4E5XG

Crystal structure of a complex between the human adenovirus type 2 e3-19k protein and mhc class i molecule hla-a2/tax
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
KKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of adenovirus E3-19K bound to HLA-A2 reveals mechanism for immunomodulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/transcription
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 21
structure length 99
sequence length 99
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3530 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4e5xG00
5IROD 4E5XG
chains in the Genus database with same CATH superfamily
1FO0B 3UTZB 2WCPA 3FOMB 5DHVH 3VWJB 2AEWA 1RHFA 4R5XA 3H3BC 4YDJA 2F1BA 4ATTA 1TJGH 3O6KH 3HR6A 5EZOL 4M02A 2ZCKH 4ABWA 4MNQD 5I28A 2KUTA 5CZKA 3WN5C 4B0MB 1PZSA 4BH7B 5MENE 2ADYA 1F13A 1GGCH 2YN5A 5E00A 2DWEB 4PG9B 2WSKA 4LU5L 4NHCH 1CIDA 3UC0L 5GS2H 3T1FA 3Q2NA 1SBSL 1Q9KA 5EUOE 4WWOA 3X1BA 4V1DA 1KTDB 3DO4A 4RIRA 3NZ8B 3IM1A 2VH5L 3P9MB 5KSVB 4KY1L 1LEGA 3WJMA 2HPTA 3C8DA 2WQWA 5GIRB 4FKHA 1S9XA 5HPMA 1KXVC 2E9BA 2GITB 1A7PL 2JCCF 3CZGA 1MWOA 2FR4B 1JPFB 1Z5LB 3SE6A 5J1SC 2OMWB 2BERA 4WWNA 4ZMTA 5IBLD 4U6HB 4TSAH 1ZK5A 1TYEB 3TNNB 3UP6A 3BZEB 2FATL 2PYED 1NC4A 1EZVY 3JTTB 3HHSA 1WFNA 1P1ZB 1BV8A 3NRQA 4WWKA 4X2UA 4ERSH 1KBBA 3HMXH 3QAZB 4ZFFA 1HC1A 4MAYD 3ABKB 4P46C 5ESVB 4R3SB 1DL7H 5ETUA 5J8OA 3Q01A 1QSFA 3D18B 3QUYD 3NJVA 4NCDA 1E27B 4EBQL 4J3VA 1BBDL 2NT1A 5IHBA 4A2LA 2YZ1A 3SZ6A 3QC5X 4GMTH 4OD3L 2E8ZA 5T5FL 2G5BA 4QRTA 5E1HB 1MREL 4FQ1L 2APWA 3S35X 3ARGB 2AQSA 4JM2F 4K5PA 1UT9A 3FT4B 1TJHH 4ALAL 2H6PB 3MR9B 3C9NB 3ZDZE 1HHHA 1ZEAL 4DW2H 3KPMB 1YY8A 2KPNA 1E9OA 1JZJA 2VC2L 4TRPL 4BZ1H 2H2PC 4FQLH 4CU8A 2PP7A 2NY5H 4ZD3H 2XZZA 2JJSC 1MW1A 2CRYA 4N5EC 2A38A 1FWXA 4M7ZB 5C0AE 2D73A 2F6AA 1XAUA 2P7TB 2IPTL 3DGGA 1DFXA 4HIPA 3QWRD 2ZUXA 5F93C 4J3WA 2AJYL 3FUFA 3H8NA 3MV7A 1YSOA 3ZYOA 4JFZH 3MO1B 4V1DD 1AKJB 1TNNA 2CMRL 2GI7A 2WOYA 1J0HA 1O6VA 1CLYL 1W2KT 5INCA 1AXTL 3ABLB 1BJ8A 4PPTA 1UKQA 4RFEB 1IV8A 4PV9A 4I48B 4M48H 3OAUH 1G4RA 4L29A 2OJZH 1NMAL 3BDYL 4ODBD 3NP4A 4UQBA 3PNWB 3AS0A 4H1LB 4X6FA 4UQ2A 5LNGA 5FYLD 4FHKA 4O2EB 4I1RA 4J28A 4L8BB 4PREB 5GSRB 1VFBA 1Z9MA 3JV4A 2Z9TA 3S37X 1OWRM 1KCVH 4FQ2H 1D5IL 4LO9A 1G1KA 3QI9D 1Z0MA 3JYCA 1HOEA 4EN3B 1A6ZA 2P5WB 3U4EB 5GZOA 4Z76B 3ULUL 1VENA 2FEJA 3AABA 4Q14A 2HVKA 2R4SH 2VO8A 2B2XL 3BUPA 3QPQC 2FQDA 5DZLA 5DUML 1RIUL 2H6UA 5GSRA 3L3DB 1A7RH 1BZOA 4UV4H 1M2VB 2PW1B 4I18B 1HNYA 1Q9WA 1D9KA 2V8MA 3MJ7A 4LSPH 4UTBH 4CNIA 3CPLA 3GJEA 4HS3B 1NMCB 3L5WA 4MVBC 3QUYB 2PYFB 5JORA 3GBNL 2LTQC 5KYUB 5FB8A 1SF5A 1N19A 3B9AA 3P40A 4P9HH 1Q9LA 1M9WA 3I3DA 3QQ9D 4CADB 4QYOA 4OZGB 4XWGL 2Y2TA 2J25A 2XOTA 4LNRB 1JGLH 1IGCH 5ESAA 4ANWA 1M42A 3AVEA 4G3YH 3RLSA 2WQSA 4CVWA 4XT1C 4HF5H 4NNXB 5K9QG 4UQCA 2Q87A 4L1SA 4ZFQA 3LIUA 1DQDH 2XIIA 3KLKA 4M8QA 4YBHA 2RAMA 9CGTA 4N25A 1W72H 5D2NE 4HJJH 2E46A 3EBHA 1IFHH 3G6AB 1TKWA 2QTVA 2BIOA 3MBWA 3ESMA 1UUNA 4XPTL 2QADD 4NCC1 5GZNC 3M1OA 4QWWD 1MUJA 2GW5A 1F11A 1A22B 5DS8B 2YBRA 1W6WA 2R69L 1U8JA 2DBJA 1CDGA 1TLMA 2ZXEB 3SE3C 2I24N 2UWEA 3SDDC 3NJXA 3PHQA 4KI5C 2NY3D 2K7QA 3LN4B 4NWTH 4WEBH 5FW6A 4AQ1A 2VW6A 4L3FA 3NPSC 4Z7OF 5BRZB 2B0SH 1N6UA 1TTCA 3DBXA 3RNKA 2CPUA 5ISZB 2CUHA 2G2RA 4FYQA 5EPMB 1RSFA 4JFED 2AJSH 3EYSH 4N2DA 5FA4B 3TEUA 4N87A 2EEBA 3APFA 3PIQB 4CMMA 1YCSA 5D2LE 1MRCL 3NQKA 3ZTEA 2Z7ZA 1OAKH 4DJMA 4HCGA 3GXIA 3LRMA 5HJ3B 4JO1H 3HZMB 1T0MB 2IAMA 4M8UA 4NQUA 1WTLA 2A74A 2WVVA 3PF2A 3P2BA 4BH8A 1RXLA 2EC9U 2EIZA 3AXLB 3VXUB 1CC3A 1KF9B 5IG7A 4DGIL 3VAEA 3HRZA 4HJSA 2C26A 2YQ2A 3GXFA 2IANA 3MUZ1 4U1SA 3STBA 3GIZL 1S9XB 1XFPA 4PRDB 3DX3A 4FP8H 1J9CT 3WN6A 2CDGA 2X38A 2CIKB 4CMMB 3SSGA 2W88A 4HV8A 3A6OA 1W80A 4NWTL 5FX3A 1PY4A 5TK2A 4DO6A 3NCXA 3GSQB 3NJKA 1PFCA 1K8IA 2Z7WA 3ZYJA 3MLVL 1EBPA 2A9AA 1B0WA 4OT1L 1QBMH 4IHBA 4MXVE 5IB4A 4FFZA 4WW2F 4X5QA 2Z1PA 2PYEA 1HVXA 3O2VL 1NEZG 2C9XA 3ML8A 3IKKA 4H26B 2ITCB 4IBSA 4NBXB 3US9A 5F3BB 1KEML 35C8L 2MCPL 2DQTL 5E2JA 2QLVB 1H6FA 3QDJA 4ODTL 4XPBH 3EBAA 1G7JB 1MFNA 1ZDQA 3WIHH 2NNCA 2OMBA 4NJ9L 4FQQA 1CICD 3FFDB 1VIWA 2WNKA 4DCQA 2ZX8A 4C58B 2X5PA 3RVXC 5JXAH 3QUZA 3EJYC 2CLZB 3RIFF 4EIZC 1ECZA 7PAZA 4MWFA 4NKDB 3BH9B 1F6FB 4HAFA 4XCNA 1EMTH 2J20A 5KN5B 4RGOL 3X13B 4HIXH 1DANU 4A2DA 3BXNA 3GRGA 1JFHA 2VDKL 1JK8A 4OZ4A 5DUPH 5KYYB 2W0FA 1DBBL 3SPHA 4YOKA 1JERA 1FGNL 3T2LA 3FH8A 3C08L 3S3CB 3NYKA 4CBZA 3FTGB 3MRFA 4CDHA 5C0EA 2VDMH 1KV7A 1N8ZA 1T4WA 1PDKA 3CDGA 1ZANL 2JB5H 4XZUB 4Y1SA 5M7QA 4OF8A 4Y2DA 1DJZA 1V10A 3LKQA 3NIGF 2BVOB 2XV2A 4ENEC 2WKGA 4FQJH 4LKXA 4P5MB 1T5KA 2X7LB 3OR7A 3T2NL 3RWDA 35C8H 4JB9H 4LB8A 4LMQE 2WTRA 3QJHA 4Z0XB 4TMPA 3D51A 3QNXA 2D3JA 3O41A 4I4WA 1S5HB 2AAVA 5FA3A 1WRFA 4IRSC 1HHGA 4OCWL 3F7LA 2PCFA 3HG2A 3MXWL 5E5RB 5IM7B 3Q8EA 1AXTH 1M7DA 4OT1H 3D4GA 5E9DD 1TSRA 3MLVH 3ATAA 2FX8H 1QQDB 3V5HB 5E5MB 4N0UA 4F9PA 4P2QA 2Q7AA 3HS8A 2DWXA 5D8JH 4YX2L 2QFPA 3QUZC 4P4KC 4DUVA 3TCXA 2PP8A 3WLBB 3B8YA 3FHQA 5C2BH 1ET8A 4HIEA 4XBGB 4RSVA 4WTZG 1EV2E 