8A 4W1PA 1R0ZA 1SQ5A 2J45A 3W2GA 4X62B 1LWOA 3Q8LA 1OYVA 4A8PA 2GDJA 1DIGA 4HS4A 1AS3A 3HBMA 3N2KB 4JVMA 4H18A 2TECE 1M1NA 2PUTA 1GCAA 3H8SA 3RKUA 1LC0A 1EXVA 4ZQFA 2FR0A 2A9RA 3HRKA 4PIVA 4FDVA 2HQRA 1FS6A 3G0CA 4B17A 3TSZA 2DXIA 3JYOA 1E3MA 1K5GA 1KKLA 2JZOA 4AF8A 1Z6GA 2ZJFA 3QXSA 2QJFA 3UG6A 5FBKA 3EB9A 4KQIA 1C7EA 2UXBB 3LRXA 3L40A 2IQIA 5JZBA 5IC4A 4ZO6A 2XF2A 2FYTA 1AHNA 2XT6A 2BAGA 4DMUB 3OE7D 5IJ9A 4X7RA 3KEQA 5DHTA 2XMCA 3BGVA 4I3GA 4LJ7A 4DR3B 3AUJB 1S2MA 3F67A 4FYIA 3NTVA 2AJCA 1X38A 3DBVO 4MB0A 5UKDA 2J46A 3SHTA 4ZZ0A 2JJMA 4E5UA 1K6MA 4AZWA 2Y92A 1TECE 3TYXA 3ZV4A 1T2FA 1RPAA 4DF3A 4QQFA 4BYMA 3UPTA 2FPSA 4H7DA 2XYRA 3U4CA 3ETEA 5IVPA 1YRYE 4I99A 2MDTA 3LF1A 3PXDA 5THQA 5IUJC 1IM2A 2FZWA 3HE3A 5IUNC 1FQOA 5F98A 4UBMA 3ORQA 2Z04A 1XE3A 1W4RA 1OZAA 3BB3A 4ZCPA 1ZM2A 2BFCB 3VYRB 1RKBA 2JK0A 2JH3A 1UK6A 4K6GA 3PQ4A 4WZBE 3UZUA 4RY2A 3ZZMA 4EHLA 1BQEA 1E4VA 4XWYA 2OZPA 3UENA 4TQ9A 2V6JA 1S7CA 4WVLA 2EHDA 2VQ6A 4KTTE 4FFPA 3ZWBA 4DIBA 1TPZA 4FMDB 2R96A 4HB4A 1XMVA 4M22A 1SNYA 4ZIRA 2J32A 4ECEA 5AUPB 4L6AA 2CN1A 3SR0A 2Z1NA 2VUHB 1M2OA 2AMFA 3EFEA 4Q6WA 4X1OA 3ST7A 4D9CA 4QICA 3VDQA 1X7HA 3OIGA 4QAJA 1J1ZA 4FMPA 4IM7A 2P2YA 4OREX 4QU8A 1RD4A 2XD4A 2BGMA 1ZNYA 3E7FA 4PYLA 3THYB 2XTAA 5JQWA 1AGXA 4HQ6A 1W7AA 4OHZA 1AUXA 2G7ZA 4IO1A 5HK9A 4Q00A 4GOJA 3UH1A 5EWLA 4TZKA 3C85A 3TI9A 5HGXA 3ZZ0A 1T0PA 4F46A 4AF6A 3SS8A 5M2QA 3DFKA 3M4JA 2BFNA 4RH1A 4RXMA 1D4AA 2IP4A 5JASA 1ZJYA 3HG7A 2YQZA 4QGGA 4M3NA 5DN6D 1CEEA 4RD1A 1XTIA 5F2OA 3S2SA 5A7GA 5IG2A 3E3OA 5SZKB 5DNAA 3ZZTA 2HT1A 3IT2A 3F71A 3L7OA 3UWOA 3I6IA 1SR8A 1BS2A 