4E67A

The structure of the polo-box domain (pbd) of polo-like kinase 1 (plk1) in complex with hydrocinnamoyl-derivatized plhspta peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
213
Chain Sequence
b'LSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title Using ligand-mapping simulations to design a ligand selectively targeting a cryptic surface pocket of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 213
sequence length 221
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4e67A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4e67A01
3P34A 3HIHA 5DNJA 4HY2A 3P2ZA 3P37A 5J19A 3P36A 3C5LA 4E67A 1Q4OA 3Q1IA 4HCOA 4RCPA 2OJXA 4RS6A 4E9CA 1UMWA 4O56A 4WHLA 5DMSA 1Q4KA 4H5XA 2N19A 4X9RA 4HABA 3RQ7A 3FVHA 4LKMA 4LKLA 4J7BB 4WHKA 4XB0A 4E9DA 4O9WA 3HIKA 4DFWA 4X9WA 5LHZA 4YYPA 3P35A 3BZIA 4H71A 4WHHA 4X9VA 3P2WA 5DMVC 4O6WA 2OGQA
chains in the Genus database with same CATH superfamily
3P34A 3HIHA 2I9XA 2QZUA 3C5LA 1Q4OA 1HDHA 4E9CA 4N9JA 3RQ7A 1AUKA 4LKLA 4N7ZA 4N7VA 4O9WA 4DFWA 4G7NA 3FS3A 4X9WA 2E50A 4CXKA 3GYWA 4H71A 4O6WA 2OGQA 5DNJA 1E3CP 3P2ZA 1N2LA 4HCOA 4RCPA 4FDJA 4RS6A 1UMWA 4WHLA 1E2SP 4CXSA 1E1ZP 2IA9A 3HMJG 5AJ9A 1N2KA 3ED4A 3BZIA 4WHHA 2UV8G 5DMVC 4NKBA 4CXUA 1E33P 4CYSA 5J19A 4E67A 1FSUA 4O56A 5DMSA 1Q4KA 2N19A 3FVHA 4LKMA 1P49A 3LM3A 4J7BB 4XB0A 4E9DA 4CYRA 3LXQA 3P35A 4FDIA 4HY2A 3P37A 3P36A 3Q1IA 2OJXA 1F34B 3GYVA 1A87A 4H5XA 4X9RA 4HABA 1F32A 3HFDA 4WHKA 2I9ZA 3KDRA 3HIKA 5DAYA 2VKZG 5LHZA 1E2TA 4YYPA 4X9VA 3P2WA 4NK7A
chains in the Genus database with same CATH topology
3P34A 3HIHA 5DNJA 4HY2A 3P2ZA 3P37A 5J19A 3P36A 3C5LA 4E67A 1Q4OA 3Q1IA 4HCOA 4RCPA 2OJXA 4RS6A 4E9CA 1UMWA 4O56A 4WHLA 5DMSA 1Q4KA 4H5XA 2N19A 4X9RA 4HABA 3RQ7A 3FVHA 4LKMA 4LKLA 4J7BB 4WHKA 4XB0A 4E9DA 4O9WA 3HIKA 4DFWA 4X9WA 5LHZA 4YYPA 3P35A 3BZIA 4H71A 4WHHA 4X9VA 3P2WA 5DMVC 4O6WA 2OGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P34 A;  3HIH A;  5DNJ A;  4HY2 A;  3P2Z A;  3P37 A;  5J19 A;  3P36 A;  3C5L A;  4E67 A;  1Q4O A;  3Q1I A;  4HCO A;  4RCP A;  2OJX A;  4RS6 A;  4E9C A;  1UMW A;  4O56 A;  4WHL A;  5DMS A;  1Q4K A;  4H5X A;  2N19 A;  4X9R A;  4HAB A;  3RQ7 A;  3FVH A;  4LKM A;  4LKL A;  4J7B B;  4WHK A;  4XB0 A;  4E9D A;  4O9W A;  3HIK A;  4DFW A;  4X9W A;  5LHZ A;  4YYP A;  3P35 A;  3BZI A;  4H71 A;  4WHH A;  4X9V A;  3P2W A;  5DMV C;  4O6W A;  2OGQ A; 
#chains in the Genus database with same CATH topology
 3P34 A;  3HIH A;  2I9X A;  2QZU A;  3C5L A;  1Q4O A;  1HDH A;  4E9C A;  4N9J A;  3RQ7 A;  1AUK A;  4LKL A;  4N7Z A;  4N7V A;  4O9W A;  4DFW A;  4G7N A;  3FS3 A;  4X9W A;  2E50 A;  4CXK A;  3GYW A;  4H71 A;  4O6W A;  2OGQ A;  5DNJ A;  1E3C P;  3P2Z A;  1N2L A;  4HCO A;  4RCP A;  4FDJ A;  4RS6 A;  1UMW A;  4WHL A;  1E2S P;  4CXS A;  1E1Z P;  2IA9 A;  3HMJ G;  5AJ9 A;  1N2K A;  3ED4 A;  3BZI A;  4WHH A;  2UV8 G;  5DMV C;  4NKB A;  4CXU A;  1E33 P;  4CYS A;  5J19 A;  4E67 A;  1FSU A;  4O56 A;  5DMS A;  1Q4K A;  2N19 A;  3FVH A;  4LKM A;  1P49 A;  3LM3 A;  4J7B B;  4XB0 A;  4E9D A;  4CYR A;  3LXQ A;  3P35 A;  4FDI A;  4HY2 A;  3P37 A;  3P36 A;  3Q1I A;  2OJX A;  1F34 B;  3GYV A;  1A87 A;  4H5X A;  4X9R A;  4HAB A;  1F32 A;  3HFD A;  4WHK A;  2I9Z A;  3KDR A;  3HIK A;  5DAY A;  2VKZ G;  5LHZ A;  1E2T A;  4YYP A;  4X9V A;  3P2W A;  4NK7 A; 
#chains in the Genus database with same CATH homology
 3P34 A;  3HIH A;  5DNJ A;  4HY2 A;  3P2Z A;  3P37 A;  5J19 A;  3P36 A;  3C5L A;  4E67 A;  1Q4O A;  3Q1I A;  4HCO A;  4RCP A;  2OJX A;  4RS6 A;  4E9C A;  1UMW A;  4O56 A;  4WHL A;  5DMS A;  1Q4K A;  4H5X A;  2N19 A;  4X9R A;  4HAB A;  3RQ7 A;  3FVH A;  4LKM A;  4LKL A;  4J7B B;  4WHK A;  4XB0 A;  4E9D A;  4O9W A;  3HIK A;  4DFW A;  4X9W A;  5LHZ A;  4YYP A;  3P35 A;  3BZI A;  4H71 A;  4WHH A;  4X9V A;  3P2W A;  5DMV C;  4O6W A;  2OGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...