5FLVA 2WTRB 4Z0XA 3KNBA 3EO9L 5MERB 3BP5B 4OJCA 4OB5H 4BZ1L 3KW8A 1IBFA 2H3XC 4J6IA 2MOVA 1BG9A 1EAQA 2L7JA 1OTTC 3D2UB 3HI5H 4AEHH 5KSBA 1R3JB 4XX1G 2Q8BL 1WBYB 1E42A 3NA9H 4KRMB 2YA0A 3BKYL 1NLBL 1SEBB 4Q9RL 4J23A 2BSED 1QUNA 4Y0GA 3TOPA 2Z8VC 1OGSA 3WI9A 2DH3A 4GMTL 2E7HA 1N6QL 4K8RC 3PAUA 4P23B 5I18H 3MGAA 4DPRA 2J1XA 1DQQB 4ZMQA 3L4VA 1W91A 4CILA 2V3DA 2DL9A 4ZS6D 3OKLA 1KB5L 1WS7A 2H5UA 3BP6A 3WS6C 4N86A 5J0BA 4G7YH 2QR0A 4M7JL 1LGVA 3LXUX 1U58B 5DFAA 1T20B 1G7IA 3FMGL 4PTTB 4L8DB 4Y4HB 2GTZB 3GBLA 1JN6A 5T33L 3ESUF 2DY2A 3QR1A 2XN9D 1JPEA 1BVZA 1XB8A 5K93A 5CEYA 5HYJD 2XETA 4M43H 3AGVA 5D1ZB 4LLMA 5K9OA 5DTFB 4HPYH 2GK2A 4ODUA 2NX5B 4APXA 1FHGA 3BZ4A 5E4EB 5BRZA 4I8DA 4OJDH 4TQ8A 1GTNA 4HUNB 1AMYA 1ET7A 5D5MB 4AYDC 2V2WA 5DHYB 4HEMA 1AHWC 1IAMA 2ATKA 3QQNA 5I9QB 1INEL 2GG1A 3D3VA 3W39A 3RFRA 2VR3A 3MLSH 5FXCH 5I15L 4G9FE 4POZC 4K5LA 4X7FC 4GRWH 5KBPA 1MF2L 3EO0A 5I1HL 4AUJA 2JJTA 5J56B 4ZQKA 1C16A 3O9WA 2N1TE 1RI8A 3B1TA 4O51B 1CTNA 1E4XH 1BECA 4NC1C 4X5XA 5L8JB 1A47A 1TJIL 4OR1A 2QLYA 3MLYH 4NRYA 4DP1X 4IIQA 2XA8L 2I7SA 1AANA 3C75A 2V2XA 3P1VA 2N01B 3U0PA 3R18A 3MBEC 2WLJA 2WXKA 4WK0B 5IW6A 2GPZA 4JKWA 4B27A 4ECNA 2XV6B 2EDFA 3DROB 3L8QA 5GRJL 1N10A 5JUEL 4KTGA 2B2XH 1PLGH 1J8HB 3VRJA 2ZPKH 5K9QI 2OL3B 1OE2A 4IK6A 1OP5K 3R7RA 2F7OA 3TJHC 2JKWA 3SDCD 2X42A 3RWEB 3BGFC 4YDJB 4NQEB 1UM4H 4LESA 4KFMA 5LNDA 1JGVH 3CFMA 1GPOL 1U93B 2O4EA 4P9HC 5F0LB 4KPHH 4BE6A 2COQA 4M03A 5F70A 3VFOA 4KK9C 4L1BA 1BLNA 4YL4A 5I1CH 5DI8A 3M17A 1JYVA 3TBCA 2VKXA 3B8SA 4YC2B 3SKNA 2XN9A 5K39B 1JD9A 1FE8H 4HFWB 5E5UB 5FYKD 2Y7QB 4AGQA 1RJZB 1MAKA 1FVEB 4K2UL 4XI5D 3ARFD 1RVFL 3QW9A 3OR6B 3C60C 5CSZA 5G4NA 5HYJB 1A7NH 1HE8A 4YDKH 4NX0A 4CN6A 4LCCB 1EZUA 4O51A 3BRFA 1J88A 5FKPA 3EH2A 4O2CA 2XZQH 3ZMRA 1YEJH 4JPQA 3DX8B 4GKSA 1A64A 2BVYA 5C0AA 2XG4A 4ENED 4HIHB 1AQMA 5KTEH 3C6LD 1AAJA 5T3ZH 3T6WA 3VMPA 2R2CA 2Q9OA 3BH4A 3GBML 1GC1H 3MRHB 5KW9L 1J5DA 4PGDA 5JIHA 1ES0B 1G94A 1VHPA 4P3CL 3QZWA 1UACL 2ZTBA 4BFEA 2MPAL 1BOGB 1Q9OA 4KZDH 3HEIB 3NFNB 1HXYA 3WFCL 5GZNA 1C5BH 5IMOA 1UEMA 4HH9A 3BWAA 3DX4A 4JQVC 4E2OA 2FL5A 4P9ML 3BAEL 3MUJA 3MO1A 4GW5A 1UM5L 1E4WL 5CUSH 3V4UL 2WLZA 3L17A 1FYTD 4FJZA 5IMKB 4AJ0A 3BQVA 5DSCA 4MSWA 3X3FL 1G1YA 1QFUL 2EO1A 4ZSOB 3SDXB 1ZT7A 4Y4FD 4Z7UF 1ZGLB 3IU4H 4GUCA 3HMWH 2KH2B 5GGTA 5IJBC 1HXYB 5AVTB 1HHKB 1E8ZA 2J3SA 4E0RA 3S96B 2NY1C 3FU3A 2EYRA 1ZVHA 5KYWB 2VERN 5FO8A 4JANA 4JY6A 1L3NA 3L1OH 4R97C 4BQ9A 4M7LH 4AM0Q 1S9VB 3HR5B 4TUOA 1DDHA 1HS6A 1EAJA 3BZEA 3NSCA 1OCWL 4GT7A 2QPDB 5L2JB 4GKLA 2UWEB 4TLTA 1JGEA 2HYMA 4HOXA 1DEEA 2BOBA 3NAAH 5DJAB 5I1GH 2XTLA 3UC0H 5CWSB 2CO3A 4JZJB 4TSBH 1FL6A 5D1XB 5I76A 4MS6A 5D7SL 4DAGH 3ULVE 2HN7B 4WW2A 2AANA 1XMEB 5GS0L 5JW5B 5J13C 2UVFA 4GRWF 1F4AA 5A2LH 2Y6SC 4HQQL 2BZ7A 1KCRL 4GMSH 2QZQA 4CC4A 1OL0A 3VD5A 2CKNA 3CFNA 5F1IB 1C08B 3B5HA 2EEDA 4AYID 2OM5A 1YHPA 4R2GD 3WJMB 2GAZB 2VRAA 5GJTH 2YPLB 4Y1AD 1B9KA 5DEGB 2XYCA 3SEPA 4X4MA 3PP4L 2FVNA 4KKBC 4WO4A 4EI5D 1RAMA 4F7PA 1N4XH 3LZOA 4TVUA 4O02H 3U9PH 4HCIA 3SPCA 1CR9H 5C9KA 2EYRB 4IMLB 4HS3A 1E5YA 3VW3L 3OHMB 4AQAB 1P4BH 5DD6B 3ENEA 1DSFL 1YMMA 1EEZB 3ZKMC 2YMXH 3FN9A 1DO5A 1ETZB 2LAAA 5D7JC 4YSTA 4NQQA 1SOQA 5I1IH 4BFNA 1JF1B 4FLSA 4F15B 3TGXA 2WXQA 3RP1A 1HFUA 4IOSD 1FO0H 3GSVB 3OAYK 4HEME 4RRPG 1O0VA 2OJEA 3I3BA 4F24A 1ZHKB 3U7YH 3QDMB 2LTQB 4B5EA 1K2DA 2HKFH 1N7MH 5HDRA 2X6CA 5E6YA 4EF3A 4D7BA 2BC4A 1KBKA 2HXAA 4X6BB 2HFTA 4LARH 4LRNH 5D1QE 1AY1L 1G9HA 4BFFA 3CFKB 4ONGH 4I9XA 2CO1A 4PB0L 2EIJB 3V5KB 1KB9K 3CWGA 1JSYA 3LKRB 3R06B 4WU5B 4GAGL 4P5KB 3QIBC 4O9HH 2HWZL 3QJRB 5DF0A 5TDNA 4YVNA 5HJGA 4ZBJA 1E28B 4U33A 3KWXA 1D5ZA 4OCMC 3I75A 4UT6L 3SYOA 3O0LA 3PL6B 5C0CA 5I0WA 3KXFE 4L23A 4CNIB 5EOCJ 3ARDC 2BSTB 1T1YA 2WN3A 1N0LB 1X6NA 2CCLA 2NW2A 3B2VL 4J4PC 5D1XC 4F9LA 1ZXKA 2XA3A 1CU4H 2V2TB 4LLAA 3ZYIA 5ADOL 1M7XA 1P4BL 4QXTB 4JHBA 4AQ1C 5D1QC 5D6CB 1GGYA 3AQXA 4XNYH 5L88L 5IQLA 4YSRA 2Y69B 2VXVL 3D39A 3V0IA 4XNBA 5IESH 5AEAA 5AG8A 2ADFL 2QSCL 1NOFA 2QPSA 5IKCB 1ZV5A 5EUOB 3RFZC 1JZDC 3OKMB 3GSOA 2WCSA 1PAZA 3FUKA 3IJEB 4QT5B 2H0EA 3MGTB 4U1HB 4JLRA 5FYKL 2EICA 2NW2B 1UJ3C 1T6VN 4LCVA 4MNHA 5LG1A 4S11A 5BO1L 5D1QD 4Z9KB 5I1KL 3DHJA 3BZFB 2P5EB 2QQLL 4WFGD 1SEBA 2YD0A 4X8XA 3L5XL 4GINA 3C8KB 3MV8E 3GPEA 5AKRA 2Y7LA 4JFOB 4DEUA 5BS0A 5HGBB 1HEHC 2H1XA 1U6AL 1IAKA 2MOQA 5D2LF 2A5UA 4FXGB 2GAZA 2MHAB 5DMYA 3VXRD 1BZ9B 4HMDA 5DQDH 4A7UA 3RWGB 2GFBA 5HJBA 5A2BA 2OI9C 4OF6A 4OZFG 2OSLA 1PPIA 2F74B 2YN3A 3BYTA 4NZ8A 4R4BA 4LDEB 3BQUB 4OLYH 2O6PA 2DEXX 4TL5A 3P3TA 5A6MA 4OLUL 2JCCE 1OP9A 4QRRD 1J8KA 5IG7B 4L4VA 1DHKA 3IDXL 3O6MH 1BX2B 2W95A 3PS6A 4BUQA 2E9WA 4PJAE 1RUQH 1S8DB 4GB9A 5JA8B 3PL6D 4WHTB 5F9DC 2GBVA 2VJ8A 4FYTA 1OPOA 2CA3A 1E40A 3OKEA 4PR5B 3RWIA 4G8IA 3RTQD 3RFZB 5J06A 1RQ5A 4TTDC 1OGTB 1Q9LB 2GK0A 2OZ4H 1F1GA 5D93C 4LRIA 1A3QA 5B39B 4JFTA 4XZUA 5CUSL 3V4UH 1BQSA 4XCNB 2NQDA 3QDJE 3W11D 2X4QA 3MRBA 1FLRL 2OPCA 4RX4A 2UY6A 1F97A 4YXHL 4M6OL 5KVDL 4XNQB 3IMTA 5CD3B 1B88A 4R90H 3QUHA 4F27A 4PGJA 2MPAH 4G6FB 1YEKH 4J3SA 4U6XA 5KG9A 1WHPA 1QATA 