4GMDA 4RF5A 1H0RA 1T0UA 5EG5A 4F7WA 1AQLA 2OCDA 3OE5A 4JA2A 3FOFC 3HJFA 3WB0A 3BJZA 2QVBA 5KMGB 1XA4A 1YGPA 4DCJA 3U3XA 4FYKA 4CT0A 2AOUA 3QYFA 4XX1A 2NU6B 5DJ5A 3R9KA 2DHQA 2JKVA 5L3SA 4YYZA 2ZE5A 1U2DC 1NL3A 1R8SA 1Y7HA 1NI3A 2C5EA 4L22A 3MJEA 1QZ3A 2DHCA 4R3UC 1JEOA 5DBHX 3S4YA 3R7FA 1GPLA 1S5PA 1ID8A 2G4VA 4BC1A 4QXRA 2L82A 2QD4A 1MTZA 3A1DA 4TLDA 1LTQA 1MRNA 5FNVA 3Q8MA 1OH5A 4GMGA 3V4RA 1FDTA 3G2OA 4PTYA 3WB1A 3TAUA 2JZCA 4DLSA 1S96A 3ZNNA 3C1TA 4NC9A 3OECA 1IBCA 3OX4A 2ONKA 2X14A 4MVJM 4GVLA 5DI9A 4ZQBA 5EYPA 3SQOA 3VDXA 5LP6F 5AI9A 5AVTA 2QN6A 2Z4SA 2HF8A 1PJ3A 2ETXA 4UASA 4UE3S 3AF6A 4NE2A 1HY3A 3QJ5A 5E38A 1U9JA 5DW3A 3E35A 4I66A 2IDKA 4KSYA 2ZIGA 3R4VA 3SR4A 4TL9A 2FN9A 3PFHA 4JJZA 3VHRA 3KJXA 4AT1A 1QG4A 4ZMBA 4F4CA 3A0RB 1JHXA 4ZI5A 2B8JA 1JSRA 2YZ7A 4DUZB 1XRJA 3B3AA 4ZU6X 4CV2A 1BDMA 1AKRA 1SBYA 1UM9B 2R97A 1BWQA 4JEHA 5G3YA 3CIOA 1ILWA 1GNRA 1JSZA 3QPUA 1SHLA 4BTLA 1P4AA 2FOLA 5G3ZA 1Y1RA 1UMCB 5BQ5A 2DPLA 3A6KA 4QTUB 5CYPA 1WD5A 2ICAA 3E03A 3IH5A 3VSEA 4HQRA 3UYKA 1IMJA 3OP1A 1RWXA 1QOQB 4Q02A 1QG0A 4X1KB 1EFLA 1UZUA 3VJMA 3QIVA 5CU7A 1UC4B 5IDVA 4EJSC 2A8YA 4Q3NA 4LRYA 5ES4B 4ZVRA 3U60B 1XXLA 4KP7A 1QE3A 3GA7A 1V37A 4FFOA 1XEXA 4UDOA 3JRWA 1AE1A 2MT9A 1EXDA 4OY3A 3DE1X 2QEQA 1QSGA 2WMDA 5L3RA 1GGFA 2OM6A 3LZDA 4G0YA 3EZ6A 4JUDX 4L7VA 2AKYA 4WOCA 3ONVA 5AT1A 3EIWA 3JQ9A 4QBHA 4RNCA 4I8IA 3LTEA 4MVXA 4PO3X 4ND4A 5AHXA 1QPBA 3RGWS 2Q4TA 2WMOB 3UM9A 1KGSA 4HDKA 2O2SA 3ZHYA 3FDIA 2QAGC 4CEHB 1GD1O 1L7DA 3EC7A 4FI3C 3JYQA 4GPAA 3W5JA 2C0PA 2E1RA 2PKCA 5AOCA 5JWOA 2A5LA 2NZJA 4QQ8A 2LBPA 1O6FA 5EWLB 4ZWNA 1G98A 