4E6RA

Crystal structure of a cytoplasmic protein nck2 (nck2) from homo sapiens at 2.20 a resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
54
Chain Sequence
IPAFVFAYVAEREDELSLVGSRVTVMECSDGWWRGSYNGQIGWFPSNYVLEEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytoplasmic protein NCK2
publication title Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A resolution
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 9
structure length 54
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4e6rA00
2AK5A 1TG0A 4CC7A 4RUGA 5ECAA 4AFUC 1MUZA 5IXBA 3M0RA 2DL8A 4F14A 3REBB 1UTIA 2O9VA 2RMOA 2BZ8A 3M0PA 4JZ4A 2DA9A 1WXTA 2B86A 1ABOA 2ROLA 2KRSA 3I5RA 1GBQA 4Y92A 3PVQA 2J6OA 1WFWA 4RTUA 1AEYA 1WI7A 2NWMA 1X6BA 1M3AA 4F17A 2KYMA 1WXUA 2LP5A 1RUWA 3EG0A 3NHNA 1BK2A 4OMOA 1AWJA 2RQRA 3M0QA 2FO0A 3C0CA 2MIOA 2DL7A 2RQUA 2CH4A 1GBRA 1U5SA 1AZEA 1A0NB 2BZXA 2ROTA 3QWXX 1OEBA 1SHFA 2DMOA 1AWXA 2LNHB 4Z8AA 2EBPA 1GCQA 1NM7A 2J6FA 2K9GA 2CSIA 3RNJA 2MCNA 5IHKA 4IIOA 1PKSA 1VA7A 2O9SA 3EGUA 2DLPA 3VS1A 1ZSGA 3VS4A 1X6GA 2D8HA 3PE0A 2LMJA 3JV3A 3M0UA 3UA7A 2LJ1A 1XOVA 1GL5A 3H41A 3VS7A 1JXOA 5IHIA 2JM9A 5GJWB 1X43A 2RQWA 2YUOA 1GFCA 4LE9A 4LUDA 3IQLA 2M0YA 2LX7A 4IIMA 1Z9QA 3I35A 4DEXA 1IO6A 5IH2A 4ZNXA 1EFNA 4JJBA 4FSSA 4RTYA 2PNIA 3PVLA 4J9FA 2IIMA 2M51A 1WIEA 2JW4A 2BZYA 2J6KA 1K0XA 1BBZA 4AFQC 1NEGA 4OMPA 1WYXA 1H3HA 3I5SA 1UDLA 1NYGA 1SSHA 1X2KA 2L3SA 2LCSA 1K4US 2P4RA 3H0IA 4OMNA 1KSWA 4D8DA 1JXMA 2L0AA 1FYNA 1BU1A 3EHRA 1KFZA 2DBKA 2FRYA 3THKA 1U06A 3FJ5A 2MOXA 4RTVA 1B3QA 1SRMA 1N5ZA 1CSKA 1I0CA 2DL5A 3I9QA 2DRKA 5GJVB 2YT6A 4D8KA 4M4ZA 2JS0A 2GTJA 2J06A 3EG3A 1G83A 1AOJA 5EC7A 2PTKA 1OV3A 2FPDA 1W1FA 1ABQA 1M30A 1SPKA 2AZSA 2F2WA 2FEIA 2E5KA 4DEYA 1GCQC 2YUQA 3O5ZA 1G2BA 1T0HA 4HVUA 2HSPA 4J9GA 2RPNA 1M3BA 1ARKA 1T0JA 2EVRA 2DE0X 1E7OA 2EPDA 4AFSC 2CSQA 4Z88A 2F2VA 1SEMA 2KROA 2OI3A 2OAWA 1QLYA 1UJ0A 1OOTA 4LUEA 5FWBA 5I22A 3M0TA 4LNPA 4RTTA 5IHNA 2DF6A 1AVZC 2PZ1A 4ESRA 2J05A 4WCIA 4OMMA 1UG1A 4F16A 1M8MA 2KEAA 4RTZA 1OPLA 4A63B 2VWFA 1E6HA 1KJWA 2O2OA 3CQTA 1WA7A 1OPKA 2W10A 1W6XA 2V1RA 1H8KA 2L3QA 2KR3A 2KRMA 3LH5A 3H0HA 2K2MA 2ECZA 2DNUA 4J9IA 1RLPC 1UHFA 2G6FX 2JXBA 2JMCA 3VS2A 2ED1A 1GFDA 2CREA 2W0ZA 2OJ2A 2A37A 2A08A 1PHTA 4HVVA 1QCFA 1GRIA 1PRLC 1WLPB 3TVTA 4ORZA 4JZ3A 3SHWA 2ED0A 2FPFA 1Z9ZA 2GGRA 1B07A 4E6RA 1HJDA 1QWEA 4JPBW 1AWWA 2X3XD 1SRLA 2JMAA 2F2XA 1GCPA 2KT1A 2A36A 2DYBA 1HD3A 5FWCA 4KRTA 1UHCA 3GBQA 4J9CA 2XMFA 3VS5A 2D0NA 1H92A 2RNAA 2DL4A 2K79A 3KFVA 2DM1A 1WXBA 1Y57A 4JJCA 2ENMA 2FRWA 2EGAA 1MV0B 4CC4B 2JS2A 4EIKA 2HBWA 2KGTA 2GBQA 2LQWA 1YNZA 4HXJA 2KXDA 2DL3A 2HEQA 5FW9A 2BTTA 2DBMA 2YUPA 1QKWA 3ZL7C 2LQNA 1X27A 3EG1A 2AZVA 1T3LA 2D1XA 4K11A 2GTOA 4OMQA 3R6NA 1TUCA 2C0OA 2K6DA 1VYUA 2SRCA 2KRNA 4Z89A 2SEMA 2GQIA 2KBTA 2LJ3A 1NG2A 2A28A 2C0TA 1M3CA 4AG1C 3EG2A 4OMLA 2V1QA 2RQVA 3VS6A 3UATA 1NEBA 2FG0A 1ZUYA 2CT3A 3M0SA 1ZUUA 2KT8A 1PKTA 1CKAA 2EYXA 1RI9A 2DX1A 3RBBB 5I11A 1NYFA 4X1VA 3U23A 1K0SA 2EKHA 1UGVA 2KNBB 1TUDA 1YN8A 2LZ6B 4J9BA 3QWYA 3REAB 4RTXA 2O88A 1PNJA 1PWTA 4J9EA 2CUBA 3ULRB 1I1JA 4RTWA 2EYZA 2CUDA 4QT7A 2I0NA 2O31A 2KYBA 1MV3A 2J7IA 2X3WD 2KE9A 4CC3A 1YWPA 1U3OA 3UF4A 4LN2A 1ZLMA 3EHQA 1AD5A 3VS3A 1NLPC 1LCKA 3H0FA 3A98A 3VRYA 1JEGA 2AKKA 5L23A 1JQQA 5HCKA 2L3PA 4HVWA 1NLOC 2EYYA 1JU5C 2DJQA 2QDLA 2K3BA 1Y0MA 2H8HA 2YSQA 1UUEA 2VKNA 3SEMA 4JJDA 2EQIA 3TSZA 1UECA 2C0IA 3VS0A 1ZUKA 1T3SA 1YWOA 1CKBA 1PRMC 2ABLA 2KXCA 3NGPA 3VRZA 1M27C 1X69A 2L2PA 1K9AA 1UE9A 2HCKA 1X2QA 2RF0A 2D8JA 1ZX6A 2AKLA 4GLMA 1FMKA 2JT4A 1WX6A 1BB9A 1SHGA 3NPFA 4CC2A 2LJ0A 1V1CA 4J9HA 2EGCA 4AG2C 2ESWA 2JTEA 3NMZC 2DILA 1QKXA 2DVJA 2YDLA 2RQTA 2VVKA 2HDAA 2GNCA 1JO8A 1KIKA 1VYVA 2EYWA 1S1NA 1AZGB 4HCKA 2DRMA 1YCSB 2CH4W 2CT4A 4R0KA 2JM8A 4GBQA 5IXFA 2EW3A 1K76A 1K1ZA 1HSQA 1RLQC 1UFFA 1J3TA 2NUZA 2K7AA 3TSWA 1YP5A 1W70A 1AWOA 1E6GA 2FPEA 3UA6A 1ZBJA 4J9DA 4AFZC 2CDTA 2YUNA 1UJYA 1VYTA 2RN8A 1QWFA 1I07A 2EGEA 1WDXA
chains in the Genus database with same CATH superfamily
3OSVA 1TG0A 5GAN7 3MJXA 5IXBA 2HKNA 3ZFJA 1NE8A 2RMOA 5KCOA 3G71A 3M0PA 4JZ4A 2DA9A 2B86A 3QDRB 1W2BA 3OB9A 2OTJA 3SWNC 2M1HA 4J6XA 3PVQA 2J6OA 1WFWA 3OYKA 1BI3A 2LP5A 1OYXA 3NHNA 3H9NA 3JCMV 4OMOA 2H3JA 2FO0A 3C0CA 2MIOA 5CK9A 4M7DC 3CC4Q 1GBRA 1A0NB 3OYCA 3QWXX 4M78B 3ZBDA 2EWNA 3HKSA 2V26A 4M75E 3OS0A 1U8RA 2J6FA 4A4EA 2MCNA 1D09B 1VQ8T 3CMAA 1QVPA 2CZ0B 4B9XA 5CR2A 1KK7A 1VA7A 1OX8A 3VS1A 2DLPA 4DBQA 5FRNA 3VS4A 1X6GA 5CKEA 3PE0A 1N8RC 2LMJA 4OMFB 3AT1B 3CEYA 4J6YA 1JXOA 4N0AC 4F7UG 3IQLA 1WPYA 1WZOA 2M0YA 2DPPB 2LX7A 4IIMA 1G8XA 5FU7B 3FLGA 3OYIA 1YHQA 2ZCFB 3X28B 4A53A 1EFNA 4JJBA 3PVLA 2M51A 1WIEA 3QPHA 2JW4A 4O6JA 5DM7R 1BI0A 3LW5E 3A8GB 3J7AF 4AFQC 2EYQA 2L3RA 1H3HA 1VQ4A 1BYMA 3I5SA 1NYGA 2R57A 4BDZA 1SSHA 3CCVQ 1KQSP 4IUVA 1Y96A 5DY9A 1TTHB 4D8DA 2E65A 1IHWA 1FYNA 3EFOA 3M5AA 3QIIA 2DBKA 3VU3C 4QQ6A 1JBMA 1QP2A 1TUGB 1YIJT 2MOXA 3ER0A 2RHZA 5GAOq 1N5ZA 1I0CA 3I9QA 3BDLA 2DRKA 4J83A 1LOJA 2V8IA 5GJVB 4R55A 1OZ3A 4D8KA 2XICA 4M4ZA 2X4WA 2PTKA 3FC3A 2X4JA 2MF2A 2AZSA 3QYGB 3CC4A 2FEIA 1WJSA 3OYLA 2YRDA 2YUQA 1Q95G 1PSFA 3CCJT 1VQ7Q 2KK4A 3QJYA 4D6WA 2X35A 1N9RA 4A4HA 1ARKA 1Q86U 4LD9K 2DE0X 1V76A 3M4YA 1OI1A 3RERA 4DQ2A 5GAMh 3CCLQ 4E7KA 1Y96B 4Z88A 1M4ZA 3G4SQ 2KROA 2OAWA 3EFOB 3P8BB 2K4YA 1O75A 3D7SB 3JCMX 3M0TA 5CKFA 4OB3B 1R0CB 3JCMJ 1MMDA 2KSSA 2J05A 4OMMA 4F16A 1Q86R 2EKOA 2M0OA 1OPLA 4YTLA 4M7AG 1E6HA 1FMVA 4OF1A 2OTLT 1UGQB 5LJ5e 4BE1A 2HQHA 2L3QA 2KR3A 2KRMA 3I56Q 2RB6A 2DNUA 1VQ9Q 3NTHA 4J9IA 1BIAA 2JMCA 3GIBA 3ME9A 1GFDA 4KULA 5GAMd 4C8QG 4HVVA 5GAN6 2BUDA 4ORZA 1ZHIA 1MMAA 1FWZA 4M78E 2ED0A 3CCMA 2GGRA 1M90U 4XTWA 2LTOA 1D0YA 1LJOA 3QBYA 1QVGS 1BI1A 2DXBA 3MEWA 4PL6A 1TWBA 4J6WA 2EJ9A 2F2XA 2MWOA 1GXIE 1HD3A 3OSSC 3L2QA 1LVKA 2Y4XA 4XU1A 2D0NA 4E7ZA 2JUFA 1Q7YU 1KD1C 2DL4A 2VUBA 1VIEA 3E9GA 1VQ5A 1EIFA 2ENMA 4P5NA 4CC4B 1M1KC 4EIKA 4ZGJB 1YNZA 1K9MU 2KXDA 4ZN3A 2DL3A 3G4SA 2FVUA 1X27A 2COZA 3S3MA 4K11A 4NS5A 3R6NA 3OMCA 1PSEA 2FYKA 4JRPA 2QQRA 2KBTA 3DB4A 3QKJA 1Q7YR 2C06A 1P92A 2HL5C 2YLCA 3A8OB 4J5YA 5LL6S 