4E5XG

Crystal structure of a complex between the human adenovirus type 2 e3-19k protein and mhc class i molecule hla-a2/tax
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
KKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of adenovirus E3-19K bound to HLA-A2 reveals mechanism for immunomodulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/transcription
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 21
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3530 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4e5xG00
5IROD 4E5XG
chains in the Genus database with same CATH superfamily
4J3TA 3VSTA 3BVNB 2YOAA 1T03L 2DWEA 4P23C 5IJKC 2AABH 3ILPB 3MBED 2OM5A 3JWDH 3QUXB 1LO4H 1Q72L 1NAMA 4E42A 1MJUH 4EIZC 2JELH 1BAWA 4BFIB 1FZKA 4DGYL 2P44B 3M07A 1Q0XL 4K3EH 2DQEL 5CP3H 3TZVB 1BF2A 4YK4B 4WTWA 3VW3L 3PHOA 4H1LH 1JP5A 4WW1A 4HCRA 4G42A 4AEFA 3EHBB 1JE6A 4LL9A 1FCCA 4U1LB 1SZNA 3S36H 1NCOA 1TQCB 5CF3A 4Z8FH 1K2DA 2ZKWA 4MXQC 3FB8B 3PGDA 1JXGA 4IKNA 3QPQD 4HZLB 3TJHD 4X6CF 2WO4A 2NNFA 2X3AA 2NQ3A 3KWWB 4AVKA 2YKLH 1HL9A 2AKRB 2XQBH 4N2NA 4RA3A 4F2EA 3T3PF 3ZHFA 1YVLA 4UT9L 4YQXL 2W07B 2GK0B 3FO1B 3VXME 3C60D 4RGMC 3C8DA 3BVUA 2VLKD 2VDNB 5IBLC 4DN4L 5KTEH 1NOLA 3PP3K 3DXAA 1R6VA 3SDYL 1A9BB 3B2VH 4NKOA 2CSPA 4CVZA 1D5MB 1BEYL 1E4KC 4M00A 4X6DB 1J05B 5A1AA 3P9MB 5AW7B 4WI0A 3K6OA 3APMA 2ZUQC 1KJ3H 2QQLH 2GJZA 3MRMA 4Y4FB 4M4PA 5C0BE 4TQ8A 4GW4A 5EC2A 5EIVA 2BY3A 4LCIL 2GCYA 2KMWA 1CPUA 3DURB 3NACH 3OX8A 3R18A 1YRKA 4ODUB 4QLRA 4TLSA 4IYKA 1T66C 2CO3A 5IJVB 1EHLH 1B88A 1Z3RA 4KI5E 4KI5C 4XPHH 5I9QC 2ZOLA 1CFSB 5FWRA 2E9IA 1SDYA 3VI3A 3PHAA 3OJMB 1Q9OA 5HDRA 5SV3A 5I18L 4MX7A 4WHTB 2XRAH 2IPUK 4MMZB 3WNIA 3OKLB 1KIRA 4F7KA 2NY4C 3KGUA 1T2QH 3EGXA 1BEXA 5E08H 5E9AA 3D2UA 3FCBA 3KVDD 2CDEB 3B2MA 3CBJB 4XAKE 3MOAH 1CDGA 1EAQA 2O61A 2ZE0A 1E28B 3ROOB 3EGSB 1EXHA 1D6VH 5AVRB 4CDHA 1IQWH 3VFOA 1CE1H 1XTLA 3U30C 5DHMC 1CLZL 1D7BA 1MHPH 1X9RA 1BLNB 2V2WB 1GMEA 4C56D 5JQIB 4XN9A 1NC4D 2C26A 2DBJA 4F3FA 3GSXA 1ML0A 3T6VA 5F9JB 1JDDA 1AD9B 5ADOH 1A6UL 3U6RA 3P4NB 4I48B 4Z7WB 1HIML 3BPCA 3QUYB 1NGQL 4IMLA 2OL3L 3TCLA 5ICZB 4PV9A 2R29H 3B7SA 5F9WB 2QZ5A 3GMQB 4OCRH 1CXHA 1PSKH 2MQGA 3BUYA 3K2UL 5EF1A 3ARDC 5KSAD 5DRZA 3TBVB 3GLZA 3N06B 1BZOA 3FT3B 5AW9B 1E5BA 4JCWA 5I19H 1T04A 3MRBB 1PZCA 2GTWB 3P40A 1TPXC 3UJJL 2H0JA 1UASA 4HJTA 3HHSB 1DLFL 4QXUH 3IDIB 3IGAB 2JJVA 1HH9B 3PWNB 1TQBB 4N90E 1Z3GH 2Y7MA 1XF5A 1Q9LB 5T1LB 2CLZB 4AENA 4H1LB 5SWZA 3MBWA 1U3YA 4G8IA 1R3KA 4K3JL 2D0FA 4OAWA 4R97B 1WFOA 1KIQA 1XVSA 3GGWB 3U1SL 2X70A 3MNZB 2WVUA 3POCA 4Z0BH 5DS8B 1PY0A 2L8AA 4RAHA 3GI9L 4NRZA 5DJ8A 3VG9C 5IB5A 2GJPA 1C1EL 1I7TB 2DW5A 4O2CB 5CD3A 1KXQA 2J72A 5F7EL 3VH8G 3UO1H 3HMWL 4BFJA 4DVRH 4OD1L 3MLVH 2BY2A 1JYWA 1MFEL 1XZWA 1NBVH 3JT2A 2WNXA 4R4BA 5E0FA 3ZRFC 4MASA 2X4SA 2VDML 5CEZE 3GJFK 1OF2A 4MHHG 2KPNA 1A7NH 1NCBL 4X4XB 3IE4A 3LZOA 4WU5A 4FD0A 3GBMH 5E4OA 3S9DB 4OZHF 4HG4K 1II4E 2HJKB 4OLZL 1TVBA 4R97C 2Z9TA 2J44A 3CLFL 5E4IA 1JV5A 3L9BA 2OJ1A 1PCXA 1B9ZA 2GUYA 3RDJA 3OAUH 5HHQB 2NUTB 2YC1B 1YY8B 3VXRE 4LMQI 1LK3H 1CL7I 3FXIC 3IVKB 2CU9A 5DJXB 3DC0A 1HZHL 1V7ML 3P30L 3F6LA 4LQFL 1S7WB 4QUOA 3TYFB 4D3CH 2Y1ZA 3VM5A 5BVPL 5IEKA 2P46B 2N4IA 2GEEA 3LKPB 4MBRA 4U6YA 1DDHB 2H2PD 3NOIA 4ODXA 3RVVD 4LAQH 4WUKH 2YUWA 1JFHA 1R34A 3FUNA 3PAYA 3CIAA 4GAJH 4W93A 4OF8A 1FZMA 1VFMA 1DJYA 1NM9A 3H1ZA 2DBLL 5DHVB 1L9OA 1A4JB 3ETBJ 3VGAB 2ZQKA 3QARA 1CZ8H 3UIZA 3P9MA 4G6JH 5KVFE 3FO9A 1AQMA 3FQ2A 2GCYB 3M1OA 4JAMA 4ETQA 1HT6A 5DMIL 2E47A 1MRCH 5GJTL 1QFWH 3FTVA 3BIBX 5F96L 3DTXB 8CGTA 2F54D 3NSFA 5ABZA 4F20A 5GISL 3WLBA 4IIQB 3V4UH 1WUZA 4JFED 5F9OL 4YNYB 4YPJA 2DJMA 4FHJA 5JO5A 2DD8H 5F72S 2XWTB 3WHXA 4Y7MA 4Y4KB 4GG6F 4CA4A 4NDMA 3O8XD 4JFFD 2QADB 3Q0HA 3RHWK 2XWXA 5HHMD 2JFCA 5BOZG 3ILEA 1SJEA 3G5XB 1EHNA 3TBSB 2W94A 3C9NB 2AV1A 4NQDD 1AE6L 1MELA 1XGZA 5CBEA 2EXSA 4JFHE 5K9QI 5FYKU 2X9YA 3L1FA 4KY2A 4N4YB 2J6EL 4JDTH 4K7PY 3DIFB 4PJDB 5B4MD 1A2YA 4JHWL 3RILA 4LSRL 4ZX4A 4PJEE 4G80A 4IGBB 4LPCA 1CI5A 1AD0B 2MNUA 1XF4A 4F58H 2FWSA 4ONFL 2XA8H 5MP6L 3BIKB 2AJ3A 3Q2NA 4WW2B 3VXUE 2NNAB 3X3GH 3DVGB 1T1XA 5SWSD 1ETJA 4X50A 1C8PA 4YSPA 2D3VA 3MRBA 5J11C 1GZHC 4KZ0A 2YD8A 4W6XB 2BSEA 2XQYA 2Y22A 3OJ2C 4B95C 5GZNC 4OLZH 1ASPA 1KCSL 4MXVE 2GUOB 2VO5A 2KPWA 3CZEA 4ZD3H 4P4RB 3B5HA 5EOQL 2RACA 3EJUA 2CUIA 3FU5A 4CUCA 5IHBA 3T6XA 5EZLB 4EOWH 3SQBB 5GZOD 5TGBB 1T7VA 4WY7H 4BGLA 1UKTA 2XZAL 5CP7A 5E8OA 3BP7B 3HJ0A 5HPOA 5DS8A 4NRZB 1AG0A 3PWUA 1OP9A 3SGDH 3T4YB 4X8JB 4GKZB 4BUQA 1WBXB 2GYSA 2PTUA 2VQ4A 3FQWA 4XE0A 3RGVA 1U8CB 3RZWA 3US1A 2ED7A 3A23A 1T1YB 3TO2B 4AL8H 2VGLM 4XMKL 1CDHA 5J12C 1L9MA 1N6UA 2RIKA 1ZEAL 4RFOH 1OQXA 4KNUA 4K5NA 4XBEL 5FYJE 2ZKXA 5E4AA 2HH0L 5E94A 3MV9D 3Q8BA 2XN9B 2WWKO 2AF2A 5A2IH 3FNKA 3WKYA 4M8UA 3LEYH 1S3RA 1I1YB 1XH3B 2GBUA 5IOKA 1G84A 1NCCH 1NIEA 4X5WA 2BM3A 1HSBA 2A6IA 4KPHH 1YEGL 5HDBE 1IGML 4JFEE 1CGXA 3TEUA 4WU7B 1OCCB 1MFMA 1DQML 2YMXH 3VWKC 1JZEA 1GYVA 1HEJC 2H3NB 3KDMA 3PFQA 1K2DB 3EO1B 1HHHA 4ZUUB 4OCRL 5AL8A 2QPFA 1MCIA 