4E6RA

Crystal structure of a cytoplasmic protein nck2 (nck2) from homo sapiens at 2.20 a resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
54
Chain Sequence
IPAFVFAYVAEREDELSLVGSRVTVMECSDGWWRGSYNGQIGWFPSNYVLEEVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A resolution
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Cytoplasmic protein NCK2
total genus 9
structure length 54
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4e6rA00
3QWYA 1SRMA 1X6GA 4CC3A 2D8HA 1N5ZA 2DRKA 2ROTA 1SSHA 1WXUA 1AWJA 1QWEA 2RQWA 4D8KA 2YUOA 5IHKA 1AWWA 2DM1A 1V1CA 1I0CA 5IXBA 4HVWA 2DL7A 2KRSA 1VA7A 3UATA 2DLPA 1TUCA 1WXTA 3H0HA 2FG0A 2LNHB 1KSWA 3M0SA 4F16A 3SHWA 1JU5C 1LCKA 3NGPA 3CQTA 3VS1A 1B07A 2EYXA 2EW3A 2J05A 1BK2A 1WFWA 2RQVA 2PNIA 2FEIA 2CT3A 2KBTA 3I35A 2GTOA 1A0NB 1ZUUA 2DYBA 1NG2A 1E7OA 1KJWA 2JW4A 1SRLA 1UECA 2LJ1A 4AFSC 3VS0A 2O9SA 1YWOA 2MOXA 1G2BA 1QKWA 2KRMA 1WLPB 2K6DA 2W0ZA 2L3SA 2GQIA 2IIMA 1ZLMA 4HXJA 3JV3A 2FO0A 4OMPA 2NUZA 1K0XA 1X2KA 1UJ0A 4Z8AA 2RN8A 2LQWA 2C0OA 2HDAA 2HBWA 4J9DA 1ABQA 1CKBA 3EG0A 4RTYA 2O31A 4HCKA 4J9BA 4DEXA 1HSQA 3VS2A 2J06A 2DL3A 2RPNA 1T3SA 2CSQA 4J9HA 1GBRA 1KFZA 1T3LA 3RNJA 1B3QA 4J9IA 3UA6A 3VS4A 1M3CA 4R0KA 3VRYA 1G83A 2MCNA 2CT4A 1HD3A 1AZGB 2CUBA 3REBB 3TSWA 1E6GA 5IXFA 1YNZA 4AFQC 2GNCA 2DJQA 1GCQC 2P4RA 2LP5A 3ULRB 1WXBA 3VS5A 2FRYA 4QT7A 2EVRA 1OEBA 4WCIA 3LH5A 2K9GA 5IH2A 2KYBA 4RTXA 3UA7A 1QKXA 2CSIA 1H8KA 2GGRA 4F17A 1AOJA 1UHCA 1AWOA 4IIOA 3SEMA 1S1NA 1H3HA 1M3BA 2KYMA 1OOTA 2B86A 2J6KA 2JMAA 2M51A 1UUEA 2A36A 1PNJA 2EGAA 1AVZC 1K1ZA 3EG2A 3H0FA 3QWXX 2DA9A 2O2OA 2EYZA 1AD5A 4D8DA 1WI7A 1U3OA 1GRIA 4RTWA 4JZ4A 2F2VA 3M0QA 4RTTA 3FJ5A 2EGCA 4CC4B 2AZVA 4LE9A 1PKSA 4J9GA 4AG1C 2BZYA 1PKTA 1T0JA 2D8JA 1NM7A 2CH4W 2O9VA 3M0RA 1BB9A 2CDTA 1U5SA 1SHGA 2AKKA 2FPFA 1ARKA 2DNUA 3UF4A 2X3WD 2XMFA 3NHNA 2JS2A 2JM8A 1W70A 2LQNA 1X2QA 2X3XD 5GJVB 5IHIA 2ENMA 1X27A 1MV0B 4K11A 1K4US 3IQLA 2PTKA 2G6FX 2YSQA 1WIEA 1SPKA 1IO6A 3THKA 4AFZC 2DRMA 3C0CA 2K3BA 4LUEA 1Y0MA 2RQRA 4Z88A 4J9CA 4GBQA 3H41A 1H92A 2K79A 4JJCA 1NEGA 2SRCA 1YWPA 2EYYA 5ECAA 1QWFA 2LJ0A 2YT6A 2KROA 2KT8A 3R6NA 4JPBW 4JJDA 3I9QA 2CREA 1K0SA 1WA7A 4HVUA 2LCSA 3EGUA 1OV3A 4IIMA 2EKHA 2KXDA 3PVLA 2OJ2A 1YCSB 1X69A 1E6HA 1NLPC 2ESWA 4A63B 1GCPA 1TUDA 3M0TA 3ZL7C 4J9FA 1RLPC 1OPLA 1PRLC 4AG2C 4RTZA 1M8MA 1UJYA 2L3PA 1X43A 2F2XA 2DF6A 1BU1A 4HVVA 3TSZA 4JJBA 2EPDA 2DMOA 2HCKA 2VWFA 1J3TA 4ZNXA 2FRWA 1AEYA 1YP5A 2HSPA 1M30A 1FYNA 1VYTA 2J6FA 1EFNA 4CC2A 2D1XA 4OMQA 1UTIA 5FWCA 2KT1A 4CC7A 1WDXA 2A37A 3U23A 1UHFA 3EHRA 2KEAA 5IHNA 1UGVA 2F2WA 1GFCA 1ABOA 2H8HA 1JEGA 1ZBJA 5FWBA 2EYWA 1U06A 1GBQA 1JXOA 1GCQA 4OMNA 2KNBB 4OMLA 1ZUKA 5HCKA 2FPDA 1SHFA 1T0HA 1UDLA 2DL4A 3REAB 3NMZC 4LUDA 4LN2A 3NPFA 1PHTA 1JQQA 1RLQC 2YUQA 1ZSGA 2V1RA 1TG0A 2OI3A 2VKNA 2RNAA 3O5ZA 2PZ1A 2BZ8A 1FMKA 1UG1A 2RF0A 1NLOC 3I5SA 2YDLA 2DE0X 3M0PA 2OAWA 3A98A 4GLMA 2JTEA 2J7IA 2MIOA 1WYXA 1I1JA 5I11A 2LMJA 1MUZA 1NYGA 1ZUYA 4E6RA 2GBQA 1K9AA 3H0IA 3KFVA 2JMCA 2FPEA 1XOVA 2J6OA 2C0IA 2NWMA 1K76A 2K7AA 5L23A 1NEBA 2JXBA 2CUDA 2D0NA 5I22A 1VYUA 2ROLA 2I0NA 2A28A 2W10A 3I5RA 2M0YA 2LZ6B 3RBBB 2L0AA 1UE9A 2YUNA 