4PKCC 3UATA 3JB9D 3G1JA 2DIGA 1K9MR 4ZGDB 3C4SA 3CC2T 3A1PA 2DX1A 5I11A 4JJNK 1I81A 3U23A 3I56A 3JB9F 3NFCA 1K0SA 5J39A 1VQ9A 5LJ3f 1YN8A 3OYJA 1XJWB 2DETA 2F69A 1I1JA 5AYFA 2I0NA 3CCRQ 2EJFA 2KE9A 4CC3A 4RMOA 4M75C 5FU6B 1ZQ1A 5GANf 1C0MA 3PIPA 4M77A 5I2MA 3VS3A 2X9HA 1NLPC 4KH0B 4LDWA 4E7JA 3VUBA 3VRYA 1JEGA 3PIOA 4IUUA 2L3PA 4HVWA 1NLOC 3VKIA 2DJQA 2Z0WA 5HY6A 1K8AR 1K73U 1UUEA 1YITQ 2VKNA 4C92D 2QK0A 2RK1A 2EAYA 4JJDA 1UECA 3VS0A 1T3SA 1YWOA 1CKBA 3N5BB 4JRKA 4NOYA 1RAGB 3QHSA 2L2PA 1K9AA 3VUZA 1YJNQ 2M9UA 2RF0A 2WSEE 1VQ6Q 1O9SA 2JN0A 4LDXA 3CXCP 3V8LA 2LT1A 4ANJA 8ATCB 2DYIA 4IKFA 1FMKA 1TU0B 1JJ2P 2DXCA 3NPFA 1WX6A 4CC2A 2XDDA 1V1CA 2FHDA 4J9HA 2QEXT 1K73R 4AG2C 3EFSA 3KXTA 2ESWA 3JCMb 2JTEA 1OULA 2CP7A 4XTXA 1I4K1 1AHJB 1RAHB 4PJOD 4CI0C 2ZPIB 4PLLA 4L6V5 4M77B 2GNCA 3EGDA 1KIKA 2PVDB 4OVAA 1AZGB 4PJOF 2CH4W 2CT4A 5IXFA 4Y91A 2D9TA 1HSQA 1RLQC 3VYHB 2E70A 2QTXA 1J3TA 2K5IA 2O4XA 1X75C 5LJ5d 3UA6A 1ZBJA 5KE3A 3JCMf 4WF2A 3CCUQ 2EGEA 3SDZA 2AK5A 3CCRA 2ATCB 4RUGA 5ECAA 4AFUC 1MUZA 1QMCA 3TCJA 2DL8A 1RL2A 1UGPB 4F14A 2JVVA 4M7DG 2L89A 3A5ZB 1UTIA 1G5VA 2O9VA 4C8QA 3G71T 4C0DB 2LT4A 5KYUA 1ABOA 2ROLA 3I5RA 1KHCA 1GBQA 2COWA 2DTHA 3V8JA 4RTUA 4EDUA 3EGDB 1AEYA 1WI7A 2NWMA 1X6BA 1BKBA 2QTVA 4F17A 1YITA 3X20B 1RUWA 3R6OA 1WHHA 2XDPA 3VJPA 1AWJA 4NL3A 1VQMQ 3M0QA 2ZPGB 2RJCA 1VQNQ 3MP6A 3TREA 2ROTA 1RI0A 1WQ7A 3CMET 3GNFB 4JLGA 3RDVA 2O4XB 2E41A 2X4XA 1YJNA 1VQ6A 1NM7A 4FW2A 1WHMA 5D6YA 3CMAT 4IIOA 1PKSA 2O9SA 3EGUA 2NYSA 1ZSGA 2AHJB 3M0UA 3UA7A 4ELYC 5HK3A 1XOVA 1GL5A 3H41A 3HP9A 2COYA 3I55Q 4QVCA 5KYUB 1YJWT 1YI2T 1NPPA 3HRTA 1EX4A 2DVEA 1HK9A 5CAIA 1Z9QA 4DEXA 4M78C 5IH2A 1SF9A 3OYFA 4FSXA 4FSSA 2NUPA 4BY6B 3NTIA 2PNIA 1VQLA 1IB8A 1XTDA 3BW1A 2GQVA 2ZPBB 2E12A 1BBZA 2KI7A 3OYBA 5A0DA 1VQ4T 3RMSA 1S72A 3CC7Q 1UDLA 4GY5A 4RKUE 3GPLA 3CCUA 1X2KA 1K4US 2LCSA 3HSBA 3HRUA 4FYWB 4MMKA 1JXMA 2L0AA 2JJ9A 2CZ7B 1M1KU 2CP0A 2E3HA 2YXYA 5GMKi 3CPWP 2P84A 2IPOB 3OYYA 1U06A 1VQOT 3FEOA 4RTVA 1D0XA 1SRMA 5FU7C 2KDSA 1RAIB 2RHUA 4A54A 4Q5WA 1WHLA 2YT6A 5GAMe 2JS0A 3OW2P 1ACMB 4EPCA 5HK0A 3MEUA 3RUXA 3VV0A 2BIVA 1VQMA 1M2VA 1JB0E 1SKUB 1SPKA 2F5KA 3HRSA 1VQNA 2NUPB 4DEYA 3O5ZA 2GFAA 4HVUA 3JB9I 2P0QA 5C0MA 4M77E 5GMKj 1M3BA 3UT1A 2EVRA 1Q82R 1M8VA 2MAMA 2EPDA 4AFSC 3Q1JA 4XTZA 2AT1B 4FT4A 1PD0A 3ZEHA 5I22A 8AT1B 1QVFA 4LNPA 2CP5A 5IHNA 2RI2A 3I55A 1AVZC 4GLKA 4R56A 4ME7A 3CD6Q 3OYHA 4OB2B 1OQKA 4KGXB 1U1TA 2RI5A 1NZ9A 2VWFA 1KJWA 4PNOA 4BI8B 3DKMA 1OX9A 1M2VB 1W6XA 2A0FB 3RESA 5LJ3g 3CC7A 4A4GA 2K5FA 3X24B 2P0KA 2YHTA 5KH6A 4C8QD 1UHFA 2G6FX 2JXBA 5D6XA 2CP3A 4X34A 2XKOC 2W0ZA 2OJ2A 2A37A 2A08A 1PHTA 1YFNA 3SWNA 4FW1A 2X51A 4C5GA 1EZZB 2LCCA 1GRIA 4PJMA 4C8QF 5GANg 4BDYA 2FPFA 3CCMT 2ZAEA 4II1A 5KYNA 1B07A 4E6RA 3HFNA 1BCOA 4JPBW 3CCQT 2X3XD 4O5VA 1SRLA 4HCBA 3RR6A 4DBFA 2KT1A 2DJZA 1VQ8Q 2L5QA 1UHCA 3DLLA 4J9CA 3VS5A 1H92A 2RHYA 2RNAA 4QQGA 1N6AA 3META 3KFVA 3CXCA 3UDCA 1Q81C 1VQ5T 1Y57A 2NLUA 4X9DA 1VQKQ 5CIUA 2DO3A 1JJ2A 4XK8E 1RACB 2HBWA 2KGTA 2VC8A 2HEQA 2DBMA 2YUPA 4BD3A 1QKWA 2AZVA 3OY9A 4MDWA 2D1XA 3JAME 3SWNB 2GTOA 4ZGEB 2C0OA 5KYXA 2SRCA 2KRNA 3VYGA 3MHXA 1WHKA 5GAN4 1ZA1B 2SEMA 3DLMA 4XQ3A 5CKDA 4N4HA 4WTOB 3PNWC 5LJ5f 4AG1C 4OMLA 2V1QA 2BE9B 4CRIA 3QSUA 3SD4A 3VS6A 3CD6A 4C92A 4Z02A 5KYYA 2DAQA 2CT3A 1ZUUA 1PKTA 2QAZA 3X25B 2EYXA 4M75G 3RBBB 3P8HA 3E9FA 1YIJQ 1NYFA 2E5QA 4KGVB 1MHNA 4IURA 2KY9A 5LJ3j 2KNBB 3JCMg 3CPFA 4RTXA 2RD1A 2CS7A 2O88A 4J9EA 4B9WA 1FXXA 4JS4A 2DD4A 4PFOA 3L2UA 4J8OA 3ULRB 1NBEB 2CUDA 2BE7D 1MV3A 3X26B 2DKGA 4PJOA 3MEVA 1D1CA 1YWPA 1U3OA 3UF4A 5KYXB 4JS5A 1RADB 4LN2A 7AT1B 1ZLMA 1YJ9Q 5GANj 3OA6A 3CCJQ 2FL7A 4PLIA 3CCVA 1LCKA 1QP3A 3C94A 2AKKA 4KT0E 2EYYA 1WHJA 1JU5C 2K3BA 3M54A 1Y0MA 5CKBA 4C92B 1VQ8A 2GF7A 2VGMA 5KYYB 4OB0B 1KC8U 5GAOm 4MDXA 3WVDB 2NUTA 3PT9A 3GP8A 4KGZB 1VQKA 2YLBA 1WQWA 2LNVA 4BACA 1M27C 1X69A 2QQAA 4QW2A 1X2QA 1NJIC 4DOWA 1W2BS 2VGNA 2RM4A 5GAOr 2H3EB 5FU6C 5GAN3 2JT4A 2GCXA 2OTLQ 4FU6A 2Y90A 4PJOB 2DVJA 1KC8R 3HPWA 4HCZA 2QI2A 3LWHA 1VQ7A 1QVFS 4E7IA 1Y71A 4EMKA 2LQ8A 3MKDA 2HDAA 1M90R 3L2RA 3CCLA 2MMPA 3NTKA 1BIBA 3GNGA 4HCCA 1WGSA 3SB2A 1KQ2A 2JTMA 2RJFA 4R0KA 2JM8A 4GBQA 1MGQA 1K76A 1TS9A 3UWNA 3V7RA 1YIJA 4HA8A 5FROA 2NUZA 2NUTB 5GAN2 3QO3A 1VQPT 1W70A 4J9DA 2CZ1B 3CPWA 2CDTA 5DLOA 3G6ET 2HD0A 3CCRT 2P4TA 4Y28E 4M7DD 5J26A 2B8AA 2XIDA 2DTIA 1QVGP 4CC7A 4F7UA 2K5LA 2PUKB 3M0RA 3EH2A 3REBB 4M77C 2QXFA 1YJ9A 4M7DF 2BZ8A 4X9CA 3OW2A 3CCJA 1WXTA 2HQXA 5GAN8 2KRSA 1MMNA 4EMKB 2WSFE 4FCYA 1M3AA 4KUDK 3EG0A 4MZPA 3OS2A 2DL7A 4OP0A 2RQUA 4XU0A 1AZEA 2BZXA 3CXCS 2RJEA 1AWXA 2XK0A 1YJNT 2EBPA 1BCMA 1GCQA 2PQWA 1N8RU 2DEUA 3M59A 4M78G 5IHKA 2MWPA 4C0DC 2Y4YA 1YCYA 4F7UB 3LWIA 2L8DA 2D0QB 3JV3A 2QA4T 2LJ1A 2YRVA 2VYTA 3VS7A 2XDBA 2JM9A 3FDRA 3MO8A 3CCST 5GJWB 4C92F 5KCHA 4KBMB 1X43A 3M9QA 2YUOA 1GFCA 4LE9A 4LUDA 4XTUA 2KVQG 3EGXA 1Y07A 3RKXA 2MYSA 4IUTA 3CCET 3PMIA 5GAMj 1N8RR 2HBPA 2XI9A 1N9SA 4ZNXA 3PMTA 1VQLT 1IZ6A 4RTYA 4J9FA 5GMKh 1HYOA 3CBPA 3L2WA 1X6OA 1LPLA 2BZYA 2J6KA 1K0XA 3OYAA 1S72T 4FL6A 3CCUT 2P0PA 2M16A 2E4HA 4RG8A 2P4RA 1D0ZA 3H0IA 4C92E 4OMNA 1KSWA 1Q81U 1VOMA 3JCMP 3EHRA 3OS1A 1KFZA 1ZBXA 1KQSA 4C0ZA 3FJ5A 4DOVA 1CSKA 3PFSA 4M7AA 3E2UA 3E19A 2EQJA 4BY6C 2GTJA 3EG3A 4LDUA 1TOVA 1G83A 1QQJA 3EGXB 5EC7A 3HHTB 2ZPFB 2LC4A 1W1FA 1VQMT 3E1SA 4PJOE 1WJQA 1M30A 2O01E 1ZSZA 2QYZA 2E5KA 1G2BA 1T0HA 1IREB 2RA2A 2HSPA 4J9GA 1YBYA 4PJJA 2CP2A 2OTJT 2OAUA 3OBWA 4QKUA 3LLRA 1SEMA 3RIRA 5L8RE 1UJ0A 1Q86C 1RABB 1OOTA 1B34A 3G7ZA 3H8ZA 4LUEA 5FWBA 2E64A 4L59A 1VUBA 5LJ5g 4RTTA 1RAAB 1OZ2A 5IN1A 4ESRA 4M7AB 3CBMA 3L1AA 4WCIA 4HT9A 2EJGA 1UG1A 4V2SA 1FX7A 2I2LA 4RTZA 1KQ1A 3M4GA 4A63B 2O2OA 1WA7A 5AT1B 1OPKA 1ZSZB 2ZGWA 2V1RA 3KBGA 1SG5A 4C8QB 3H0HA 4QVZA 2V8KA 1RLPC 3QXEB 3VS2A 2ED1A 4HT8A 2LDMA 4F7UF 2CREA 3QG1A 1RAFB 1AT1B 5GAMf 1YHQT 4PJLA 1W4SA 2QQSA 3SHWA 5A2QE 3OW2S 3H6ZA 3CMEQ 5C6SA 1AWWA 2VB6A 2E3IA 1KD1U 2JMAA 3J80E 3LX7A 4F7UE 2MK5A 2DYBA 5HKCA 1UB4A 5FWCA 4C5IA 3INZA 4KRTA 3GBQA 2XMFA 2XD0A 5KE2A 5LJ3h 2K79A 3L2VA 2DM1A 4JJCA 3FRNA 4KUIA 3OYMA 3KUFA 2CYZB 1YJWQ 