4N8VB 2P46B 2HLEB 2N0MA 3K6FA 1I7UA 3UBXA 2Y6TE 4Y16C 2DI8A 2WKOF 1ZAGA 2R56H 2QVKA 1MWAB 3L3KB 4W9JC 3CLEL 3DI3B 4JFFE 4NSKA 4YDIH 4LLUA 2N3JA 2GUOA 4ZQKB 4Q6KA 1UXMA 2QHRH 2ZOOA 3QPKA 3AT9A 4Z23A 3HHMA 4OTXH 4PY8I 4OZIA 4C4KT 3NFPB 3QZBA 4R8WH 1MHHA 1Z9SA 2CR0A 2PCPB 1IGJB 3MGTA 2WANA 3NA4A 4P49A 3W9EB 2FBJL 5I18L 2VR8A 5ICUA 1LP9B 1FORL 1L0XA 3LY6A 3FB8B 4PRHE 4WJ5B 1NZRA 4FFZH 5D2LA 4YEFA 5LGHH 5E94B 4QO1B 3OZ9H 3UJTH 3MNZB 1H3PL 4NXKA 5EF3A 1KGCD 1WCBB 4IOSA 2H32A 2VDRB 2XWBA 3AC0A 2PO6C 1DQQA 1DCLA 4QCIA 1U8QA 3C5XA 3HA0A 5J57B 5A1AA 2HLFD 3B7SA 2ZPKL 5GGSY 1X5JA 2D0FA 4PCTA 2YEZA 4YXKL 3K72A 3UAAA 4ESKA 2QPEB 3UYOD 4AEFA 5E99L 1QFOA 3LXAA 4JX0A 3QUXD 5FWRA 3WAKA 3S35L 3HBPA 5F71A 3OB0K 4GW1A 3ARDD 3HG1D 5KJRL 1HTYA 1CIUA 1T4KB 5GRZA 3ILPA 1IILE 5ID1A 1OE3A 3DPBB 1FFRA 4WEUD 1BX2A 3X1GA 1OVZA 1EFXA 4RGND 4DK3A 1XCQA 4JM4L 4S0SD 3MROB 3KYOA 4JO3H 5E1IA 3WTTA 1FZOB 1K4DB 4TNGA 4QHUB 3SOBH 2IOOA 1QSZA 3MOAH 1SDYA 3H56A 4ACTA 3RAJH 3EG9B 3QUXC 4WV1B 3WE6B 2IDFA 1XWVA 3F00A 2BW4A 1AZVA 3D25B 2PLTA 2AKRA 2FIKB 1KEGH 5C0BD 5PCYA 3F7YA 1OZUA 3TC9A 1LWJA 1RZJL 2QQQA 4I0KA 4BK5C 1QFHA 3QNZB 3SBQA 5GS2D 1Q4NX 3DK2A 3FH7A 4XO9A 1CBJA 4ZMLA 5E7FA 3VXQB 5E8NA 3ULUE 4H0LC 4WI0B 4FFWC 3FTWA 5EO1B 5DHVA 3V0AC 2LVEA 3ZYZA 5ERWB 1OK8A 1UWEH 1YNKH 2HRGA 2HX8A 3QRGH 4IGBB 4B6ZA 3BKML 3H7BB 1KC5H 3S36X 1T5XA 2WB7A 2XRAL 2WNGA 1H5BA 3L13A 5ICYA 4LHQB 4TXVB 2OYMA 4PMEA 2G0KA 4DP0X 1KFAH 5CSBA 5JXAL 4P4KD 3VXTA 2ZX9A 1N70A 1KB5H 3FQYA 4JO2H 1LDPH 1R3LA 3JT0A 4FRWA 3HC0A 3ZTNH 1M9SA 3BUYA 4C83A 3WFZA 2WWOA 2YAOA 4FG2A 1KYDA 2Z7UA 3GHEH 2JKNA 4JPKL 5C0AD 1JD7A 1OTTD 5IW6B 2NRDA 4GRLD 1PIFA 3MX0B 3QO0A 1SMDA 5EBGA 5F1IA 4OUOA 2BOCB 4ZXBA 2WXRA 2V5MA 4X0KB 1IM9B 4I2XA 4X9IA 4ZRGA 3PP3H 3SN6N 2VDNL 5B4MD 4ZMVA 5C09E 1HI6A 5JW3H 4NQCB 1W15A 4M5YH 1EEQA 1I7TA 3ARWA 4XOEA 3EHBD 3QUXB 3UPRA 3TBSB 3EO0B 3VU2A 1T2JA 4TLKA 1JBJA 4LOUD 2R0WH 2YARA 4JZJA 2EVGA 1BIIA 4OCYL 1G9MC 3CBRA 5FFLA 4TOYL 5AAMC 2WLKA 3KS0J 1NGQL 4PCYA 1FH2A 4EQ3A 3WTWA 1LWHA 2D31A 3KPTA 4IRZA 1UC6A 5J4MA 2RGSA 4ONFL 4M5YL 4N0UE 2MTAA 3RE0A 4BSWA 5LQBH 2DN7A 3B1UA 3E1ZA 1P2CA 3P4OB 3BIKB 2FEEI 3STZA 1J86A 4AT6A 5EB9A 2OMXA 1RP9A 2NXZB 1YNTB 1JHTB 3QHZL 4YGVB 3BVXA 5DTFA 5D7IF 3C5ZD 3TFBA 5C9JA 2QQKL 2VDKB 3D9AL 2HKHL 4AYGA 3SGKA 4UOQA 3GJFA 2EKSB 4NZUL 1QSFE 3QI9B 4M5TA 4EN3D 2XZAL 4OZHF 3K1DA 1GSKA 3MRDA 3HLAA 3N5AA 5FW7A 4MDIB 2J1YA 1J8HE 5AAWA 1RUMH 5CN2A 1KJVA 2X44D 4WKXA 2B7DT 2D0HA 2HT2D 3O4OC 3RHWK 3ULSA 4POUB 1IC7H 2XRAH 4NQEE 3CLFH 2MCMA 1JXKA 1Q9OB 3X2QB 1KC5L 1KXTA 4ELKB 1DFBH 2DI7A 3OG6B 1FGNH 5E8EA 2ODHA 2FZ3A 2L04A 1A1NB 1F4XH 2Y24A 3B5GA 2Q3XA 2G4EA 2YKLL 4CRPA 2OTWB 1NGXB 3DV4B 5IHHA 3C6EA 1H9DA 3AACA 5IOPA 1RK0A 2QQNL 3TNNA 5EMYA 2X9WA 3CN0A 2BNQA 4XVTH 4ZTPH 1G1OA 4EI6B 3T0EC 2NR6A 4WCYL 1DQDL 4CC4C 1XR9A 4M5ZH 2X4TB 3O0RH 2WK2A 3AY4C 4Q56A 3PXLA 2OP4L 3QNFA 4MTMA 3T71A 2OCJA 3X13A 3VTMA 4AMKH 5AFAA 3SOBL 4APQB 5CLYA 1WBXB 1N0XH 1O7DC 5B1JC 1ADQA 3FAXA 4JJ5A 2Z34A 1KEMH 1UATA 4XH2A 2BJMH 2EUZA 5KVGL 4FG0A 3F7KA 4BQ8A 4MJID 2VISA 3FT3A 5E08L 3FQ1A 4JFEE 4HVBA 1LNUB 4JVUA 3G6JE 3D3VD 4GIOA 2EDMA 4LSRL 5E4EC 3P02A 4DPBX 5DZPA 4QEGA 3RWJA 3SGEH 3EH3B 2WXMA 3AB0C 2VLRB 3NZUA 4G83A 1AACA 3TA3A 1J1XH 1I8AA 3RPIA 4NQVA 5E70A 3K71B 3VFGH 1YJDL 2PCXA 1NFDA 2LV4A 3LD8C 4YO0B 3MA7A 1O9WA 3VGFA 3S3JA 3T8MA 1VGKB 1QBLL 3FQXB 2PW1A 1F4YL 1AGBA 1ODUA 1TEFA 2XZAH 3DGGB 4NQDA 5T5NG 2QL1A 4LQFH 1NGXA 2WQXA 3DV4A 1GRWA 4XVUC 5BOZG 5ANME 2WINA 4JY6B 3LXCA 4HJ0D 1IBZA 3NIFB 3VFUA 1YUKB 2YAQA 1EAOA 2P5EA 3HRZC 2NY6C 4PSRA 1I9RL 5GS0C 2OYPA 2OJZL 1AZUA 2LU7A 1E7UA 3GTTA 2DYSB 5DFVC 3D85A 3MUUA 3PWPE 4Z95H 5C0ND 2YGQA 3WFDL 2QPFA 4HZ1A 4KKQA 5C0BA 2ESVD 4GG6F 3BWAB 3D4YA 4JG1H 3JV4B 3BUDA 1QTYT 3I02B 2IPTH 3QI9A 1AQKH 3FUMA 1YPZB 1GW0A 1JUFB 2Q3ZA 3I9GH 3FZUC 1GHFH 2UWEE 3QFDA 5AB1A 2JTYA 4FNTA 4PJFA 1IZKA 2EE3A 1LM8V 4UINL 3FO0H 1PKOA 3NCEB 4TRPH 1OAJA 3LB6D 4XPTH 4S1SL 1CGTA 1DVUA 3L6FA 2BWDA 5D1QA 5AOZA 3SE8L 4F93B 2K9FB 1HHJB 4ZW3A 4H4NA 2ITDA 1BVKA 3SE4A 1XL6A 2JVUA 3WMSA 2DMCA 1Y07A 4N5UA 2NUPB 1U8LB 3HC3L 1WC7B 2VO5A 4CU7A 4GNKB 4PJEE 1UG9A 2QR0B 3BD3A 3ILQD 2IPUK 5CIPH 1L6XA 2QZ5A 2WMPA 3PXHA 4XTRD 2ZNXA 4EBQH 4Y9EA 3OB8A 1UXSA 2NY2D 2UUDH 4EDXB 3CHOA 1LEIB 4XWGH 1E65A 1LK2A 3MRCA 1U8NA 1T83C 5DJ6B 1F6LL 1HEZB 3DX2A 3LKOB 3LZNA 3QS2A 3U7AA 5DMIH 4BK4A 5JDJA 4UTBL 3D0VB 3EJCA 4DWHA 3CXDL 1I3UA 3X1NA 3MNDA 5I1JH 5SWQB 3VO0A 4W4NA 1MVYA 2WIIB 3CD4A 1SUJA 4K4KA 4ZNEE 4K71B 1MCLA 3G5WA 4PP2A 4XO3A 4AYFB 2VAAB 3HC2A 4HYTB 1THAA 2I5YH 3ULUH 4NJAL 4DOHE 2OMVB 3D69A 1GW6A 5C09D 3RDTD 1XF5A 3AREB 2VH5H 3IXAA 3WHE0 4UMSA 5E9DE 1NGZB 4WFFE 3QHTC 2CM6A 3D0VA 2V6HA 4NSKB 2WXNA 5FK9A 2UZXA 1M1XB 4WNQB 1HXKA 3OKMA 5FHAL 4W1TA 1CFSA 1KN4L 2GITA 2VWEC 4OF5A 4AE0A 5EU3B 1GGCL 1RZKL 2CAKA 2EDYA 4EXPX 4OY9A 4I1NB 4A2HA 3H55A 2V3FA 3N44F 3G6AA 4M48L 4EN3A 2XUWA 1ZHBA 3FQWB 3QUKA 5C08A 1MELA 1PF3A 2J8OA 3S35H 2QQLH 2R2BB 4I3GA 5DVLA 1A02N 3RL1A 1T1WA 1YMHB 2ATPA 4J3OH 4BINA 2X4QB 3MRBB 3KXFB 4NAJA 4UQ3B 2A73B 2NY6B 