1UT1A 5SV4A 3EHBC 5IVXE 1A21A 2QT6A 2Y7NA 4JO3L 3T0ED 5DVNA 1A6UH 5AOLA 4A2EA 1Z9SB 4KBPA 1KG0A 5DWUL 3KLLA 3GHBL 4OVUA 2IQAA 3GDCA 3HE6A 4B5ZA 3QXTA 4PI2A 2AS5M 1A7PH 2I69A 4MNQE 4PWIA 3WAJA 3FB7A 3ULVC 4P3DA 1YC8A 4H0HB 3QQ4B 1CI3M 1NGWA 1OKEA 2FTAA 2DL9A 4K71C 3UBHA 4ERSH 3CHQA 4X98A 2PYEE 5TPWH 1ZT1B 1VZIA 1JZGA 2Z91B 3SDAB 3OKDB 2VM3A 3LPPA 4PRID 4EQ3A 4UTAH 5C08D 2PPEA 3VFWA 4LOUD 4BWWA 3AM8A 4GMSH 3KVQA 5H2BA 5HY9A 5ETUB 2RGSA 4M3HA 1M7UA 3D52A 4NFCA 1W0WB 3O3UN 1NGPH 5JW5B 1U9KA 2D31A 4LDOB 2W88A 2QVMA 5FLVA 2MTPA 1QLEB 1JNNH 3D39E 4KZCA 1ET7A 1Z5HA 2XWTA 4XVJL 3ZU8A 5DR5H 2ZXWB 1AJ7H 1BF8A 2P80A 3OKLA 1DBJH 2V5TA 3IJYA 3TEXA 4P3CH 2YO3A 4ADJA 1MVFA 4D9LH 3MRNB 4TSAH 5GZOC 4BSWB 4JO4L 2ZG2A 4CBZA 4P2RB 2R1WB 1JTOA 1W0VA 3GMMB 2DJSA 5C0JB 4GQPH 3ATBA 4W4OA 5CIPB 3SGDI 4FL4C 4U1JB 5KEZA 1AIFA 5GGQH 1BD2A 1E9OA 4R3SB 1Z0NA 3QJZA 1KCVL 3N2JA 4Z5RB 2L7EA 2D03L 3L17A 2ILLA 4OZFH 3TFKC 2BNQD 2FYYA 4PRBA 4NBZB 5HI4C 4HLZG 3BP5B 5JQHC 3TA3A 3HS0C 3QXAA 4ODVH 3D0AA 1A7QL 3EH3B 3HI5H 3ZZSA 4A2GA 3DV4B 4TUOA 3K8MA 5JZ7D 1KT2B 4XC1L 1OSPH 2BSRA 1J0ZA 4N2LA 1HKLL 3WL9B 4RBPK 1X9QA 3UDWC 4M29A 1YJDL 2AAVA 4ELKB 4HAGA 2PP9A 4NRYB 3IDMA 2QSTA 5IQNA 5IREA 3RE0A 4H20H 2UUDH 4YH6A 4AYFA 4ODHL 5BOJA 4ZPTA 4L9LC 5I1EL 2PW2A 1MVUA 1UB5B 3VXRD 4JFQA 3FFCB 1UQSB 3ZKMC 2CD0A 4DESA 1TF4A 4XNYL 2C3VA 1IQDA 5CGBA 2AXGA 2F7RA 2DQUL 2AEWA 1K8IB 5L8JB 5MENE 4H8PA 2WB7A 4IBUA 4HSAC 3O8XC 3N0PB 4KKCD 1BYNA 5C6TL 1AH1A 1UCBH 2ZAHA 2K6WA 5BZWA 1QKZL 3GTTA 5IB5B 1FVDA 4KK6D 1YUHA 3QNYA 1QWNA 4MCMA 4WIQA 3GZOA 4F92B 2NY5C 2OMBA 4KRLB 5C86A 5IUCA 1U8MA 4G5AA 3GHEL 1MFDL 2OW6A 3EZ8A 1MIML 1ZCRA 3HIZA 3UZQA 4GIPD 4NBYB 1UB6A 4U1MB 4HOZA 4XPBH 1EXUA 4YHKL 1AQHA 1BAFL 4K9EL 5DC2A 2HFGL 3DOSA 3JVGA 1SN5A 2NY6D 3GLAA 3FRPG 2HRPL 4I18C 1X4YA 3Q8AA 1J12A 2XPYA 2Q7YA 2WVTA 3ZMNA 1OF0A 1CGSL 1SDAB 1G87A 3R4RA 5FGBC 3AAZB 2GPZA 4LBAA 1LO0L 3B9KB 3NJNA 4OV5A 1E4WH 2FJHB 3IDJB 5DEGB 3NPZB 1ZTXH 3QWRA 2XG5A 3MLWL 4KMTH 2ZX9A 1P7QA 4JRXD 4DZ8A 2Q2EB 5LXVA 4QOKA 2E6JA 4IEFB 1E5AA 2GJRA 2VAAA 4ZX3A 2BWDA 2QV2A 3N40P 3TGXA 1MJ7L 4XBGA 2EXYC 4EXPX 4BFNA 4TVPL 4JZJB 5D7LA 3IRPX 4FQ2L 2WCSA 3FCSB 4OUOA 2QBWA 3V5KB 5T3ZD 3FB5B 1X4XA 5BO0D 5B1KA 2WUBL 2WLHA 1AP2B 3X12A 4QRSA 4XPBL 4YHKH 5E51A 3V4VA 2G3MA 2X4RA 1FZJB 3DX7A 4XCYA 5CHNA 3UBXG 4IK6A 3FB7B 1S8DB 5EEVA 3CK0L 1NGYB 1WAAE 2LAGB 3HN5A 3STBA 4F37K 2RFXA 5MEPA 3F00A 4S2SA 3ARGD 4XPGH 2ZXGA 3H8NA 3HG0A 1P5UA 1QFWM 2NCEA 4EN2A 4ZMPA 4MS8D 5HYSA 1PZBA 3NGBC 1UCBL 4CNIB 5KS9A 2HFFB 1M71A 4PBWD 4XCEA 5CBAB 4OIIL 4K5PA 5H37H 4OZGA 1IBBA 1GZPA 4AQ1A 4P0DA 4LPYA 2CPCA 3SE8H 5ETUA 1YQ2A 5C0RH 3MV8E 1IGCL 1W0WA 1FL5B 1N26A 1QSZA 4OFIA 2EZ0C 2RAMA 4BA0A 5I30L 4XN5A 5C0CA 5HGAB 3VD7A 4N28A 4ODHH 5LBSH 5EORH 3V7AG 2YUXA 2O30A 2QSCH 1YLBB 3R0MA 4GG8A 4ZJ9A 4JFDB 4KTEH 5TQ2L 2BFVL 1OAYH 4XNAA 4BFRA 5HYQA 1ACYH 3MRNA 1H6UA 1KYFA 2M1KA 3ZTJG 1ET5A 1MJ8L 2WKOA 3FUKA 4UM8A 4XC1H 3B6SA 4DEUA 4J3WA 4NT6B 5DHEA 3TF7C 1QW9A 1J9QA 1QHOA 1OTTC 3W39A 5I6MA 1YG9A 1IKOP 2IAMC 4NO0A 4BZYA 2E76C 2DLEA 1J8HD 4PJGA 4PCKA 3VRLE 2XJLA 1JI2A 1PLBA 1L0XA 4HUWB 4KZDL 1ZGLP 5D2LB 3T8XA 3GK8L 3MRPA 3CXHK 1QYGL 2NNXA 4M7LH 4TTGA 4LSUL 2R2HB 1E7UA 2CR0A 2R0WH 2AHIA 2ZP0T 1VA9A 2H1PL 1KT2A 1QUNB 2H26B 3NCYS 2G3XA 3FB6B 1BVKA 1A6PA 4QRPB 5H8DA 2VDOL 4GSRA 2IAMD 3TIDA 2VR6A 1KB5H 4KXDA 4U2YA 2RD0A 1IBGL 5EBMA 2Z4QA 4UT6L 3T77B 1OSZA 2FZ3A 5CFHA 1LEIB 4UQBA 4CC0A 2L04A 2VQ1A 1CJYA 2B9BA 4YSUA 4B9PA 2BC4A 2Y3AA 4FXKA 4Q58C 1RVFL 3BAIA 4MHHI 5IQMA 3PL6B 2X3CA 4C4UA 4W9HC 1N12A 1SN2A 2ZWKA 3SDCB 1MCKA 1B0GB 1YYCA 3B9KD 2J7LA 1KNOB 5FLUA 1TETH 2VE6B 4OZFG 2PW1A 4OIBA 1MY7A 3SN6N 2V2TA 4GG6B 1LNUB 4OGQC 3LHPL 1GTFA 4RDQF 5AZ2L 3ULUC 3QZBA 1QA9B 4LEBA 1T0MA 1UWXH 1NPJA 3QUMH 4AYMC 4OF6A 4G6AC 3D39B 1T5WB 4FQJL 1P53A 4OJYA 1DQKA 2EADA 1ZWIA 3TL5A 4LOVA 4U3SA 5EN2B 4JG1L 1WA1X 2NZ9C 1M9WA 2R56L 5JXEA 5SWZD 4P46B 4QF1B 4WI6A 2WQSA 1NAKL 1AGEB 2R2BB 3QIBA 3QUKA 2V7NA 1QZNA 4DP2X 5HBBA 4BFIA 4MAZA 2CBTA 4K3DH 2FB4H 1KYAA 3H3BC 3N41F 3O6FD 1SHSA 3RDTB 1T0OA 3M6DA 4BH7B 2X9WA 1IEAA 2X42A 1S7UB 3K80A 5I74B 2ETWA 3H7BB 5I8EA 4G42B 4KKNA 1ES0A 2YWZA 3MCKB 2FX9H 3D18A 2ZZUT 4YHPA 1AAJA 4GW4B 5HHPB 5DFAA 4TLUA 1T80A 3MYJB 4YOKA 5J1SC 1WZMA 1A4KB 1YC7A 4ZTPH 1U8LA 5AYQA 2R0ZH 3KPSE 2I32A 3AC0A 3ARFA 3GMNA 4Y19D 3AY4A 3ZTDC 4XBEH 4YSAA 5IMOB 1RIUL 1WBZA 3IGUA 1ZKAA 1OAUH 4P5MB 2VDNL 4P46C 5E70A 5EIQA 2Y0SA 1KXQE 1HXMA 1T2JA 1BMGA 1XB6A 1YAIA 2VUKA 4G1MA 1I3GH 5FHAH 2YQGA 4JDVA 2F58H 2J8UE 1KIRB 4S2SB 5DI8A 1RUPL 1A6VL 1P5UB 1FI8C 1H3WM 3O0RH 2Y3NA 3ROLA 4BWUA 1YMHB 1UM6H 2IDCA 5JOEA 3A67L 3GMLA 1OGSA 1EAOA 2FGZA 5C0AA 2GTQA 3O9WB 2DICA 1GOGA 4FFYL 1J1OL 5D1ZB 4AV5A 4EOWL 2V33A 1WSST 5FKAA 1A6ZA 1JGDA 1M2VA 3GS0A 5CU5A 1MPAH 1PAZA 3VI3B 2G2RA 5D1QC 3D85D 4N9GA 3SY6A 2YPVH 2A83B 3JWOH 4KV5E 4R90L 4ZDHA 4B27A 1VSCA 4CVXA 1OW0A 1IBYA 1XDTT 2LLLA 2JKIS 3VH8B 1ADWA 2AVFA 2OTWA 1BX2A 3SDAD 3DRTA 3WIHA 4ZMZA 1G6VK 1KBPA 3IMTA 1ZS2A 1PMYA 2VLKE 5EBLB 3IMSA 5IHZB 3P4MA 5JHDE 2DQCH 1P5UC 3G04B 3TT1H 4ZFZB 