1YI2Q 1Q7YC 2QGFB 2CKKA 4AT1B 5FW9A 1Y7XA 3ZL7C 3EG1A 3M53A 4J7FA 1KD1R 1IXDA 5GANh 4JDSA 1MNDA 2WSCE 4Z89A 1K9MC 3CC4T 1M1KR 2GQIA 3M55A 2HL3A 3M56A 2LJ3A 1NG2A 2A28A 5LJ5j 2KMTA 3P8DA 3CD6T 1NEBA 4M75D 2KQWA 1PC0A 2KT8A 2RHIA 1X01A 1TXQA 4RG2A 1VQOQ 2FZCB 4M75F 4BI4A 5LJ3d 4C0GA 1QVGA 2DK3A 2R5MA 2LZ6B 3V7CA 3JCMQ 4OB1B 1HXDA 1PNJA 1PWTA 2CUBA 2JTFA 4M7AD 4RTWA 5I21A 2EFIA 4QT7A 2G3RA 2O31A 2KYBA 2DIQA 3JSCA 3MEAA 1K8AC 2X3WD 3MPUB 1H3ZA 2KAFA 5GANd 4M7AF 1KQSS 3A8LB 3CMEA 2HAXA 3CCVT 3CBOA 3H0FA 5L23A 5HCKA 1M5Q1 4BI3A 5M9OA 3OMGA 2YSQA 2QGGA 2XG8D 1JRIA 3SEMA 2EQIA 2C0IA 2DZCA 5CO7A 4ZN1A 1PRMC 1VQKT 3JCMh 1K73C 2VASA 2VXFA 3GF5A 4M7AE 2JZ2A 3VRZA 2DZ9A 5GMKm 4XU3A 1YJWA 1YI2A 4M7DA 2HQEA 1UE9A 2HCKA 2D8JA 1ZX6A 1D1AA 3PTAA 2AKLA 4GLMA 3C95A 3QZ5B 1BB9A 1SHGA 2HNIA 2DTOA 5CCAA 2EQMA 3NMZC 3O8VA 2DILA 4C8QE 2YDLA 2E10A 2RQTA 1VQ7T 2IVWA 4C92C 4LDYA 1KHIA 3JCMc 4FYYB 3CCLT 1JO8A 3FB9A 1VYVA 4N0AA 2JNGA 3G4ST 1PM3A 1G3YA 4BB7A 4M77G 1K1ZA 5DLQE 1VQOA 1UFFA 1QCNA 5CQYA 2K7AA 3T9NA 3TSWA 1D3BA 3CCMQ 4FT2A 1YP5A 1AWOA 4AFZC 3JCMd 3CCQQ 1UJYA 4M7DB 2HMAA 1VYTA 2RN8A 3JB9J 1QWFA 1I07A 3HFOA 4PJOC 5GAOn 2QQBA 2ZPEB 3TU4K 2XU8A 3C12A 3JB9H 4FM4B 2QG9B 3A8HB 1YJ9T 1C6VX 4LDVA 2VV5A 3BE3A 3I56T 1VQ5Q 2LX9A 1OU8A 1VQ9T 2RK2A 2V8JA 4Y92A 1IGUA 1D1BA 2KYMA 1WXUA 2LVMA 2K57A 2FB7A 3OS5A 1BK2A 2RQRA 3UPUA 4N4GA 2CH4A 1U5SA 4PK4A 1OEBA 1SHFA 2DMOA 2QDYB 1D3BB 4C5HA 4M78D 2LNHB 4Z8AA 2K9GA 1IRXA 2CSIA 4RCCA 3RNJA 4A4FA 4M78F 3ASKA 4F04B 2D8HA 4IUQA 2JOYA 5CKHA 4EMKC 1BI2A 1R0BG 5CQXA 5GMKe 5IHIA 2DD5A 2RQWA 2MI6A 3HTRA 2OX7A 2BKDN 3I35A 4BE0A 1IO6A 1TH7A 4VUBA 4BE2A 5FRMA 3BFMA 1OU9A 1LNXA 2IIMA 1UEBA 4E7LA 1NEGA 4OMPA 1B7TA 1WYXA 1XQHA 2EQUA 3CCQA 1PCXA 4PFZA 2L3SA 2QQ9A 1U1SA 4BUGA 2XHCA 3EFRA 5GAMg 3L42A 1WHGA 4OGEA 1BU1A 4E7HA 1I8FA 3OQ5A 1R77A 2FRYA 4XTVA 3THKA 1B3QA 1NPRA 2A3LA 2FZGB 4J7IA 3A8MB 4EMHA 4EMGA 4B6MA 2DL5A 1ZA2B 2X4YA 4C0FA 2HKQB 2PVGB 4XU2A 2J06A 1Q82C 2CP6A 1AOJA 2D6FA 1OV3A 2FPDA 4L5GA 1ABQA 1W2BP 2F2WA 3QDFA 1GCQC 2CZ6B 2YRCA 3QUIA 1MNEA 4DBRA 2EIFA 3FIFA 2E6ZA 2RPNA 1T0JA 1E7OA 2CGHA 4HKEA 1QVFP 2CSQA 1I5LA 2F2VA 4MZMA 5KYWA 2E1HA 1F1BB 2OI3A 2DERA 4AMCA 1YITT 1QLYA 3LGLA 1IGQA 3J81E 1TSFA 1VQPQ 1UGSB 4M7DE 2DF6A 2PZ1A 1K8AU 2RH2A 1JJ2S 1VQ6T 2GFUA 3G6EQ 1M8MA 1QCOA 1I5OB 2KEAA 4FYVB 3S3NA 4DBHA 3CQTA 2OTLA 4OGCA 3CC2Q 2W10A 3BY7A 4N4IA 5GAN5 1H8KA 2R5AA 4RCBA 2F5TX 4MZTA 2DEQA 3LH5A 5D7UA 2K2MA 2ECZA 3EAEA 4ATOA 2R58A 2ZZDA 3AHUA 3OBYA 3M57A 2LRQA 1M2OA 5IT9E 3WXMB 2K2VA 1QCFA 5KYWB 3JCMW 1PRLC 1WLPB 3TVTA 5LJ5h 4M7AC 4JZ3A 5LJ3e 1Z9ZA 3WVEB 5GAOp 1HJDA 3GLXA 5GMKl 1RAEB 1QWEA 4M75A 4C5EA 3V8KA 1M1GA 1GCPA 1ZSZC 2MPXC 4XAXB 2A36A 2YWWA 4C8QC 2FZKB 5GANe 2QA4Q 4FIBA 1WXBA 3S6WA 1KG1A 1H641 2FRWA 2EGAA 2M02A 1MV0B 3RKWA 2JS2A 3QZ9B 4QQDA 3CCSQ 4JUVA 5J3BA 2GBQA 2LQWA 2PUOB 4JRIA 4HXJA 2F1LA 1VIFA 2BTTA 1C1AA 3OYNA 2LQNA 3CCEQ 1T3LA 1Q81R 1MMGA 4OMQA 3S3OA 1TUCA 2K6DA 4JLIA 1VYUA 1IHVA 3FJPA 2QEXQ 1VQLQ 1VQNT 1WJRA 3F70A 5CVIA 3LYIA 4E7SA 1VQPA 2C0TA 5IAYA 1G3WA 1M3CA 5I2SA 4PFPA 3EG2A 3OYEA 1S72Q 4ZTJA 2RQVA 4M75B 1UGRB 3G6EA 3JRZA 3TQ7P 2FG0A 1ZUYA 3M0SA 3V7SA 5FLXE 1CKAA 1G3SA 3CC2A 1G3TA 1RI9A 3JB9G 9ATCB 6AT1B 3EH1A 4MMLA 4X1VA 4DA4A 3RMQA 5D6WA 2HZYA 1FMWA 2EKHA 3DB3A 1UGVA 3I55T 1TUDA 3QWYA 4IUPA 4PJNA 3REAB 2RHXA 3SFMA 3URGA 3L2ZA 4TVRA 2EYZA 2WACA 2LCLA 2PVOB 4ZTFA 2VXEA 1PD1A 2J7IA 2K3YA 3G71Q 3GOXA 3EHQA 3CC7T 3JCMe 1AD5A 2IG0A 3PGGA 2DXUA 5EG2A 3A98A 4E2FB 1JQQA 2OTJQ 3CPWS 2QDLA 2H8HA 4QVDA 2QASA 5GAOl 3TSZA 2K3XA 4ELZC 2QA4A 1NJIU 1ZUKA 1B34B 3EG9A 4C92G 4LD6A 2PU9B 2ABLA 2KXCA 3NGPA 3MP1A 3CCSA 1N27A 1KC8C 5A0LA 2E6NA 3QYHB 1V29B 3TEEA 3CCEA 3MP8A 3QJ6A 2DFUA 1M1FA 1M90C 3CMAQ 2RO0A 4JRQA 2LJ0A 3M58A 2QEXA 4E47A 2EGCA 1WNLA 1M9SA 2A7YA 1QKXA 2HSEB 2VVKA 3MCAB 1PG5B 1NJIR 5A0GA 4UC4A 4NL2A 4XTYA 1QW1A 2RJDA 1DJ7B 3OYDA 4PJOG 2EYWA 2ZPHB 4M77D 1S1NA 4HCKA 2DRMA 1YCSB 4KH1B 4LXCA 2RI3A 2EW3A 1YHQQ 1SSFA 3BDUA 1R8OB 4M77F 3RKYA 4M78A 1Q82U 3LGFA 4A4KA 3EG9B 1E6GA 2DXTA 3OYGA 2FPEA 2LQKA 4FYXB 1VQ4Q 1XNIA 2AIRB 2YUNA 3LH0A 4J9BA 3HL8A 1WDXA 2EQKA
chains in the Genus database with same CATH topology
2AK5A 1TG0A 4CC7A 4RUGA 5ECAA 4AFUC 1MUZA 5IXBA 3M0RA 2DL8A 4F14A 3REBB 1UTIA 2O9VA 2RMOA 2BZ8A 3M0PA 4JZ4A 2DA9A 1WXTA 2B86A 1ABOA 2ROLA 2KRSA 3I5RA 1GBQA 4Y92A 3PVQA 2J6OA 1WFWA 4RTUA 1AEYA 1WI7A 2NWMA 1X6BA 1M3AA 4F17A 2KYMA 1WXUA 2LP5A 1RUWA 3EG0A 3NHNA 1BK2A 4OMOA 1AWJA 2RQRA 3M0QA 2FO0A 3C0CA 2MIOA 2DL7A 2RQUA 2CH4A 1GBRA 1U5SA 1AZEA 1A0NB 2BZXA 2ROTA 3QWXX 1OEBA 1SHFA 2DMOA 1AWXA 2LNHB 4Z8AA 2EBPA 1GCQA 1NM7A 2J6FA 2K9GA 2CSIA 3RNJA 2MCNA 5IHKA 4IIOA 1PKSA 1VA7A 2O9SA 3EGUA 2DLPA 3VS1A 1ZSGA 3VS4A 1X6GA 2D8HA 3PE0A 2LMJA 3JV3A 3M0UA 3UA7A 2LJ1A 1XOVA 1GL5A 3H41A 3VS7A 1JXOA 5IHIA 2JM9A 5GJWB 1X43A 2RQWA 2YUOA 1GFCA 4LE9A 4LUDA 3IQLA 2M0YA 2LX7A 4IIMA 1Z9QA 3I35A 4DEXA 1IO6A 5IH2A 4ZNXA 1EFNA 4JJBA 4FSSA 4RTYA 2PNIA 3PVLA 4J9FA 2IIMA 2M51A 1WIEA 2JW4A 2BZYA 2J6KA 1K0XA 1BBZA 4AFQC 1NEGA 4OMPA 1WYXA 1H3HA 3I5SA 1UDLA 1NYGA 1SSHA 1X2KA 2L3SA 2LCSA 1K4US 2P4RA 3H0IA 4OMNA 1KSWA 4D8DA 1JXMA 2L0AA 1FYNA 1BU1A 3EHRA 1KFZA 2DBKA 2FRYA 3THKA 1U06A 3FJ5A 2MOXA 4RTVA 1B3QA 1SRMA 1N5ZA 1CSKA 1I0CA 2DL5A 3I9QA 2DRKA 5GJVB 2YT6A 4D8KA 4M4ZA 2JS0A 2GTJA 2J06A 3EG3A 1G83A 1AOJA 5EC7A 2PTKA 1OV3A 2FPDA 1W1FA 1ABQA 1M30A 1SPKA 2AZSA 2F2WA 2FEIA 2E5KA 4DEYA 1GCQC 2YUQA 3O5ZA 1G2BA 1T0HA 4HVUA 2HSPA 4J9GA 2RPNA 1M3BA 1ARKA 1T0JA 2EVRA 2DE0X 1E7OA 2EPDA 4AFSC 2CSQA 4Z88A 2F2VA 1SEMA 2KROA 2OI3A 2OAWA 1QLYA 1UJ0A 1OOTA 4LUEA 5FWBA 5I22A 3M0TA 4LNPA 4RTTA 5IHNA 2DF6A 1AVZC 2PZ1A 4ESRA 2J05A 4WCIA 4OMMA 1UG1A 4F16A 1M8MA 2KEAA 4RTZA 1OPLA 4A63B 2VWFA 1E6HA 1KJWA 2O2OA 3CQTA 1WA7A 1OPKA 2W10A 1W6XA 2V1RA 1H8KA 2L3QA 2KR3A 2KRMA 3LH5A 3H0HA 2K2MA 2ECZA 2DNUA 4J9IA 1RLPC 1UHFA 2G6FX 2JXBA 2JMCA 3VS2A 2ED1A 1GFDA 2CREA 2W0ZA 2OJ2A 2A37A 2A08A 1PHTA 4HVVA 1QCFA 1GRIA 1PRLC 1WLPB 3TVTA 4ORZA 4JZ3A 3SHWA 2ED0A 2FPFA 1Z9ZA 2GGRA 1B07A 4E6RA 1HJDA 1QWEA 4JPBW 1AWWA 2X3XD 1SRLA 2JMAA 2F2XA 1GCPA 2KT1A 2A36A 2DYBA 1HD3A 5FWCA 