4M4ZA 1VYVA 1W1FA 2DX1A 2RMOA 1I07A 4OMMA 4Z89A 2DVJA 1Y57A 3PVQA 1GFDA 2KE9A 1M3AA 2DL8A 2ED1A 4ESRA 3PE0A 3M0UA 3VS7A 1JXMA 1HJDA 3VS6A 4FSSA 1RI9A 5FW9A 1M27C 1BBZA 1MV3A 2ECZA 2EBPA 2YUPA 2O88A 2A08A 2L3QA 1AWXA 2ABLA 2JT4A 2V1QA 4RUGA 2EGEA 4LNPA 2EQIA 1WX6A 1NYFA 4Y92A 1AZEA 2KGTA 1QCFA 4AFUC 1CSKA 2DBKA 1X6BA 3EG1A 4DEYA 3TVTA 4J9EA 1GL5A 1ZX6A 2VVKA 1Z9ZA 2SEMA 2KR3A 4KRTA 1PWTA 4RTVA 3VS3A 4X1VA 2DL5A 2KXCA 2BTTA 2LJ3A 4OMOA 2KRNA 3EG3A 3VRZA 1RUWA 4JZ3A 4EIKA 2AK5A 2JS0A 1YN8A 2K2MA 2GTJA 1CKAA 2L2PA 2DBMA 2HEQA 1UFFA 2BZXA 4F14A 4RTUA 2JM9A 3GBQA 5GJWB 2CH4A 2C0TA 1QLYA 5EC7A 3EHQA 2E5KA 1PRMC 1KIKA 1Z9QA 2ED0A 2DILA 2AKLA 1SEMA 1W6XA 4ORZA 2LX7A 2RQTA 2QDLA 2RQUA 1OPKA 2AZSA 1JO8A
chains in the Genus database with same CATH superfamily
3QWYA 1X6GA 2ROTA 5FU7C 1SSHA 2MMPA 4XTYA 5CKDA 1VQKQ 2RQWA 2E6ZA 2VC8A 1TUCA 4J5YA 3OSSC 1VQ5Q 2DPPB 2LNHB 4C0FA 2HAXA 3SHWA 4FW2A 2VXEA 2EW3A 2J05A 1YJWQ 1WFWA 3OBWA 5A0DA 2X4WA 3P8HA 2CT3A 3GF5A 2VGMA 5FU7B 2DYBA 4XU3A 2KK4A 1SRLA 1UECA 4AFSC 3VS0A 2O9SA 1YJWA 2KRMA 1U8RA 3JRZA 3ME9A 1WLPB 2K6DA 1XJWB 1ACMB 4R55A 2DKGA 1F1BB 5C0MA 2IIMA 4C0DB 3OYLA 3M56A 1ZLMA 3OYGA 1WHJA 4RCBA 1K73R 4M77A 1QCOA 2NUZA 2DEUA 1X2KA 3JCMJ 2HBWA 3PMIA 4J9DA 3KUFA 4J6YA 1SKUB 5GAOr 3OYAA 1S72T 1HSQA 5CIUA 4PL6A 1BI3A 2J06A 4FM4B 4C8QD 5I21A 3OYHA 1YJ9A 1GBRA 3EFOB 3OB9A 3L2QA 3VRYA 3BDUA 1IHVA 4IUVA 1HD3A 2E3HA 1AZGB 3G71A 3TSWA 1QP3A 3EG9A 4FW1A 4M77E 5IXFA 2HL5C 2GNCA 1M1KR 2DJQA 2FB7A 2P4RA 4V2SA 3MJXA 5J3BA 3HP9A 2O01E 3CPFA 4KULA 5LJ3f 1Y07A 2FRYA 4EMGA 4M7DD 2EYQA 2YRDA 3GOXA 3LH5A 1WZOA 2KYBA 1YI2Q 3CEYA 3UA7A 1H8KA 2LQ8A 2DEQA 2ATCB 2K3XA 4F17A 4ME7A 1AOJA 1UHCA 7AT1B 1VQ9T 1S72A 1S1NA 2YLCA 1VQOA 1H3HA 1KK7A 3L1AA 4M77C 4JS4A 2DZCA 1UUEA 2A36A 4MMKA 4E7KA 4IUPA 1K1ZA 3H0FA 4LD6A 3VJPA 2JOYA 2K5LA 2Y90A 2M16A 3G71T 3JCMX 2CZ0B 3FJ5A 2GCXA 2AZVA 3L2RA 4ZGEB 1P92A 1TWBA 2BZYA 2ZPGB 5KYUB 4M78E 1T0JA 2KVQG 3M0RA 1BB9A 2CDTA 1SHGA 3NHNA 1R0BG 1VQ4A 3QO3A 3OS0A 2LQNA 1X2QA 5GJVB 3JCMe 3PGGA 2QEXQ 2QG9B 3QG1A 2HD0A 2OTJQ 3QYGB 2PTKA 1YHQT 3V7CA 3GPLA 1WHGA 3OBYA 4LUEA 2RQRA 4C5HA 5DLQE 1X01A 3CCVT 3INZA 1H92A 4EMHA 1WJQA 1BKBA 2SRCA 1JJ2S 2EYYA 1I5OB 1QWFA 2YT6A 2PUKB 5KE3A 3CMEQ 4X34A 1MGQA 1WA7A 4DBRA 1NPRA 1Q81R 2COWA 3EGUA 4PJOC 2DXCA 2EKHA 3FLGA 1D1BA 5GAMj 3CMAT 3OS5A 4OB0B 2HNIA 2ESWA 3G4SQ 1QP2A 3V8LA 5IN1A 3ZL7C 4M7AE 4A4KA 4KH0B 1PRLC 5CAIA 4ZN1A 3FEOA 1X43A 2DF6A 3EGDA 3CD6T 5DY9A 1K9MR 4KUDK 1FX7A 3L2UA 4M78C 4M75D 1U1TA 5LJ3g 2FRWA 4FYYB 1AEYA 1YP5A 3EGDB 4TVRA 3OQ5A 2K2VA 2JTMA 1B34A 3L2VA 2D1XA 4OMQA 1VQ8Q 1UTIA 2K4YA 5KYUA 2LT1A 5FROA 4OP0A 4MMLA 3RR6A 1Q7YR 1KC8C 3U23A 1G3TA 5IHNA 2O4XB 4IUTA 2H8HA 5FWBA 2EYWA 1U06A 1VQLQ 3CCMA 2CZ6B 3OYKA 5HCKA 1VQPA 2DL4A 3REAB 1W2BP 1C6VX 4LN2A 1PHTA 4GY5A 4N4IA 3CD6A 2YUQA 5KYXB 4P5NA 2RK2A 5CKFA 3A8MB 2BZ8A 1WHHA 3FB9A 2DE0X 2GFUA 2OAWA 4C8QE 4GLMA 5GAMd 2FZCB 1YJ9Q 1WYXA 2BKDN 2AHJB 5I11A 2XDBA 3CCUQ 2NUPB 2X4YA 2GBQA 1WPYA 3KFVA 1YITA 2FPEA 1XOVA 2J6OA 2C0IA 3E1SA 4IUUA 4M7DA 2P4TA 2K7AA 5L23A 2PUOB 2EAYA 1VQLA 3OMCA 2D0NA 3OMGA 4OMFB 2ROLA 3OW2A 5GAMe 2A28A 2W10A 3I5RA 2M0YA 1D0XA 4M4ZA 4AMCA 4HCBA 1M1KU 