2W92A 2X7LA 1QNZH 3LNFA 3S37L 4D7PA 3HI1B 2CGZA 4WU7B 2NCEA 1N5AB 2QSCH 3BZ5A 1OSZA 3FT9A 4OJFL 1C8PA 3M88A 4CC0A 1GYWA 1PJ9A 1PNCA 2VXVH 5EZIH 4DW2L 2OMZA 5HD8D 5BW7C 1H6UA 2G3XA 3P77B 1CZ8L 4LPTA 4LVHC 4Z7VF 4KXAA 5AOMA 1TJHL 4ALAH 5J1TC 3M1BB 1TVBB 2BX5A 2ZT9C 3II2A 3VM5A 1MJUH 2BVQB 1ZDSA 4ODUB 1Q0XH 2WKLA 3EFDH 4G2AA 1J5OH 3QSKB 3OMIB 4FMKA 1FNGA 5F7DA 3R1GH 2JK5A 4KXCA 1I7RB 1A6PA 4NO3A 4ODSL 3VD4A 2FWOB 3L2NA 1T21B 2H6OA 2BCMA 1DL7L 4LP5A 3QI9C 2JJVA 5EO9A 3UAFA 2EP6A 5BZXA 3V2AR 3E2HC 4GFTB 3E3QC 3DRTB 4ZAKB 3TFKD 4HMEA 2OTUB 4KRPB 4AEEA 4MQXC 1WFMA 1H3TA 3VXTB 3FB8A 1GAFL 1U8NB 4CN1A 1IL1A 2FYYB 2XU9A 3BLPX 3OJVC 3STLA 4FHJA 1GJIA 4K9EL 3VXRE 3BUTA 3V6OC 4AG4H 1RZIB 1U8IA 4YS4A 3WLBA 3O8XA 1G43A 2CQVA 3KBPA 3O3AB 3O2WL 3MV7D 5T1KA 1A2YA 3IETB 3FQXA 3IPBA 3CG8A 1FLRH 2CBQA 2BSSB 4QY8B 1NBZB 2C5DC 3QNYB 5AVUB 2WBJA 2E9IA 1HI6B 4A2GA 3KYMA 5D1ZA 5K9OB 3IFOA 1K3ZA 4QHNA 3MUGB 4L4TE 5B1BB 3EUDA 1QVOB 3DX7B 3NSDA 2DQEL 2P42B 3PCYA 1R5VB 4IM8A 4PH8A 1HNFA 1I9JH 3U25A 5DI8B 5DR5L 4FNLL 4Q2ZB 3WLWD 2M26A 4RNRA 3C60A 4I4WB 2OSXA 2QV2A 1IKNA 4MGXA 5EN2B 5GJTL 1IC5H 3N42F 3SCMC 1BZ7B 3NCFB 3QNYA 3W0WB 1J1PL 2XPGB 3WJLC 3FUNA 4NYLA 1CFVL 1PZDA 4Q6IC 4R26H 2JKJA 4KI5D 4F5CE 5MI0C 3SE9L 1LMKA 1OXYA 1AD9B 2F19H 5E8PB 2FD6H 4M6ML 1ILSA 1H3WM 2C9AA 4Y16D 4A39A 3AITA 5GS0H 4N2IA 1UB5A 5EO1A 5D6DA 4URKA 1AR1D 4FA7B 3BP5A 3IS1X 3GMQB 1KYFA 3PY9A 1IQWL 2KLSA 3H9SA 3UDWC 4WFGE 2XXMB 4KC3B 2EQDA 4FA8A 5CJBA 3ZE2B 4RMTA 1KENH 3QUYC 4FQQB 2FZ3B 4L3ED 2OZ4A 5IT2L 3L5XH 2X87A 5BRZE 4R4BB 1SXNA 3RZCB 1KG0B 1PD1A 5CMAB 5C6PB 1LVEA 3NTCL 4CMHB 2WUCH 3KL5A 4GRMB 3C6LB 2DYPA 4LEXH 2CWRA 4ORZC 2XTSA 5CM1A 5IB3B 3DSFH 4LCWD 2KQNA 1VADA 2FUTA 4KKCD 4XPHL 1DQJA 2GI0A 1A4KB 1ZTMA 5CEZL 4E0RB 5B1JA 3MRJA 1DBKH 4Y4HC 2Y07L 3OWRA 1M57B 2AXHA 1FCCA 1IGYB 1PGRB 3BO8B 4LHUG 2QSQA 4W9KC 4XB3A 5CEZH 4F8PA 1XGUB 4IEFB 1VEMA 5F7FA 5CD3A 3QQDA 3SQBB 2NTSP 4HPOH 1UKSA 3RA7H 3QO0B 5LNEA 4YSPA 5I75C 4XAKE 2OULB 2A3TA 2DF3A 4DETA 4LSUL 4QXWA 4K23H 1EAPB 3RBGA 1VAHA 1O5PA 3BP4A 4HH9B 5I9QC 1W72A 3ZE2E 2H2SC 4TSCL 1DR9A 1BLIA 2WTOA 2HLFC 4H88L 5EU7E 5CGBA 3DVGA 2CO2A 3UO1H 1TZGH 1A7NL 4FOMA 5KZCB 3K81A 5C6TH 5E6UB 4AEIH 5F1OB 3HOGA 3FW6A 4P5SA 4PJGA 4GUPB 2FJFB 4YQXL 4MAUH 4QRRA 5HP5A 4PP1D 2IDUA 4I5BB 2R4RH 1NQBA 2XI9A 5IQ9A 2CBPA 4CC1A 2WM0A 3RWHB 1U8HB 5ITFB 1JZ2A 1T04A 1ZPLA 2VWEE 3SDAA 5EZPA 1P7KA 2P52A 3IMVA 2ADJB 1EXHA 1I1FA 1QYGL 2EEAA 5CCHE 4F2ME 5FEBA 4EAEA 1IEAA 4Z7QE 1FYHB 4LBEB 4BJLA 3CIQA 4GXUN 4Z7WE 3C9NA 1RKRA 2VLJE 1CYXA 4JRLA 2YRBA 3FO1B 4MLSA 2Z35B 1CXEA 1IAIM 1WAEA 4PLJD 3K8MA 3ESOA 2BOLA 5FYJE 4M8QB 1R3HB 1PD6A 1WITA 2BFGA 2KT6A 1KXQE 2D3VA 2NUPA 4HKBA 1HDMB 1RP8A 2F7QA 4HXBH 2V7HA 1I85A 3MNWA 4UDTA 4NQEA 5KYXA 1NAMH 3MLZH 5SX4H 3MJ9A 3RX8A 3O4OB 2CXKA 2FX7L 2YEQA 3O3EB 2NY3C 1U2HA 4IOIB 4Z3HA 1FN4B 3HZYB 4ZMNA 2R1XA 3MACH 4YSAA 3IXTB 3NP3A 4FULA 3LVTA 4XPFL 1MCRA 3ESVF 3KYNA 5SWQA 3WOVA 1ASPA 2HFFB 1BQKA 2A6JB 1SBBA 2CO7B 4PGEA 1J5IA 3MJ8A 1RUKL 3AMKA 3V6ZA 4OFDA 3GJFB 3MPCA 4NUGH 4J12A 4W93A 3CVIH 1KPUA 2J8UF 3L1GA 3FQNB 1A6ZB 2P5WA 1FYTA 1J12A 4P5TB 1A3LH 1T7XA 2QELA 2R2EB 4PJHF 2X4TA 1PKQE 3LQZA 3CZUB 3K8KA 4LEOA 3BH8B 4N6RA 3D2UA 5IEHA 4LPYA 5GRWA 4EIGB 1VCBC 3C09C 4FTVD 4Q9BA 1I9EA 1TJMA 3T4YB 1OE1A 4IJTA 4WUKL 1J0IA 2H32H 4Z7WB 4QRFA 4EOWL 2AEQH 3OLDA 5DD1H 5JHDB 3QWRA 1E4WH 4NN7C 2VDOL 4U1HA 1XTLA 1HQ4A 1KNOB 2BIMA 5F44A 4FD0A 3IDMA 1PSKH 3HVDA 4JANB 4WFED 5ABZA 1Z9PA 2W0PA 4N8VA 2YLHA 2GJ6A 3DPDA 2OCFD 3SBRA 2WQRA 4AX3A 1FNHA 1PZCA 2O93L 1G7MA 4I0PA 4TLUA 4C56B 2H4EA 3UCRA 1D5BA 3H7LA 5AW8B 2KLRA 2IALB 4NT6A 3ULVF 1QZNA 4OB5L 3QR2A 1QRKA 3A4DA 4PGZA 4Y5VC 2EUVA 1AXIB 1CICC 4G5ZH 4Y4KA 2X05A 1SVBA 5HHMD 2OMZB 4LL1A 2C7UA 4IHOB 1UD8A 4N0YL 1KACB 5CEXB 4Y7MA 3AUWB 4HHAB 3ZHLA 1DQLH 2IGFH 2PO6D 2Y1YA 1RCYA 4RESB 5MEOB 1GVIA 1B6DA 1RZKH 3GSXA 1VFUA 4R3SA 4LBAA 5BNXD 5D7IA 1X5IA 2NSXA 4L3AA 4GQ9L 1FZJA 2HFGH 4JHWH 1FF5A 1LO3H 4MA3B 4WHTA 2AK1H 1CTMA 3B2UD 4GXVH 4W9DC 2K6WA 4WW2B 5D5ME 1CD1A 5IB5B 5EDXA 2WZPA 1J1OL 3CC5B 4Q6YA 2HVBA 3F65A 2J5WA 2Y7MA 5IROA 3ROLB 2VUOA 3NEEA 1FL3A 1MUJB 2YC1B 3L95B 3CFJA 4NO0A 5EWIL 3F7VB 4R4ND 3HVNA 4A67A 3SE3A 3T8XB 3WMPA 2WWKT 1JTOA 4OH2A 1UD6A 5ANHA 2O5NA 3MFGB 1SEQH 4FTVB 3EGSA 2AGJH 5FDWB 2GJPA 3FCSA 3KYOB 3I74A 2VDKH 5DFVD 3T0EE 1G9ML 4X80H 5LBVA 4X7DC 2XA8H 1EMTL 3NIFE 3V52L 1CGUA 3QUYA 5JIKA 3VDAA 5HI5C 1W0VB 1WAAF 4P48A 3KL3A 3ARBB 5TD4A 4KXZH 2AV7B 3PLYA 2IJ0C 1GGTA 2VDLB 1AQDB 4FJ6A 5AOLA 4OZGA 3S3PA 1YECL 2VLLB 4AENB 4NIYE 4NJ9H 2V9QA 4NQVB 3K71A 2J73A 3KLHD 5GGQH 1U92A 2FTAA 3Q1EA 1CO1A 5H8DA 1REIA 4NDMA 2OV0A 5SWSA 5F6HJ 3WL9B 5KANG 1NCTA 2P5WD 4G1MA 1YPZE 3I6GB 4G6FD 1BJ1J 4XVUD 5TQ2H 5JDSB 1J9SA 2X3CA 1KIUA 3C2AH 4NZRL 4NLHA 1K5WA 4KXDA 3GMNA 2WMPB 2VISB 4OLXH 1U8PB 1XF1A 5EIVA 4Q9QH 2I60H 2WVVB 4FZEL 1EFQA 1LK2B 4I0PD 4JKMA 1HKLH 5DQ9B 3DX6A 1ZLDA 5HHOA 3BUYB 1XF4A 4NHUB 3TYFA 4AQ8C 3E3QE 1LO0H 3F05A 1YYLH 3VDCA 4LLDA 2LVCA 3FTYA 2OMNA 3RNKB 5FYJH 3ECVA 3IYLW 4P2RB 3DHPA 5HYQB 5L7XL 5EV7A 3V0EA 5BRQA 4GQPH 1LQSR 