5SY4A 4AZ3B 2GCOB 4C4TA 4B3GA 2W2KB 1SQ0A 3W3ZB 2HRBA 1GL9B 3EPRA 1Z75A 2GHRA 3SSNA 3LT1A 5CB6A 3BC1A 2DSNA 3IA2A 5EHGA 5E2IA 1I7QB 2XWQA 3KQYA 2F62A 4M21A 3FUXA 1NSTA 1KFJB 3WL4A 2B8EA 4EQ6B 2C9ZA 2QL9A 5BV8A 2ZYRA 1GZ5A 4QO8A 2FSGA 3CNBA 2YJTD 3OSUA 4EG1A 5KTKA 4K26A 4MTLA 3U7GA 4RKYA 1XZJA 1XWIA 2J41A 1VHLA 2R8OA 2K7ZA 3H2HA 5CDFE 1BH6A 4LZJA 3S1AB 3TIFA 3JQBC 2C8JA 4LE0A 3D6JA 5EIOA 1Y5IA 3C8MA 3HRHA 1O95D 3VTKA 4EY8A 3D1JA 1QE0A 3B1KA 1NQAO 2PYDA 4BB9A 1USKA 4HRVA 4PG7A 5AVQA 4Y9DA 3DOIA 1NJ5A 4NAUA 2NUTB 3NDPA 4MCAA 3ZJUA 3BULA 2YVUA 3GDFA 4S35A 1P91A 3NG1A 2ZI5A 5ALZA 1C3JA 2VVTA 4BYGA 1XZQA 2WVHA 3BH7A 4UPVA 1S8AA 1Z7EA 4QNMA 5JS6A 3H5RA 1DBQA 5C4MA 1VMAA 3K2QA 1G18A 5E9AA 2WSMA 1L4HA 3OPVA 1E7QA 4CIYA 1UL1X 2R6AA 1OGYA 3X0DA 3H1FA 5TS2A 3BSWA 1KJJA 4IOLA 4YX9A 5KNDH 4H1HA 3UUWA 5KPJA 3COZA 2I03A 2HGZA 3BZBA 5CLFA 3W90A 1RM3A 2CXTA 5AKEA 4C7OA 1RBQA 2J6CA 2ZVPX 4IKPA 4PC6A 1FMCA 2BDEA 1CNEA 4BL5A 5TXGA 5EJIA 1QVAA 2AG0A 3NTRA 1V3UA 4F38A 2QW1A 4LV5B 1Z25A 3WYGA 3NBYC 3FSGD 1C8LA 4P5PA 1YL5A 4KH0A 1TZKA 3I04M 1Z39A 1NE2A 5JUWA 1POWA 4DJJA 4U7PB 2FLKA 4UUMA 3WLNA 4FKMA 3QLVA 4N3BA 3UA4A 3L4KA 2OSVA 3BK7A 3WGKA 4YV0A 1BCRB 1KEUA 3FCXA 3R77A 5CGZA 3A7EA 1K1EA 2D62A 1JBEA 5FL7A 3WRYA 4D9NA 1NJ2A 2CZCA 2XNDD 4ETNA 3ZOZA 4BP8A 4KAJA 4WA7A 1DDOA 2HNAA 2IU3A 4IY1A 3O9ZA 4OQDA 3FOEC 2WJ3A 4JKIA 4HDKB 4YRSA 1FQJA 3LCCA 4ASUD 2M1ZA 4HEA1 1QGUB 3OZBA 3R6DA 2VYCA 4FCWA 3TZQA 4HZIA 4RDXA 1IOVA 2GEVA 3VI3B 1UBCA 4OQPA 3ZQUA 2O2EA 1CP3A 1MW9X 1RBZA 1EPUA 2PEZA 2BH9A 2X0JA 5JPIA 5DMXA 4L2IA 2P3QA 5EZQA 4CIVA 4MRNA 1LNSA 3G9ZA 