1W1FA 3X26B 2DX1A 2RMOA 3OA6A 3N5BB 3DKMA 3RKWA 4C8QA 4Z89A 8ATCB 1IXDA 1Y57A 4A4EA 3MEAA 2ED1A 2DL8A 4M7AA 1YHQQ 3VS7A 2HKQB 1HJDA 5FW9A 3G6ET 1M27C 3QDRB 1G3WA 5CR2A 4PJNA 3CCVQ 2OTLA 1YCYA 1OYXA 2L3QA 1AWXA 2ABLA 4M75F 4II1A 3OYDA 1WX6A 5FRNA 4Y92A 1WNLA 3A8OB 1CSKA 4XU2A 1D0ZA 5GAOp 3EG1A 2BUDA 1GL5A 2VVKA 3CXCP 4BI8B 3UPUA 3CCET 2KXCA 1LNXA 2RD1A 4OMOA 4JZ3A 3CMEA 2OAUA 4LDVA 4MDXA 3OYEA 1QVPA 4N0AA 2XU8A 2LT4A 4ZGJB 2DBMA 3JB9H 4M7DB 4F14A 4RTUA 4Y28E 4EDUA 5IT9E 3GBQA 3UT1A 1EIFA 2CH4A 5EC7A 1QLYA 1NE8A 1PRMC 4BDZA 2CP7A 4Y91A 2DILA 1W6XA 4ORZA 1BIBA 3JCMg 2MF2A 5GANf 1OPKA 4XTUA 1C1AA 4JLIA 5FU6B 1KD1R 2DRKA 5CVIA 1NZ9A 3JCMV 1WXUA 2DXUA 1NJIR 5IXBA 1IRXA 2RI2A 3MEVA 1BYMA 2DLPA 1LJOA 3R6OA 5L8RE 4PJOE 3CCLQ 5LJ5g 3PIOA 2FG0A 1KSWA 3M0SA 1JU5C 2ZCFB 1VQ9Q 4PJLA 1B07A 1BK2A 2BIVA 2PNIA 3J80E 2FEIA 1X6OA 2KBTA 3I35A 4Z02A 2GTOA 1A0NB 1ZUUA 1NG2A 4E7JA 4XU1A 3HRUA 4PFZA 1YFNA 1YWOA 3MP8A 2MOXA 4PLLA 2LC4A 1W2BA 1OX8A 4M75E 2CP3A 2AT1B 4EMKA 4F7UG 2ZPHB 4MZTA 1ZSZC 3PIPA 2CP2A 1RAHB 3JV3A 2NLUA 4OB2B 1G3SA 2F1LA 4OMPA 4JRPA 5GANh 2K5IA 3KBGA 2P0KA 1UJ0A 1WHLA 2LQWA 3ZBDA 2V26A 1XTDA 2JZ2A 1TS9A 1R8OB 1TTHB 2PQWA 4J9BA 4DEXA 3SD4A 1UB4A 4M77G 3VS2A 2DO3A 3RDVA 3S3NA 2DL3A 2RPNA 1EX4A 4J9HA 1M1KC 2MK5A 3ZEHA 1T3LA 1K9MC 4J9IA 4PK4A 3UA6A 3VS4A 3CCUA 3HSBA 4XTXA 1G83A 2QA4T 4JDSA 3MP1A 2CUBA 3S3MA 3REBB 1BI0A 1NJIC 2COYA 2FVUA 3FC3A 2DK3A 2KY9A 1YNZA 4PJOF 4F7UF 1GCQC 2R5MA 1Y71A 4DBFA 3OYCA 3ULRB 1HK9A 2HBPA 2HQHA 2IVWA 3VS5A 2EVRA 3TEEA 4WCIA 3LWIA 4F7UE 5GAN5 5IH2A 3I55Q 4O6JA 1QKXA 1PG5B 4OGCA 2GGRA 1BCMA 1OZ2A 4KUIA 2HZYA 1M3BA 3EGXB 2KYMA 1BCOA 2KI7A 1RAEB 1YHQA 2M51A 4C92C 1PNJA 2P84A 2WSCE 1O9SA 1AVZC 1YIJQ 2DA9A 2O2OA 3CCVA 2OTLQ 3EAEA 2XI9A 1AD5A 4KT0E 4RG2A 2YRVA 5HKCA 1WI7A 1U3OA 4FU6A 4M7AF 2F2VA 3M0QA 4RTTA 3AHUA 1PKSA 4C92F 5GAN7 4AG1C 4FYXB 1LPLA 2DTOA 1MNDA 2Z0WA 2FPFA 4M7AG 3NTHA 2DNUA 3UF4A 1MNEA 1FMWA 1MMAA 1W70A 1VQ8A 1WJRA 3M54A 2X3XD 3SWNA 4DQ2A 2ENMA 2RJFA 3QUIA 1RABB 2LRQA 5LJ3j 3QHSA 2D9TA 2R57A 2G6FX 4B6MA 3GP8A 1N9SA 3H8ZA 1OULA 1SPKA 3WXMB 1IO6A 4PKCC 5D6WA 2K3BA 4HKEA 1N8RU 2R5AA 3PMTA 4GBQA 2LTOA 2K79A 2YXYA 1NBEB 3BE3A 1NEGA 4BD3A 1OX9A 2VASA 5ECAA 4KGXB 3QDFA 2LJ0A 2ZPFB 4JS5A 3O8VA 3HL8A 1UEBA 4JJDA 3I9QA 4XTZA 4HVUA 4A4HA 4IIMA 2OJ2A 4AT1B 3RKYA 1X69A 4E7IA 1E6HA 1M2VA 2QYZA 3CCMT 3GNGA 3M5AA 1M2OA 2X51A 4C8QG 1VQPT 4J9FA 1RLPC 4M7AD 1Q86C 4M7DC 4C5GA 1M8MA 1UJYA 2L3PA 4A53A 1OI1A 2P0PA 2V8JA 4M78F 3QKJA 4JJBA 1N27A 2EPDA 1J3TA 1MMDA 1VYTA 2PU9B 2QGFB 3RIRA 1MMGA 4CC2A 4PFPA 5KYNA 1VQ5A 1RI0A 2L3RA 2KT1A 2JVVA 2XDDA 1WDXA 3MEUA 5LJ5h 2ZPBB 4M7AB 1YITQ 1PM3A 3CPWA 1UGVA 4OVAA 4E7ZA 3A1PA 1QVGS 1GFCA 3CMAA 1ABOA 1JEGA 2F5TX 1GBQA 4QQ6A 4QVCA 3I55A 1GCQA 5GMKm 2KNBB 4RCCA 1UDLA 5CKBA 2GFAA 4C5EA 5GAMf 3OYJA 1TXQA 3NPFA 2CP5A 9ATCB 1JQQA 1TUGB 3VYGA 1W2BS 4GLKA 2V1RA 4BDYA 3S3OA 3BDLA 2RH2A 3VKIA 2RNAA 5D6YA 3CCEQ 3O5ZA 3CC7Q 4RG8A 2RF0A 2CZ1B 5KYXA 2YDLA 3CC2Q 1H3ZA 4X9DA 3A98A 2XIDA 3WVDB 2E41A 2J7IA 3LGFA 3G4SA 1V76A 5GANg 2DERA 4M78A 4E6RA 4FT2A 2JMCA 2NWMA 4XTWA 2DXTA 1OU9A 3V7SA 2DTHA 2DZ9A 5KYWA 3A8HB 5GAN8 3HHTB 3M4YA 1QVFS 2I0NA 2E3IA 2QEXA 