4E67A

The structure of the polo-box domain (pbd) of polo-like kinase 1 (plk1) in complex with hydrocinnamoyl-derivatized plhspta peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
213
Chain Sequence
LSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PLK1
publication title Using ligand-mapping simulations to design a ligand selectively targeting a cryptic surface pocket of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 213
sequence length 221
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4e67A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4e67A01
1UMWA 3P36A 4WHHA 4WHKA 5DMVC 3RQ7A 3P2ZA 3P2WA 5LHZA 4X9RA 2OGQA 4LKLA 1Q4OA 5J19A 4DFWA 4XB0A 4HCOA 4E67A 3C5LA 4O6WA 4J7BB 4X9VA 2N19A 4O9WA 3FVHA 4E9DA 3P37A 3Q1IA 4LKMA 3HIKA 4RS6A 5DNJA 4HABA 5DMSA 4YYPA 1Q4KA 3BZIA 4WHLA 4HY2A 4E9CA 2OJXA 3P34A 4RCPA 4H71A 4X9WA 3HIHA 4O56A 4H5XA 3P35A
chains in the Genus database with same CATH superfamily
3ED4A 4FDJA 1F32A 1Q4OA 4G7NA 4HCOA 4X9VA 2VKZG 3FVHA 4E9DA 4HABA 4CYRA 3BZIA 4HY2A 1E3CP 3P34A 5AJ9A 4H71A 5DAYA 1E33P 4CXKA 4CYSA 3GYWA 4H5XA 3P36A 1A87A 3P2ZA 3P2WA 1F34B 5LHZA 4LKLA 2I9XA 4CXSA 4O6WA 3FS3A 2N19A 3P37A 3HIKA 3GYVA 4YYPA 4NKBA 4WHLA 1E2SP 2I9ZA 2E50A 4O56A 1N2KA 1N2LA 1E1ZP 4WHHA 3RQ7A 4N7ZA 4FDIA 5J19A 3C5LA 4J7BB 3LXQA 4O9WA 2QZUA 3HMJG 1AUKA 1P49A 4CXUA 4RS6A 5DMSA 4NK7A 4E9CA 2OJXA 4RCPA 1HDHA 4X9WA 3HIHA 1E2TA 3P35A 1UMWA 4WHKA 3HFDA 5DMVC 2UV8G 4X9RA 2OGQA 4N9JA 4DFWA 4XB0A 4E67A 3Q1IA 4LKMA 5DNJA 1Q4KA 3KDRA 2IA9A 1FSUA 4N7VA 3LM3A
chains in the Genus database with same CATH topology
1UMWA 3P36A 4WHHA 4WHKA 5DMVC 3RQ7A 3P2ZA 3P2WA 5LHZA 4X9RA 2OGQA 4LKLA 1Q4OA 5J19A 4DFWA 4XB0A 4HCOA 4E67A 3C5LA 4O6WA 4J7BB 4X9VA 2N19A 4O9WA 3FVHA 4E9DA 3P37A 3Q1IA 4LKMA 3HIKA 4RS6A 5DNJA 4HABA 5DMSA 4YYPA 1Q4KA 3BZIA 4WHLA 4HY2A 4E9CA 2OJXA 3P34A 4RCPA 4H71A 4X9WA 3HIHA 4O56A 4H5XA 3P35A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMW A;  3P36 A;  4WHH A;  4WHK A;  5DMV C;  3RQ7 A;  3P2Z A;  3P2W A;  5LHZ A;  4X9R A;  2OGQ A;  4LKL A;  1Q4O A;  5J19 A;  4DFW A;  4XB0 A;  4HCO A;  4E67 A;  3C5L A;  4O6W A;  4J7B B;  4X9V A;  2N19 A;  4O9W A;  3FVH A;  4E9D A;  3P37 A;  3Q1I A;  4LKM A;  3HIK A;  4RS6 A;  5DNJ A;  4HAB A;  5DMS A;  4YYP A;  1Q4K A;  3BZI A;  4WHL A;  4HY2 A;  4E9C A;  2OJX A;  3P34 A;  4RCP A;  4H71 A;  4X9W A;  3HIH A;  4O56 A;  4H5X A;  3P35 A; 
#chains in the Genus database with same CATH topology
 3ED4 A;  4FDJ A;  1F32 A;  1Q4O A;  4G7N A;  4HCO A;  4X9V A;  2VKZ G;  3FVH A;  4E9D A;  4HAB A;  4CYR A;  3BZI A;  4HY2 A;  1E3C P;  3P34 A;  5AJ9 A;  4H71 A;  5DAY A;  1E33 P;  4CXK A;  4CYS A;  3GYW A;  4H5X A;  3P36 A;  1A87 A;  3P2Z A;  3P2W A;  1F34 B;  5LHZ A;  4LKL A;  2I9X A;  4CXS A;  4O6W A;  3FS3 A;  2N19 A;  3P37 A;  3HIK A;  3GYV A;  4YYP A;  4NKB A;  4WHL A;  1E2S P;  2I9Z A;  2E50 A;  4O56 A;  1N2K A;  1N2L A;  1E1Z P;  4WHH A;  3RQ7 A;  4N7Z A;  4FDI A;  5J19 A;  3C5L A;  4J7B B;  3LXQ A;  4O9W A;  2QZU A;  3HMJ G;  1AUK A;  1P49 A;  4CXU A;  4RS6 A;  5DMS A;  4NK7 A;  4E9C A;  2OJX A;  4RCP A;  1HDH A;  4X9W A;  3HIH A;  1E2T A;  3P35 A;  1UMW A;  4WHK A;  3HFD A;  5DMV C;  2UV8 G;  4X9R A;  2OGQ A;  4N9J A;  4DFW A;  4XB0 A;  4E67 A;  3Q1I A;  4LKM A;  5DNJ A;  1Q4K A;  3KDR A;  2IA9 A;  1FSU A;  4N7V A;  3LM3 A; 
#chains in the Genus database with same CATH homology
 1UMW A;  3P36 A;  4WHH A;  4WHK A;  5DMV C;  3RQ7 A;  3P2Z A;  3P2W A;  5LHZ A;  4X9R A;  2OGQ A;  4LKL A;  1Q4O A;  5J19 A;  4DFW A;  4XB0 A;  4HCO A;  4E67 A;  3C5L A;  4O6W A;  4J7B B;  4X9V A;  2N19 A;  4O9W A;  3FVH A;  4E9D A;  3P37 A;  3Q1I A;  4LKM A;  3HIK A;  4RS6 A;  5DNJ A;  4HAB A;  5DMS A;  4YYP A;  1Q4K A;  3BZI A;  4WHL A;  4HY2 A;  4E9C A;  2OJX A;  3P34 A;  4RCP A;  4H71 A;  4X9W A;  3HIH A;  4O56 A;  4H5X A;  3P35 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...