3MHTA 2NUPB 3GCXA 1XLTA 3HFRA 2GBPA 2UUPA 3FWNA 3ORRA 3LQKA 5H3CA 4MCHA 1P2SA 4AZTA 4UDXX 3FYCA 1NOJA 1BYIA 3JZDA 4HPXB 1D3AA 4L0CA 3C3DA 3OCUA 5HQ3A 3TUZC 4UBKA 1WJGA 2GSWA 1R4NA 2O20A 4C43A 1LFDB 3KQVA 1KI4A 4FGWA 3OX3A 3C7TA 4XE5A 2ZETA 4HSEA 4MVJG 4NECA 2ABWA 2XMQA 3B7GA 5FHRA 3IFSA 3R4CA 3OIUA 3WYFA 3SZMA 3DD5A 3HJGA 5KYNA 1BVRA 2PAFA 4X6LA 4S04A 1HYGA 2I6GA 4O8CA 5I9NA 1K2VN 4TTTS 4WLFA 3VU0A 3GGPA 3QLJA 5IJ0A 2NTNA 1ADGA 5K0ZA 3CVUA 3OTWA 5H68A 1I8TA 3I1YA 1QORA 1E20A 2FOXA 3TLGB 3PC3A 4NYJQ 1DADA 5CTJA 3PWSA 4DC0A 3B1JA 1XDBA 5EVCA 1M1ZA 3H05A 3GDHA 1NBMA 2C2BA 2PXAA 3NETA 4IEIA 1V26A 5D3MA 1E3IA 1SA0A 5DBOA 5ESXA 2BCGY 2FJUA 1KJYA 3WYAA 2VZ9A 2GXAA 2R1VB 3RYIB 1X74A 4IDGA 3BIXA 1E2GA 5IXYA 2WIKA 4WDRA 1Q0RA 4UKDA 2WIBA 1SC4A 1T6ZA 1JEQA 1U7WA 3DYVA 3V97A 5H82A 4F7DA 1XVAA 1PHRA 1CY6A 3TL2A 2CXNA 2B5OA 1H8ED 2QQ0A 1P3JA 5CVCA 3VSDA 3S2YA 5I7AA 1MQ9A 3DV0B 3EW9A 1Z6QA 3L0DA 5K0CA 1FTYA 2YVKA 1I4DD 2IYYA 1GPNA 2JAPA 4DEXA 2OQ2A 5TS3A 4EY7A 2IF0A 1J25A 5JCOA 5D6OA 2ZWMA 1TQ2A 1QCZA 3OE7A 3Q3VA 1I5OA 4QAQA 2IZ6A 1T4CA 3G5UA 4EVIA 4RL4A 5D8DA 4C5AA 2ZUVA 1L7AA 3WXMA 3ZXIA 3UK2A 2HCFA 7YASA 4D57A 2RBEA 1MFPA 1RAAA 2V7VA 4PGHA 4A6EA 3QE9Y 3EBPA 3PQ2A 2VP2A 5EJMA 4EEZA 2PSSA 5F7JA 3WNVA 5CFMA 2LTAA 4ISCA 3H5AA 3RVPA 5CB4F 4BQFA 4DDWA 2VKQA 3EAQA 5AM0A 2A3RA 1KE1A 3ZQ6A 4B3XA 2P7IA 2WPDD 3NT5A 1Y6FA 1F48A 3OO1A 2NP6A 3MELA 3IUBA 5G4KA 3BHJA 5J40A 4E4RA 2LNDA 1VLQA 5FFMA 2ODBA 4R2HA 4ACAA 1TA4A 1A9SA 1ISGA 4JI7B 1QXSA 4DBLC 1OFIA 3C5CA 4OJYA 1EBBA 5T6MA 1K4YA 1Y6RA 2PSJA 3CRW1 2I3DA 3NJRA 1LV7A 1HMPA 2G0TA 3U31A 5KDOA 4U3JA 