3RBBB 1UE9A 1OZ3A 1Q81C 3MPUB 2XD0A 5CKEA 1RADB 4A4GA 3RUXA 4BUGA 4OMMA 1XNIA 1TU0B 1UGQB 1AT1B 5D7UA 3QZ5B 2DVJA 3CCEA 1I5LA 3JCMW 3PVQA 1GFDA 3HKSA 1I4K1 2R58A 3VV0A 3CMET 3SDZA 4ESRA 1VQ6Q 2IPOB 5DM7R 5CQXA 3H6ZA 1RI9A 5CKHA 1KHIA 5GAOq 3G7ZA 2QASA 3I56Q 3CPWS 1MV3A 2ECZA 1TSFA 2YLBA 1YBYA 1M1GA 2O88A 1OU8A 2GQVA 2MPXC 1VQMA 2DTIA 2CYZB 2V1QA 1RACB 2EGEA 5FU6C 1VQLT 1HYOA 1NYFA 1VQOQ 2KGTA 3VUZA 3SFMA 1X6BA 4J6WA 3TVTA 4J9EA 3LLRA 1ZX6A 2MWOA 4FYWB 1Z9ZA 3NTKA 4KRTA 4RTVA 2QK0A 4UC4A 2BTTA 2E5QA 2FZGB 2XKOC 2KRNA 4M78B 3JSCA 2K2MA 2PVDB 2IG0A 1VOMA 3OYFA 4BACA 2RO0A 3OY9A 3G6EA 3NTIA 2BZXA 2CS7A 3HFNA 3QJYA 1ZSZB 1RAIB 3ZFJA 2ED0A 2CP0A 2EQMA 4JRQA 2AKLA 2LX7A 2RQTA 4E2FB 3CCRQ 3C94A 3OS2A 4O5VA 2RJEA 2MYSA 2V8KA 4CC3A 1N5ZA 2DIQA 4J7IA 1AWJA 5IHKA 1YJNA 4D8KA 2DM1A 1DJ7B 1V1CA 1X75C 1D1AA 3J7AF 2NYSA 3CC4Q 3EG9B 2KRSA 4C92D 3M9QA 1NJIU 2FZKB 4IURA 1V29B 3CC2T 1FWZA 2DD5A 4F16A 1LCKA 2E10A 3CC7T 1IZ6A 2CGHA 3VS1A 3VU3C 2EYXA 2HQEA 3CCRT 5CQYA 1K8AC 3UDCA 2RQVA 5GAOm 2X9HA 1E7OA 2JW4A 2LJ1A 1R0CB 2Y4YA 2XICA 4N4HA 3BFMA 3C95A 2W0ZA 3CCLT 1K73U 1WJSA 5LJ5f 1U1SA 1YJNT 2GQIA 1PC0A 3QYHB 4HXJA 2G3RA 2QA4Q 2FO0A 4FCYA 2EJFA 3HRSA 2XK0A 5KYYA 1VQ6A 1K0XA 4OF1A 2RN8A 2DXBA 2EJ9A 2DETA 2C0OA 3HFOA 4M77B 1N9RA 1CKBA 2BE7D 1Y96B 2LQKA 2O31A 4HCKA 3CXCS 3DLLA 4J7FA 1Y96A 3JAME 1YI2T 1T3SA 6AT1B 5HK3A 3RNJA 1B3QA 3X20B 2CT4A 2YRCA 3CCLA 1M5Q1 2COZA 5GAN2 4B9WA 4AFQC 2E6NA 2JTFA 4F04B 1VQ6T 4LD9K 4ANJA 1VQ8T 3OW2P 5A2QE 3BY7A 4LXCA 1FXXA 5J39A 2L89A 2B8AA 3M57A 3UWNA 2B86A 2J6KA 2QTXA 2V8IA 2F5KA 2JMAA 1KQSS 1KHCA 2VXFA 1VQNT 3WVEB 2LCCA 1IGQA 2LNVA 3HRTA 3NFCA 4JJNK 4CRIA 3EG2A 5KE2A 3CCUT 2XG8D 4C0DC 2HMAA 2EYZA 1SF9A 1AHJB 1VIEA 4JZ4A 3JCMd 2VYTA 4F7UB 1Q82U 3QZ9B 5GAOn 2DD4A 3E9FA 1VQ7A 5I2SA 2D8JA 3EH1A 2CH4W 2O9VA 3JB9F 2QQRA 2X3WD 2XMFA 2CP6A 1IHWA 2JS2A 1M8VA 1UGSB 5IHIA 3L2WA 1KQSA 1VQ9A 5IAYA 4PFOA 2EFIA 4K11A 1K4US 3IQLA 5HY6A 4ZTFA 4J83A 1ZBXA 2YSQA 3CC4A 4AFZC 2DRMA 3C0CA 4E47A 2JN0A 2RHXA 4XAXB 4Z88A 1KD1C 3JCMf 3X28B 1VQKA 2A7YA 3FIFA 4JUVA 1YWPA 2RHIA 5GANd 3R6NA 4C92E 4C8QF 1KQ2A 3CCJT 2QQ9A 3J81E 1OV3A 4LDXA 1TOVA 1D1CA 2KXDA 1ZA1B 1XQHA 3PVLA 1YCSB 1NLPC 5EG2A 4A63B 5GAN4 3RERA 1GCPA 1TUDA 3OS1A 2MAMA 4NL3A 1OPLA 1KD1U 4E7HA 2M9UA 3JB9I 1VQPQ 2F2XA 3JCMc 1BU1A 3TSZA 4BE2A 1NPPA 2RK1A 2DMOA 2HCKA 4ZNXA 3E2UA 2QDYB 4B9XA 1BI1A 1D3BA 1M30A 1VQKT 2J6FA 4M75B 2X35A 1EFNA 2PVOB 1S72Q 2X4JA 4E7SA 4PJOA 3PT9A 2E65A 1SSFA 5FWCA 2NUTB 2A37A 2HQXA 3EHRA 3JCMP 2KEAA 3A8LB 3LGLA 3MCAB 3RMSA 1QVGA 2A0FB 3FDRA 1ZBJA 1QQJA 2E1HA 2HL3A 2RHZA 1JXOA 1Q82R 1M90R 1RAGB 1VQMQ 4OMLA 2L8DA 1ZUKA 2K5FA 2YWWA 3EFSA 1SHFA 1T0HA 5GAMg 3NMZC 2HSEB 4C0ZA 3VYHB 2DAQA 3QXEB 2OI3A 2PZ1A 2FL7A 1UG1A 4DOWA 3I5SA 5GAMh 4ATOA 3M0PA 4D6WA 4IUQA 2BE9B 3FJPA 2JTEA 1BIAA 2NUPA 4ELYC 2ZPEB 5CCAA 3G1JA 4EPCA 3JB9J 2LMJA 3V7RA 1NYGA 1ZUYA 2OTLT 1K9AA 3GLXA 4QVDA 2KDSA 2WACA 3P8BB 3EH2A 4N4GA 3OYYA 3CCSA 2CUDA 2RHYA 5I22A 2HKNA 4R56A 4PJOG 4C8QB 1WQWA 5GAOl 2K3YA 1QMCA 3QPHA 1QVFP 1I8FA 1VYVA 5A0GA 5LJ3d 1YJNQ 2KE9A 3OYBA 1IB8A 2O4XA 3OYMA 4JRKA 3M0UA 2L5QA 2E12A 3VS6A 4FSSA 1KG1A 1BBZA 1M90C 1Q86U 1D09B 2A08A 2D0QB 3CPWP 