4KRTA 1UHCA 3GBQA 4J9CA 2XMFA 3VS5A 2D0NA 1H92A 2RNAA 2DL4A 2K79A 3KFVA 2DM1A 1WXBA 1Y57A 4JJCA 2ENMA 2FRWA 2EGAA 1MV0B 4CC4B 2JS2A 4EIKA 2HBWA 2KGTA 2GBQA 2LQWA 1YNZA 4HXJA 2KXDA 2DL3A 2HEQA 5FW9A 2BTTA 2DBMA 2YUPA 1QKWA 3ZL7C 2LQNA 1X27A 3EG1A 2AZVA 1T3LA 2D1XA 4K11A 2GTOA 4OMQA 3R6NA 1TUCA 2C0OA 2K6DA 1VYUA 2SRCA 2KRNA 4Z89A 2SEMA 2GQIA 2KBTA 2LJ3A 1NG2A 2A28A 2C0TA 1M3CA 4AG1C 3EG2A 4OMLA 2V1QA 2RQVA 3VS6A 3UATA 1NEBA 2FG0A 1ZUYA 2CT3A 3M0SA 1ZUUA 2KT8A 1PKTA 1CKAA 2EYXA 1RI9A 2DX1A 3RBBB 5I11A 1NYFA 4X1VA 3U23A 1K0SA 2EKHA 1UGVA 2KNBB 1TUDA 1YN8A 2LZ6B 4J9BA 3QWYA 3REAB 4RTXA 2O88A 1PNJA 1PWTA 4J9EA 2CUBA 3ULRB 1I1JA 4RTWA 2EYZA 2CUDA 4QT7A 2I0NA 2O31A 2KYBA 1MV3A 2J7IA 2X3WD 2KE9A 4CC3A 1YWPA 1U3OA 3UF4A 4LN2A 1ZLMA 3EHQA 1AD5A 3VS3A 1NLPC 1LCKA 3H0FA 3A98A 3VRYA 1JEGA 2AKKA 5L23A 1JQQA 5HCKA 2L3PA 4HVWA 1NLOC 2EYYA 1JU5C 2DJQA 2QDLA 2K3BA 1Y0MA 2H8HA 2YSQA 1UUEA 2VKNA 3SEMA 4JJDA 2EQIA 3TSZA 1UECA 2C0IA 3VS0A 1ZUKA 1T3SA 1YWOA 1CKBA 1PRMC 2ABLA 2KXCA 3NGPA 3VRZA 1M27C 1X69A 2L2PA 1K9AA 1UE9A 2HCKA 1X2QA 2RF0A 2D8JA 1ZX6A 2AKLA 4GLMA 1FMKA 2JT4A 1WX6A 1BB9A 1SHGA 3NPFA 4CC2A 2LJ0A 1V1CA 4J9HA 2EGCA 4AG2C 2ESWA 2JTEA 3NMZC 2DILA 1QKXA 2DVJA 2YDLA 2RQTA 2VVKA 2HDAA 2GNCA 1JO8A 1KIKA 1VYVA 2EYWA 1S1NA 1AZGB 4HCKA 2DRMA 1YCSB 2CH4W 2CT4A 4R0KA 2JM8A 4GBQA 5IXFA 2EW3A 1K76A 1K1ZA 1HSQA 1RLQC 1UFFA 1J3TA 2NUZA 2K7AA 3TSWA 1YP5A 1W70A 1AWOA 1E6GA 2FPEA 3UA6A 1ZBJA 4J9DA 4AFZC 2CDTA 2YUNA 1UJYA 1VYTA 2RN8A 1QWFA 1I07A 2EGEA 1WDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AK5 A;  1TG0 A;  4CC7 A;  4RUG A;  5ECA A;  4AFU C;  1MUZ A;  5IXB A;  3M0R A;  2DL8 A;  4F14 A;  3REB B;  1UTI A;  2O9V A;  2RMO A;  2BZ8 A;  3M0P A;  4JZ4 A;  2DA9 A;  1WXT A;  2B86 A;  1ABO A;  2ROL A;  2KRS A;  3I5R A;  1GBQ A;  4Y92 A;  3PVQ A;  2J6O A;  1WFW A;  4RTU A;  1AEY A;  1WI7 A;  2NWM A;  1X6B A;  1M3A A;  4F17 A;  2KYM A;  1WXU A;  2LP5 A;  1RUW A;  3EG0 A;  3NHN A;  1BK2 A;  4OMO A;  1AWJ A;  2RQR A;  3M0Q A;  2FO0 A;  3C0C A;  2MIO A;  2DL7 A;  2RQU A;  2CH4 A;  1GBR A;  1U5S A;  1AZE A;  1A0N B;  2BZX A;  2ROT A;  3QWX X;  1OEB A;  1SHF A;  2DMO A;  1AWX A;  2LNH B;  4Z8A A;  2EBP A;  1GCQ A;  1NM7 A;  2J6F A;  2K9G A;  2CSI A;  3RNJ A;  2MCN A;  5IHK A;  4IIO A;  1PKS A;  1VA7 A;  2O9S A;  3EGU A;  2DLP A;  3VS1 A;  1ZSG A;  3VS4 A;  1X6G A;  2D8H A;  3PE0 A;  2LMJ A;  3JV3 A;  3M0U A;  3UA7 A;  2LJ1 A;  1XOV A;  1GL5 A;  3H41 A;  3VS7 A;  1JXO A;  5IHI A;  2JM9 A;  5GJW B;  1X43 A;  2RQW A;  2YUO A;  1GFC A;  4LE9 A;  4LUD A;  3IQL A;  2M0Y A;  2LX7 A;  4IIM A;  1Z9Q A;  3I35 A;  4DEX A;  1IO6 A;  5IH2 A;  4ZNX A;  1EFN A;  4JJB A;  4FSS A;  4RTY A;  2PNI A;  3PVL A;  4J9F A;  2IIM A;  2M51 A;  1WIE A;  2JW4 A;  2BZY A;  2J6K A;  1K0X A;  1BBZ A;  4AFQ C;  1NEG A;  4OMP A;  1WYX A;  1H3H A;  3I5S A;  1UDL A;  1NYG A;  1SSH A;  1X2K A;  2L3S A;  2LCS A;  1K4U S;  2P4R A;  3H0I A;  4OMN A;  1KSW A;  4D8D A;  1JXM A;  2L0A A;  1FYN A;  1BU1 A;  3EHR A;  1KFZ A;  2DBK A;  2FRY A;  3THK A;  1U06 A;  3FJ5 A;  2MOX A;  4RTV A;  1B3Q A;  1SRM A;  1N5Z A;  1CSK A;  1I0C A;  2DL5 A;  3I9Q A;  2DRK A;  5GJV B;  2YT6 A;  4D8K A;  4M4Z A;  2JS0 A;  2GTJ A;  2J06 A;  3EG3 A;  1G83 A;  1AOJ A;  5EC7 A;  2PTK A;  1OV3 A;  2FPD A;  1W1F A;  1ABQ A;  1M30 A;  1SPK A;  2AZS A;  2F2W A;  2FEI A;  2E5K A;  4DEY A;  1GCQ C;  2YUQ A;  3O5Z A;  1G2B A;  1T0H A;  4HVU A;  2HSP A;  4J9G A;  2RPN A;  1M3B A;  1ARK A;  1T0J A;  2EVR A;  2DE0 X;  1E7O A;  2EPD A;  4AFS C;  2CSQ A;  4Z88 A;  2F2V A;  1SEM A;  2KRO A;  2OI3 A;  2OAW A;  1QLY A;  1UJ0 A;  1OOT A;  4LUE A;  5FWB A;  5I22 A;  3M0T A;  4LNP A;  4RTT A;  5IHN A;  2DF6 A;  1AVZ C;  2PZ1 A;  4ESR A;  2J05 A;  4WCI A;  4OMM A;  1UG1 A;  4F16 A;  1M8M A;  2KEA A;  4RTZ A;  1OPL A;  4A63 B;  2VWF A;  1E6H A;  1KJW A;  2O2O A;  3CQT A;  1WA7 A;  1OPK A;  2W10 A;  1W6X A;  2V1R A;  1H8K A;  2L3Q A;  2KR3 A;  2KRM A;  3LH5 A;  3H0H A;  2K2M A;  2ECZ A;  2DNU A;  4J9I A;  1RLP C;  1UHF A;  2G6F X;  2JXB A;  2JMC A;  3VS2 A;  2ED1 A;  1GFD A;  2CRE A;  2W0Z A;  2OJ2 A;  2A37 A;  2A08 A;  1PHT A;  4HVV A;  1QCF A;  1GRI A;  1PRL C;  1WLP B;  3TVT A;  4ORZ A;  4JZ3 A;  3SHW A;  2ED0 A;  2FPF A;  1Z9Z A;  2GGR A;  1B07 A;  4E6R A;  1HJD A;  1QWE A;  4JPB W;  1AWW A;  2X3X D;  1SRL A;  2JMA A;  2F2X A;  1GCP A;  2KT1 A;  2A36 A;  2DYB A;  1HD3 A;  5FWC A;  4KRT A;  1UHC A;  3GBQ A;  4J9C A;  2XMF A;  3VS5 A;  2D0N A;  1H92 A;  2RNA A;  2DL4 A;  2K79 A;  3KFV A;  2DM1 A;  1WXB A;  1Y57 A;  4JJC A;  2ENM A;  2FRW A;  2EGA A;  1MV0 B;  4CC4 B;  2JS2 A;  4EIK A;  2HBW A;  2KGT A;  2GBQ A;  2LQW A;  1YNZ A;  4HXJ A;  2KXD A;  2DL3 A;  2HEQ A;  5FW9 A;  2BTT A;  2DBM A;  2YUP A;  1QKW A;  3ZL7 C;  2LQN A;  1X27 A;  3EG1 A;  2AZV A;  1T3L A;  2D1X A;  4K11 A;  2GTO A;  4OMQ A;  3R6N A;  1TUC A;  2C0O A;  2K6D A;  1VYU A;  2SRC A;  2KRN A;  4Z89 A;  2SEM A;  2GQI A;  2KBT A;  2LJ3 A;  1NG2 A;  2A28 A;  2C0T A;  1M3C A;  4AG1 C;  3EG2 A;  4OML A;  2V1Q A;  2RQV A;  3VS6 A;  3UAT A;  1NEB A;  2FG0 A;  1ZUY A;  2CT3 A;  3M0S A;  1ZUU A;  2KT8 A;  1PKT A;  1CKA A;  2EYX A;  1RI9 A;  2DX1 A;  3RBB B;  5I11 A;  1NYF A;  4X1V A;  3U23 A;  1K0S A;  2EKH A;  1UGV A;  2KNB B;  1TUD A;  1YN8 A;  2LZ6 B;  4J9B A;  3QWY A;  3REA B;  4RTX A;  2O88 A;  1PNJ A;  1PWT A;  4J9E A;  2CUB A;  3ULR B;  1I1J A;  4RTW A;  2EYZ A;  2CUD A;  4QT7 A;  2I0N A;  2O31 A;  2KYB A;  1MV3 A;  2J7I A;  2X3W D;  2KE9 A;  4CC3 A;  1YWP A;  1U3O A;  3UF4 A;  4LN2 A;  1ZLM A;  3EHQ A;  1AD5 A;  3VS3 A;  1NLP C;  1LCK A;  3H0F A;  3A98 A;  3VRY A;  1JEG A;  2AKK A;  5L23 A;  1JQQ A;  5HCK A;  2L3P A;  4HVW A;  1NLO C;  2EYY A;  1JU5 C;  2DJQ A;  2QDL A;  2K3B A;  1Y0M A;  2H8H A;  2YSQ A;  1UUE A;  2VKN A;  3SEM A;  4JJD A;  2EQI A;  3TSZ A;  1UEC A;  2C0I A;  3VS0 A;  1ZUK A;  1T3S A;  1YWO A;  1CKB A;  1PRM C;  2ABL A;  2KXC A;  3NGP A;  3VRZ A;  1M27 C;  1X69 A;  2L2P A;  1K9A A;  1UE9 A;  2HCK A;  1X2Q A;  2RF0 A;  2D8J A;  1ZX6 A;  2AKL A;  4GLM A;  1FMK A;  2JT4 A;  1WX6 A;  1BB9 A;  1SHG A;  3NPF A;  4CC2 A;  2LJ0 A;  1V1C A;  4J9H A;  2EGC A;  4AG2 C;  2ESW A;  2JTE A;  3NMZ C;  2DIL A;  1QKX A;  2DVJ A;  2YDL A;  2RQT A;  2VVK A;  2HDA A;  2GNC A;  1JO8 A;  1KIK A;  1VYV A;  2EYW A;  1S1N A;  1AZG B;  4HCK A;  2DRM A;  1YCS B;  2CH4 W;  2CT4 A;  4R0K A;  2JM8 A;  4GBQ A;  5IXF A;  2EW3 A;  1K76 A;  1K1Z A;  1HSQ A;  1RLQ C;  1UFF A;  1J3T A;  2NUZ A;  2K7A A;  3TSW A;  1YP5 A;  1W70 A;  1AWO A;  1E6G A;  2FPE A;  3UA6 A;  1ZBJ A;  4J9D A;  4AFZ C;  2CDT A;  2YUN A;  1UJY A;  1VYT A;  2RN8 A;  1QWF A;  1I07 A;  2EGE A;  1WDX A; 