1L3BA 3LO8A 3OFVA 5KVVA 5EJ2A 3D1LA 4XGRA 1KMCA 5A9SB 3RC8A 2JFGA 1O94D 3WNBA 1G7RA 4NSNA 5DM60 2FDCA 3CNHA 3THWB 1OZFA 3PX3A 2QAGB 4UNSA 1X9GA 2ODQA 4P3NA 2VHWA 4R71A 2GKSA 4DZTA 3WLRA 2OHIA 1NT4A 2QLJA 1J22A 1DOHA 1FYXA 2J3KA 2EEPA 3OKPA 1DXQA 3WGMA 5DHPA 2E4YA 3NPMA 3HY6A 3UW1A 4YRLA 3VDMA 4F86A 2EGUA 5JDIC 5BWMA 1JFSA 4TTSA 2BTQA 1AX9A 1MOQA 1LI7A 3INYA 4LWPA 1XLTC 2WIFA 5HKLA 1H2YA 1MEEA 3RDPA 2FF7A 2PIDA 2L69A 1ML4A 1ADJA 3K1ZA 4YRTA 4QUGA 2X15A 3VV2A 1QYXA 3RNLA 3LHFA 2EKPA 4JCOA 2RCNA 3SKVA 4BQSA 1EVKA 1LEHA 4IVQA 4DR5B 1O9BA 1F17A 3IAHA 1VYVA 3ILYA 5TQJA 5FCDA 2BW0A 4O3MA 4OIMA 4YC7A 1SKBA 1C7IA 3BDIA 4RA9A 1G6HA 5LUBA 2QSZA 1CUAA 4N7MA 5F9HA 4YMWA 2ZRCA 1X7YB 1IULA 1B8OA 1D8TA 2CK3A 1XKQA 2RHTA 3C5VA 4KODA 3GQBB 3HMKA 1Q7CA 2JJ8A 3IV6A 4CTJA 5JSZB 2X9NA 4QELA 2DYKA 1C3VA 1JG2A 5BURA 1NYLA 3CRRA 1Z5VA 5CA1B 4O1MA 5E9WA 4Q9HA 5A06A 4LZAA 1W0JD 4ER6A 2I6QA 3ZXSA 3ZBPA 1T1JA 4DMHA 1TMOA 2B4YA 4J1TA 2POQX 2IUFA 1R6DA 4EW2A 5I4BA 2DHEA 3QPAA 1OAKA 5AM5A 3TRIA 1B14A 2C7RA 4DT1A 3H11A 4PWZA 2A0FA 2EJVA 1IHDA 1NKVA 5JCJD 2I66A 1ND5A 4MCJA 4DPMA 1M34B 2PL9A 1DKQA 3N53A 3QMPA 4F8YA 5B6IA 5JH7F 2COKA 4MO9A 2V0NA 1JG1A 2ZIEA 1IEXA 5CVDA 3ZHQA 4E2FA 4Z4IA 1XNQB 1BC5A 1P1JA 4C2TA 4CM5A 3LQ1A 4JVLA 2FCRA 3ZY3A 4O25A 3VH4A 1XEAA 1FFWA 4DLYA 2DHDA 1M2KA 3IP8A 4X1IB 3TTWA 2B9VA 4M8NE 5JCOC 5ECDA 2GR9A 1TAUA 3D8SA 4B3IA 5EJGA 3IA7A 5EE1A 2XHEA 5DM2A 4LNUB 4DPKA 1ZUD1 3CNQS 3QU2A 4MO2A 4RS3A 5EE9A 3MTBA 1Y1LA 3BFXA 4AZSA 1MR3F 4JBIA 3OZVA 4Q3CA 1K7XB 4FNMA 1CU1A 1RHJA 1EA7A 1EJ2A 4CLOB 5C8VA 5AI5A 4QFBA 3IO3A 1XDSA 2BYTA 3DCNA 2HA2A