4LNPA 2EQIA 4HCZA 5FRMA 3AT1B 5KCOA 1AZEA 2XHCA 4NS5A 1QCFA 4AFUC 3JCMQ 3M53A 2DBKA 1PD0A 1QVGP 4DOVA 2LCLA 1M1FA 5C6SA 1PWTA 3URGA 4LDUA 3ER0A 2Y4XA 2C06A 3QIIA 5LJ3h 3VRZA 4L59A 1RUWA 2EWNA 4EIKA 1JRIA 4YTLA 2AK5A 2GTJA 1K73C 3CC2A 3CBMA 2HEQA 1RAAB 1PD1A 4C92G 4PJMA 2FHDA 1Q82C 5GJWB 2C0TA 1N6AA 3CCQA 4OGEA 1MMNA 1Z9QA 4NL2A 4FSXA 3MEWA 2RI5A 1C0MA 2RI3A 3A5ZB 3OYIA 2DFUA 3L2ZA 1Q95G 2QDLA 2RQUA 2RHUA 5GMKj 4XTVA 1JO8A 4QVZA 1SRMA 2D8HA 1ZA2B 3M58A 4M7DE 1M4ZA 1QWEA 2YUOA 3JB9D 1AWWA 3T9NA 4C5IA 1I0CA 5KCHA 4HVWA 2LVMA 2DL7A 1VA7A 3UATA 5GANe 3E9GA 1BI2A 1WXTA 4M77D 3H0HA 5GAN6 4KGZB 3SWNC 4OB1B 1VUBA 5KH6A 3ASKA 3NGPA 3CQTA 2VB6A 3S6WA 5D6XA 3CBPA 4FT4A 1WGSA 1I81A 3I56A 4BY6C 3PFSA 3CCQT 4QKUA 4DBQA 1KJWA 1YI2A 2CZ7B 1YJ9T 2QTVA 3HPWA 4DBHA 2M02A 3EGXA 1G2BA 1QKWA 4EMKB 1QCNA 4E7LA 1G8XA 3M55A 4PNOA 2EQJA 1VIFA 2L3SA 4FIBA 3MHXA 2KAFA 4M78G 4C92A 4X9CA 1ZQ1A 3KXTA 4WTOB 4DA4A 1G3YA 4Z8AA 5GMKi 3C4SA 2ZAEA 5GMKh 2HDAA 1ABQA 5LJ5e 5FLXE 5KYYB 2X4XA 1JJ2P 3EG0A 4RTYA 3CCRA 4ELZC 3EFOA 3I56T 3CCSQ 2QQSA 3SWNB 2OX7A 2CSQA 4ZN3A 1VQNA 1KFZA 1KQ1A 2QI2A 1M3CA 4R0KA 5LJ3e 4RKUE 2MCNA 1YIJA 5J26A 2JJ9A 3D7SB 1VQNQ 2KSSA 1E6GA 2DYIA 4XU0A 4QQGA 2ZZDA 2EQKA 1RL2A 2QGGA 2LP5A 3C12A 1WXBA 3EFRA 1WHKA 4QQDA 4A54A 4QT7A 1OEBA 1PSEA 2K9GA 5LJ5j 5GMKe 1VQ4T 4RTXA 2CSIA 3V8KA 4M7DF 2RA2A 2VV5A 4M78D 2FYKA 1AWOA 4IIOA 4M75C 3SEMA 2AIRB 5CK9A 5LL6S 3OW2S 1OOTA 3SB2A 3MKDA 2M1HA 2P0QA 2KMTA 3Q1JA 4M7DG 2VUBA 2EGAA 3CC4T 4KGVB 3QWXX 5AYFA 3RMQA 2QA4A 4D8DA 2QQAA 1YIJT 1GRIA 4RTWA 2RJCA 1ZHIA 1D3BB 3PTAA 2MWPA 4CC4B 2EGCA 4CI0C 2LX9A 3HTRA 3DB4A 4OB3B 3OSVA 4LE9A 1B34B 4J9GA 3PNWC 1PKTA 2ZPIB 2KQWA 1NM7A 1U5SA 2AKKA 1ARKA 1SG5A 2QXFA 3A8GB 2JM8A 4Q5WA 1KC8U 4BY6B 8AT1B 3MO8A 1X27A 1HXDA 1MV0B 1R77A 1RAFB 1VQOT 2PVGB 4PJJA 5M9OA 1IGUA 5DLOA 3CCMQ 1WIEA 2EQUA 3THKA 2MI6A 1Y0MA 4J9CA 3H41A 4JJCA 4XQ3A 3CD6Q 2DJZA 2RM4A 2KROA 1KQSP 2KT8A 4C8QC 4IKFA 2E4HA 3MP6A 4JPBW 1VQ7T 3JCMh 2CREA 1M2VB 1K0SA 1MHNA 2LCSA 3M4GA 3LX7A 4BB7A 2GF7A 3JB9G 1K8AR 3CMAQ 3M0TA 2VGNA 1JB0E 2JUFA 3P8DA 4AG2C 4RTZA 1Y7XA 1LOJA 4HT9A 4HCCA 4BI4A 4HVVA 3META 4BE0A 3GNFB 2VWFA 3CXCA 1H641 4F7UA 1W4SA 4J8OA 2HSPA 1FYNA 1UGRB 1JBMA 4RMOA 1VQ7Q 3LYIA 4L5GA 3RKXA 3RESA 1OQKA 2NUTA 2M0OA 1VQ4Q 1WHMA 3VUBA 1UGPB 4JLGA 4CC7A 3G4ST 5AT1B 3DB3A 4PJOB 4BE1A 4L6V5 1UHFA 2OTJA 3CCJA 2F2WA 4M77F 1YITT 3X24B 3DLMA 2QQBA 2XDPA 4FYVB 2ZGWA 3E19A 4OMNA 2I2LA 4JRIA 2FPDA 2LDMA 2JNGA 4LDYA 2QEXT 4LUDA 4M7AC 5I2MA 1RLQC 1QVFA 1ZSGA 3GIBA 1IREB 1TG0A 2DVEA 2H3JA 1KC8R 3L42A 1Q7YC 2VKNA 3QBYA 1FMKA 2H3EB 1NLOC 3OYNA 2QAZA 1M9SA 5CO7A 1VQ5T 2DIGA 2MIOA 1Q7YU 2EKOA 1I1JA 2OTJT 1MUZA 3X25B 2WSFE 4QW2A 3H0IA 3CCJQ 5LJ5d 3TQ7P 3H9NA 1PSFA 3G71Q 3I55T 1K76A 3TU4K 1LVKA 4A4FA 1NEBA 4KH1B 2JXBA 3CCQQ 3QSUA 1VYUA 2RJDA 4EMKC 4KBMB 1M90U 4BI3A 2LZ6B 2L0AA 4MDWA 4HT8A 5KYWB 2YUNA 1D0YA 4M75A 4NOYA 4PJOD 1I07A 4C0GA 2E64A 3TREA 1M3AA 1EZZB 1FMVA 3TCJA 4XK8E 1G5VA 3QJ6A 3PE0A 4M75G 1JXMA 1K9MU 4WF2A 2E70A 4MZMA 2EBPA 4HA8A 3CBOA 2A3LA 2YUPA 3G6EQ 4ZTJA 1B7TA 5GANj 1WQ7A 2JT4A 4RUGA 3LH0A 1Q86R 4J6XA 3CCST 1JJ2A 1PCXA 1Q81U 4VUBA 4MZPA 4DEYA 4LDWA 3F70A 2SEMA 2KR3A 3JCMb 2RB6A 3VS3A 4X1VA 2WSEE 2DL5A 2LJ3A 3EG3A 1O75A 2JS0A 4PLIA 1YN8A 5GMKl 1CKAA 4C92B 1ZSZA 2L2PA 1UFFA 4FL6A 4ZGDB 3CC7A 2JM9A 4N0AC 3LW5E 1VQMT 1QW1A 2EIFA 3BW1A 3V8JA 5HK0A 1GXIE 2F69A 2EJGA 3EHQA 2E5KA 3M59A 1N8RR 1KIKA 2K57A 2D6FA 5A0LA 3LWHA 1SEMA 2YHTA 1N8RC 2CKKA 1YJWT 1K8AU 1TH7A 5GAN3 3FRNA 2AZSA