#chains in the Genus database with same CATH topology
 3OSV A;  1TG0 A;  5GAN 7;  3MJX A;  5IXB A;  2HKN A;  3ZFJ A;  1NE8 A;  2RMO A;  5KCO A;  3G71 A;  3M0P A;  4JZ4 A;  2DA9 A;  2B86 A;  3QDR B;  1W2B A;  3OB9 A;  2OTJ A;  3SWN C;  2M1H A;  4J6X A;  3PVQ A;  2J6O A;  1WFW A;  3OYK A;  1BI3 A;  2LP5 A;  1OYX A;  3NHN A;  3H9N A;  3JCM V;  4OMO A;  2H3J A;  2FO0 A;  3C0C A;  2MIO A;  5CK9 A;  4M7D C;  3CC4 Q;  1GBR A;  1A0N B;  3OYC A;  3QWX X;  4M78 B;  3ZBD A;  2EWN A;  3HKS A;  2V26 A;  4M75 E;  3OS0 A;  1U8R A;  2J6F A;  4A4E A;  2MCN A;  1D09 B;  1VQ8 T;  3CMA A;  1QVP A;  2CZ0 B;  4B9X A;  5CR2 A;  1KK7 A;  1VA7 A;  1OX8 A;  3VS1 A;  2DLP A;  4DBQ A;  5FRN A;  3VS4 A;  1X6G A;  5CKE A;  3PE0 A;  1N8R C;  2LMJ A;  4OMF B;  3AT1 B;  3CEY A;  4J6Y A;  1JXO A;  4N0A C;  4F7U G;  3IQL A;  1WPY A;  1WZO A;  2M0Y A;  2DPP B;  2LX7 A;  4IIM A;  1G8X A;  5FU7 B;  3FLG A;  3OYI A;  1YHQ A;  2ZCF B;  3X28 B;  4A53 A;  1EFN A;  4JJB A;  3PVL A;  2M51 A;  1WIE A;  3QPH A;  2JW4 A;  4O6J A;  5DM7 R;  1BI0 A;  3LW5 E;  3A8G B;  3J7A F;  4AFQ C;  2EYQ A;  2L3R A;  1H3H A;  1VQ4 A;  1BYM A;  3I5S A;  1NYG A;  2R57 A;  4BDZ A;  1SSH A;  3CCV Q;  1KQS P;  4IUV A;  1Y96 A;  5DY9 A;  1TTH B;  4D8D A;  2E65 A;  1IHW A;  1FYN A;  3EFO A;  3M5A A;  3QII A;  2DBK A;  3VU3 C;  4QQ6 A;  1JBM A;  1QP2 A;  1TUG B;  1YIJ T;  2MOX A;  3ER0 A;  2RHZ A;  5GAO q;  1N5Z A;  1I0C A;  3I9Q A;  3BDL A;  2DRK A;  4J83 A;  1LOJ A;  2V8I A;  5GJV B;  4R55 A;  1OZ3 A;  4D8K A;  2XIC A;  4M4Z A;  2X4W A;  2PTK A;  3FC3 A;  2X4J A;  2MF2 A;  2AZS A;  3QYG B;  3CC4 A;  2FEI A;  1WJS A;  3OYL A;  2YRD A;  2YUQ A;  1Q95 G;  1PSF A;  3CCJ T;  1VQ7 Q;  2KK4 A;  3QJY A;  4D6W A;  2X35 A;  1N9R A;  4A4H A;  1ARK A;  1Q86 U;  4LD9 K;  2DE0 X;  1V76 A;  3M4Y A;  1OI1 A;  3RER A;  4DQ2 A;  5GAM h;  3CCL Q;  4E7K A;  1Y96 B;  4Z88 A;  1M4Z A;  3G4S Q;  2KRO A;  2OAW A;  3EFO B;  3P8B B;  2K4Y A;  1O75 A;  3D7S B;  3JCM X;  3M0T A;  5CKF A;  4OB3 B;  1R0C B;  3JCM J;  1MMD A;  2KSS A;  2J05 A;  4OMM A;  4F16 A;  1Q86 R;  2EKO A;  2M0O A;  1OPL A;  4YTL A;  4M7A G;  1E6H A;  1FMV A;  4OF1 A;  2OTL T;  1UGQ B;  5LJ5 e;  4BE1 A;  2HQH A;  2L3Q A;  2KR3 A;  2KRM A;  3I56 Q;  2RB6 A;  2DNU A;  1VQ9 Q;  3NTH A;  4J9I A;  1BIA A;  2JMC A;  3GIB A;  3ME9 A;  1GFD A;  4KUL A;  5GAM d;  4C8Q G;  4HVV A;  5GAN 6;  2BUD A;  4ORZ A;  1ZHI A;  1MMA A;  1FWZ A;  4M78 E;  2ED0 A;  3CCM A;  2GGR A;  1M90 U;  4XTW A;  2LTO A;  1D0Y A;  1LJO A;  3QBY A;  1QVG S;  1BI1 A;  2DXB A;  3MEW A;  4PL6 A;  1TWB A;  4J6W A;  2EJ9 A;  2F2X A;  2MWO A;  1GXI E;  1HD3 A;  3OSS C;  3L2Q A;  1LVK A;  2Y4X A;  4XU1 A;  2D0N A;  4E7Z A;  2JUF A;  1Q7Y U;  1KD1 C;  2DL4 A;  2VUB A;  1VIE A;  3E9G A;  1VQ5 A;  1EIF A;  2ENM A;  4P5N A;  4CC4 B;  1M1K C;  4EIK A;  4ZGJ B;  1YNZ A;  1K9M U;  2KXD A;  4ZN3 A;  2DL3 A;  3G4S A;  2FVU A;  1X27 A;  2COZ A;  3S3M A;  4K11 A;  4NS5 A;  3R6N A;  3OMC A;  1PSE A;  2FYK A;  4JRP A;  2QQR A;  2KBT A;  3DB4 A;  3QKJ A;  1Q7Y R;  2C06 A;  1P92 A;  2HL5 C;  2YLC A;  3A8O B;  4J5Y A;  5LL6 S;  4PKC C;  3UAT A;  3JB9 D;  3G1J A;  2DIG A;  1K9M R;  4ZGD B;  3C4S A;  3CC2 T;  3A1P A;  2DX1 A;  5I11 A;  4JJN K;  1I81 A;  3U23 A;  3I56 A;  3JB9 F;  3NFC A;  1K0S A;  5J39 A;  1VQ9 A;  5LJ3 f;  1YN8 A;  3OYJ A;  1XJW B;  2DET A;  2F69 A;  1I1J A;  5AYF A;  2I0N A;  3CCR Q;  2EJF A;  2KE9 A;  4CC3 A;  4RMO A;  4M75 C;  5FU6 B;  1ZQ1 A;  5GAN f;  1C0M A;  3PIP A;  4M77 A;  5I2M A;  3VS3 A;  2X9H A;  1NLP C;  4KH0 B;  4LDW A;  4E7J A;  3VUB A;  3VRY A;  1JEG A;  3PIO A;  4IUU A;  2L3P A;  4HVW A;  1NLO C;  3VKI A;  2DJQ A;  2Z0W A;  5HY6 A;  1K8A R;  1K73 U;  1UUE A;  1YIT Q;  2VKN A;  4C92 D;  2QK0 A;  2RK1 A;  2EAY A;  4JJD A;  1UEC A;  3VS0 A;  1T3S A;  1YWO A;  1CKB A;  3N5B B;  4JRK A;  4NOY A;  1RAG B;  3QHS A;  2L2P A;  1K9A A;  3VUZ A;  1YJN Q;  2M9U A;  2RF0 A;  2WSE E;  1VQ6 Q;  1O9S A;  2JN0 A;  4LDX A;  3CXC P;  3V8L A;  2LT1 A;  4ANJ A;  8ATC B;  2DYI A;  4IKF A;  1FMK A;  1TU0 B;  1JJ2 P;  2DXC A;  3NPF A;  1WX6 A;  4CC2 A;  2XDD A;  1V1C A;  2FHD A;  4J9H A;  2QEX T;  1K73 R;  4AG2 C;  3EFS A;  3KXT A;  2ESW A;  3JCM b;  2JTE A;  1OUL A;  2CP7 A;  4XTX A;  1I4K 1;  1AHJ B;  1RAH B;  4PJO D;  4CI0 C;  2ZPI B;  4PLL A;  4L6V 5;  4M77 B;  2GNC A;  3EGD A;  1KIK A;  2PVD B;  4OVA A;  1AZG B;  4PJO F;  2CH4 W;  2CT4 A;  5IXF A;  4Y91 A;  2D9T A;  1HSQ A;  1RLQ C;  3VYH B;  2E70 A;  2QTX A;  1J3T A;  2K5I A;  2O4X A;  1X75 C;  5LJ5 d;  3UA6 A;  1ZBJ A;  5KE3 A;  3JCM f;  4WF2 A;  3CCU Q;  2EGE A;  3SDZ A;  2AK5 A;  3CCR A;  2ATC B;  4RUG A;  5ECA A;  4AFU C;  1MUZ A;  1QMC A;  3TCJ A;  2DL8 A;  1RL2 A;  1UGP B;  4F14 A;  2JVV A;  4M7D G;  2L89 A;  3A5Z B;  1UTI A;  1G5V A;  2O9V A;  4C8Q A;  3G71 T;  4C0D B;  2LT4 A;  5KYU A;  1ABO A;  2ROL A;  3I5R A;  1KHC A;  1GBQ A;  2COW A;  2DTH A;  3V8J A;  4RTU A;  4EDU A;  3EGD B;  1AEY A;  1WI7 A;  2NWM A;  1X6B A;  1BKB A;  2QTV A;  4F17 A;  1YIT A;  3X20 B;  1RUW A;  3R6O A;  1WHH A;  2XDP A;  3VJP A;  1AWJ A;  4NL3 A;  1VQM Q;  3M0Q A;  2ZPG B;  2RJC A;  1VQN Q;  3MP6 A;  3TRE A;  2ROT A;  1RI0 A;  1WQ7 A;  3CME T;  3GNF B;  4JLG A;  3RDV A;  2O4X B;  2E41 A;  2X4X A;  1YJN A;  1VQ6 A;  1NM7 A;  4FW2 A;  1WHM A;  5D6Y A;  3CMA T;  4IIO A;  1PKS A;  2O9S A;  3EGU A;  2NYS A;  1ZSG A;  2AHJ B;  3M0U A;  3UA7 A;  