3RKDC 4MNGE 3KWVA 4ZW7A 4PG2A 3SQOH 2YXMA 2R2BA 2X4PA 1QMUA 3DX9B 2A77L 1PQZB 5A2CA 1L9NA 1C5CH 1A25A 1NA8A 3DX6B 3LH9A 4NQTA 3STLB 3IJ8A 2Q8BH 3QJOA 3CFQA 2PWGA 3UEZA 4Z3IA 2BWIA 4B9KC 2CHDA 2BNRE 4XNQA 3DHUA 4KROC 3H1ZA 1S7UB 4JAMB 4POZD 4TQPA 1N64L 3GMQA 3NEOA 5B38B 5GS1C 3SHSA 3UC2A 1F3JA 3WE6A 2IAAC 2R0KH 3LPFA 1NLDH 3TVMC 4M6AA 4S1RH 1LP9A 1I3RA 4A6YB 3BVNA 1RZFH 4QYOB 5C9JB 2AQ2A 4UUJB 2WPGA 3VE0A 4UM9B 5HI3D 4Z78B 2IEPA 1FJ1B 2BP8A 2ZWKA 3WIHA 1IT9L 2VLMD 5IB2A 4I85A 4FJYA 4KROD 2EDJA 2VSDA 1S8DA 3DXAA 2QDVA 3U0PB 4GOSA 5EBMB 2CLVA 4YSUA 1LO4H 1UA3A 2VMJA 2QMKA 2ZWNA 4OFVA 5F6HI 2YXFA 3QDGA 4KQ3L 3FQUA 1A6WH 4G9DB 3HHSB 3O0RL 2NY1B 4OD1H 2W60A 3VXUD 3PG2A 1Y0LA 2X4SA 4WCYH 1IGCL 4A2MA 5MEPA 4FQXA 4GI9A 4OKVA 3K80A 3PWLB 4ZOAA 5DRXA 1ACYL 2WB1A 5HHXL 4DZBA 5AVYB 5KVEH 3C5SA 1KB3A 3HRZB 5JOPE 3DVNA 2QGEA 3P3SA 4FLQA 1YG9A 2E7DA 4PJHA 4UIMB 4OIFA 2AI0H 3OHXB 5EBMA 1KTCA 5TF1H 2EDNA 3U0WH 4G1MB 1XB6A 1RIUH 2RB8A 1SJEB 1NWOA 3EG9A 3KPSD 4HIXL 4QPEA 3HG0A 4GYBA 5IF0B 3I84A 4DQOL 1EXGA 4OV5B 5HHXH 1OARL 1KY7A 1ETZA 1NCWL 2B5IC 3UTTE 4EKJA 1ZT4A 4LCWA 4NM4L 2CBOA 4WO0A 4BZ2A 4NC0B 2PCYA 4K3JH 3LOWA 2ZOKB 5A2KH 1AQ8A 2RH0A 5DK2A 3AQDA 2H9GB 2DYPD 1OT4A 3BHBA 2R7EB 4IGBA 3PYCA 4D9LH 1U8KB 3U79A 3F62A 1UD2A 2FHCA 5B1CA 5F9JB 3QHZH 4F7TB 1WZ1L 3FO1A 3U6RA 3E6HB 3BDYH 1MFBL 1EPFA 1RZ7L 4IJ3B 3SGKC 3VG9B 5DHEA 3ZKND 4QF1A 1FUNA 5AL0A 1KV3A 1VPOH 3K4AA 1CLYH 1SVCP 1XMWA 5ENWA 1NGQH 1NFKA 2FK9A 4X5XB 4QRUA 4UM9D 3WXWL 4A7QA 3DXAD 1UM6L 2VW7A 1MNNA 4NQDB 4HUVA 4W81A 1RIHH 4LCUA 3MCKA 3S0PA 5IBUB 3V5DA 3OXRA 4UM8B 3UBGA 4C55A 4F1ZA 3KJ6L 3TCLB 4CJ0A 3G3LA 3GIZH 3RU8H 4J8RB 1NDMA 4XP5L 4Y2LA 4ELDA 4X7SH 1N5AA 4AXWA 4JG9A 2DW5A 4NRZB 4BFOA 1TU2A 4PR5A 3JTTA 5I16A 4JREC 3HE6B 5DQJA 3U46B 2HG5A 2NY1D 2CO4A 3C5ZB 15C8H 3TBSA 1DVQA 3VNZA 2GSIB 1YEDA 4PJDF 4B60A 4M3KB 5CEZE 4XNUL 2V0AA 5IBTH 1MRCH 2X6BA 4YUEL 3HUJE 2R1WB 1JUFA 1W0WB 2IDSA 32C2B 4P2QD 3VXPB 3PUCA 2F54B 2F1EA 2PPAA 4KMTH 5F9JA 3VVVA 2CD0A 3GMPA 3RG1C 3ZUCA 4ERSL 1GYCA 4X6CF 4BRJA 2F53B 2XIDA 3ILQC 4ZX4A 1PW3A 3E2HB 4R83A 3WGUB 2OA9A 5BUAA 3II3A 3RKDD 1J9RA 4ETQB 4KAQH 1DVFA 1QEXA 1CDYA 1JGUL 4P2OA 3ZHDA 3O2DA 2WGXA 3WU1A 1NCDL 4HKXB 3Q3GA 5C0IB 3FB5B 5ERWA 5TQ2L 3RB7A 4OQTA 3DIDA 1NC4B 2G5RA 2K6YA 3QXDA 4LLQA 3D52A 1H3VA 4FNRA 3AQYA 1NSNL 4ZFGH 1OZTG 3BUIA 3BH8A 4WY7H 3G5YA 1HHGB 1JGLL 4JY5L 1PLBA 1XGTB 2L7UA 2N4IA 4EE2A 3VYPA 2HH0H 2ZSVB 4HISA 4NHCL 4XBPB 3U4BH 5IMMB 4XHJC 3O9WB 3M7OA 2RALA 3OMZA 3UGEA 3FYIB 3FSOA 3FUDA 3V52H 4PJ7F 4HS8L 4HUMB 4Y4HD 3CDZB 5F1NA 1N12A 4WDIA 3WTSA 2R0ZH 4OQTH 1GZHC 2EXYD 4G6AD 5D7HA 3IB4A 1H6TA 1XDTT 2MKLC 4PJFF 4AKOA 1MZYA 1JF1A 2XTJE 2OMTA 4JDTL 5D1ZD 2X3BA 1UUSA 4PIBA 3QJSB 2RHEA 2R51A 1G7HA 3PWJB 4GW1B 3C87A 4QXUH 4APXB 3MV01 5EU5B 1FJ1A 4X99B 5IQNA 2OK0L 3DMMB 4G72B 4GG6A 4F7PB 1KCVL 2C4XA 3ERXA 1SNRA 3FKUS 4FQ2L 5DJXA 2VQUA 5HVFB 2CH8A 5DVPA 5KYXB 2J1WA 1TZAA 3EO1A 3LS5H 4YLCA 3ZQ9A 4GAJL 4JHWL 5AVZB 2P3YA 3A47A 4BKLA 3R06A 4WU5A 5C7XL 5IOPB 2X1XR 4ANUA 3QEUA 5D2NC 1XIWA 1CVRA 1TZ8A 4D9QE 4YDVB 1NMAH 1KBGH 4I2XB 4ZSOA 3WEMA 2ZKMX 4UBDD 3VCLB 4LLVA 3HS0C 2F53D 1ED3A 4P8QA 4Q6IB 4DFIA 4ZMAT 3FONA 1A1OB 1V7NL 4NAQA 3QDJB 3LRHA 1HX0A 3EJUA 4AIZB 2FL5B 2FECI 4NPJA 1IRAY 1BF8A 2EDHA 2LFEA 4XHQA 4TVSa 5D4IA 5EC1A 4YDIL 5MHSE 3QDMD 2WINB 4IEFA 3B7YA 1DLHA 4YAQA 1HIML 3GEWB 3PHAA 3X12A 3TBYB 4PVBA 4OZIB 4ZD3L 3PAZA 4PRPD 4FG6C 5GJSL 3U83A 1TQBB 1TZHA 4WHYH 3KW7A 3HBZA 3ZTDC 2PWDA 2AQNA 2WUBH 4OLVH 4ODHL 2WN2A 4WNSA 1MFMA 3RPIB 3QJVB 3I75B 5DK0B 1V7ML 5E2TH 1MPAH 2VMCA 2BH0A 3GUTA 1MREH 4L8CB 4FTVA 2EXWC 5FDWA 5KYWA 2XWCA 4U1LA 5I1DB 1ND0A 3DVGB 3GM8A 2IWEA 4GO6B 4XXWC 1DQML 2VJXA 2GY5A 3UZQA 1JYNA 2AXFB 2Y4SA 1KCSH 4DPCX 3QXWA 4UZGA 3OX8A 3RZWA 5EU6E 3EYFB 5E1QA 4D0BA 1TOXA 4KJPD 4NZTL 3GSRB 3OPUA 1H8SA 2FJGB 2Y7OA 5F7HA 5IJCC 1YY8B 3HZVB 1JRHH 2H0FA 3QDAA 3RGVB 2GTQA 3QCUL 4M1DL 2IANB 4YSEA 1U92B 1HXMA 3VXUE 2L3BA 4ANVA 4B96A 7FABL 5BS0D 5B3JE 4TKWA 5D70L 3L5WB 1HL9A 4NENB 4AV4A 3KJ4C 1RUKH 2P9RA 5AVXB 3REWA 3VM7A 4KVPA 5JW4R 2JKRM 1RZPA 4JGNA 3VXOB 2ZX7A 2WD0A 3F64A 5CEXA 5T1KD 1O6SB 1L7IH 4UV7H 2KYIA 3GSNL 1FG2A 1D5ZB 1A6UH 4CVUA 2W65A 1GH7A 3G5ZA 5TQ0H 1ASQA 4XRCB 1SBSH 4PJ9B 3ZDZF 4HK0A 2J43A 2YFNA 3CXHK 5HDOA 1H5BC 1WFIA 3QEGH 4LU5H 2WBJC 2OW7A 3W0WA 5K9JH 2ENYA 3E6FA 4UQAA 2R23A 3JBG7 1P7KB 1Z5LA 5AW6B 4UQ9A 3RWGA 1JMZA 1UB6A 2B1AH 1WT5A 3BWZA 3CFKA 4HBCH 2DQIH 4MBRA 5DHVB 3NH7L 1P5UC 4PYHA 1A8ZA 4E41B 3ZK0A 4LBEA 5L8LB 4K5OA 3DLQR 2V7NA 3HC4L 5GRUL 2BP0B 3EHBC 2FJGA 1KJ2H 3I6KB 4I48A 4HK3J 1PAMA 3NSFA 3O3BA 2WQ8A 4HKZB 4MJ5A 4Y2DD 4GAAA 5I6XB 5DZJA 3U1QA 5F9WC 1WK0A 4AIEA 5HVWA 4GSRA 5GSVB 1BFVH 1G87A 1DBAL 4QUOA 1HILA 1Q72L 3I9PA 1XGQA 4NPYA 2IADB 2BVUA 1H6EA 2WBXA 5CU5A 4TQEH 4J3OD 4UILL 1DLHB 2YPVL 4LGSB 3D4CA 3Q3GB 3VWKC 4AYFA 4BA0A 2DS4A 5CEYB 1RJLA 4X6EB 3P73B 2B1HH 3VXOA 4L3CB 4G6MH 4Z76A 2FO8A 3WD5L 4LIQE 4EN2A 2GT9B 3VRIA 2BDNL 2DOCA 5CFHA 3ZR5A 1AC6A 3DHMA 2HP4A 3QORA 4MMXC 4AVIA 4U6TA 1XT5A 5ID0B 4CUCA 4KK5D 4N22A 5JR1L 1XCTB 1FRGH 1MHCB 