4E67A

The structure of the polo-box domain (pbd) of polo-like kinase 1 (plk1) in complex with hydrocinnamoyl-derivatized plhspta peptide
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
221
structure length
213
Chain Sequence
LSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNSVGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLLKAGANITPLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVTYIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Using ligand-mapping simulations to design a ligand selectively targeting a cryptic surface pocket of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase PLK1
total genus 71
structure length 213
sequence length 221
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00659 POLO_box POLO box duplicated region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4e67A02
3.30.1120.30 Alpha Beta 2-Layer Sandwich Arylsulfatase, C-terminal domain POLO box domain 4e67A01
1UMWA 4O6WA 4XB0A 2N19A 3C5LA 3RQ7A 4RCPA 4X9WA 4WHLA 5J19A 5LHZA 4H71A 4LKMA 4HCOA 3P34A 4HY2A 4YYPA 4J7BB 4DFWA 1Q4KA 4X9RA 3P2WA 3HIKA 4LKLA 4X9VA 5DMVC 4E9DA 2OJXA 3P35A 4HABA 3Q1IA 3FVHA 4WHKA 3HIHA 4E9CA 4O56A 2OGQA 3BZIA 1Q4OA 3P37A 4WHHA 4H5XA 5DMSA 3P36A 5DNJA 4RS6A 4E67A 3P2ZA 4O9WA
chains in the Genus database with same CATH superfamily
4CXKA 4NKBA 3LM3A 4J7BB 3KDRA 5DAYA 3HFDA 4DFWA 2E50A 1Q4KA 3GYWA 3P2WA 1A87A 3GYVA 4HABA 2UV8G 2I9XA 3HIHA 4N7VA 2OGQA 3BZIA 4CYRA 3FS3A 4WHHA 4RS6A 4O9WA 1P49A 1UMWA 1E33P 4XB0A 2N19A 3C5LA 3RQ7A 4X9WA 4WHLA 4H71A 1E2SP 3P34A 4N9JA 1E3CP 1E2TA 1F32A 4CXSA 1E1ZP 3HIKA 4E9DA 3Q1IA 4O56A 4H5XA 5DNJA 2VKZG 2IA9A 4O6WA 5J19A 2QZUA 5LHZA 4N7ZA 4HY2A 4G7NA 1HDHA 4NK7A 4X9VA 2I9ZA 2OJXA 1N2KA 3FVHA 4WHKA 4FDJA 1N2LA 4E9CA 3P37A 1FSUA 5DMSA 4E67A 3ED4A 4RCPA 4FDIA 4LKMA 3HMJG 1F34B 4HCOA 3LXQA 4YYPA 1AUKA 4X9RA 4LKLA 5DMVC 3P35A 4CYSA 1Q4OA 5AJ9A 4CXUA 3P36A 3P2ZA
chains in the Genus database with same CATH topology
1UMWA 4O6WA 4XB0A 2N19A 3C5LA 3RQ7A 4RCPA 4X9WA 4WHLA 5J19A 5LHZA 4H71A 4LKMA 4HCOA 3P34A 4HY2A 4YYPA 4J7BB 4DFWA 1Q4KA 4X9RA 3P2WA 3HIKA 4LKLA 4X9VA 5DMVC 4E9DA 2OJXA 3P35A 4HABA 3Q1IA 3FVHA 4WHKA 3HIHA 4E9CA 4O56A 2OGQA 3BZIA 1Q4OA 3P37A 4WHHA 4H5XA 5DMSA 3P36A 5DNJA 4RS6A 4E67A 3P2ZA 4O9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMW A;  4O6W A;  4XB0 A;  2N19 A;  3C5L A;  3RQ7 A;  4RCP A;  4X9W A;  4WHL A;  5J19 A;  5LHZ A;  4H71 A;  4LKM A;  4HCO A;  3P34 A;  4HY2 A;  4YYP A;  4J7B B;  4DFW A;  1Q4K A;  4X9R A;  3P2W A;  3HIK A;  4LKL A;  4X9V A;  5DMV C;  4E9D A;  2OJX A;  3P35 A;  4HAB A;  3Q1I A;  3FVH A;  4WHK A;  3HIH A;  4E9C A;  4O56 A;  2OGQ A;  3BZI A;  1Q4O A;  3P37 A;  4WHH A;  4H5X A;  5DMS A;  3P36 A;  5DNJ A;  4RS6 A;  4E67 A;  3P2Z A;  4O9W A; 
#chains in the Genus database with same CATH topology
 4CXK A;  4NKB A;  3LM3 A;  4J7B B;  3KDR A;  5DAY A;  3HFD A;  4DFW A;  2E50 A;  1Q4K A;  3GYW A;  3P2W A;  1A87 A;  3GYV A;  4HAB A;  2UV8 G;  2I9X A;  3HIH A;  4N7V A;  2OGQ A;  3BZI A;  4CYR A;  3FS3 A;  4WHH A;  4RS6 A;  4O9W A;  1P49 A;  1UMW A;  1E33 P;  4XB0 A;  2N19 A;  3C5L A;  3RQ7 A;  4X9W A;  4WHL A;  4H71 A;  1E2S P;  3P34 A;  4N9J A;  1E3C P;  1E2T A;  1F32 A;  4CXS A;  1E1Z P;  3HIK A;  4E9D A;  3Q1I A;  4O56 A;  4H5X A;  5DNJ A;  2VKZ G;  2IA9 A;  4O6W A;  5J19 A;  2QZU A;  5LHZ A;  4N7Z A;  4HY2 A;  4G7N A;  1HDH A;  4NK7 A;  4X9V A;  2I9Z A;  2OJX A;  1N2K A;  3FVH A;  4WHK A;  4FDJ A;  1N2L A;  4E9C A;  3P37 A;  1FSU A;  5DMS A;  4E67 A;  3ED4 A;  4RCP A;  4FDI A;  4LKM A;  3HMJ G;  1F34 B;  4HCO A;  3LXQ A;  4YYP A;  1AUK A;  4X9R A;  4LKL A;  5DMV C;  3P35 A;  4CYS A;  1Q4O A;  5AJ9 A;  4CXU A;  3P36 A;  3P2Z A; 
#chains in the Genus database with same CATH homology
 1UMW A;  4O6W A;  4XB0 A;  2N19 A;  3C5L A;  3RQ7 A;  4RCP A;  4X9W A;  4WHL A;  5J19 A;  5LHZ A;  4H71 A;  4LKM A;  4HCO A;  3P34 A;  4HY2 A;  4YYP A;  4J7B B;  4DFW A;  1Q4K A;  4X9R A;  3P2W A;  3HIK A;  4LKL A;  4X9V A;  5DMV C;  4E9D A;  2OJX A;  3P35 A;  4HAB A;  3Q1I A;  3FVH A;  4WHK A;  3HIH A;  4E9C A;  4O56 A;  2OGQ A;  3BZI A;  1Q4O A;  3P37 A;  4WHH A;  4H5X A;  5DMS A;  3P36 A;  5DNJ A;  4RS6 A;  4E67 A;  3P2Z A;  4O9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...