chains in the Genus database with same CATH topology
3QWYA 1SRMA 1X6GA 4CC3A 2D8HA 1N5ZA 2DRKA 2ROTA 1SSHA 1WXUA 1AWJA 1QWEA 2RQWA 4D8KA 2YUOA 5IHKA 1AWWA 2DM1A 1V1CA 1I0CA 5IXBA 4HVWA 2DL7A 2KRSA 1VA7A 3UATA 2DLPA 1TUCA 1WXTA 3H0HA 2FG0A 2LNHB 1KSWA 3M0SA 4F16A 3SHWA 1JU5C 1LCKA 3NGPA 3CQTA 3VS1A 1B07A 2EYXA 2EW3A 2J05A 1BK2A 1WFWA 2RQVA 2PNIA 2FEIA 2CT3A 2KBTA 3I35A 2GTOA 1A0NB 1ZUUA 2DYBA 1NG2A 1E7OA 1KJWA 2JW4A 1SRLA 1UECA 2LJ1A 4AFSC 3VS0A 2O9SA 1YWOA 2MOXA 1G2BA 1QKWA 2KRMA 1WLPB 2K6DA 2W0ZA 2L3SA 2GQIA 2IIMA 1ZLMA 4HXJA 3JV3A 2FO0A 4OMPA 2NUZA 1K0XA 1X2KA 1UJ0A 4Z8AA 2RN8A 2LQWA 2C0OA 2HDAA 2HBWA 4J9DA 1ABQA 1CKBA 3EG0A 4RTYA 2O31A 4HCKA 4J9BA 4DEXA 1HSQA 3VS2A 2J06A 2DL3A 2RPNA 1T3SA 2CSQA 4J9HA 1GBRA 1KFZA 1T3LA 3RNJA 1B3QA 4J9IA 3UA6A 3VS4A 1M3CA 4R0KA 3VRYA 1G83A 2MCNA 2CT4A 1HD3A 1AZGB 2CUBA 3REBB 3TSWA 1E6GA 5IXFA 1YNZA 4AFQC 2GNCA 2DJQA 1GCQC 2P4RA 2LP5A 3ULRB 1WXBA 3VS5A 2FRYA 4QT7A 2EVRA 1OEBA 4WCIA 3LH5A 2K9GA 5IH2A 2KYBA 4RTXA 3UA7A 1QKXA 2CSIA 1H8KA 2GGRA 4F17A 1AOJA 1UHCA 1AWOA 4IIOA 3SEMA 1S1NA 1H3HA 1M3BA 2KYMA 1OOTA 2B86A 2J6KA 2JMAA 2M51A 1UUEA 2A36A 1PNJA 2EGAA 1AVZC 1K1ZA 3EG2A 3H0FA 3QWXX 2DA9A 2O2OA 2EYZA 1AD5A 4D8DA 1WI7A 1U3OA 1GRIA 4RTWA 4JZ4A 2F2VA 3M0QA 4RTTA 3FJ5A 2EGCA 4CC4B 2AZVA 4LE9A 1PKSA 4J9GA 4AG1C 2BZYA 1PKTA 1T0JA 2D8JA 1NM7A 2CH4W 2O9VA 3M0RA 1BB9A 2CDTA 1U5SA 1SHGA 2AKKA 2FPFA 1ARKA 2DNUA 3UF4A 2X3WD 2XMFA 3NHNA 2JS2A 2JM8A 1W70A 2LQNA 1X2QA 2X3XD 5GJVB 5IHIA 2ENMA 1X27A 1MV0B 4K11A 1K4US 3IQLA 2PTKA 2G6FX 2YSQA 1WIEA 1SPKA 1IO6A 3THKA 4AFZC 2DRMA 3C0CA 2K3BA 4LUEA 1Y0MA 2RQRA 4Z88A 4J9CA 4GBQA 3H41A 1H92A 2K79A 4JJCA 1NEGA 2SRCA 1YWPA 2EYYA 5ECAA 1QWFA 2LJ0A 2YT6A 2KROA 2KT8A 3R6NA 4JPBW 4JJDA 3I9QA 2CREA 1K0SA 1WA7A 4HVUA 2LCSA 3EGUA 1OV3A 4IIMA 2EKHA 2KXDA 3PVLA 2OJ2A 1YCSB 1X69A 1E6HA 1NLPC 2ESWA 4A63B 1GCPA 1TUDA 3M0TA 3ZL7C 4J9FA 1RLPC 1OPLA 1PRLC 4AG2C 4RTZA 1M8MA 1UJYA 2L3PA 1X43A 2F2XA 2DF6A 1BU1A 4HVVA 3TSZA 4JJBA 2EPDA 2DMOA 2HCKA 2VWFA 1J3TA 4ZNXA 2FRWA 1AEYA 1YP5A 2HSPA 1M30A 1FYNA 1VYTA 2J6FA 1EFNA 4CC2A 2D1XA 4OMQA 1UTIA 5FWCA 2KT1A 4CC7A 1WDXA 2A37A 3U23A 1UHFA 3EHRA 2KEAA 5IHNA 1UGVA 2F2WA 1GFCA 1ABOA 2H8HA 1JEGA 1ZBJA 5FWBA 2EYWA 1U06A 1GBQA 1JXOA 1GCQA 4OMNA 2KNBB 4OMLA 1ZUKA 5HCKA 2FPDA 1SHFA 1T0HA 1UDLA 2DL4A 3REAB 3NMZC 4LUDA 4LN2A 3NPFA 1PHTA 1JQQA 1RLQC 2YUQA 1ZSGA 2V1RA 1TG0A 2OI3A 2VKNA 2RNAA 3O5ZA 2PZ1A 2BZ8A 1FMKA 1UG1A 2RF0A 1NLOC 3I5SA 2YDLA 2DE0X 3M0PA 2OAWA 3A98A 4GLMA 2JTEA 2J7IA 2MIOA 1WYXA 1I1JA 5I11A 2LMJA 1MUZA 1NYGA 1ZUYA 4E6RA 2GBQA 1K9AA 3H0IA 3KFVA 2JMCA 2FPEA 1XOVA 2J6OA 2C0IA 2NWMA 1K76A 2K7AA 5L23A 1NEBA 2JXBA 2CUDA 2D0NA 5I22A 1VYUA 2ROLA 2I0NA 2A28A 2W10A 3I5RA 2M0YA 2LZ6B 3RBBB 2L0AA 1UE9A 2YUNA 4M4ZA 1VYVA 1W1FA 2DX1A 2RMOA 1I07A 4OMMA 4Z89A 2DVJA 1Y57A 3PVQA 1GFDA 2KE9A 1M3AA 2DL8A 2ED1A 