5JDSA 3ULUC 1LP9E 4U0RC 1I3VA 3A4FA 2F8XC 3MV8D 4V11A 4RWHA 3REVB 4B7LA 3TP4A 1QOKA 4JMNA 3LEVH 3JWNH 5EOTA 2VR5A 1DANT 1VB9A 1NGPH 3X11A 3V8CA 5B38G 1AY1H 2FX9L 4FKEA 2FT7A 4AW4A 2PR4L 1XEDA 3VFVA 2J6WA 4AIXA 5LXVA 3ZBMA 3LRSB 3MV9E 4LIQH 4NNYA 3T6XA 1DDTA 1GOHA 4FQCH 3Q6FA 1D7DA 3B37A 2VYRE 4I87A 5J1AA 1EO7A 3VXNB 4WUUA 3OKYA 3WD5H 4NN7B 3HMXA 4QHKI 2XY2A 3H2QA 2X2YA 2BK8A 1NAKH 3U0TB 3TWCH 2AVFA 3JWNG 4D0CB 4ZTOL 5FOBA 2XXCB 5IJKC 3GTNA 4PV8A 2PWFA 3FU5A 4KI5E 2YBRB 1PFOA 1ESOA 1KGUA 2ZWLT 4KHXH 1PEWA 1D5BB 2DLEA 1A3ZA 4X6CE 1M1XA 4JL2A 5KJ4A 3PAVA 3A6BH 1EHAA 2ZOKA 2DIJA 3W9DA 3PGCA 5GGUA 4RLDA 4GUQA 3PP4H 3X3GL 1AI1H 2O6CA 1NCBL 5C0JA 3D18A 4WGVB 1RK7A 3ORJA 3QA3B 5DC2A 2PPCA 5D71H 3W2DL 4JQIL 2DWTA 2X9XA 2B3IA 2NSMA 4XMPH 2RCSH 2ROXA 2I9LB 1F90H 4QAMB 1S7QB 4PJ8C 3HZMA 3SBWC 3TONA 3L81A 5CKGA 1G1CA 5GGVH 2DWYA 2DLTA 3UGXA 1BAFL 1KTLB 3VFPB 4PVMA 4Q2ZA 1A7QL 1IU1A 4YE0A 5IW1B 4OUUA 2QVTA 4N0FB 4L3EB 4H8UA 3WO4C 1UXSB 5GS0D 5MP6H 2FNBA 2DDQH 2CUMA 3EDEA 3LIZA 5I5RA 3US0A 3DX9A 3TV8A 2XXGA 3SE9H 4AQ8A 4CSPA 2IGLA 3L1OL 1XGYH 5I0ZA 2EKJA 3VTAA 3KBHE 5GGRA 3IDUA 2FNWA 2J88H 3QUML 2OMUA 3PFQA 1QVOA 4JPIB 3WHXA 3PNWA 3QXTA 3AS1A 3N2JA 1SDDB 1NCBH 1TSHA 2ENSA 4PJXB 5H94A 4ISVB 2EDWA 4CGUB 2G3MA 4S1QL 5BZZA 4QLRA 4XX1E 4JM2D 1AD0A 2FECL 4HWZA 5I30H 1AZBA 1E5UI 2VMDA 1QNIA 2DQEH 3BDXA 1KUMA 1B4LA 1NPNA 2HTKD 4YFEA 1C7SA 2DQFA 2WVSA 3IDIB 2VB5A 1QFUH 3V6FB 4NZTH 4ZTOH 1JDDA 3D69B 1T1ZA 1G9EA 2NUTB 2JNZA 2H1LM 1W72B 5JMRA 2WTPA 2BP8B 1ZJAA 3LV3B 4PJ8A 4JQXC 5LN4A 4XWOC 2AK4A 1BPLB 3M6DA 4R5TA 2E86A 2DKSA 4XBEH 4XPGL 4LLYB 1XGZA 4PAZA 4E42A 4E9QA 1WS8A 4DEPC 1M2VA 5KVFH 3KMDA 1AGCB 3GXMA 5A16A 1XH3A 2PR4H 1UFGA 3SB3A 1UACH 4U1GB 3FU0A 4DN4L 2G60H 1KJ2A 5DVNA 8PAZA 4LSVH 2H47C 3F85A 1PZUB 2R2HA 1BCIA 1T1ZB 2QGDA 1JYWA 1NC2D 3QUGA 4OGYH 1D7FA 2CIIB 3IFNL 3MRJB 1HIMH 5J5EA 2AQ1A 2HX9A 3LN5B 4PWHA 5AKVA 4ZMWA 1KGIA 1BVLB 3TNMA 3BHBB 1TITA 2JKTM 4MZIA 2M1KA 5JR1H 3TPUA 2XACC 2XJKA 2XG4B 4HXAH 3P3RA 3VGAB 1IBDA 3QDME 3WSQH 3U6XS 3HKFA 3KPPB 1SJEA 3WJJC 3BQUC 5FGCE 3D4ZA 1Q1JL 5H37G 1QKZL 2JELH 2C9UA 4N3TA 3T6QC 3HG1A 4NRZA 3BUBA 3NJIA 3VG0H 1XCXA 4UNVA 1MCHA 4OV5A 3THMH 1UWXK 1HE7A 1R24A 1MFUA 2Q7YB 4ZX6A 1NOAA 2XBTA 5CP7A 3LMJH 5JPMC 1P4UA 1QSEE 3L3GB 2XFGB 5ICXA 3B2DC 1JGVL 1QI5A 1DBAH 1BFVL 2XWRA 1YNTF 2YA2A 2LE9A 1WHOA 2R9HD 3J07A 3V6OA 1S5IH 3UAJD 4P5TC 3O4LD 3VFTA 4MZ3A 4NGHL 4B95C 1RJZA 1FYTE 3KPMA 3NZHH 4L3EA 3PGFL 1CXHA 4X50A 4I5BA 5MEPB 3LZPA 3Q7JA 1RURL 2VE6A 4MAYA 3Q5YA 1CN4A 3SDXE 5BZDA 1X7QA 4IDLA 5EF0A 2K8QA 2JJSA 3D06A 2VR4A 4TULH 3ZE0F 5HYSG 2ERJC 1OW0C 4KK6C 3L9EA 1DVFB 4O4YH 2PF6A 4OCXL 3CLWA 4L9LC 2EAEA 1N5YH 1MDTA 1SYSB 4NN6B 3VFTB 2YD5A 3E8VA 4JZNB 3NACH 4XP4L 5CJOH 4WY7L 5AYUL 4F33A 3VWKA 1A6UL 4HZLA 3TA3B 2AXGB 2D7QA 3JWDL 4H1LG 3FFCA 2DQCH 5DD3H 2ZAIA 2EYTB 3U0TA 1TQCB 3NPZB 1JMXA 1KY6A 4J4PA 5D1XA 5I76B 1UA6H 2RFXA 3MTXA 3BSZH 4F15C 2OXHB 1WE5A 4H8WC 5LUMA 3KCPA 4N8CH 3KM1A 3UTPE 3I6LE 3ZKNC 1FPTH 3QIUD 4F8LA 2PABA 5LXGH 4HFUH 5CINL 3UADA 2WXHA 3PWPD 1SHWA 4KGJA 4J27A 4GAYA 2FJHB 1MHEA 4NUJA 5DMIL 4XMVA 4YSQA 1QA9A 2G2NA 3D3VB 4W9CC 4AWJC 3IMUA 4V1DB 2X4NB 4G8GD 1IQDA 4M7JH 3Q2CA 2HB0A 3N85L 3TO2B 4DT2A 1G7HB 2FBOJ 5DEFB 2DQJL 3CPLB 1S9WA 3GJEB 2OXGB 3V5DB 3MRMB 5FO7A 4F7EA 2IH3A 3PJSB 3MRLA 1AFVL 3QIUC 4P2CG 4M93B 4OJYA 3NSJA 4ZQTA 2ICES 4ZUTA 2JCWA 3BKYH 4JFHE 2EABA 3MV9A 4HZAA 3P4NB 3MN8A 3F5WB 4ODHH 1LYQA 4MSWB 4A2EA 4QXVA 4BWWA 5KVMC 4MB5A 2ZCLL 2GTZA 5DYOB 2X4UA 2G75B 4HW6A 4DP9X 3HBGA 3ETBJ 1OIOA 3FO0L 5ITBH 3QJUB 5F6IC 2KS0A 1RUAL 1HYRC 1S9YA 1SY6H 2V5TA 5T3XL 1KNOA 3ZL2A 5KSAC 5HHMB 2N56A 3FUHA 5F1SA 2P80A 3MRDB 5FYLE 5G5DA 1F5WA 4OCSL 3GSWA 4MA7H 1JWMA 1E27A 3SCMD 3GZPA 3WFBH 2ESVB 4JJHA 2VLKD 4YXLH 2Z31B 3P73A 1PQZA 3H7BA 3JVFC 3ZDXF 4PV9B 4A63A 3ZKXC 4WWKB 4FMFA 3FB6A 5DC0A 2W5PA 2BP0A 3STZB 4BWUA 3POCA 2O6DA 5F7YC 2ZJSL 4UB0L 5ESQB 3UTSE 3VUAA 1X5AA 4KOBA 1MQKL 3APMA 3UJJL 5HYJA 3RUGF 1E0OB 3A5VA 3EGDB 4Y2OA 3L08A 4PJBE 5IHZB 4MD4B 3AW5A 2GC7C 3LQMA 3NPSB 2DMGA 3HI6H 3EFFB 3LYRA 1HHHB 1FC2D 5I73B 2PPDA 3AU0A 2Z4TA 4XNMB 1J1XL 2X1QA 1EZLA 4N0CC 2QADB 2Q6WB 4MNQB 4QRPE 2UZXB 4TUJB 4JFDB 4L4JA 1U41A 5HDBF 4L1DA 2Z92B 1ZLVH 3FU8A 1EANA 3T3PF 3A6CL 4ZODA 2OTWA 1JIBA 3OLGA 5E6SB 5AOJA 2BS9A 4C83B 1NCNA 4AUUA 2ARJA 3W0WE 1ADQH 2P8PB 4WTWA 1TENA 2E4FA 3VGDA 4N2HA 1JHKH 3BP7A 2R27A 2Y06H 4Z7QB 1G7LA 4OAWA 1X5ZA 4L8DA 2A73A 1IO4C 1P53A 1ZD6A 2OR9H 1WZMA 3M86A 2VZUA 3KH4A 5EIIA 2EIMB 1T5WA 3B5TA 5E1GA 1URLA 1K72A 3BWSA 3O11B 3FB7B 3DO7B 1LD9A 4R4FH 5HY9A 1CUOA 5MI0B 4GSQA 2J1ZA 2YFOA 3TYGH 1CXKA 5C3LD 4NO0D 4QD2E 4F5CA 1SJHB 4YEEA 2YUVA 5H2BA 2X70B 5MEQA 4F8OA 4EDXA 4KAQL 2WSPA 4N9GB 1ZTXH 3CAFA 5L6YL 2F74A 1U91A 5J1AB 4URTB 4ZS7L 3SDDD 4Z8FL 5GGVY 1NPUA 4HWEL 5LAPA 3LNHA 3B2PA 3BEVB 1NLDL 1XAKA 1ZV2A 1FAKT 5D7LE 4TQIA 5HGAB 4WK4B 2WNXA 1IC4H 3L2MA 1HHJA 1R34A 2GJZB 1UYWL 3INUH 2QEJA 4P3DB 2JCCB 5F6IB 5EU6A 1ZKAA 4Y16A 3UO8B 2F53E 2CRIA 5AB9A 3CMOH 5KS9F 5LGKA 2YAHA 1ZVSB 1R3IH 4FADA 1U91B 5IBTL 4YMPA 3UJJH 4L37A 1NDTA 3TN0B 