4ELY C;  5HK3 A;  1XOV A;  1GL5 A;  3H41 A;  3HP9 A;  2COY A;  3I55 Q;  4QVC A;  5KYU B;  1YJW T;  1YI2 T;  1NPP A;  3HRT A;  1EX4 A;  2DVE A;  1HK9 A;  5CAI A;  1Z9Q A;  4DEX A;  4M78 C;  5IH2 A;  1SF9 A;  3OYF A;  4FSX A;  4FSS A;  2NUP A;  4BY6 B;  3NTI A;  2PNI A;  1VQL A;  1IB8 A;  1XTD A;  3BW1 A;  2GQV A;  2ZPB B;  2E12 A;  1BBZ A;  2KI7 A;  3OYB A;  5A0D A;  1VQ4 T;  3RMS A;  1S72 A;  3CC7 Q;  1UDL A;  4GY5 A;  4RKU E;  3GPL A;  3CCU A;  1X2K A;  1K4U S;  2LCS A;  3HSB A;  3HRU A;  4FYW B;  4MMK A;  1JXM A;  2L0A A;  2JJ9 A;  2CZ7 B;  1M1K U;  2CP0 A;  2E3H A;  2YXY A;  5GMK i;  3CPW P;  2P84 A;  2IPO B;  3OYY A;  1U06 A;  1VQO T;  3FEO A;  4RTV A;  1D0X A;  1SRM A;  5FU7 C;  2KDS A;  1RAI B;  2RHU A;  4A54 A;  4Q5W A;  1WHL A;  2YT6 A;  5GAM e;  2JS0 A;  3OW2 P;  1ACM B;  4EPC A;  5HK0 A;  3MEU A;  3RUX A;  3VV0 A;  2BIV A;  1VQM A;  1M2V A;  1JB0 E;  1SKU B;  1SPK A;  2F5K A;  3HRS A;  1VQN A;  2NUP B;  4DEY A;  3O5Z A;  2GFA A;  4HVU A;  3JB9 I;  2P0Q A;  5C0M A;  4M77 E;  5GMK j;  1M3B A;  3UT1 A;  2EVR A;  1Q82 R;  1M8V A;  2MAM A;  2EPD A;  4AFS C;  3Q1J A;  4XTZ A;  2AT1 B;  4FT4 A;  1PD0 A;  3ZEH A;  5I22 A;  8AT1 B;  1QVF A;  4LNP A;  2CP5 A;  5IHN A;  2RI2 A;  3I55 A;  1AVZ C;  4GLK A;  4R56 A;  4ME7 A;  3CD6 Q;  3OYH A;  4OB2 B;  1OQK A;  4KGX B;  1U1T A;  2RI5 A;  1NZ9 A;  2VWF A;  1KJW A;  4PNO A;  4BI8 B;  3DKM A;  1OX9 A;  1M2V B;  1W6X A;  2A0F B;  3RES A;  5LJ3 g;  3CC7 A;  4A4G A;  2K5F A;  3X24 B;  2P0K A;  2YHT A;  5KH6 A;  4C8Q D;  1UHF A;  2G6F X;  2JXB A;  5D6X A;  2CP3 A;  4X34 A;  2XKO C;  2W0Z A;  2OJ2 A;  2A37 A;  2A08 A;  1PHT A;  1YFN A;  3SWN A;  4FW1 A;  2X51 A;  4C5G A;  1EZZ B;  2LCC A;  1GRI A;  4PJM A;  4C8Q F;  5GAN g;  4BDY A;  2FPF A;  3CCM T;  2ZAE A;  4II1 A;  5KYN A;  1B07 A;  4E6R A;  3HFN A;  1BCO A;  4JPB W;  3CCQ T;  2X3X D;  4O5V A;  1SRL A;  4HCB A;  3RR6 A;  4DBF A;  2KT1 A;  2DJZ A;  1VQ8 Q;  2L5Q A;  1UHC A;  3DLL A;  4J9C A;  3VS5 A;  1H92 A;  2RHY A;  2RNA A;  4QQG A;  1N6A A;  3MET A;  3KFV A;  3CXC A;  3UDC A;  1Q81 C;  1VQ5 T;  1Y57 A;  2NLU A;  4X9D A;  1VQK Q;  5CIU A;  2DO3 A;  1JJ2 A;  4XK8 E;  1RAC B;  2HBW A;  2KGT A;  2VC8 A;  2HEQ A;  2DBM A;  2YUP A;  4BD3 A;  1QKW A;  2AZV A;  3OY9 A;  4MDW A;  2D1X A;  3JAM E;  3SWN B;  2GTO A;  4ZGE B;  2C0O A;  5KYX A;  2SRC A;  2KRN A;  3VYG A;  3MHX A;  1WHK A;  5GAN 4;  1ZA1 B;  2SEM A;  3DLM A;  4XQ3 A;  5CKD A;  4N4H A;  4WTO B;  3PNW C;  5LJ5 f;  4AG1 C;  4OML A;  2V1Q A;  2BE9 B;  4CRI A;  3QSU A;  3SD4 A;  3VS6 A;  3CD6 A;  4C92 A;  4Z02 A;  5KYY A;  2DAQ A;  2CT3 A;  1ZUU A;  1PKT A;  2QAZ A;  3X25 B;  2EYX A;  4M75 G;  3RBB B;  3P8H A;  3E9F A;  1YIJ Q;  1NYF A;  2E5Q A;  4KGV B;  1MHN A;  4IUR A;  2KY9 A;  5LJ3 j;  2KNB B;  3JCM g;  3CPF A;  4RTX A;  2RD1 A;  2CS7 A;  2O88 A;  4J9E A;  4B9W A;  1FXX A;  4JS4 A;  2DD4 A;  4PFO A;  3L2U A;  4J8O A;  3ULR B;  1NBE B;  2CUD A;  2BE7 D;  1MV3 A;  3X26 B;  2DKG A;  4PJO A;  3MEV A;  1D1C A;  1YWP A;  1U3O A;  3UF4 A;  5KYX B;  4JS5 A;  1RAD B;  4LN2 A;  7AT1 B;  1ZLM A;  1YJ9 Q;  5GAN j;  3OA6 A;  3CCJ Q;  2FL7 A;  4PLI A;  3CCV A;  1LCK A;  1QP3 A;  3C94 A;  2AKK A;  4KT0 E;  2EYY A;  1WHJ A;  1JU5 C;  2K3B A;  3M54 A;  1Y0M A;  5CKB A;  4C92 B;  1VQ8 A;  2GF7 A;  2VGM A;  5KYY B;  4OB0 B;  1KC8 U;  5GAO m;  4MDX A;  3WVD B;  2NUT A;  3PT9 A;  3GP8 A;  4KGZ B;  1VQK A;  2YLB A;  1WQW A;  2LNV A;  4BAC A;  1M27 C;  1X69 A;  2QQA A;  4QW2 A;  1X2Q A;  1NJI C;  4DOW A;  1W2B S;  2VGN A;  2RM4 A;  5GAO r;  2H3E B;  5FU6 C;  5GAN 3;  2JT4 A;  2GCX A;  2OTL Q;  4FU6 A;  2Y90 A;  4PJO B;  2DVJ A;  1KC8 R;  3HPW A;  4HCZ A;  2QI2 A;  3LWH A;  1VQ7 A;  1QVF S;  4E7I A;  1Y71 A;  4EMK A;  2LQ8 A;  3MKD A;  2HDA A;  1M90 R;  3L2R A;  3CCL A;  2MMP A;  3NTK A;  1BIB A;  3GNG A;  4HCC A;  1WGS A;  3SB2 A;  1KQ2 A;  2JTM A;  2RJF A;  4R0K A;  2JM8 A;  4GBQ A;  1MGQ A;  1K76 A;  1TS9 A;  3UWN A;  3V7R A;  1YIJ A;  4HA8 A;  5FRO A;  2NUZ A;  2NUT B;  5GAN 2;  3QO3 A;  1VQP T;  1W70 A;  4J9D A;  2CZ1 B;  3CPW A;  2CDT A;  5DLO A;  3G6E T;  2HD0 A;  3CCR T;  2P4T A;  4Y28 E;  4M7D D;  5J26 A;  2B8A A;  2XID A;  2DTI A;  1QVG P;  4CC7 A;  4F7U A;  2K5L A;  2PUK B;  3M0R A;  3EH2 A;  3REB B;  4M77 C;  2QXF A;  1YJ9 A;  4M7D F;  2BZ8 A;  4X9C A;  3OW2 A;  3CCJ A;  1WXT A;  2HQX A;  5GAN 8;  2KRS A;  1MMN A;  4EMK B;  2WSF E;  4FCY A;  1M3A A;  4KUD K;  3EG0 A;  4MZP A;  3OS2 A;  2DL7 A;  4OP0 A;  2RQU A;  4XU0 A;  1AZE A;  2BZX A;  3CXC S;  2RJE A;  1AWX A;  2XK0 A;  1YJN T;  2EBP A;  1BCM A;  1GCQ A;  2PQW A;  1N8R U;  2DEU A;  3M59 A;  4M78 G;  5IHK A;  2MWP A;  4C0D C;  2Y4Y A;  1YCY A;  4F7U B;  3LWI A;  2L8D A;  2D0Q B;  3JV3 A;  2QA4 T;  2LJ1 A;  2YRV A;  2VYT A;  3VS7 A;  2XDB A;  2JM9 A;  3FDR A;  3MO8 A;  3CCS T;  5GJW B;  4C92 F;  5KCH A;  4KBM B;  1X43 A;  3M9Q A;  2YUO A;  1GFC A;  4LE9 A;  4LUD A;  4XTU A;  2KVQ G;  3EGX A;  1Y07 A;  3RKX A;  2MYS A;  4IUT A;  3CCE T;  3PMI A;  5GAM j;  1N8R R;  2HBP A;  2XI9 A;  1N9S A;  4ZNX A;  3PMT A;  1VQL T;  1IZ6 A;  4RTY A;  4J9F A;  5GMK h;  1HYO A;  3CBP A;  3L2W A;  1X6O A;  1LPL A;  2BZY A;  2J6K A;  1K0X A;  3OYA A;  1S72 T;  4FL6 A;  3CCU T;  2P0P A;  2M16 A;  2E4H A;  4RG8 A;  2P4R A;  1D0Z A;  3H0I A;  4C92 E;  4OMN A;  1KSW A;  1Q81 U;  1VOM A;  3JCM P;  3EHR A;  3OS1 A;  1KFZ A;  1ZBX A;  1KQS A;  4C0Z A;  3FJ5 A;  4DOV A;  1CSK A;  3PFS A;  4M7A A;  3E2U A;  3E19 A;  2EQJ A;  4BY6 C;  2GTJ A;  3EG3 A;  4LDU A;  1TOV A;  1G83 A;  1QQJ A;  3EGX B;  5EC7 A;  3HHT B;  2ZPF B;  2LC4 A;  1W1F A;  1VQM T;  3E1S A;  4PJO E;  1WJQ A;  1M30 A;  2O01 E;  1ZSZ A;  2QYZ A;  2E5K A;  1G2B A;  1T0H A;  1IRE B;  2RA2 A;  2HSP A;  4J9G A;  1YBY A;  4PJJ A;  2CP2 A;  2OTJ T;  2OAU A;  3OBW A;  4QKU A;  3LLR A;  1SEM A;  3RIR A;  5L8R E;  1UJ0 A;  1Q86 C;  1RAB B;  1OOT A;  1B34 A;  3G7Z A;  3H8Z A;  4LUE A;  5FWB A;  2E64 A;  4L59 A;  1VUB A;  5LJ5 g;  4RTT A;  1RAA B;  1OZ2 A;  5IN1 A;  4ESR A;  4M7A B;  3CBM A;  3L1A