1HNYA 4YLQT 3VFOB 3HG4A 3WGUB 1MDAA 4KNSA 2VSCA 3LH9A 3EF4A 1E9PB 1FL6A 3NH7L 1NDTA 3D48R 2M8XA 4F3FB 1TZHA 4FJZA 2Q10A 4ZFOA 2Q5BA 2XZZA 3QPXH 2C1PA 4LFHD 4TNVK 5E9NA 5BMFH 3K1DA 1HEHC 4FABH 5B8CB 2FO8A 4OB5L 3QXAB 4LKCA 2BZ7A 3RWHB 3VI4A 1ZANL 3IDNA 2ISDA 1XL6A 1QUNA 1WD8A 3H4FA 3O4LE 1XGQA 2Y6TE 1ZV2A 4PCYA 4BQCA 3VFGL 5CU9A 3QEHB 1G9NC 4JMXA 5EMYA 4CN4A 3FSZA 4XNMA 1NCTA 2V6HA 4I2XE 3U4EA 4O2FA 3QIWC 5IB4B 2NMSA 2CK0L 3A6BH 3HHSA 1FQ9C 2A0LC 4ZPTB 3VMNA 2GFBB 5KOMC 2D7TL 4WRLA 4LGRB 1YPZA 1EEUA 2WOYA 1Q9LA 3AUWB 3ESPA 1I4FB 1X5XA 2GJ6E 4HIXL 4GUOA 2XPGA 4P5RA 2GIXA 1J1OH 1F11A 1GY1A 4GXUN 1ETZB 5D1QB 1PD6A 2OXGA 3VRIB 1JZ2A 4AEHH 4GAFB 5IW6A 1PZAA 2BOBA 4XGZB 3HVDA 4NM4L 1A65A 1CZ8L 1RUPH 2PTTB 3HLAA 1RZ8B 1T5WA 3KG5A 5D5MB 4QKTA 2G5RA 4UINL 1BZQK 4LFHG 3N1GC 2J5LC 3BMWA 5C9JB 1W72L 3LB6D 2EC9U 3OKOB 2BVOB 4OQTL 2IBZY 2BERA 3AXLB 3C60B 4IMKA 5EU3B 3RBGA 2DWSA 1TJGH 3RX9A 3WNKA 3OHXB 1ZLDA 3QXUA 1S7VA 4F2MA 2V7NB 3V7MA 5KG9A 1WBYA 4JB9H 2WLIA 4MB1A 2IAAC 1V27A 3ETSA 1PU0A 1MIEL 5JIDA 5T33L 2TAAA 4GRWB 4LOFA 1DFBL 1G5GA 4TQIA 2OMVB 3UO8B 4XXWC 5A2CA 4Q4EA 4V1DE 2ZP9A 1SBSL 3P2DA 1DP0A 2JI3A 5F93C 4S10A 3ARDB 4O2EB 1UACH 3QPQC 5EFIA 1E65A 4X8CA 1CDYA 3TBWA 4AIXA 3QQDA 4M7JH 5IFAL 1YQVL 4YHML 2J1WA 4NHCL 1AP2A 1CGWA 4EZLA 4FYRA 2RMNA 1PX8A 3HZVB 2LFGA 5CEXB 3INUH 3BDBA 4WFGE 1BA9A 2EYSB 1NBVL 1F3DH 3FMGH 2BSTA 2EDNA 4HX1A 3O11B 5F7EH 2Z1KA 5A40E 2DQMA 4J7RA 1HJCA 4N0YL 4PLJD 3ZHNA 5J56B 2NNRA 3S3JA 4FLOA 4IOIB 1MH5B 1MI5B 3RJQB 4WJ5A 2DQHH 1M1XB 4DP5X 4HGKC 1JMXA 2E7HA 3WG7B 2MTAA 2GTZA 3Q6GH 3ESMA 3UTTD 1HI6B 2OXHB 2JF1A 4MSWB 3M7FB 4AGMA 4ODUA 1HS6A 4K3JH 4PRPB 4WK0B 1D9KA 2A77H 4PUBH 4GW5A 3SYAA 1HINH 5L2KB 1QI3A 4NO3A 2VLJA 4MKMA 2PP8A 4TNFA 1I82A 4H88L 4W81A 5HHMB 3HAEB 1UD5A 3VFMB 3U2SB 1KN4H 3WXVH 4E9VA 1GXEA 1UTDA 2RCSL 3QCTL 3SKJH 1HQRA 1MXGA 3QJSB 4UT6H 4R7XA 1XH0A 1SLWA 2WIIA 5FYKH 2GC7C 1IC0A 2W38A 1EVTC 1T4KA 3V4PA 3VH8A 5I15H 3FK3A 5JHDD 1A3LL 1F4YL 2J88L 2GC4C 1GJUA 2AV1B 1IAMA 1MRFH 5HVHB 3B6SB 1RIHL 4UOJA 3NCMA 4ABUA 2V8LA 1PZ5B 1JUFB 3DUUA 4IJ3C 4J3VA 5AAMA 5HD8D 3VXSB 4MCYA 5KYUA 3LRGA 4PCSA 1MCRA 4GIOA 4CN6A 4FKEA 5I8CA 5JPMA 4NIKB 5TK2A 3S4SB 1RFDL 3A6OA 1FYHB 1QYGH 2YPKB 3BUTA 1MHPL 4C4KT 3MO1B 3L95B 4J27A 2Y7LA 1LE5B 1AD9A 1TFPA 4OZIB 3ZHKA 4HFWB 2GI7A 3BKYL 3PU7A 3O81A 1RUQH 4NZRL 2LE9A 3WJMA 3FFCE 4PRAA 5CSZB 1QSFD 2DN7A 2DJUA 3CFEA 5E1IA 5BRQA 5C8JB 1T04B 3ARBC 3SGEH 1DQJA 2O6EA 5GRUH 5PCYA 3CFBB 3MRKB 1A4BA 2A4CA 5KWYC 4XMPH 2AVGA 1JZ8A 3GJFB 3RUGE 3G6DL 5EORL 1OP3H 2GSMB 2GW5A 1R3IH 4YUEH 5BPPA 1ZGLM 4H1LA 1EHLL 1E7VA 2I9LA 3VI4F 1V10A 1B0GA 2YQ2A 4ANWA 1MFBL 1JS4A 2GB2A 1T5XB 2VN4A 1I7RB 1LMIA 2X7LA 3GXFA 4X8JA 2X4NB 1BEYH 5IW1B 1SGKA 4AIZA 2HJLA 1ZLEA 2ZPKH 1T22A 5KYYB 3EO1A 5KANG 1UG9A 2EIKB 4M5TA 4XPGL 4H13C 5T3XD 4D9RD 1JRHH 1U92A 1GYCA 5GGVL 3IRCA 3RAJL 3CK0H 4M5ZL 4LCCC 3ZHLA 1AXTH 3MA9L 3UYOD 5IF0B 5DK2A 5DD5H 1XGPB 4TVPH 3L3IA 1ZV9A 2IOOA 3QQNA 2ATAA 3LZFH 3WFCL 4GI9A 5HI5D 5J9PB 1IC5L 1UOLA 4IOFC 5F7BA 1CFVH 1F90H 4HA1A 1JPSH 4PH8A 4P5SA 5SX5H 5I8OL 2B59A 4X9GA 4KDVA 1KJ2B 1N59A 4WKZA 2FJGA 5INDB 4XMXA 4OZGE 4GSXA 3FCTB 4R9HA 4WTZA 1KTDB 5C08B 5HHPA 1A6AA 1TLMA 1AG6A 5DGRA 4HXAL 3RWCA 1OP5K 4KKPA 4DOHE 4NSKB 2OMZB 1X7TA 3QJQB 1CICC 4WI2A 3UTTA 2CKBA 2PCPB 4NO5B 5ALBH 2I9TA 4JEGB 1JXDA 4ALAL 2EEBA 5MENA 4BJLA 4KQ0A 3WFCH 4M61A 4YZFE 2IADA 4LIQL 1XGYH 2B1HH 5E6IC 3HE6B 5F6IC 4QRQA 1T89C 1S6NA 4HCRL 3B34A 1EAJA 2GITB 5ICXB 4FOMA 2WIMA 3PNWB 5DD5L 3RFZB 1JBJA 4NCC1 1FZMB 3RTQC 2F9BT 3QQ4A 3CZUB 4PJFE 3HUJB 2G0LA 1MIMH 3FUMA 5E6ZA 4WJ5B 2VZUA 3QQ9C 4UMGA 4EBQL 1QWUA 5FYKD 2ERJB 3ROLB 3QXWA 4M5YH 3EDFA 2OXHA 3FBQA 5FW6A 3RZCB 1OLLA 2VXQH 3UYPB 3GSVB 5DZJA 5AW0B 5A2KH 2WAQA 2VDLL 5E1AB 2HLAA 3I74A 3MV7D 1MNNA 1BQLL 1S7QB 3ARQA 1QAWA 4HS3B 4N9GB 1M7DB 3Q2LA 1NUDA 3LRSB 4I5BB 3EUDA 2N7SA 3ASOB 4DKEH 4DSYA 1ZT4B 1XAKA 4XC3L 3S7GA 5I1CH 4LEEA 3LH2H 4AEIH 5J6HB 2IFFH 3T3ME 5IQ9B 3U0PA 3ZL4H 5E8NB 2E9WA 2YPLA 5FAAA 4ICXA 2VQTA 2OZ4A 4FQQB 4X83A 3LZPA 3MRRA 4PJGF 5ICYA 5I8CB 4HHGA 2E86A 3T1WA 4HK0B 3NZHL 1UXSA 1A1NA 3K2MC 4LVOB 2AK4B 3EYOB 4OZHA 3OKEA 4HP5A 3O2WL 5EUKB 3SJVD 2VSMB 5D6DC 2IDTA 2PPAA 3F58H 5LGHH 1N64H 4RZCA 3WE6A 5IVXB 3QFDB 4ZMYA 3LAFA 2EDOA 4I1NB 3BT0A 4WW2F 1MAMH 4PJXB 4EDWH 1ODUA 1FVDB 4TSAL 5B3JE 3QNYB 3CZGA 1I8AA 5I1IH 2BOLA 4Y4HB 4QRRB 2CLRA 3BGMA 5IB4A 2XG4B 4XVJH 2J88H 2YEZB 4WWKD 1AC6A 3TZVD 1DDTA 1QX1A 3HRZB 3OM3B 2EINB 1VEMA 1XGTA 5C97A 1QR1B 1UQSA 3LPFA 4XP6H 4GRLC 5K93A 5E9DB 4MA7L 2A9DA 3WMSA 4R5VA 1X9UA 3HC3H 2W9LA 3HZ3A 1AGCB 3IYLW 3NA9L 4JZNA 4DKDC 1WHPA 2RJMA 1MHHA 3BO8B 4JHUA 4UUJA 3L3JB 1SLXA 5DS2A 2J5WA 1A1MB 2BFGA 3W0WA 1KGXA 3BJ91 4Z7UF 4UTAL 1IGYA 4K8RC 2P7TB 1UVQA 3EO0B 4PJ5D 4BGDA 1RQ5A 3HLAB 3KW8A 3FQWB 3MCLL 3NYKA 4LSVH 1KPUA 1ZJBA 4AIZB 2YJLA 2WC7A 3HE7C 3ZVVA 4NWTH 3HOGA 3WBDA 1B0WA 4NN7B 5F1NA 5A6MA 1J5OL 3RL2A 2IDQA 3GI8L 3SJVE 1ZVSA 3QDHA 4PVLA 3UGEA 3CDGB 4HV8B 1F3RB 1AVAA 4I3RL 3IEAA 3OXSA 3MRQA 5IFJA 1QQDA 4QRTA 1XH3A 1TJIH 3P0YH 1X5KA 2KERA 1UACL 4KKZA 