4ESRA 3PE0A 3M0UA 3VS7A 1JXMA 1HJDA 3VS6A 4FSSA 1RI9A 5FW9A 1M27C 1BBZA 1MV3A 2ECZA 2EBPA 2YUPA 2O88A 2A08A 2L3QA 1AWXA 2ABLA 2JT4A 2V1QA 4RUGA 2EGEA 4LNPA 2EQIA 1WX6A 1NYFA 4Y92A 1AZEA 2KGTA 1QCFA 4AFUC 1CSKA 2DBKA 1X6BA 3EG1A 4DEYA 3TVTA 4J9EA 1GL5A 1ZX6A 2VVKA 1Z9ZA 2SEMA 2KR3A 4KRTA 1PWTA 4RTVA 3VS3A 4X1VA 2DL5A 2KXCA 2BTTA 2LJ3A 4OMOA 2KRNA 3EG3A 3VRZA 1RUWA 4JZ3A 4EIKA 2AK5A 2JS0A 1YN8A 2K2MA 2GTJA 1CKAA 2L2PA 2DBMA 2HEQA 1UFFA 2BZXA 4F14A 4RTUA 2JM9A 3GBQA 5GJWB 2CH4A 2C0TA 1QLYA 5EC7A 3EHQA 2E5KA 1PRMC 1KIKA 1Z9QA 2ED0A 2DILA 2AKLA 1SEMA 1W6XA 4ORZA 2LX7A 2RQTA 2QDLA 2RQUA 1OPKA 2AZSA 1JO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWY A;  1SRM A;  1X6G A;  4CC3 A;  2D8H A;  1N5Z A;  2DRK A;  2ROT A;  1SSH A;  1WXU A;  1AWJ A;  1QWE A;  2RQW A;  4D8K A;  2YUO A;  5IHK A;  1AWW A;  2DM1 A;  1V1C A;  1I0C A;  5IXB A;  4HVW A;  2DL7 A;  2KRS A;  1VA7 A;  3UAT A;  2DLP A;  1TUC A;  1WXT A;  3H0H A;  2FG0 A;  2LNH B;  1KSW A;  3M0S A;  4F16 A;  3SHW A;  1JU5 C;  1LCK A;  3NGP A;  3CQT A;  3VS1 A;  1B07 A;  2EYX A;  2EW3 A;  2J05 A;  1BK2 A;  1WFW A;  2RQV A;  2PNI A;  2FEI A;  2CT3 A;  2KBT A;  3I35 A;  2GTO A;  1A0N B;  1ZUU A;  2DYB A;  1NG2 A;  1E7O A;  1KJW A;  2JW4 A;  1SRL A;  1UEC A;  2LJ1 A;  4AFS C;  3VS0 A;  2O9S A;  1YWO A;  2MOX A;  1G2B A;  1QKW A;  2KRM A;  1WLP B;  2K6D A;  2W0Z A;  2L3S A;  2GQI A;  2IIM A;  1ZLM A;  4HXJ A;  3JV3 A;  2FO0 A;  4OMP A;  2NUZ A;  1K0X A;  1X2K A;  1UJ0 A;  4Z8A A;  2RN8 A;  2LQW A;  2C0O A;  2HDA A;  2HBW A;  4J9D A;  1ABQ A;  1CKB A;  3EG0 A;  4RTY A;  2O31 A;  4HCK A;  4J9B A;  4DEX A;  1HSQ A;  3VS2 A;  2J06 A;  2DL3 A;  2RPN A;  1T3S A;  2CSQ A;  4J9H A;  1GBR A;  1KFZ A;  1T3L A;  3RNJ A;  1B3Q A;  4J9I A;  3UA6 A;  3VS4 A;  1M3C A;  4R0K A;  3VRY A;  1G83 A;  2MCN A;  2CT4 A;  1HD3 A;  1AZG B;  2CUB A;  3REB B;  3TSW A;  1E6G A;  5IXF A;  1YNZ A;  4AFQ C;  2GNC A;  2DJQ A;  1GCQ C;  2P4R A;  2LP5 A;  3ULR B;  1WXB A;  3VS5 A;  2FRY A;  4QT7 A;  2EVR A;  1OEB A;  4WCI A;  3LH5 A;  2K9G A;  5IH2 A;  2KYB A;  4RTX A;  3UA7 A;  1QKX A;  2CSI A;  1H8K A;  2GGR A;  4F17 A;  1AOJ A;  1UHC A;  1AWO A;  4IIO A;  3SEM A;  1S1N A;  1H3H A;  1M3B A;  2KYM A;  1OOT A;  2B86 A;  2J6K A;  2JMA A;  2M51 A;  1UUE A;  2A36 A;  1PNJ A;  2EGA A;  1AVZ C;  1K1Z A;  3EG2 A;  3H0F A;  3QWX X;  2DA9 A;  2O2O A;  2EYZ A;  1AD5 A;  4D8D A;  1WI7 A;  1U3O A;  1GRI A;  4RTW A;  4JZ4 A;  2F2V A;  3M0Q A;  4RTT A;  3FJ5 A;  2EGC A;  4CC4 B;  2AZV A;  4LE9 A;  1PKS A;  4J9G A;  4AG1 C;  2BZY A;  1PKT A;  1T0J A;  2D8J A;  1NM7 A;  2CH4 W;  2O9V A;  3M0R A;  1BB9 A;  2CDT A;  1U5S A;  1SHG A;  2AKK A;  2FPF A;  1ARK A;  2DNU A;  3UF4 A;  2X3W D;  2XMF A;  3NHN A;  2JS2 A;  2JM8 A;  1W70 A;  2LQN A;  1X2Q A;  2X3X D;  5GJV B;  5IHI A;  2ENM A;  1X27 A;  1MV0 B;  4K11 A;  1K4U S;  3IQL A;  2PTK A;  2G6F X;  2YSQ A;  1WIE A;  1SPK A;  1IO6 A;  3THK A;  4AFZ C;  2DRM A;  3C0C A;  2K3B A;  4LUE A;  1Y0M A;  2RQR A;  4Z88 A;  4J9C A;  4GBQ A;  3H41 A;  1H92 A;  2K79 A;  4JJC A;  1NEG A;  2SRC A;  1YWP A;  2EYY A;  5ECA A;  1QWF A;  2LJ0 A;  2YT6 A;  2KRO A;  