2P8LA 1IL1B 1FFTB 3BAXA 1J5HA 3BEVA 5FYJD 1URZA 2XQYK 4U1MB 1MJ7L 1VZIA 4NOBA 3ULVH 2PW2B 2DJSA 5HHPB 1L9OA 2UY6B 3KYNB 5T3XD 5GS3A 4PJ5A 3VRIB 1D9KC 4TS6A 4Q6IA 3UP1A 1FFOB 1IBYA 3MJ8B 1LO0L 2APTA 1GS8A 1AXSB 4ZUVB 3FQUB 3JTSA 4KJPC 5SV4A 4G1EA 4G70B 4JR9H 3B3IA 5FGBC 5L0QC 3GIVB 5D2NB 4RMQA 1RUAH 2BVTA 4PV1C 4KUCD 5DJ2A 4DZ8A 3CDGB 5B3SB 1EXUB 4E9XA 3M46A 2CBTA 3ZE1B 2X12A 4HH8A 4OLXL 4NWUL 4HG4K 1NFDB 4WEMB 3DETD 1WZAA 4A6YH 5EPMA 4R4FL 2XTJB 3HI1A 4OI9A 2GJZA 3HG3A 4QHPA 1H3UA 1Z9NA 4XN5A 1KBVA 4HSCX 5T1JA 5HJDA 1NUGA 1T5XB 1HSAA 2P7TA 2C3WA 4NM4H 2A9BA 1FA4A 4F3FB 5DWPA 1GR7A 1MFCH 1ZK9A 4K94L 1NCHA 2F08A 3K7UA 1MH5B 2M83A 2X6VA 4N0UB 3O2DH 4YBQC 1H15B 3MRKA 5AKTA 2C9PA 1DBJL 5BQ7A 3L48A 4BCZA 2VQ1A 4JZOA 2XCMC 4I13B 1LD9B 1GS6X 4PS7A 1XCWA 4PQXA 3P3YA 5TF1L 3QDGB 5DUBB 3H9SB 1ET5A 3IF1B 3LRKA 2R4SL 3QEQE 3REWB 4CW1A 1XF3B 3TEWA 1N59B 1V54B 1FN4A 4JREB 3GIVA 5JIPA 4XC1L 1PMYA 1O6SA 2DMKA 3P9LA 1XF4B 4NHUA 3S36H 1INQA 3UYRL 5C86A 1K6QL 3X14A 3U1SH 43CAB 4U1NA 2O5ZL 4AK1A 2ICWB 2WBWB 3KVQA 5EZJB 1DUZB 2X4OB 1T21A 3GK8H 1NCCL 1GGBH 1IGIH 2EH8H 2VDNB 1QRNB 3BVWA 3IJEA 4QT5A 4U7SA 3TF4A 3LKSA 1SXAA 5DURD 1OKEA 1T3FA 2BZDA 2IIJA 2X4RA 4KVCL 1TVBA 1UD5A 4R5VA 5AYQA 5BCAA 1WICA 4R7DB 2Y1VA 2IV8A 3MUGA 3N06B 5E99H 2AJYH 4HWBA 1CE6B 2ZG2A 4WGWB 4M5SA 2R39A 4Y2NA 2AK4D 5AVRB 3V6OE 1N64H 4HBQA 1WTGT 4JHZA 2EYSA 2APFA 1SY6L 3GBEA 4JPVH 1G0YR 2ZZUT 2EECA 4MD0A 1MLCB 1NM9A 4YHLL 5ITBL 4K3GA 3RDTB 3S4SB 1WWCA 2ZCLH 2IQ9H 1BAWA 1QW9A 1ZEAH 4K55A 2Z64C 4G6JH 5ABDE 3HUJA 3LEXA 4BK5A 3OKOA 1QLRA 2JXMA 2YXVA 4UM9A 2DWDA 1NBVH 1TFPA 3BEWB 5GISH 4P57B 4E9YA 1S7WA 2P44B 4Z7VE 4JPIA 4GBXB 1YY9C 4LCUB 1BBDH 4U1SB 2PP9A 3RY6A 1CFSB 4FXKC 4TVPL 4XMKH 4EOWH 3RJDA 3O41B 4ODVH 2LHAA 1SXSA 3M8OL 2FEDC 3FUIA 2GIMA 1ASOA 4BKSC 4XNZB 4ZNCD 1GGIL 3LZQA 1U3JA 4G6KL 4JFPA 3CLEH 2AXJA 4KH9A 5JIMA 2B16A 2EZ0C 1XR8A 1FLTX 4C56E 4HFUL 5CINH 4WGKA 1QSVA 4S2SA 1SOKA 3DTXA 4DERA 4Z7UA 4YBLB 3LV3A 2I85A 3GMMA 3I6SA 3MA9H 3QJFB 4WO4C 3T1WA 1QWUA 4R7VA 4BH8B 5I5MA 2I27N 3FRUA 5MEOA 3ILPB 1PG7W 1K85A 1YEKL 3VI3F 2OSWA 3PQYD 4OCNC 4QTHB 4WJKB 4YHMH 1OALA 1IKFL 4R0LC 5A6LA 2XWXA 1BZ7A 4G80B 2DQCL 3D1MC 3BCFA 5DUBA 4JFWA 1AD0B 5D4HA 5GGQL 1U3HC 5EA0L 3P30L 3BT0A 4GAYB 1D5XA 4XPFH 1F00I 4NZFA 3PHOB 3CCHA 5K69A 2VABA 2BNUB 2HG0A 3CFJB 3T0EB 2NY4D 1XH0A 1QI3A 1RL1A 4DKTA 1JPFA 1CK0L 1GZHA 3HUJF 3RZCA 4ZAKD 3HLAB 3AB0B 3L3JB 4MA1B 2IAMD 4YHPB 3T3MF 1Z5HA 4U7MA 3CNKA 5EBWA 4HSQA 4F8QA 2AJZB 3EOAA 5HGHA 4KXZI 4M8RA 3GUTB 1O9VA 5IJVB 1SHXA 2FT8A 2J88L 1WO2A 1MAML 3NZHL 4WWID 1XGYL 3ZTCC 3C6SA 4AJVA 2ZP0T 4X8JB 4ODWB 3FSAA 3U7WH 3S96A 5DGQA 4LHJB 1OSPH 2RBLA 3AT0A 4KK9D 2BNRD 1ID2A 1KGJA 3FRUB 3VI4E 2AERT 3NRFA 4JNXA 4HKXA 2HJFA 25C8H 5D96C 3IFPA 3WYRA 1IARB 1A7QH 2ED7A 3NSXA 2JKSA 3GXNA 3NIDE 5ACLA 5DSCB 4PUBL 2MKWA 4G71B 1AGEB 1OSYA 1BM7A 3C60D 4GG8A 3U9UA 2RR3A 2Z8SA 5JHDE 1G6RB 1IM3A 4F37K 3RIFK 2R59A 1TZGL 3SD5A 3ZRCC 2E8YA 2NY0B 5DWUL 4XCYA 1FI8C 1KCKA 1G7PA 2YQGA 1OM9A 2MEJB 3WKMH 4TSCH 4R7NB 5I1AB 2GJ6B 3TBVA 4PJIF 1D2OA 4PRPB 5DDHA 3EH5B 1OY3B 3IFNH 1WV7T 4OGYL 2VN7A 5T1LA 3NFSL 1VF5C 3A6BL 1IGJA 2ADFH 4CGTA 2CM5A 2ATKB 3PU7A 1EA9C 1P1ZA 4GS7C 4P5TD 2NSQA 3GB7A 4KOCA 3EJJX 1O7DE 3VA2C 3DV6B 2V9UA 4EUPB 3IKCA 1LJMA 5GRVK 3WEBA 5FHBL 5EU5A 3MJ9H 1PSKL 3T0ED 4R84A 4PRPA 2E5EA 2VDOH 4WI0A 4JY4A 3MLTB 2XN9B 3MR9A 1G7IB 3OJDB 3MOQA 2DLFH 4F7TA 1E9PA 3IJYA 3RILA 1FFPB 3RGVD 4JHUA 1F3RB 2VXUH 1SJMA 4KDVA 3SDAD 3OJMB 3WBDA 4PB9L 1CICA 2G4GA 3RTLA 3S7GA 1A3LL 5DRWB 2E47A 1PX3A 2Y1ZA 2BSDA 5AW9B 3SKJH 3WCYA 4F7MA 4R2GB 4PB0H 3CVIL 4MQSB 5IFAL 3C5JA 4KKPA 4LSSL 4U1KA 1QI4A 4LARL 4Y5XC 1CXIA 4KX8A 1BYPA 3PHSA 3J27A 3VYNA 1KYUA 1M71B 3LIZH 4BRVA 2XDHA 1SFDA 3UH8A 4AVHA 3VXSA 4AQEA 1S78C 3QXAB 4MXQC 3EYQC 4EEEA 4OZFB 1L9QA 1E7VA 3O9WC 4PUBH 5KAQG 3I9AA 4KZCA 2HT3D 2B1HL 4OCLC 5JOPD 2CALA 1PX8A 2IMNA 5IFHH 5KBNC 2Y5TA 3CSPA 3ZX1A 4NQXA 4PJDA 1BWWA 4RA0C 4TQEL 2P26A 2V2XB 3V6ZB 4U6HA 5ILTL 1OSPL 2FD6L 1RMFL 3TEXA 4KTDH 5KS9A 2AQ3A 4HU2A 5H4ZA 3OX8B 5EFIB 2VN4A 4FQXD 3VXME 2MNWA 3NBNA 2X6UA 2WLNA 1NH6A 3RWCA 2DJ4A 3WENA 4E68A 3ZMEA 3BIKA 4PRHD 3W57A 3QIBA 3D0LB 3ILEA 2VL5B 1DQJB 3HBQA 2X0VA 4KTDL 1BZEA 1J7VR 5DJAA 2JB6B 1JZGA 5F89A 3VFSA 1E2VA 3QGVA 2A4CA 4YHYC 5ILTH 1IVTA 1OLLA 3F8UB 2C7UB 1T22B 5DU7A 3ABZA 5PAZA 1V27A 3KYKH 1TF4A 3DOIA 3B4NA 4WV1C 2BHZA 3HR5A 2Y36H 5I19H 4L5FH 1Z9LA 4B9ZA 3L6FB 3PPSA 5ELIA 1T1XA 5DVKA 1KJVB 1GCYA 4AV5A 5C07A 4H2AA 3ZL1A 1ZT7B 4QLWA 2DH2A 2RQ8A 3WN5A 2O1AA 3KS0H 1HZHH 1BYNA 3WL9A 1X5GA 2FJSA 2XQYG 4QRUB 5AW4B 1T03H 4H88H 1EDQA 4LPUA 3MV8B 1AYRA 3SD2A 3DGCR 1BQ5A 4K3DL 1ZHLB 1T6BX 4C56A 4MYWB 4HEPA 3LEVL 5DZ9A 2Z93B 5FUCC 3T77B 4D0CA 4OAWB 1YEHH 5DJDB 3KGTA 4K3EL 5EOQH 3DSNB 3L7FA 4YWGL 4GRLA 4G6KH 1QABA 4PJ8B 3KWTA 2QKSA 3DOSA 4AOFA 1JHTA 4HPOL 5F3BA 4WO4B 2AEPL 2AJXH 4X0NA 2F9BT 1L5GA 1JVLA 3RGBA 2AITA 3CIAA 2VQ1B 3GHPA 4JZOB 4U6VH 3UYPB 4XC3H 2KLTA 4MJ2A 4KNQA 1HILB 4Y1TA 2Y07H 4NO2B 1T3FB 4PGBB 2GCYA 1TMQA 3FT3B 4UAHA 2ZCHH 1FVDA 1AS7A 4QRPB 4AZUA 3QORC 4MMXA 