3GPSA 3JWDC 1CWVA 1SJMA 2OMVA 2E3VA 3CFCL 5FFGA 1VCAA 5C0AE 3T8VA 1MHCB 1ZHBB 5ANMA 1FNGA 3WJLA 4H8QA 4B9KC 3L4TA 1U8QB 1HHJB 2VN7A 3LEYL 1J5IA 1JDAA 1FIEA 4TOYL 4M8VA 3CSYA 5AAPA 5BRZE 4BFBD 4YAQA 3SGKA 2B3IA 3QQDB 3QYNA 32C2B 4KO9A 2ZXEB 2WKGA 4I77H 3EYQD 3V4VB 3D8MA 4C4KO 4LEXL 4TMPA 3MRFB 2OSWA 5GHWL 5L4FA 2JNZA 4AL8L 3AB0B 3EUUA 4QD2E 3ZYZA 3FTGA 4V1DB 2J1XA 2DRUA 3CU7A 1ACXA 1TTFA 3GSQA 2OL3A 4FMVA 4HJIA 4JRFA 5F7AA 3BSZL 2IH1A 2RFXB 3ULUE 4KUZL 5FO9B 2YARA 4Z7QE 1KCUH 5IV2A 4AY0A 3QDJE 1A9VA 2Q0ZX 1A3RL 3V6ZB 3CSPA 3OKDA 1S9XA 2W0LA 4MJIA 4P2YA 3BH4A 3W39B 5D4HA 2Q3XA 3EJRA 4R83A 4Z7VA 1LQSR 4OV6F 5F3HB 2NY4B 4FG4A 1KGCD 1NCAL 4XRCB 5GSRA 1BSIA 1AANA 2FL5A 4FLSA 3LN4B 3U0WL 3EYFA 4K7FB 4MNGB 4HUKB 2VUOA 1QSVA 2DLFL 1P5VA 3BPCB 4IMLB 3TCLB 1E40A 1I9IH 4J3XA 4F8LA 1RI8A 3E1ZA 2WIIB 1AC0A 3I3BA 3WYRA 4QHKJ 3GMQA 3IJYB 4Z7NF 5L9DH 1ZT4A 1KBGH 1BVKB 5DFWH 5KBLA 2PR4H 3PDGA 1JD7A 2ZNXA 4XMZA 2VDMB 4HAFA 3SDDB 3B5GA 4F9PA 5D4IA 1IFGA 1ADQH 3EXLA 2J4WH 3NPSB 4M56A 1XGUB 3ECBB 4QTHB 4AG4H 4EO5A 1JGLL 2FX8H 1J0IA 1UA7A 2O72A 3GSNL 4KVPA 4NO0B 2R51A 3RA7L 3SGJC 4KK8D 5KYUB 4MJ2A 1HH9A 2AJSL 3PWNA 1U3NA 4YDIL 1S5HB 2WKLA 1HDMA 2ENYA 5FIEA 1T89A 4X80L 5SWZB 2AK4A 3EYOA 3NG5A 4UQ2A 5KVMC 2E7CA 3OF6A 4ZUVB 2JKWA 2WSKA 3Q13A 2BS9A 1KIQB 4HFWA 3NH7H 1NBYA 1DBAL 2PYEB 3ISWA 5BCAA 4J4PC 5JZ7C 3U79A 1JGEA 3V6OE 5EF2A 1WZLA 4Y1SA 1X7QA 4X6BB 2FJSA 3QJVB 3B2UC 4MJJA 1ZVYA 1U95A 43C9A 4EJ1C 3C8HA 4GJTB 1CL7L 3VX1A 4BQ6A 5EU5A 3JBG7 1KGCE 2PPCA 3B56A 1NCGA 2ZUVA 3I6KB 1DJIA 1XHHA 4KXZH 3WI9A 3EOYG 2X2IA 2YZ1A 1ZS8B 1CT8B 5AOMA 5C0EB 1N6QL 4JFEA 4R90H 5E2JA 5DJ6A 3HEIB 4QY8B 3DYPA 4LRIA 3VSQA 2OMTA 3QZWA 3MJ7B 4GRWF 5DJ0B 2XVKA 3VFUA 1MPAL 3FTSA 4N5ED 4MJID 1UWGL 1KACB 1FFNB 3ABZA 1XAUA 4WFHD 4WO4D 5F2FA 2MJWA 4H26A 3X3FH 2MPVA 2BW4A 1HH6A 2IAMB 2PUQT 3EGDB 4HJEA 4GLRI 4RH4A 3L1EA 3MX0A 2FIRT 1YY9C 3KYKH 1A6VH 2VN3A 3CH8A 3ARBB 3OB0H 2X0VA 1DBAH 4L1DA 4PJ9D 3WEAA 1DN0B 5EF0A 2P49B 3KYKL 1KPVB 3U36B 1SOKA 4B7LA 3ARFB 3K6IA 2X9ZA 3LCYA 5BVPH 3TEWA 1GOFA 1HZHH 5DC0A 4MS8C 3PGFL 2YAEA 3DX4A 4CC1A 5L6YL 3CCHB 4EUPB 4RMSA 4OV5B 4G6KH 5DK3A 4BYHA 4CAGA 2B59B 5E2VL 1ADQL 4DP0X 1S4IA 4EN3C 1ZHBA 4UV7H 5ANMB 3UZVB 5AVUB 2E7BA 2FD6L 3IJHB 4UM9D 3VXMA 3UACA 2A6DB 1QRNE 2OMXA 5F89B 4BWTA 2KZ1B 5DC9B 3KCPB 2D4FA 5BV7B 1BZ7B 3CLFH 1BBJA 3ILDA 1CL7H 4PTUA 4YDLB 2VL5B 4P07A 2LTQC 2XOTA 4X7FC 3TJHC 1RZFL 4F27A 1UWXK 1OCOB 2ORBH 4C56A 2F54E 1EK3A 4NQED 4HFUL 3WUWA 2G75B 5DRXB 1MFEH 1G7LA 4J6IA 1FDLH 4ENZA 2P8LB 1MCLA 3HMWH 4TNWF 3WDIA 4M1DH 2PR9A 3UTTE 1AGDB 1JHLL 1KJ2H 3FPYA 4X7SH 4HETA 3BESR 4GT7A 3R7RA 1WJ3A 1AXSA 1RZ7L 4JPIA 3MRMB 3UO1L 3ZSTA 1I8MB 3F7PC 1DVXA 2F1BA 2I26N 5IMLA 1CF1A 4LO9A 4F2ME 2AQQA 3QUZA 5CJBA 2XWBB 5EO9A 1CTOA 5F0MB 1LYQA 4Z7VB 5FUZH 5D2NE 3NCFB 3LDBB 5CXPA 3KR3L 2ZKHL 3OKKA 2DQGL 2XBDA 3SGEI 3D25A 4YK4C 2IPTL 2BXZA 4YPGA 4GRMA 2WBJA 3H9SB 2YS4A 5BZDB 4DEPC 1JF6A 4KZEH 3EDJA 1T7XA 1I9IL 1XB3A 3AG1B 3IBEA 4LLMB 1NEZA 4NNXB 4PI0A 5F21B 3RWEB 5KSUA 4JPQA 5LJYH 2R29A 3SZKC 4YVUA 3UJJH 5EBLA 1JXJA 1L4IA 3B1UA 3DI2B 3OMNB 1U8JA 4PU2A 1DN2A 1BZ9A 1KC5L 3TC9A 4F8PA 4XVUD 4GRWH 1L9NA 1U8OA 3V5HB 4DVBB 5FYKE 5AD0A 4LSUH 1IU1A 1KCUL 3L3OB 4N2IA 1MWAH 1HIMH 2AFNA 4XE5B 3MLSH 1A1NB 2I24N 4FEIA 5A3ID 4PN6A 1GW6A 3LDBC 4K07A 2IPKA 1FN4A 1G6RA 2JB5H 2OYPA 3IN0A 4PJCB 4UZGA 3MOAL 2OQJB 1MW1A 4O02B 3JV6B 35C8L 4Y89A 5DJZB 3FB6A 5EDXA 6CGTA 2EVFA 5ISZE 3OR7A 2FSEA 1N0LA 2J71A 3FH8A 5K9JL 2Y2TA 3QB7C 3NAAH 3B9DA 4BFGA 3OR6B 4FLRA 3WEXA 2EVHA 3BGMB 4PRNB 5FKPA 3VFPB 1Q1JH 1IIIA 3HB3B 2P9RA 1NCJA 5MERA 2NTFA 2Q9OA 2BCKA 2APXA 2H0FA 3HBQA 3NA9H 4GKNB 1XF5B 3ZT6A 2UY7B 1E8XA 2RA1A 3RNQA 4AENB 3MV7A 1KV3A 1OL0A 5I17B 3QZWB 3VXRB 5GRWA 4ABVA 1TJIL 5ESQB 4UUJB 4F37F 2E7LA 5HYFA 5GS1A 4E0RB 2F19H 2EDQA 3QJHB 1GYWA 2VABB 2V7HB 3BT2L 4J1UA 3JTTB 1BWWA 3WLWC 1ASQA 3QCUL 4PS3A 1ERNA 2Z8SA 4J6RH 4NI3A 4DGIL 2H6PB 2OAAA 1OTUD 1D7DA 2EDRA 3L4UA 1N64L 5FECA 5IUSA 2R1YA 3QDJD 1E3FA 1GAFH 3IF1A 1OEZW 4G82A 1WAAA 3AXLA 2HX9A 5EU3A 1H15A 3KLQA 1F86A 3O2WH 2ODHA 3TBWB 2X38A 5FM8A 2YD7A 1KG0B 1JZIA 3EG9A 1C5CL 5HYJB 2VJ0A 4YQXH 2J8OA 1GRWA 4F7EB 4QRUA 2ICWB 3WN5B 1OCWL 3NT0A 2X4OA 3QDME 4QPEA 4QO1A 4W9GC 4EE2A 4MQXC 1ED3B 1T6VN 1VACB 1YEDB 4N2EA 4U6HA 2Y1VA 1ZXQA 2FUQA 3ALXA 5EO1A 1BQSA 1IBFA 3AQXA 1DVFD 3WTXA 1ZPUA 3GRBA 3UERA 2JLPA 3WY3A 1ILUA 1G7QB 4HBCL 3RKPA 5F89A 4HJ1A 4DGYH 3QORB 4BD4A 4YSRA 1MJUL 1ZTXL 4KROB 5C0CD 3LMJH 3VFNB 1S7WA 1CGTA 3M1BB 3IJ9A 4WCYH 3WIIH 2AABL 5C3IA 3FN9A 2Q86A 3HS8A 3S37H 4XI5C 5D71H 4MZ2A 4N2GA 4HPOL 4G8FA 1BFOA 1R47A 1PKQE 5DEJA 1MY5A 4FQIH 4M5YL 3FOLB 3T3PE 3L6FA 2VDPB 4XB7A 2JIXD 4MZIA 3QR1A 3BKJL 2JXMB 5BZXA 4BIKA 1FAKT 3MI6A 1CXIA 4GNKB 2O6PA 3VRLF 2HLEB 4QMEA 3SPVA 2CIKB 4I8DA 5TDPA 1AOHA 2BH0A 1TTCA 1K6QL 4HCIA 2VKWA 4IRZH 2OP4L 4JUTA 4HIEA 4HU2A 4PJAF 4RRPM 2FJFA 2ARJB 3KGSA 4UNTA 4BFEA 3ZL4L 4L8CB 3MN8A 1YN7A 1UJ3B 4EI5B 4G11A 4LIQH 3C8KA 4L4VE 1A4CA 4LK4A 4WWOA 3PE9A 4OCYL 5GRVL 4WCYL 3EOTH 3HKZA 4LNVA 2QKIB 3TBYA 2LHAA 4KRMB 2DTMH 4ZDHB 1NMCB 