A;  4WCI A;  4HT9 A;  2EJG A;  1UG1 A;  4V2S A;  1FX7 A;  2I2L A;  4RTZ A;  1KQ1 A;  3M4G A;  4A63 B;  2O2O A;  1WA7 A;  5AT1 B;  1OPK A;  1ZSZ B;  2ZGW A;  2V1R A;  3KBG A;  1SG5 A;  4C8Q B;  3H0H A;  4QVZ A;  2V8K A;  1RLP C;  3QXE B;  3VS2 A;  2ED1 A;  4HT8 A;  2LDM A;  4F7U F;  2CRE A;  3QG1 A;  1RAF B;  1AT1 B;  5GAM f;  1YHQ T;  4PJL A;  1W4S A;  2QQS A;  3SHW A;  5A2Q E;  3OW2 S;  3H6Z A;  3CME Q;  5C6S A;  1AWW A;  2VB6 A;  2E3I A;  1KD1 U;  2JMA A;  3J80 E;  3LX7 A;  4F7U E;  2MK5 A;  2DYB A;  5HKC A;  1UB4 A;  5FWC A;  4C5I A;  3INZ A;  4KRT A;  3GBQ A;  2XMF A;  2XD0 A;  5KE2 A;  5LJ3 h;  2K79 A;  3L2V A;  2DM1 A;  4JJC A;  3FRN A;  4KUI A;  3OYM A;  3KUF A;  2CYZ B;  1YJW Q;  1YI2 Q;  1Q7Y C;  2QGF B;  2CKK A;  4AT1 B;  5FW9 A;  1Y7X A;  3ZL7 C;  3EG1 A;  3M53 A;  4J7F A;  1KD1 R;  1IXD A;  5GAN h;  4JDS A;  1MND A;  2WSC E;  4Z89 A;  1K9M C;  3CC4 T;  1M1K R;  2GQI A;  3M55 A;  2HL3 A;  3M56 A;  2LJ3 A;  1NG2 A;  2A28 A;  5LJ5 j;  2KMT A;  3P8D A;  3CD6 T;  1NEB A;  4M75 D;  2KQW A;  1PC0 A;  2KT8 A;  2RHI A;  1X01 A;  1TXQ A;  4RG2 A;  1VQO Q;  2FZC B;  4M75 F;  4BI4 A;  5LJ3 d;  4C0G A;  1QVG A;  2DK3 A;  2R5M A;  2LZ6 B;  3V7C A;  3JCM Q;  4OB1 B;  1HXD A;  1PNJ A;  1PWT A;  2CUB A;  2JTF A;  4M7A D;  4RTW A;  5I21 A;  2EFI A;  4QT7 A;  2G3R A;  2O31 A;  2KYB A;  2DIQ A;  3JSC A;  3MEA A;  1K8A C;  2X3W D;  3MPU B;  1H3Z A;  2KAF A;  5GAN d;  4M7A F;  1KQS S;  3A8L B;  3CME A;  2HAX A;  3CCV T;  3CBO A;  3H0F A;  5L23 A;  5HCK A;  1M5Q 1;  4BI3 A;  5M9O A;  3OMG A;  2YSQ A;  2QGG A;  2XG8 D;  1JRI A;  3SEM A;  2EQI A;  2C0I A;  2DZC A;  5CO7 A;  4ZN1 A;  1PRM C;  1VQK T;  3JCM h;  1K73 C;  2VAS A;  2VXF A;  3GF5 A;  4M7A E;  2JZ2 A;  3VRZ A;  2DZ9 A;  5GMK m;  4XU3 A;  1YJW A;  1YI2 A;  4M7D A;  2HQE A;  1UE9 A;  2HCK A;  2D8J A;  1ZX6 A;  1D1A A;  3PTA A;  2AKL A;  4GLM A;  3C95 A;  3QZ5 B;  1BB9 A;  1SHG A;  2HNI A;  2DTO A;  5CCA A;  2EQM A;  3NMZ C;  3O8V A;  2DIL A;  4C8Q E;  2YDL A;  2E10 A;  2RQT A;  1VQ7 T;  2IVW A;  4C92 C;  4LDY A;  1KHI A;  3JCM c;  4FYY B;  3CCL T;  1JO8 A;  3FB9 A;  1VYV A;  4N0A A;  2JNG A;  3G4S T;  1PM3 A;  1G3Y A;  4BB7 A;  4M77 G;  1K1Z A;  5DLQ E;  1VQO A;  1UFF A;  1QCN A;  5CQY A;  2K7A A;  3T9N A;  3TSW A;  1D3B A;  3CCM Q;  4FT2 A;  1YP5 A;  1AWO A;  4AFZ C;  3JCM d;  3CCQ Q;  1UJY A;  4M7D B;  2HMA A;  1VYT A;  2RN8 A;  3JB9 J;  1QWF A;  1I07 A;  3HFO A;  4PJO C;  5GAO n;  2QQB A;  2ZPE B;  3TU4 K;  2XU8 A;  3C12 A;  3JB9 H;  4FM4 B;  2QG9 B;  3A8H B;  1YJ9 T;  1C6V X;  4LDV A;  2VV5 A;  3BE3 A;  3I56 T;  1VQ5 Q;  2LX9 A;  1OU8 A;  1VQ9 T;  2RK2 A;  2V8J A;  4Y92 A;  1IGU A;  1D1B A;  2KYM A;  1WXU A;  2LVM A;  2K57 A;  2FB7 A;  3OS5 A;  1BK2 A;  2RQR A;  3UPU A;  4N4G A;  2CH4 A;  1U5S A;  4PK4 A;  1OEB A;  1SHF A;  2DMO A;  2QDY B;  1D3B B;  4C5H A;  4M78 D;  2LNH B;  4Z8A A;  2K9G A;  1IRX A;  2CSI A;  4RCC A;  3RNJ A;  4A4F A;  4M78 F;  3ASK A;  4F04 B;  2D8H A;  4IUQ A;  2JOY A;  5CKH A;  4EMK C;  1BI2 A;  1R0B G;  5CQX A;  5GMK e;  5IHI A;  2DD5 A;  2RQW A;  2MI6 A;  3HTR A;  2OX7 A;  2BKD N;  3I35 A;  4BE0 A;  1IO6 A;  1TH7 A;  4VUB A;  4BE2 A;  5FRM A;  3BFM A;  1OU9 A;  1LNX A;  2IIM A;  1UEB A;  4E7L A;  1NEG A;  4OMP A;  1B7T A;  1WYX A;  1XQH A;  2EQU A;  3CCQ A;  1PCX A;  4PFZ A;  2L3S A;  2QQ9 A;  1U1S A;  4BUG A;  2XHC A;  3EFR A;  5GAM g;  3L42 A;  1WHG A;  4OGE A;  1BU1 A;  4E7H A;  1I8F A;  3OQ5 A;  1R77 A;  2FRY A;  4XTV A;  3THK A;  1B3Q A;  1NPR A;  2A3L A;  2FZG B;  4J7I A;  3A8M B;  4EMH A;  4EMG A;  4B6M A;  2DL5 A;  1ZA2 B;  2X4Y A;  4C0F A;  2HKQ B;  2PVG B;  4XU2 A;  2J06 A;  1Q82 C;  2CP6 A;  1AOJ A;  2D6F A;  1OV3 A;  2FPD A;  4L5G A;  1ABQ A;  1W2B P;  2F2W A;  3QDF A;  1GCQ C;  2CZ6 B;  2YRC A;  3QUI A;  1MNE A;  4DBR A;  2EIF A;  3FIF A;  2E6Z A;  2RPN A;  1T0J A;  1E7O A;  2CGH A;  4HKE A;  1QVF P;  2CSQ A;  1I5L A;  2F2V A;  4MZM A;  5KYW A;  2E1H A;  1F1B B;  2OI3 A;  2DER A;  4AMC A;  1YIT T;  1QLY A;  3LGL A;  1IGQ A;  3J81 E;  1TSF A;  1VQP Q;  1UGS B;  4M7D E;  2DF6 A;  2PZ1 A;  1K8A U;  2RH2 A;  1JJ2 S;  1VQ6 T;  2GFU A;  3G6E Q;  1M8M A;  1QCO A;  1I5O B;  2KEA A;  4FYV B;  3S3N A;  4DBH A;  3CQT A;  2OTL A;  4OGC A;  3CC2 Q;  2W10 A;  3BY7 A;  4N4I A;  5GAN 5;  1H8K A;  2R5A A;  4RCB A;  2F5T X;  4MZT A;  2DEQ A;  3LH5 A;  5D7U A;  2K2M A;  2ECZ A;  3EAE A;  4ATO A;  2R58 A;  2ZZD A;  3AHU A;  3OBY A;  3M57 A;  2LRQ A;  1M2O A;  5IT9 E;  3WXM B;  2K2V A;  1QCF A;  5KYW B;  3JCM W;  1PRL C;  1WLP B;  3TVT A;  5LJ5 h;  4M7A C;  4JZ3 A;  5LJ3 e;  1Z9Z A;  3WVE B;  5GAO p;  1HJD A;  3GLX A;  5GMK l;  1RAE B;  1QWE A;  4M75 A;  4C5E A;  3V8K A;  1M1G A;  1GCP A;  1ZSZ C;  2MPX C;  4XAX B;  2A36 A;  2YWW A;  4C8Q C;  2FZK B;  5GAN e;  2QA4 Q;  4FIB A;  1WXB A;  3S6W A;  1KG1 A;  1H64 1;  2FRW A;  2EGA A;  2M02 A;  1MV0 B;  3RKW A;  2JS2 A;  3QZ9 B;  4QQD A;  3CCS Q;  4JUV A;  5J3B A;  2GBQ A;  2LQW A;  2PUO B;  4JRI A;  4HXJ A;  2F1L A;  1VIF A;  2BTT A;  1C1A A;  3OYN A;  2LQN A;  3CCE Q;  1T3L A;  1Q81 R;  1MMG A;  4OMQ A;  3S3O A;  1TUC A;  2K6D A;  4JLI A;  1VYU A;  1IHV A;  3FJP A;  2QEX Q;  1VQL Q;  1VQN T;  1WJR A;  3F70 A;  5CVI A;  3LYI A;  4E7S A;  1VQP A;  2C0T A;  5IAY A;  1G3W A;  1M3C A;  5I2S A;  4PFP A;  3EG2 A;  3OYE A;  1S72 Q;  4ZTJ A;  2RQV A;  4M75 B;  1UGR B;  3G6E A;  3JRZ A;  3TQ7 P;  2FG0 A;  1ZUY A;  3M0S A;  3V7S A;  5FLX E;  1CKA A;  1G3S A;  3CC2 A;  1G3T A;  1RI9 A;  3JB9 G;  9ATC B;  6AT1 B;  3EH1 A;  4MML A;  4X1V A;  4DA4 A;  3RMQ A;  5D6W A;  2HZY A;  1FMW A;  2EKH A;  3DB3 A;  1UGV A;  3I55 T;  1TUD A;  3QWY A;  4IUP A;  4PJN A;  3REA B;  2RHX A;  3SFM A;  3URG A;  3L2Z A;  4TVR A;  2EYZ A;  2WAC A;  2LCL A;  2PVO B;  4ZTF A;  2VXE A;  1PD1 A;  2J7I A;  2K3Y A;  3G71 Q;  3GOX A;  3EHQ A;  3CC7 T;  3JCM e;  1AD5 A;  2IG0 A;  3PGG A;  2DXU A;  5EG2 A;  3A98 A;  4E2F B;  1JQQ A;  2OTJ Q;  3CPW S;  2QDL A;  2H8H A;  4QVD A;  2QAS A;  5GAO l;  3TSZ A;  2K3X A;  4ELZ C;  2QA4 A;  1NJI U;  1ZUK A;  1B34 B;  3EG9 A;  4C92 G;  4LD6 A;  2PU9 B;  2ABL A;  2KXC A;  3NGP A;  3MP1 A;  3CCS A;  1N27 A;  1KC8 C;  5A0L A;  2E6N A;  3QYH B;  1V29 B;  3TEE A;  3CCE A;  3MP8 A;  3QJ6 A;  2DFU A;  1M1F A;  1M90 C;  3CMA Q;  2RO0 A;  4JRQ A;  2LJ0 A;  3M58 A;  2QEX A;  4E47 A;  2EGC A;  1WNL A;  1M9S A;  2A7Y A;  1QKX A;  2HSE B;  2VVK A;  3MCA B;  1PG5 B;  1NJI R;  5A0G A;  4UC4 A;  4NL2 A;  4XTY A;  1QW1 A;  2RJD A;  1DJ7 B;  3OYD A;  4PJO G;  2EYW A;  2ZPH B;  4M77 D;  1S1N A;  4HCK A;  2DRM A;  1YCS B;  4KH1 B;  4LXC A;  2RI3 A;  2EW3 A;  1YHQ Q;  1SSF A;  3BDU A;  1R8O B;  4M77 F;  3RKY A;  4M78 A;  1Q82 U;  3LGF A;  4A4K A;  3EG9 B;  1E6G A;  2DXT A;  3OYG A;  2FPE A;  2LQK A;  4FYX B;  1VQ4 Q;  1XNI A;  2AIR B;  2YUN A;  3LH0 A;  4J9B A;  3HL8 A;  1WDX A;  2EQK A; 