4GEJA 4HIHA 4WIQA 1B0GB 4RVBA 5E2VL 4OZIE 3PQYE 4UILH 1G6VK 3FQ4A 4MX7A 3KJ4B 4F2FA 4M9PA 2ICEB 1R4XA 1K2DB 5EZIL 4LLVB 1FZJB 3BQUD 3ET9F 4ILDA 5JXEA 2JH2A 1X7TA 5AZ2H 1DE4B 3V8OA 3FB7A 2DM2A 3SOTA 3N50A 4JFSA 3E6FB 5IGXL 1KIUB 4CSTA 3WKML 2YD9A 1ZT1B 4CVXB 4N8VG 5GRUH 2CKBL 1N8ZB 2B39A 4WAFA 4BEIA 1UD3A 4H1LH 1W0VA 2IFFH 4L2YA 3VXMA 1AP2B 3T2OA 1AOZA 5F7EL 3SDXF 1DCEA 3HFML 1UOWA 5T1LD 3W5NA 4LASL 3ZU8A 2EH7H 3VMNA 1N6VA 4IMKA 2VZTA 4CSSA 3LZLA 3EGSB 3WEXB 1GGBL 5F88B 3LH2H 4XXWA 1FFOA 3GDBA 3ZXAC 3QEGL 3VB9A 2LABA 3U30B 5MHSD 4IOFC 5HDQL 1JPTH 3FN3A 5JNYA 2ZXQA 4FFVC 3QIWA 3SDAC 1T89A 1B4JL 1F1DA 3CDZA 3CVBA 2W9DH 5F1NB 1RJCA 3S88L 4N8UA 1QTPA 4D8OA 2P8LB 5GHWH 4B3EA 2ZP8A 4G82A 1KELL 3V0WL 4K8RH 4Z0BL 4QHNB 3BSHA 2UWEF 1B0GA 2MQ0A 3MDJA 2EJ1A 4DP2X 5IVXB 4AVJA 1J1PH 2J12B 3KAAA 1PZ3A 3GLEA 1YQVL 1MCNA 3Q2VA 1DJHA 4LCYB 4ZJ9A 4PJ7A 3L3HA 4X98A 4H5SB 4HWUA 3MNVB 4HS8H 4KKLD 3LS4L 4FG6D 1I75A 3OBAA 4M4PA 4MAYC 4P46D 5CJXC 3FL7A 1COBA 5HHME 1BQLH 3C8KA 3RY5A 2CHWA 1AD9A 2WCGA 5DQ9A 4X6DF 4PTUB 1WAAE 3DSNA 2VNCA 4U2YA 1V05A 6FABH 4QTFA 1QACA 4HUVB 2NTFA 1J05A 2ZKXA 3VNYA 4DKDC 5B3NA 4YIQA 1HEJC 2ZOWA 4H8WH 4PJGE 3RKPA 1WCBA 4N9OB 4XNXH 3HC3H 3BP6B 1KIPB 3O11A 5ALBL 1IKFH 2GQHA 1JK8B 4OZ4B 1JZIA 4Q7DA 2X2IA 4AIZA 2JTDA 1SUHA 2L7EA 3L4YA 3MQIA 2MQGA 1WDAA 1ZA6B 5I6MA 5H37A 4Y4HA 3U6RB 1JGUH 1E4KA 3JV0A 1U4FA 1G5AA 5IK3B 4JRXA 4A7SA 3ETTA 3RVUD 4N2MA 1G9NL 2O5XH 3LKSB 3SPJA 2W38A 1AR2A 1W0YT 1F8TL 2VLME 3G08A 4MMZC 3H3PH 3P9LB 3B2XA 4MMXB 1FNSL 2FRGP 2IVFC 4JR9L 2NZ9D 3HE7D 3U36B 5I73C 4YIQB 1LXMA 1PY9A 4ELMB 3PJSA 2KZKA 1O5DT 2EE6A 4FQHB 2WW8A 4G7YL 4M1CC 2DEYX 3FQTB 3KPRD 3VFWA 2I7OA 4LCIH 4MMYA 4U1IA 2O5YH 1OAXH 2JB6A 2OL3L 5F89B 5EU6B 1NDMB 1R3JA 2IMMA 3TV3L 1S3KH 4WKZB 1GKOA 1LLAA 4RGNB 1L9RA 2BP3A 3VD7A 2CBMA 2IBZY 1NBVL 3CU1A 4LKCB 4OFKA 5GISL 1U3NA 1BZDA 1MNUL 2OKMA 2IQAA 5TGBB 3T6ZA 2B20A 1BVNT 2QSTA 4KDTA 4NKIH 2OR7A 1F4YH 5F8QC 4DGYL 2R15A 1FL5B 1M6OA 4ZPTA 5AW3B 5IMKA 4PLNC 1DJSA 5D6DC 4PCSA 3VFMB 3MCLL 2ZE0A 3PGDA 1G7QB 2W60B 2XPYA 1ETA1 1MIML 4HGWA 3KLSA 4YX2H 1B0IA 4W9IC 1I1CA 4JDTH 4Z7NF 4KTYA 1MRFL 1KPRA 1KPVB 1ONQB 2CLRA 2F54D 2MOGA 2P48B 2VABB 5DMGD 1TCMA 1YEIH 3CQFA 4XMLL 4RSYA 3WS3A 3MYJB 4MXWL 5CIPB 1ZT4B 4LVNB 3X11B 4UOJA 2W65B 3U36A 1FNFA 2BY0A 4JPWL 1TO5A 4LOEA 5EUOF 3UABA 5CSGA 4FGMA 4RBPK 1N0XL 4KKCC 5IKCA 2W9EL 3PWNA 1KN2H 1TO4A 3GNMH 3PGDB 5GZOC 3KPLB 2KI6A 1UZGA 1OB0A 4R96A 5K9KB 4H44C 5DC4B 3BI9X 3FPYA 1FVCB 5AVQB 5JPNA 2Y22A 1RULL 2ROYA 5FAAA 1CI5A 4JHAL 4QO1A 3V10A 1U8HA 5ITFA 5LVEA 1IGML 5BXFB 1MEXH 2WIMA 2NTFB 2IH3B 5C0RH 4GBXA 2ICEA 2FH6A 1U8QB 3CSFA 4KFZC 4NI6A 43C9A 5I0VA 4FXGA 1TG8A 3NN8A 1GA2A 4JN1L 1OAUL 4OBSA 4WI2A 1I1YB 4Z7UE 1AMXA 3Q1SH 3KPRB 1F4WL 1Z9SB 3K0WA 4BKTC 2V2WB 1BM3L 5DHYA 2ZUTA 2P49B 2AZUA 3GMLA 1T66C 1SJXA 1PZ2A 3ZTJG 3NMEA 5AD0A 5SWZB 5KAQF 3SGJA 5DQJB 4K94H 4KROB 5TJWK 2P8MA 5T1DH 3K2IA 4YC2C 3ECWA 1A14H 4Y1AE 2OXHA 4MDRA 2LU5A 5D96B 1BVLA 5EC1B 3TNMB 3WIHL 2WYIA 1A21A 4KQ3H 4N9GA 3EDKA 2HKHH 1IMHC 1YQ2A 3EOAB 1NKOA 3H6JA 5BMFH 4LEBA 4P4RB 5HBBA 3BMWA 4U6XB 4FTVE 3ARRA 1ZXQA 3S8GB 2MSPA 5DO2D 1S7UA 4JAMA 2BHFA 2NNAB 1CDUA 2F5AL 5KVDE 1QRNA 3DRTA 1ITCA 4YZFE 3K72B 2DYRB 3VWKB 3GMPB 4X7SL 1QBML 4NQSB 5T3ZE 2PUQT 4NM8L 4QJ3B 3ZMNA 3TBTB 2BY1A 3Q5OA 1MJ8L 5DA0B 2A9DA 5EUKB 5I8KL 3WFBL 2IF7A 4XGZA 2GABA 3OAYH 4D3CH 1T22A 4FABL 3GC3A 4OCSH 1IEHA 2YD3A 2AF2A 1R3LB 2Q0ZX 5LHDA 2PETA 4NERA 5IMLB 5EZLA 5GGSA 4OZHA 1VPOL 2IAMC 4KRNA 5DFTA 3VH8G 1YRKA 3T0WA 3IPFA 5ICYB 2EACA 3CBJB 5HGDA 1M7UA 2OMYB 2WOBA 4PS8A 3V55A 4NN5B 1WEJL 4TUJA 3T2QA 4Z7UB 2X4NA 4MA8H 2Q5BA 3BKCH 1NMCC 5A7BA 1X5HA 4JO1L 4Y9BA 2EDKA 4AH2B 3QCVH 1D3CA 1WLHA 2B59B 2DEWX 3SJVD 3T08A 2X41A 2IPKA 1FAIL 3DX7A 3IRZA 4G7VH 1NIDA 3WJJA 1AJ7H 4P23D 3CMOL 4W70A 2J21A 4ZFOL 2DRUA 2ADJA 4GG6E 2WVUA 2YRLA 2HLAA 3N85H 4WDIB 1SYVB 2K7PA 2MIZA 3T1FB 1EK3A 4WEBL 1LEKA 2NLJB 3ARTA 3BKMH 4PJ9A 4BK8A 4LHUA 4NDMB 1BIHA 4HWEH 4XNZC 5SWZD 2Y5TB 1OO2A 3DO7A 5ANMB 1BGXL 4YGVA 3DJRA 1ZLWH 2CO6B 3DRQB 2FUQA 2WWMC 5BZDB 3U30C 5FO8B 5C08E 3VFOB 1NCOA 2W80C 3BSZL 4ABVA 5JORB 3KWWB 4OGXH 4F7MB 2XWTA 3C2AL 1ZSHA 4NZRH 1ACYH 4AQAA 3ASWA 4GRWB 2R0LH 5IMLA 2NXYB 4ANKA 3KE0A 4AMKL 4IKLA 1VRSA 4HDIB 4KVNL 2G3NA 2V33A 3SYQA 2Y2WA 1ORQA 3FOMA 4X9BA 3S5YA 1I7TB 1PLAA 1B0RA 4J3OC 4JO3L 1W8OA 1YAIA 2ZUUA 4JM4H 4XWOD 5CZRA 1IE4A 4QAWA 3ZKSD 1T7YA 2HA1A 3A6CH 1LMIA 4B9IA 4IKIA 5EH1A 1LK3L 1EJ6A 3MLRL 2WGNB 4HIQA 4LSPL 2AABH 1RZFL 4QRSB 3UJIL 1MZZA 4L3EE 5G2NA 1S9VA 3S9DB 1ES0A 1EHLL 2JQZA 1KTDA 1KT2A 2FIRT 4RIRB 2ZAHA 3RVTC 4GKNA 1MRDH 5A6IA 2C3VA 1RUML 4PJAF 3PWJA 4HLZH 3N40F 1YEDB 5JZ7C 3SDCB 1WBZA 1B3JA 4D9RD 3A67L 1FSKB 5GSVA 1WD8A 4N1HB 1D5IH 4PJ5E 1H3PH 3F2LA 1R6VA 3FQRB 2AK1L 4L4VD 1MNUH 4X5LA 1OP4A 5EO0B 4X4YB 1E9QB 2H1PH 5J9PA 2CSPA 5LGHL 2A6KB 1JV5A 2LLNA 2QQKH 5D7IE 2PXYD 4FF9A 1FORH 2W8CA 3HPLB 4G8EA 1AKJA 4QNPF 2PNDA 3SQOL 4QHMA 1AYOA 3SDYL 1MXGA 4XO8A 2NY2B 4E9RA 2SEBA 2LU3A 1SXBA 2VERA 1CFNB 3QDMA 3OMNB 3T5WA 5LQBL 4JG5A 2CO7A 2ILLA 3JV5A 3MOBH 3KPQB 4KQ4H