3VD9A 2HCZX 3SE4A 3VVVA 1T0NB 5I2IA 3SPHA 4BBWA 2QLVB 1TNNA 2Y23A 1WDAA 4PG2C 3M88A 5FK9A 1QLRA 1D3CA 4XTRD 4YHYB 2C9PA 2VXQL 4MDIB 4QXWA 2FYVA 4H2CA 1G7HA 3FFDB 5EPMB 2X6BA 2K1MA 1OY3B 2LU5A 4HUXA 1EO5A 5FA3A 3JXAA 1JOIA 4FQIL 4TSCL 5C9KA 2XXFA 4JQVA 2J1YA 2P43B 1QOKA 1HC1A 4IIQC 4JRYA 1DUZB 2XUWA 3FYEB 1NBYB 3FKUS 3WO4B 4NQQA 4B3VA 1ESOA 4KJQC 4Q2ZB 5KBPA 4KQ4L 5D7SL 4HCRH 3E9UA 4R7DB 2PWHA 2X2HA 1AZCA 1EDQA 1K4DB 1Z0MA 2WYZA 4J6RL 4NS0A 2NNAA 3RX5A 2XZQL 1RZKH 2XKNA 2ICEC 2ZX6A 3AU1B 1TENA 4NPJA 3P54A 5JDSA 2F74A 1U8MB 3U4EB 4KDWA 1HCYA 1Z32X 3KXFD 4BELD 1CXLA 1W2KT 3ZTNH 4HBCH 3SDDD 4B9CA 2VZSA 4Z7NE 4O9HH 3WKNA 1UCTA 2N1TE 4PR5B 3S0PA 4A2MA 2CIIB 5HDQL 1NIAA 1BAGA 1HYSC 3CPLB 3NSJA 1LJMA 4LHJB 2FEEL 4GI8A 3VUAA 4ZOAA 1I3UA 2ZCHH 3H85A 4N3TA 2EECA 2WAHA 2FJHA 3IDJA 1JIBA 2DWTA 2XG5B 1R24B 3NEXA 4I18A 4KI1A 4KX8A 4JUSA 3NFPA 4OD2A 1S9WA 2HN7B 3NCCB 4OSUH 4KKRA 5DA4A 3O41A 2BSSA 2AGJH 5E6UB 1ZK9A 2JKSA 4KXZI 4X6DE 5DZAA 1PTZA 2X09A 3RVVC 4E9WA 3OKOA 2CKBH 4LF3A 2MMXA 4Y2DA 1BPVA 2DWDA 2DB8A 3QFJD 1QLEL 1QBAA 3MLSL 3FUDA 2UZPA 4MA3B 1L7TL 1SDDB 4ANVA 4JG0H 3L48A 3ARYA 1UUNA 2X4RB 1VACA 3DX7B 4UZUA 3ZBMA 4P2OD 3G5VA 5JPMC 2Q1EA 4F8QA 4AK2A 5F7DB 1S8DA 1I31A 5F7MC 3DXAB 1KJ2A 1AHKA 1W80A 1DLHB 4S0TD 1XSKA 5DFVD 4KTYA 5T1LD 3D3VA 3V0FA 1TR7A 2GJZB 3AREC 2YD6A 2Y7OA 1A3LH 4K3GA 4XOBA 2R23A 1IGMH 2ZP8A 3E38A 3UC2A 1JRHI 4HSCX 5I5JA 3TH4T 3U9WA 3QNZA 1YZZA 4L3EB 4KOCA 1JGIA 3ARXA 4AVJA 2QADC 5DQJB 3GHPA 1FL5A 3OWRA 2DM4A 4JL1A 4MRBA 5IB3A 4E9YA 4Z7WF 1OE3A 5EUOB 3MVSA 1KYDA 3TT3H 1ILSA 3WE1A 5DU7A 3UG5A 1TVDA 3Q8CA 2F5AL 4L4VB 4PJBB 2P8LA 3TCXA 4FJ6A 1GZQA 1FFOB 1OOAA 4CMMB 4HUUA 1MWAL 2MSPA 1RZ7H 5HJDA 1JV2B 2C9AA 3LHAA 3D6GA 3OLDA 4OLWL 1CFNA 5DHXB 4AMKL 4WF7A 1X5GA 2O61B 3KEHA 2DQ6A 3SPVB 4RFEA 5EV7A 1H3PH 3GSWA 3IFNL 4S1DD 3VFWB 3GSNA 3MRDA 2Z31B 5GRXG 4IGBC 5ITBH 1FFQA 1XF1A 3FULA 3LTVA 3MROB 3OAYH 1RZFH 3OKKB 1IC7H 1E8YA 3H0TA 5J1TC 1GIGH 4FXGA 3LXAA 5G4NA 3UAJC 4WWKC 3WEBA 1R3JA 5EOQH 5HHOD 5HGHB 5FF6B 1T83A 2NY5H 4BSVA 3VDBA 3C6LD 4M1GL 1KXTB 4R96A 2MHAA 1PIFA 4G6ML 5GQBA 2RTTA 3IE9A 4Y4HD 3MLXH 1I3VA 5AOJA 3B43A 4PJ8B 3TIDB 4AW4A 5IT2L 1P4BL 4JRXE 1TJXA 2XG4A 1KYOK 3MZTA 4GKLA 2D7MA 3UAFA 1BD2B 1A1OA 1E9OB 4QRRD 2B0SL 2WP3T 5DRNA 3G5YB 5DUPL 5DS1A 5JPMB 2OMYA 4QR7A 2ZIDA 3ZPDA 5DJAA 5G4OA 1B4JL 4JDZA 1CN4A 2Z4TA 5EC1A 2EH7H 4JN2A 3EF7A 4E2OA 3OXRB 1M56B 4JM4L 1WGVA 2X4TB 2HG5B 3M8OH 3UOAB 3WO3B 3HHMA 5IM7B 1KOAA 4R7DA 1WZAA 4ZPVA 4M6ML 3SYQA 3STLA 2HLFC 5DXWA 4G8EB 1E8ZA 2DMBA 4WGVB 1NIFA 1EJFA 2WINA 1ICTA 4YDKH 2WCGA 5IOPB 1UWGH 5CEZD 1XGRB 3VFRB 4U3SB 1FNHA 4LU5L 5DFTA 3F7QA 4GP8B 3D85A 3FQTB 1JK9A 3FBKA 4RQQB 5AENA 1BGXL 5LBGA 3H3KA 3MRHA 5GISH 1GC1C 5DQ9A 2WQ8A 3MRQB 5IFJB 2AXGB 1TEFA 3C6LB 1NSNL 5D1XD 4ZAKA 1ORQB 1TTBA 1MIEH 2AMGA 4PRIB 1D2OA 1OE2A 2H9GA 3CIQA 4JB9L 2BP8B 1JFQH 1IGYB 5AVQB 4JK0D 1J10A 4DT2A 2VDRL 4X6EA 3MBEB 3KYOB 1JVKA 1RULL 4HWEH 3OLGA 1S3KH 2ZAIA 1P7KB 4J8QA 4R26H 4YR6A 2Y5TA 3IFOB 3QR2A 4GPVA 3RZCD 4Z7QB 3CLEL 1ZANH 3QIUB 3R06B 3BVNA 4HCGA 4L1BA 4FQ1L 2LVEA 5CGYD 1ASOA 1T20A 4NO2A 2VSDA 4GAJL 4KH9A 1X5ZA 2K7PA 5AVXB 4RNRA 5CWSB 4AMWA 3FDWA 3KM1A 3MLPA 2Z92B 2IO5A 4N8VG 1BPLB 2VLLB 3ABMB 2WXPA 5DD0H 3LS4H 3II2A 2HVJA 2K8QA 5KN5B 1YECH 4WO4A 4DPCX 4AEHL 1L6XA 4PV8A 4ZX6A 3M46A 1U41A 1SXSA 2A9CA 3VU2A 2BNUA 4ZS7L 4BFOA 1KTLA 5JR1H 1JYNA 3RPIA 3VWJC 4JFFA 1DZ0A 2HUEA 2A5UA 3V6ZA 1KFAL 1JXFA 3KW7A 4Y9EA 3S48A 1E0OB 1GVIA 2OSLA 2JCCA 2ZWZA 1MXDA 3GKZA 3VFNA 1MNUH 1XO8A 2YPVL 5D7LB 2JB6B 2WK2A 4P5KA 2DQIL 4ABWA 3W5MA 1YHPA 1DANU 5KS9E 5JW4R 3MQIA 1IARB 4QRSB 5ELIA 4POUB 2BPBA 3MC0A 3OZKA 4F15C 1ZGLB 3LIZA 4WHYH 3KYMA 4FI7A 5FYLE 1R0AL 2IIJA 4R6UA 1OPOA 5HYEA 2ARJQ 3GDBA 3LIZL 3HUJA 5D9SB 4CMMA 1J05A 4JPKL 4DCQB 1ONQA 4YWGL 1BFSA 1G7JA 3GSOB 2D2OA 4L0YA 1H3TA 3GSWB 3BSZH 1IRAY 1C1EH 3PYCA 3Q9PA 4KQ3L 3QULA 2GT9A 1FHNA 4GUPA 4AQ1B 2VDRH 5DSCB 3TT1L 4POZC 4LEXH 4DPRA 1ECZA 1RZIA 2V3DA 1I8IB 3MROA 4F33A 1KBGL 1OAUL 1DSWA 1KBBA 1UD3A 4ZMTA 4NZJA 3A21A 1WO2A 4MX7B 3VE0A 2DYPA 1U6AL 1RLBA 1BGXH 1WK0A 2MOGA 3K72B 4ESKA 1D7CA 5AKRA 3ZRCC 3ABKB 5I1DB 3DVGA 3NFNB 4NC0B 2OR7A 2COQA 3V5DA 4APXB 5FOJA 2QJDA 5LN8A 1TKWB 2BNRB 3U2JA 2TRYA 4FC3E 3P0YL 1BFTA 1N18A 2VLKA 5ANME 3X2QB 1A3RH 4PJ7B 1NQBA 3D0LA 4L1LA 3ZQWA 1BLNA 2V2WA 1KXHA 3MUGB 4WO0A 5I6NA 5F9AC 4HUWA 5DMGC 1S7RB 3N55A 5JXED 2VLMD 2J73A 1HXYB 5JDJA 5A2FA 4J23A 2GSIA 3RY6C 3UMTA 3X1GA 1TTGA 5T3ZE 2DYRB 4HUVB 2BVYA 1GGBL 2A6JB 3MNVB 1PQZB 2HXAA 3NP3A 2Q6WB 4QLWA 2E8YA 1RIUH 2WXOA 1T1WA 3K91A 1WBXA 1ZV5A 2YPVA 2Y72A 1HE8A 4NI6A 4HIIB 1OZTG 4J3OC 3GEFA 4HXBL 3MODH 1XZ0A 4LLQA 2XTJE 1LEIA 1AQDB 2LABA 3X13A 3ZO9A 1EO8L 3T4AC 5A43C 2BVOA 4P8QA 1U4EA 4OJDH 5CJXA 1F2QA 3VVWA 4IU2B 4M1GH 5I18H 1U93A 2XWJA 1H9DA 3KNBA 2JMRA 3DSFL 1KLUB 3UAJD 4AH2A 4F2MB 4FG0A 1Z9OA 1YN6B 3MJ7A 2D7QA 2VXVL 5DJ0A 1UOWA 5L2KD 4HJ0C 2XWZA 2OW7A 2XYCA 2VXSH 1QSEE 1OALA 2E74C 4L5FE 4OF7A 3JQOB 5IQOA 2ED9A 1NC2A 1IC7L 5DEFB 3N44F 4G70B 5GJSH 5KW9L 1IBGH 4KUCF 1KELH 1KENH 2NY3B 3QDGB 5LUMA 2VDOH 3VG0H 