#chains in the Genus database with same CATH homology
 2AK5 A;  1TG0 A;  4CC7 A;  4RUG A;  5ECA A;  4AFU C;  1MUZ A;  5IXB A;  3M0R A;  2DL8 A;  4F14 A;  3REB B;  1UTI A;  2O9V A;  2RMO A;  2BZ8 A;  3M0P A;  4JZ4 A;  2DA9 A;  1WXT A;  2B86 A;  1ABO A;  2ROL A;  2KRS A;  3I5R A;  1GBQ A;  4Y92 A;  3PVQ A;  2J6O A;  1WFW A;  4RTU A;  1AEY A;  1WI7 A;  2NWM A;  1X6B A;  1M3A A;  4F17 A;  2KYM A;  1WXU A;  2LP5 A;  1RUW A;  3EG0 A;  3NHN A;  1BK2 A;  4OMO A;  1AWJ A;  2RQR A;  3M0Q A;  2FO0 A;  3C0C A;  2MIO A;  2DL7 A;  2RQU A;  2CH4 A;  1GBR A;  1U5S A;  1AZE A;  1A0N B;  2BZX A;  2ROT A;  3QWX X;  1OEB A;  1SHF A;  2DMO A;  1AWX A;  2LNH B;  4Z8A A;  2EBP A;  1GCQ A;  1NM7 A;  2J6F A;  2K9G A;  2CSI A;  3RNJ A;  2MCN A;  5IHK A;  4IIO A;  1PKS A;  1VA7 A;  2O9S A;  3EGU A;  2DLP A;  3VS1 A;  1ZSG A;  3VS4 A;  1X6G A;  2D8H A;  3PE0 A;  2LMJ A;  3JV3 A;  3M0U A;  3UA7 A;  2LJ1 A;  1XOV A;  1GL5 A;  3H41 A;  3VS7 A;  1JXO A;  5IHI A;  2JM9 A;  5GJW B;  1X43 A;  2RQW A;  2YUO A;  1GFC A;  4LE9 A;  4LUD A;  3IQL A;  2M0Y A;  2LX7 A;  4IIM A;  1Z9Q A;  3I35 A;  4DEX A;  1IO6 A;  5IH2 A;  4ZNX A;  1EFN A;  4JJB A;  4FSS A;  4RTY A;  2PNI A;  3PVL A;  4J9F A;  2IIM A;  2M51 A;  1WIE A;  2JW4 A;  2BZY A;  2J6K A;  1K0X A;  1BBZ A;  4AFQ C;  1NEG A;  4OMP A;  1WYX A;  1H3H A;  3I5S A;  1UDL A;  1NYG A;  1SSH A;  1X2K A;  2L3S A;  2LCS A;  1K4U S;  2P4R A;  3H0I A;  4OMN A;  1KSW A;  4D8D A;  1JXM A;  2L0A A;  1FYN A;  1BU1 A;  3EHR A;  1KFZ A;  2DBK A;  2FRY A;  3THK A;  1U06 A;  3FJ5 A;  2MOX A;  4RTV A;  1B3Q A;  1SRM A;  1N5Z A;  1CSK A;  1I0C A;  2DL5 A;  3I9Q A;  2DRK A;  5GJV B;  2YT6 A;  4D8K A;  4M4Z A;  2JS0 A;  2GTJ A;  2J06 A;  3EG3 A;  1G83 A;  1AOJ A;  5EC7 A;  2PTK A;  1OV3 A;  2FPD A;  1W1F A;  1ABQ A;  1M30 A;  1SPK A;  2AZS A;  2F2W A;  2FEI A;  2E5K A;  4DEY A;  1GCQ C;  2YUQ A;  3O5Z A;  1G2B A;  1T0H A;  4HVU A;  2HSP A;  4J9G A;  2RPN A;  1M3B A;  1ARK A;  1T0J A;  2EVR A;  2DE0 X;  1E7O A;  2EPD A;  4AFS C;  2CSQ A;  4Z88 A;  2F2V A;  1SEM A;  2KRO A;  2OI3 A;  2OAW A;  1QLY A;  1UJ0 A;  1OOT A;  4LUE A;  5FWB A;  5I22 A;  3M0T A;  4LNP A;  4RTT A;  5IHN A;  2DF6 A;  1AVZ C;  2PZ1 A;  4ESR A;  2J05 A;  4WCI A;  4OMM A;  1UG1 A;  4F16 A;  1M8M A;  2KEA A;  4RTZ A;  1OPL A;  4A63 B;  2VWF A;  1E6H A;  1KJW A;  2O2O A;  3CQT A;  1WA7 A;  1OPK A;  2W10 A;  1W6X A;  2V1R A;  1H8K A;  2L3Q A;  2KR3 A;  2KRM A;  3LH5 A;  3H0H A;  2K2M A;  2ECZ A;  2DNU A;  4J9I A;  1RLP C;  1UHF A;  2G6F X;  2JXB A;  2JMC A;  3VS2 A;  2ED1 A;  1GFD A;  2CRE A;  2W0Z A;  2OJ2 A;  2A37 A;  2A08 A;  1PHT A;  4HVV A;  1QCF A;  1GRI A;  1PRL C;  1WLP B;  3TVT A;  4ORZ A;  4JZ3 A;  3SHW A;  2ED0 A;  2FPF A;  1Z9Z A;  2GGR A;  1B07 A;  4E6R A;  1HJD A;  1QWE A;  4JPB W;  1AWW A;  2X3X D;  1SRL A;  2JMA A;  2F2X A;  1GCP A;  2KT1 A;  2A36 A;  2DYB A;  1HD3 A;  5FWC A;  4KRT A;  1UHC A;  3GBQ A;  4J9C A;  2XMF A;  3VS5 A;  2D0N A;  1H92 A;  2RNA A;  2DL4 A;  2K79 A;  3KFV A;  2DM1 A;  1WXB A;  1Y57 A;  4JJC A;  2ENM A;  2FRW A;  2EGA A;  1MV0 B;  4CC4 B;  2JS2 A;  4EIK A;  2HBW A;  2KGT A;  2GBQ A;  2LQW A;  1YNZ A;  4HXJ A;  2KXD A;  2DL3 A;  2HEQ A;  5FW9 A;  2BTT A;  2DBM A;  2YUP A;  1QKW A;  3ZL7 C;  2LQN A;  1X27 A;  3EG1 A;  2AZV A;  1T3L A;  2D1X A;  4K11 A;  2GTO A;  4OMQ A;  3R6N A;  1TUC A;  2C0O A;  2K6D A;  1VYU A;  2SRC A;  2KRN A;  4Z89 A;  2SEM A;  2GQI A;  2KBT A;  2LJ3 A;  1NG2 A;  2A28 A;  2C0T A;  1M3C A;  4AG1 C;  3EG2 A;  4OML A;  2V1Q A;  2RQV A;  3VS6 A;  3UAT A;  1NEB A;  2FG0 A;  1ZUY A;  2CT3 A;  3M0S A;  1ZUU A;  2KT8 A;  1PKT A;  1CKA A;  2EYX A;  1RI9 A;  2DX1 A;  3RBB B;  5I11 A;  1NYF A;  4X1V A;  3U23 A;  1K0S A;  2EKH A;  1UGV A;  2KNB B;  1TUD A;  1YN8 A;  2LZ6 B;  4J9B A;  3QWY A;  3REA B;  4RTX A;  2O88 A;  1PNJ A;  1PWT A;  4J9E A;  2CUB A;  3ULR B;  1I1J A;  4RTW A;  2EYZ A;  2CUD A;  4QT7 A;  2I0N A;  2O31 A;  2KYB A;  1MV3 A;  2J7I A;  2X3W D;  2KE9 A;  4CC3 A;  1YWP A;  1U3O A;  3UF4 A;  4LN2 A;  1ZLM A;  3EHQ A;  1AD5 A;  3VS3 A;  1NLP C;  1LCK A;  3H0F A;  3A98 A;  3VRY A;  1JEG A;  2AKK A;  5L23 A;  1JQQ A;  5HCK A;  2L3P A;  4HVW A;  1NLO C;  2EYY A;  1JU5 C;  2DJQ A;  2QDL A;  2K3B A;  1Y0M A;  2H8H A;  2YSQ A;  1UUE A;  2VKN A;  3SEM A;  4JJD A;  2EQI A;  3TSZ A;  1UEC A;  2C0I A;  3VS0 A;  1ZUK A;  1T3S A;  1YWO A;  1CKB A;  1PRM C;  2ABL A;  2KXC A;  3NGP A;  3VRZ A;  1M27 C;  1X69 A;  2L2P A;  1K9A A;  1UE9 A;  2HCK A;  1X2Q A;  2RF0 A;  2D8J A;  1ZX6 A;  2AKL A;  4GLM A;  1FMK A;  2JT4 A;  1WX6 A;  1BB9 A;  1SHG A;  3NPF A;  4CC2 A;  2LJ0 A;  1V1C A;  4J9H A;  2EGC A;  4AG2 C;  2ESW A;  2JTE A;  3NMZ C;  2DIL A;  1QKX A;  2DVJ A;  2YDL A;  2RQT A;  2VVK A;  2HDA A;  2GNC A;  1JO8 A;  1KIK A;  1VYV A;  2EYW A;  1S1N A;  1AZG B;  4HCK A;  2DRM A;  1YCS B;  2CH4 W;  2CT4 A;  4R0K A;  2JM8 A;  4GBQ A;  5IXF A;  2EW3 A;  1K76 A;  1K1Z A;  1HSQ A;  1RLQ C;  1UFF A;  1J3T A;  2NUZ A;  2K7A A;  3TSW A;  1YP5 A;  1W70 A;  1AWO A;  1E6G A;  2FPE A;  3UA6 A;  1ZBJ A;  4J9D A;  4AFZ C;  2CDT A;  2YUN A;  1UJY A;  1VYT A;  2RN8 A;  1QWF A;  1I07 A;  2EGE A;  1WDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...