1N68A 1KJ3L 2QQLL 3CG8A 1MI5D 4HQQL 4ZQKB 2BSSB 2J43A 3EJPA 4JG1H 3B2XA 2XDHA 4C57C 2NPLX 3LV3A 4GQRA 2EVIA 4DN4H 5AZUA 4U1NA 4V33A 1WWBX 1Q94A 1JYVA 4AUUA 4I3SH 1I1AC 4P46A 4QF1A 5TE6L 5EEYA 1N5YH 4ZX5A 2CO6A 3LS5L 4UT9H 4OLXH 3ZZQA 4M7KH 4QT5A 3TT3L 1DBML 4YFLF 3DX6A 1UWFA 2YKLL 3SE3C 3ZE0B 4AYDC 4QI3A 3RPKA 4ZYKB 3VB9A 3FZUD 1L9SA 4GRLA 3EFFB 3H7BA 3MJ8A 5B7EA 4HISA 2IFFL 1YMME 1MHCA 3ZMEA 1DUYA 2ZSVB 4UIMB 3NFSL 1T3FA 3SDAA 4DKEL 1BVLA 3ZIMA 2HT3C 3TPUA 1EQWA 2ZICA 3SO3B 2A9NL 4RWHA 5J57B 5I8KH 4L3EA 4L2LA 4LLWA 5ENWB 1J0KA 2H0EA 4U4IA 3RNKA 1TCRB 2E7LC 3LKPA 1SUHA 3TTSA 2MCMA 3HI1B 3BPOC 3JV5A 3IDYB 4N0UB 4WDIA 2AJUH 1RK0B 2H8PB 2KDGA 5HHVH 2J1KA 4W9LC 4ISVA 5E99H 1LVEA 4XX1G 1XF2B 4MNQD 4UTBH 1RMFL 1XR8A 3DSNB 3PV7A 5DD3L 3PABB 4GT0A 1C7TA 4P23A 4QHLB 2CKBL 5IJKA 4PY8I 4X0NA 1MCWW 5B1JA 1AHWA 3PPEA 3FT2B 3TVMD 2PCFB 1NGXA 3TONA 2ZKMX 4P9ML 3S35X 2GQHA 2C34A 5K1VA 5I1LA 3GSUA 3BAYA 4U1SB 2B1HL 3LZRA 5FA4A 4KTDL 4GAYA 5JHDA 4FXGB 4U6XA 5I0DA 3FN0L 1AQKL 4LIQE 5ALBL 1KEGL 2UZYA 4R0LC 1FA4A 3GIZH 4JHZA 4Y5YA 1MCSA 4UILH 5A2AA 2JWYA 5CJOL 4B60A 1MCNA 5AYTA 3IGFA 4RFNC 1KWKA 2G4EA 1INQA 2CH8A 2YSSB 1A3QA 1EDYA 3ES6B 1E9QB 1Y18A 4PJ8A 3W9EB 1QP1A 2V37A 5EO0B 1MFVA 4APXA 3WNMA 5C8JA 3Q3GB 4IRSA 1U8HB 2EXWC 3LH8A 3LN9A 4HOWA 5EB9A 2KQNA 1CGSH 2W92A 1MI5E 2XV3A 5PAZA 5F9WC 1RZPA 1E5ZA 4I2XA 3UMNA 1RSFA 4QWWD 4HHWA 3TV3L 3O6KH 2NY6B 1YYLH 5CEYB 4ZXBC 3QEGL 1QABA 2X2YA 4YHNA 5ILTL 4PJCA 4R4ND 5GGVH 4AQZA 4PP1C 2A4ZA 2N7AA 1PQZA 4NAQA 3BIKA 3QJHA 4MQTB 3OR7B 1JJUA 2WTRB 4KJPD 5T5NG 4M02A 2UY6A 3I3EA 4AI7A 5F1OB 4JCLA 4HLEA 3AS0A 3BWAB 4OQ1A 1TUPA 4KVCH 4GBXB 3MV9E 5GS1C 4J39A 4HF5H 1B0IA 4KMLB 3X13B 3D69A 4U6HB 2HWZH 3NSCA 5JQ6L 2VKXA 1UGNA 1YPZB 4I0PD 4YDNA 4AQAB 4AZUA 5I5MA 3CSGA 1O0VA 2WLLB 4Z6AT 5E23A 2ZUXA 4E42B 5TGBA 2EKSA 5I8OH 4XCFH 3MLWH 3ARUA 4KMTL 4D9QE 3L7EA 2UYLA 1O5DT 1KEGH 3FFCD 5D7IE 2HJFA 1IC5H 4NZFA 3EXJA 2CA3A 2ZG3A 5I23A 3O9WD 4LCUB 1A7RL 1X5JA 3RVWD 1BJ1H 5DD6B 2JE8A 5KYNA 1RJLA 3JTTA 5F3FA 4JO5A 1WAEA 3HKFA 3T0EC 1F6LL 2AEIT 3V4VH 2DMHA 4QRBA 2ZYSA 2AQSA 4Y4FC 1MN4A 1TT6A 3IJEA 3G6JE 3LV3B 3MNMA 4IRJB 4HGWA 1MG3C 4NNYA 5GGUA 3BZFA 4RMTA 2ZCZA 4PJXE 2BW5A 2ICES 3I9AA 3HAEG 4G1EA 3HN3A 2LR4A 5E94B 3ULSB 2ZYHA 2IADB 3KYAA 4GP5B 4TVSa 1NA8A 4UTAA 1WBYB 4Y2DD 5K33A 5KN5A 2CBPA 1JHKH 4PJAE 2JQAA 3T5WA 4JG5A 5E6ID 3OKNA 4YE4L 1IAOA 1MCQA 3FOLA 4HIPA 4FYSA 5HJ3A 4PJCF 3F05A 2P42B 2WYHA 5G5DA 4W6YB 4JKLA 2UZIH 3MLTB 2HFFA 4U1IA 5E6SB 1K72A 4OJCA 2ED6A 5E5RB 2GBAA 1ZLSH 3C5JA 5J13C 2DWYA 1E2VA 4HKZB 1ZLWH 3T3MB 5DEZA 2FJFB 4L8CA 4UIKH 2DS4A 3ZDXF 4PBDA 3ULVH 2APWA 3TWYA 4R7NB 2B9AA 1VKXB 1NGPL 3B1TA 4EF3A 4LPVA 2O1AA 1M7DA 4G8AC 4GMSL 2VDLB 1DBMH 1TEYA 4N0UA 1TO4A 3ZW3A 4YX2L 3HB3D 2X10A 4WHTA 1S7SB 2P5WB 3LY6A 1N5AA 3L4YA 2JCCE 3FTXA 2GSGA 3IJSA 4W9KC 2VLJE 2X05A 3K6FA 5EG6C 3H6AA 2WY3B 4OLXL 2EDYA 2FHCA 4WJKB 1GAFL 4MQ7B 1G7JB 2YKKA 3GSOA 3NN8B 2C3GA 2CJSA 2UZXB 3LKSB 2H3XC 3P3RA 1AHWB 4KROC 2NW3A 3LNFA 4DQOL 5IMLB 1NGXB 2N56A 4TXVB 4Y16C 1DQDH 2AQTA 1PJ9A 3FMGL 4GUPB 2XN2A 3QCUH 4PGJA 2UWEF 4GW1B 1RIHH 2EJ1A 2BMKA 3INUL 1NKGA 3HZYA 4N5EC 3HUJE 3BT2H 1QBLL 3VTMA 1OB0A 3REVB 1TQSA 4N85A 3VFMA 1ZLVK 2ADGA 5DWUH 2FK9A 4FNUA 1G0DA 2CK2A 2R69H 5DUML 4ZNEE 5IROA 2WMPB 3OKEB 3PWPE 4KVNH 1FYTB 4KAQH 1J8SA 3PJSB 3O4LD 5F0JB 2I7OA 5HPMA 2W65A 3SDXB 4WI7A 3LXBA 1OGTA 5SWSA 3NCWA 2OMUA 4UT9A 2YMXL 5AAMC 2OR8A 1WQVT 4P2RA 3ZDYB 3Q3GA 3RGVC 1QHPA 2Z4QB 5D7JC 3T77A 3EBHA 4YS4A 1Y1UA 5T33H 1EO8H 1U8OB 3V5HA 1U8NB 5CCHE 1TQTA 3GLEA 5G4MA 4HXBH 1I9JH 1T7ZA 2DQHL 5AZEH 4PR5A 4QNPE 4PMEA 1OTTD 1N10A 3B83A 4IHBA 2WQXA 1J8HB 4GSDL 2AV7B 1GH7A 4ANKA 1SFDA 3RUGA 1KB9J 1A1MA 1BBDH 4LBEA 3L3KB 4RISL 3US9A 5DJZA 3RGVD 4GEJA 4XN2A 4IS6B 5LAPA 4QGYA 4Y16A 4JKNA 3AABA 2IGTA 3LD8B 3FYIB 4EMZA 4KK9C 4ETYA 1B3IA 3QC5X 2JCWA 3MLYH 2E6QA 3VXQA 4UNVA 2ALWA 4GI6A 2ITCA 5L7XH 1TTUA 2GIYA 4U1KB 3KL5A 5KAQG 3BPOB 3UTSB 1FGVL 1UJTA 3VJ6B 1EH9A 1EHXA 1ODAA 1NFAA 3NIGF 4PG9B 1IQDB 4FFYA 2JKNA 3BLBA 5DURD 3STZB 4PP2B 5DURB 1MLCA 4K5MA 3RPBA 2DYPD 4TNWK 1U6AH 4LCUA 1BXVA 2C4XA 1RZJC 3WIHH 3GBDA 2OTPA 3QQ3B 4OLYL 3ARGC 5I8EB 4MB5A 5FUZL 3O45B 1IT9L 1HQ4B 3QA3A 5K59E 1QRKA 3HCVA 4RFOL 5E5MB 5T5FH 1FO0A 3HR5B 1RP8A 4OKVB 4QXGL 1L6PA 2WXIA 3KBHE 4POYA 5IVNA 5HJBA 4NNYB 4ZMXA 1IC4L 2WOBA 2P5EA 4E41E 5FWQA 2DWEB 3BH8A 3VSVA 1RZJH 1OP3K 3ZE1B 4C59B 4OM0L 5I1AA 2VC2B 5KVDH 3ESNA 4JDEA 4YIQA 4HFUH 1M6OA 3ARRA 1XCQA 3E6FA 5FM5M 1FC2D 3FRPA 3OBAA 3HNTL 1IFHH 4JDVB 4JJOA 4DTGL 4ORGB 1EZLA 3SPJA 1G7MB 3N0AA 3UG4A 2O6FA 1MVYA 3CTTA 3QXDA 5DHYB 1S9KC 3CZSA 4LEOA 4WKXA 1CFNB 1MG2C 1S7XB 1RJYB 1KCSH 2DY2A 1YMHA 1A4AA 4XBGB 1J88A 5JIMA 3IXTB 5CGYC 1S9XB 4MJIB 4RFNB 4EUPG 2X89D 4FQHA 5TF1L 4PJFA 4FQPA 4I3GA 2H47C 3GRWH 1VKXA 5C7XH 1NPNA 5MEOB 3IMRA 4JGNA 4X2UA 5IKCB 1CU4H 5MP6H 1JK8A 1JTTA 3BZ4B 2W9DH 2A74A 3ZX1A 3FONB 2MIZA 2EDJA 1XMEB 4L37A 4N3UA 4PBXA 4U0QB 4HK3J 5K69A 3BRDA 2BDNL 1N9PA 1RKRA 4JHWH 3GNMH 1PLAA 4APQA 3HI6L 1CURA 1FG2B 5EUOE 4Z76A 1KY7A 1TZIB 4IKJA 3APDA 4JFZH 5HGDA 3EFDL 5JW4Q 5L0QC 5I5RA 2PYED 3D4GA 4MJHA 4R5XA 2CGYA 4O00A 1IM3D 3CLEH 2DQCL 2JV6A 3ARSA 5B3NA 4NCDA 4PVMA 3L1GA 1X9LA 1JFQL 3A6CH 3LVEA 1ZA6A 4MJ5A 1S7QA 4HS3A 4U0RB 4AV0A 4A66A 5C0CB 5T1JA 1KDJA 1NSNH 2NY0D 2VO8A 1YNTB 4OQTA 5HGBA 3O2DH 3GXNA 1UA3A 5IMKB 2MQ3A 2PXYA 3A4AA 3LIUA 3RQ3A 1YEWA 1JGEB 4DFHA 1FE8H 4YBLC 2DEWX 3DK0A 5LQBH 3OAUL 2JJSA 1JI1A 1OCRB 2OSYA 1H8OA 1NINA 2NXYB 2PWEA 3H53A 3PWVA 3UTPD 5ACZA 1H6FA 5F96H 5C6WH 4FKHA 2W8CA 5DMIH 3L4VA 4FQQA 5BQDA 4BSJA 3MLYL 2BSED 1B4LA 3RFZC 5IJDC 3GBML 4NZ8A 2OV0A 1DFXA 1DZBA 1KN2L 3QJXA 2ED8A 4MZ3A 3Q8EA 1NL0L 4JDZB 1JVLA 5TE7L 2NY4D 1BXXA 4LL4A 3BEVA 5KUKA 3TA3C 2EE2A 3QO1A 4Y5VB 5IIEB 4JM4H 4FXGC 3VXOA 5CEYA 2I7SA 2NQCA 4H5SA 3KPRE 4N25A 4UNUA 3BZEB 3INOA 4QAWA 1PKOA 3OMZA 2YD2A 2AK4D 4G8EA 2VERA 3L5WA 5EEZA 2EDTA 2ZOOA 2EDBA 4P49A 5EH1A 1HSAA 2H2SC 2VCOA 3FO2A 1IGIL 3BVVA 4Y19A 4YC2B 3U0TA 1QFOA 4IW4C 1IIKA 4RRPA 3MV8D 1UWEH 3W0WE 3J7HA 3BLKA 3SZ6A 3CDCA 4AEEA 4UDTA 1FRGH 2FEEI 3WNNA 3S3BB 2I60L 2F1AA 3U4BH 3WTVA 1F45A 4TF4A 1RVFH 3T0EE 2ZCLH 1Z3GL 1HL5A 4F9LA 3AACA 2WLIB 3C6LA 4ZAKB 3L7FB 1AR1B 2DLFH 1RCYA 3FT9A 3MNZA 2GJ6D 2BVQB 3O6FA 1VFUA 2FLBT 4MA1C 3F7YB 2Z8RA 1OT1A 5D8JH 3SKNA 1PYWA 3OB8A 5LNGA 2VDMH 1T0MB 5E0QA 3WHE1 2G0KA 4K71B 2AI0L 5LBSA 2P8MA 3C6SB 1IAIM 4MFHA 2R69A 3V4PL 1J5HA 3AREB 4C83A 1FSKB 5D93B 3PQYB 2W5PA 4M62H 5D2NC 4OLWH 2ZKYA 4LOUC 2HYMA 1G7IA 1PKQA 2VW7A 4DVRL 5KYXB 1T20B 1G9HA 4H8WL 3H9ZA 1WTLA 3QUYD 1H3PL 3IFNH 1KPRB 3PNRB 2X4SB 4LPWA 1JPEA 1NFDB 1K85A 4Q6IA 3LRKA 4OH2A 4NQXB 3KD4A 4UI2A 1HOCA 4WO4B 4QRPE 3E6FB 4R2GB 4AKPA 1IJ9A 1BXUA 1CE1L 5GGSB 3IDGB 3T2NL 2F5AH 2NY2C 5F0PB 4M9PA 2BNUB 2VDOB 2VJ8A 3PXHA 5E03A 4HLJA 3WJLC 3ZQ9A 1O6SA 4I9WD 2D7OA 4OCMC 1QNZH 4LLVA 3TNMA 1OARL 5D2LE 1IBZA 3MLTA 5DUBB 4UIKL 3VWKA 4P2AA 5TQ2H 4LVHC 1U8LB 1Z66A 2A73B 4NUJB 1BVZA 1JPGB 1KB5L 3B7RL 2WVVB 3D3VD 3UEZA 2WNGA 1D6EA 5D1XB 4NYLA 3S35H 1L9QA 2MFNA 1SJVA 3ZE2F 4KK5D 5E7FA 2V0AA 4X6CE 1UD2A 5C3TA 3O4LA 3FONA 4G1MB 2ZUYA 2OL3H 4WWKB 1EXGA 3G6JF 5EU4B 2WQAA 4WGKA 5DHVA 1URIA 2VLRB 3ETBF 3F7VA 4LSSL 2NX5B 4LCIH 3VI3E 4K0OA 2VZOA 4XCNB 3T4AA 3F12B 1J0YA 3CFDA 4M6OH 5FM5O 1OAXH 5AW8B 1MCPH 2DIAA 1UENA 1BZ9B 3PUCA 2EVJA 3QO0B 1E42A 2WD0A 4NO0D 1HWHB 1P4UA 3UPRB 1XFPA 4GW1A 1F4XL 3CFKA 1T1ZB 2P52A 3O3EB 5JLZB 3REVA 4PJCE 3L4CA 2W59A 1TITA 3CN0A 4QRRE 2C9SA 5BQ7A 3E8VA 1YO4A 5DRWA 1KSRA 5GPRA 3HFMH 1F4AA 4UM9B 1DQVA 4O02A 5CZRA 4MYWB 4OCLC 1EX0A 2A99A 4WHYG 1DHKA 4G6FD 1EJ8A 3C9NA 2O5NA 3UTZA 4L3EE 3SDDA 4S1RL 4Z3FA 3CFJB 4EDXA 4DUXA 4LE8A 1CLVA 3NACL 2BIQA 1DVZA 4UOW0 1RZKL 4YBHA 1JNLL 2CRIA 3T3MF 2NTFB 3LYRA 3AB0C 3U48A 2ZWNA 1NCUA 2L4OA 4PREB 4BUHA 3QIBD 4YBQC 3MXWL 4ZO8A 5EU7E 1BOGB 3ARBD 4G80B 3JUYA 4IDJL 4JN1L 3N50A 4C8XA 1NIDA 2K7QA 4MAUH 3AT0A 4JM2D 4CC4A 4Q6YA 3BPNC 3NZHH 1H3GA 1H8LA 3STLB 1YYLL 3SGJA 2X4NA 1UD8A 4G7YH 1A7BA 4HWUA 2VC2H 3AS1A 2WINB 3NCJL 5T1KB 5JORB 1A0QL 2H45A 2R1YB 3H55A 1WAPA 1YEHH 4UDTB 4Y7OC 2FH6A 3CFTA 4JJ5A 4XC3H 4KHTL 2EIBA 4JFEB 1XL4A 3DBXB 3RG1C 3KNBB 4I89A 3AMLA 2XPGB 3D3VE 5I71B 3MUHL 3BEWA 3MLRH 5DQ9B 4DKTA 3FQYA 1UHVA 3I6LD 4RA0C 3K71B 3DX6B 1NDGB 2JK5A 1YEDA 1YMMB 3HG1B 3NP4A 5JYLA 2R83A 3VA2C 5ID0B 1F13A 1AGFB 2AQ2A 2ZXBA 3GD1C 5I24A 2DM2A 5CGTA 3EFFA 3MJ8B 1FP5A 5C6PB 4QHKI 4D7PA 1OM3H 1RZ8A 4LDCA 4P57B 5JW4M 1PIGA 5KVGH 5DVOA 1GW0A 1PF3A 2IANB 1NLBL 1T1YA 1MREL 1WP6A 2OMNA 3MR9B 4Z7UE 5C7XL 1F5WA 4P9MH 3DXAE 4FFVC 3DGGB 4PS4L 4XXWA 3FH5A 3Q8FA 5CLXA 3OG6B 1SY6A 2AJZB 2BLFA 1D5BA 2VMEA 3W38A 2W07A 4UTBL 4M5SA 4EUPA 1ZSHA 5L8LB 1WFUA 4K9EC 4JN1H 5CLZA 4BDVB 5D71L 1H0DA 1JF5A 1PNDA 4XNYH 1JZ6A 4NKOB 4CVZB 2JQMA 2XFGB 4PJHF 5MEPB 2JXMA 3JVFC 2LV4A 4JANA 1KTCA 1Q4NX 4J2XA 3NIGE 1VEOA 3U83A 1HL4A 2IFGA 2TSBA 2NYKA 3VWKB 3WIIL 1N70A 2P1YA 3KGTA 2XWCA 1BIIB 3ZTCC 1P84J 3HHRB 3RVTD 4K4KA 5IESH 3L4WA 2UXVA 4Y4KC 1G7PA 4HT1H 4X0KA 5AWNH 2YA1A 2K8MA 4ZUSB 1BIHA 4QOKD 5GRJL 1KZQA 3FU9A 1YA5A 5FO8A 1OSPL 1JK8B 5AOZA 3NIGB 3N1QC 1P7QD 4JRXA 3BXNA 3TBTB 3TBYB 3RIFF 3UJIL 3U46A 4B6ZA 1JMZA 3PDOA 5KJRH 4WWKA 1JPTH 4OCXH 3LRSA 2Z7YA 3MV01 3SEPA 3U7AA 2JJWA 1T0NA 1MCEA 5I2IB 3ZTEA 1EAPB 5CCKL 3MRIB 1X5YA 3FQRB 1INQB 3B7UX 1WVZA 1UH2A 2F8XC 1YJDC 2AZAA 3NQIA 1VCBC 4L8SC 3U0PB 2CJ3A 1KCVH 1TCMA 3E2HB 3KH3A 1FJ1B 1MCBA 1X6LA 2AQ1A 1IO4C 1HI6A 3C09B 4HH9B 4N8VA 3PAVA 5BS0A 3QI9D 1VGKB 2EH8L 3FTYA 4Z7QF 5FS5A 2NLJA 3L5IA 1S9YB 2ADFH 2MKWA 1P4IH 3ATAA 1EBPA 4JPSA 4ILDA 5HHNA 2YK1L 4D0CB 4G43B 4HEMA 5FA4B 3GHBH 1ZA6B 3VG0L 3BPLB 4PJIF 5EIIB 3W11D 3K74B 1L9PA 1IEBB 3MRPB 1MFBH 1HQRB 4B7IA 1KB3A 3KLKA 5DR5L 3VE0B 5IMKA 4YHNB 3NBNA 4Q9RL 4NNXA 1F58H 1JNNL 1UZ8B 1LK2B 4HJJH 3UTPE 2VN5A 4HWZB 2V9QA 1U3ZA 3G6DH 4OZFB 5ESVA 3RWIB 2X1PA 5DRZB 1LEKB 3TBVA 3UADA 3FT3A 4F7TA 3CFJA 3V5DB 1FIGL 2MOVA 5EBMB 1JUFA 3DUUB 3MV8A 2VR5A 4IRSB 5BUPA 4J12A 2JJTA 3DROB 3FUJA 3NAAL 2B2XL 2VQ1B 3BJLA 3O3BB 4FN0A 4RWYH 4BCXA 1OARH 1IKNA 3MUGA 5KSBA 3CHRA 4GEIA 1NFIB 3L3OA 5H35A 2UVFA 2XWDA 1WIOA 3TESA 1JCVA 3S3SA 1ZA3B 3CDYA 35C8H 5I6OA 3QNFA 2RH0A 4XMKH 3GMRB 4J3SA 3IAGC 2AZUA 5D1XE 3FU3A 4GG6A 5CSZA 3WL9A 4Q0XH 3RHWF 4TUJB 4NENB 5AAWA 3VXPA 3HS9A 2IALB 1HWGB 2XKSA 2OZNA 3G3LA 4M62L 5HHME 3W1ZA 2YUZA 3IJEB 4HCFA 3PWLB 4JO1H 3CFMA 4UDUB 4OZ4B 4MCNA 3AU0A 1LWHA 5CZVL 1MDTA 2PABA 4Y8AA 4AQAA 1F4YH 1KC5H 1N4XH 1D5ZB 3VYPA 4EI6A 4JPVL 2BVPA 5FYKL 2HPTA 5HI3C 4BRVA 1I7ZA 4WNQB 3QAZC 5E24E 1M05A 3HE6C 4QRTB 3P4LA 1RAMA 1YEFH 4KROD 4S1SH 1KN4L 1F56A 3WXVL 4LCWB 2DQGH 2C9VA 4GBXC 5GS1B 4E0RA 3QRGL 2Y2WA 3B37A 2I60H 1TQCC 3GSRA 4NRXB 3MCKA 4U1LA 5LXGH 3CPUA 3QDMA 3W57A 2VRQA 1TO5A 4ONFH 2H6PA 3QUZD 3FRUB 4LT7A 4PWGA 1YCSA 5GGVY 3MJ9A 3U6XS 5IZ7A 4X5QA 3ZDZF 4L1HA 2F0CA 2E9JA 1F42A 1GGYA 2AEPL 1HHGA 4X7SL 4N0YH 1NDMA 4JR9H 2BP0A 2E46A 5H94A 1UXLA 1FDLL 3L3IB 4ZMWA 4QRUB 4BHUI 3RL1A 4NQXA 5IJCC 1HOCB 3WU1A 2R4SH 4OBRA 4U1HA 4G7SB 3LRLA 3TIEB 1P7QB 3HPLB 1J11A 1TOXA 1NICA 3NIDF 5IK3A 4MQXD 4HUUB 4FQXD 4YL9A 2G30A 6PCYA 1HTYA 5DFVC 3EHBD 5CO1A 5HDLA 1ZHKA 4IOFD 4DEWA 4LCWD 2Z8VC 5KVFH 5JOFA 3DURA 3OX8B 4NSKA 15C8H 2ICCA 4W1TA 4Y2LA 5FYJL 3R7QA 3X14B 3DTXA 4WV1A 3M1BA 3IKCB 5E2VH 1I85A 2VNCA 4GFTB 4UZSA 1Q8MA 5T3ZH 3X3GL 5C0FB 5E6RB 3PWJB 1D5XB 1URLA 2A83A 1ZJAA 4PTTB 4XXDB 3A4DA 4TRPH 3CFNA 2A9AA 2W65B 2HRLA 2GSGB 2VLRA 3F7VB 4PRPE 3SDXA 5A7BA 2R2EA 4IRJC 1YECL 3W3BA 5L88L 3QUZC 3DRQA 5D2NB 4CADB 1Q90A 3AGWA 4OQTH 1JWSA 4PRIE 3AADB 5E2TH 1XV8A 1NOAA 3G04A 3ULUD 3RZCA 4MA8L 1TXKA 1JWMB 2YPLD 3BISA 4HIEB 1MF2L 4LLYB 4X6FB 1HKFA 4R26L 5HHNB 4D0CA 2BNQA 1H3XA 3X17A 1S5IH 1AS6A 3V0WH 3TO4B 4U6VH 2JTYA 2VDKL 2VZ1A 3GTNA 1V7MH 3FAXA 3L81A 3P30H 4D3CL 5B8CA 4KRPB 4GG8B 1QBMH 4L9LB 3HG1D 4J3OD 4UBDD 4GO8A 3ZYOA 1CU4L 2UX6A 4UYPA 4MXWH 1PLGL 2E8ZA 4X6BA 2YD1A 3ZT5A 3UTZB 5GS2D 3MUJA 2P80D 1QWHA 4Z23A 3DETC 2HLFD 5LGYA 3CN2A 2MCPL 3QYMA 2WXRA 2ZXDA 5C0BD 4PLOB 3VI3F 1R3HA 2HAZA 3CDZB 2O26U 1MLBB 2PPDA 4YDKL 4P4RA 4F7MA 2NDGA 4ZO9A 5CGMA 4DUVA 3VMPA 4P05A 2WXNA 5LKNA 3MRHB 4J3OG 1IFHL 2J6EA 4OB5H 4DTGH 3VFUB 1IAKA 1XEUA 3DX8B 3IFLL 1DE4A 3I6SA 2HZHA 5E4EC 2FQFA 5F97E 1TZ8A 3W9DA 4FYQA 4XMWA 4LAQL 1KTRL 4A37A 4CJ0A 4AJVA 4D0BB 2N0MA 2C9UA 1RZJL 5EBWB 5L4IA 1JZDC 2P5ED 1XIWA 4X80H 2PWFA 4GQZA 5F1KC 1KYOJ 2CMRL 4H4NA 2N3JA 5JUEL 5CZXD 4OIFA 3OTTA 5HHXL 3VTAA 2J4WL 3N85H 2FEDD 1XSJA 2UVEA 3HZKB 4KUCD 5C9JA 4L0ZA 3QIUA 3R06A 3U1SH 2FECI 4Z3HA 1V55B 1KPVA 1P4BH 1EZSA 2R1XB 2I25N 4FFZH 5JHLA 3QHFH 1DJZA 3DBXA 4N8CL 2CIIA 3TBBA 1KUMA 1OF2B 1WS7A 2IBGA 2Q3AA 2C9XA 3A47A 3VFVA 5JHLL 1Z9LA 3VX0A 3O8XA 4HMEA 4IM8A 1F3JA 1J87A 4PBVC 4PRHA 1V3KA 3IXAB 2P5PA 4J2QA 4K2UL 3NFPB 2PLTA 4NCC2 3SPGA 1GTNA 1TDQA 4NEHB 4K73A 5D7KD 1QR4A 3RPIB 4MJIE 1GIGL 4NRXA 4ZFOL 5F1SA 4FFYH 1P1ZB 1B2WH 2WO3B 1OSYA 5L7XL 1PSKL 1S7XA 4HZ1A 1KLGB 4YZFF 2CG9X 5SWSE 3CZJA 3VQ1C 4O2EA 4X5PA 3NJXA 1U58B 3LQZA 4WTZG 2GY5A 4I85A 3BH8B 5F7UA 4HH8A 4TULH 5EEUA 2ICWJ 1R3LA 3L4ZA 4AMKH 1OO2A 1S9VB 3UBXI 2G2NA 5GGSY 2K9UA 3BZ4A 3EZJB 3OLIA 2GABA 3QUMB 3RDTA 2WQWA 4NP4L 5GHWH 3S5LB 4TUKL 1HYRC 3HC2A 4HX1B 2X9XA 4CGUB 4FLHA 1H0DB 1MCOH 4FS0A 4C55A 1DLHA 5FXCH 5D72L 1L9TA 2ZWSA 3FZUC 4DCQA 5G5DB 3VCLB 4JPIB 4PGCB 4GQ9H 3IJ8A 3PP4L 4Z76B 5SWQA 2XVLA 4TVUA 5DJXA 3JTSB 1AHWC 5BJTB 2FX9L 3GUTB 5EO9B 1JZHA 5B7FA 2CHNA 3RGBA 4JKMA 4CL7A 1FNSH 5GZOA 3GMNB 3P77B 2D3NA 3KBFA 5IJBC 1RZGA 2D31B 4MVBC 4MJ5B 1GS7A 2OYMA 4FNSA 3JYCA 4PHXA 3LQAC 4PRPD 3CFCH 2FB4L 4LARL 2FATL 3BAEL 2JQZA 4IDLA 3OAWA 2P5WA 3L16A 4EZMA 4EAEA 3AG3B 1G4MA 2V4LA 4PLNC 1PG7X 2H1XA 5BV7C 1IM9D 3H2PA 4KFMA 4I3RH 3SDDC 1I9RH 3VXSA 3B2VL 5E8EB 2DQDL 4AM0B 1QLEH 4CN1A 4N2HA 1IB5A 3I02A 5D5MF 1CLCA 2HTLC 3MRDB 4ZOBA 3T04D 4KRPC 2WWMD 3QUML 4DQOH 3UDWA 2FWUA 3D0LB 3HZYB 4NWTL 2K78A 5E8PA 1KIPA 1PX3A 2LQRA 4OM1H 5KSVB 2X28A 5ERWA 2FYYB 4PRBB 3MCLH 3APNA 4LSVL 5IB1B 1OGAB 1B2YA 1QTSA 1JPTL 4O4YL 2PXYB 3WFHB 5KJRL 4CVXB 4YX2H 5I66B 1USZA 4G72B 1DVQA 4YFDB 4K3HA 2R2CA 5EZPA 1OGTB 1Z9PA 1DYZA 2FSEB 4NQCE 4XWOD 4E5XG 4MA7H 1T6WA 5ACZB 4I0CC 3P3TA 3QDGE 1FAIH 2CJUH 5K39A 1BECA 5C0DB 5I6XB 2O5ZL 3L45A 3WGVB 3DROA 2J55A 4L9DA 1SYVB 2F1EA 3HG2A 1YDPB 3BSHA 2XC8A 3II3A 2M2DA 4EDWL 4MB3A 2NXZB 5IWLC 5DJDA 5I1IL 2MWCA 4R0LA 3HC0B 2Z93B 1MAML 4P2OA 4L8BB 1V3MA 3T8MA 4LESA 4B96A 3IDNB 1T5XA 2X88A 3NJGA 2BJMH 3JWNH 4W9JC 4Y5XA 2MCG1 4YVNA 3ZLQC 1XGQB 3GO1L 3ZXAC 2FQEA 3SKNB 2XQBL 2P4AB 2F53B 2GIMA 4CMHB 4DPAX 1MAJA 4PJEF 2CJTA 3VFSA 1QMUA 5J6GA 4IHOB 3T2OA 1B4TA 4JFXA 5B39B 3VGFA 2CPUA 4HIJA 3IPEA 5B38B 4PJ8D 4Z8FL 3V4VL 4FE9A 4AGOA 1QPKA 2FNWA 4NC1E 1OM3L 3LNHA 3NSYA 5D2LF 5LGJA 2VM9A 3CVIL 2OMTB 3RU8L 5KZCB 2MEJB 1G1CA 3FH7A 1ED3A 2I27N 2PPFA 2E7DA 3BGFC 4E5XA 1I1YA 1FFNA 4HS8L 5AW4B 1JZ3A 2JELL 4RMRA 4XCFL 1S2EA 1YNTF 2CBOA 3EDKA 1I1AB 1UOVA 3F7YA 4PB0H 2DZEA 1T4WA 4KKAD 3DMMA 1P1ZA 4WQOA 3S96A 3KPQB 1U3HA 4UAOB 4N68A 5ESAB 2YD5A 2E27H 5HYJE 3TPUB 3WELA 1PVHA 1NCDH 1ZHLA 2OMZA 3GUFA 1J18A 4EN3A 3BVXA 1Z9SA 3MGTB 2EYTB 4M61B 1WCBA 4EBQH 3ULUF 1CR9L 4NHUB 1CGVA 2LU7A 3SE4C 5I0WA 2Q20A 1JGVL 3BD4A 4OCWH 4H1LG 3OGCA 2XN1A 1DJSA 2CDFA 4WFFD 1J9RA 3O6KL 1R1CA 2DIBA 4HPOH 1XSOA 2BZDA 4YO0A 3VYOA 1PAMA 3SD5A 3CFDB 4NN5C 3M45A 3NEEA 4Q52A 1CS6A 2LFEA 1MJ7H