2KT8 A;  3R6N A;  4JPB W;  4JJD A;  3I9Q A;  2CRE A;  1K0S A;  1WA7 A;  4HVU A;  2LCS A;  3EGU A;  1OV3 A;  4IIM A;  2EKH A;  2KXD A;  3PVL A;  2OJ2 A;  1YCS B;  1X69 A;  1E6H A;  1NLP C;  2ESW A;  4A63 B;  1GCP A;  1TUD A;  3M0T A;  3ZL7 C;  4J9F A;  1RLP C;  1OPL A;  1PRL C;  4AG2 C;  4RTZ A;  1M8M A;  1UJY A;  2L3P A;  1X43 A;  2F2X A;  2DF6 A;  1BU1 A;  4HVV A;  3TSZ A;  4JJB A;  2EPD A;  2DMO A;  2HCK A;  2VWF A;  1J3T A;  4ZNX A;  2FRW A;  1AEY A;  1YP5 A;  2HSP A;  1M30 A;  1FYN A;  1VYT A;  2J6F A;  1EFN A;  4CC2 A;  2D1X A;  4OMQ A;  1UTI A;  5FWC A;  2KT1 A;  4CC7 A;  1WDX A;  2A37 A;  3U23 A;  1UHF A;  3EHR A;  2KEA A;  5IHN A;  1UGV A;  2F2W A;  1GFC A;  1ABO A;  2H8H A;  1JEG A;  1ZBJ A;  5FWB A;  2EYW A;  1U06 A;  1GBQ A;  1JXO A;  1GCQ A;  4OMN A;  2KNB B;  4OML A;  1ZUK A;  5HCK A;  2FPD A;  1SHF A;  1T0H A;  1UDL A;  2DL4 A;  3REA B;  3NMZ C;  4LUD A;  4LN2 A;  3NPF A;  1PHT A;  1JQQ A;  1RLQ C;  2YUQ A;  1ZSG A;  2V1R A;  1TG0 A;  2OI3 A;  2VKN A;  2RNA A;  3O5Z A;  2PZ1 A;  2BZ8 A;  1FMK A;  1UG1 A;  2RF0 A;  1NLO C;  3I5S A;  2YDL A;  2DE0 X;  3M0P A;  2OAW A;  3A98 A;  4GLM A;  2JTE A;  2J7I A;  2MIO A;  1WYX A;  1I1J A;  5I11 A;  2LMJ A;  1MUZ A;  1NYG A;  1ZUY A;  4E6R A;  2GBQ A;  1K9A A;  3H0I A;  3KFV A;  2JMC A;  2FPE A;  1XOV A;  2J6O A;  2C0I A;  2NWM A;  1K76 A;  2K7A A;  5L23 A;  1NEB A;  2JXB A;  2CUD A;  2D0N A;  5I22 A;  1VYU A;  2ROL A;  2I0N A;  2A28 A;  2W10 A;  3I5R A;  2M0Y A;  2LZ6 B;  3RBB B;  2L0A A;  1UE9 A;  2YUN A;  4M4Z A;  1VYV A;  1W1F A;  2DX1 A;  2RMO A;  1I07 A;  4OMM A;  4Z89 A;  2DVJ A;  1Y57 A;  3PVQ A;  1GFD A;  2KE9 A;  1M3A A;  2DL8 A;  2ED1 A;  4ESR A;  3PE0 A;  3M0U A;  3VS7 A;  1JXM A;  1HJD A;  3VS6 A;  4FSS A;  1RI9 A;  5FW9 A;  1M27 C;  1BBZ A;  1MV3 A;  2ECZ A;  2EBP A;  2YUP A;  2O88 A;  2A08 A;  2L3Q A;  1AWX A;  2ABL A;  2JT4 A;  2V1Q A;  4RUG A;  2EGE A;  4LNP A;  2EQI A;  1WX6 A;  1NYF A;  4Y92 A;  1AZE A;  2KGT A;  1QCF A;  4AFU C;  1CSK A;  2DBK A;  1X6B A;  3EG1 A;  4DEY A;  3TVT A;  4J9E A;  1GL5 A;  1ZX6 A;  2VVK A;  1Z9Z A;  2SEM A;  2KR3 A;  4KRT A;  1PWT A;  4RTV A;  3VS3 A;  4X1V A;  2DL5 A;  2KXC A;  2BTT A;  2LJ3 A;  4OMO A;  2KRN A;  3EG3 A;  3VRZ A;  1RUW A;  4JZ3 A;  4EIK A;  2AK5 A;  2JS0 A;  1YN8 A;  2K2M A;  2GTJ A;  1CKA A;  2L2P A;  2DBM A;  2HEQ A;  1UFF A;  2BZX A;  4F14 A;  4RTU A;  2JM9 A;  3GBQ A;  5GJW B;  2CH4 A;  2C0T A;  1QLY A;  5EC7 A;  3EHQ A;  2E5K A;  1PRM C;  1KIK A;  1Z9Q A;  2ED0 A;  2DIL A;  2AKL A;  1SEM A;  1W6X A;  4ORZ A;  2LX7 A;  2RQT A;  2QDL A;  2RQU A;  1OPK A;  2AZS A;  1JO8 A; 
#chains in the Genus database with same CATH topology
 3QWY A;  1X6G A;  2ROT A;  5FU7 C;  1SSH A;  2MMP A;  4XTY A;  5CKD A;  1VQK Q;  2RQW A;  2E6Z A;  2VC8 A;  1TUC A;  4J5Y A;  3OSS C;  1VQ5 Q;  2DPP B;  2LNH B;  4C0F A;  2HAX A;  3SHW A;  4FW2 A;  2VXE A;  2EW3 A;  2J05 A;  1YJW Q;  1WFW A;  3OBW A;  5A0D A;  2X4W A;  3P8H A;  2CT3 A;  3GF5 A;  2VGM A;  5FU7 B;  2DYB A;  4XU3 A;  2KK4 A;  1SRL A;  1UEC A;  4AFS C;  3VS0 A;  2O9S A;  1YJW A;  2KRM A;  1U8R A;  3JRZ A;  3ME9 A;  1WLP B;  2K6D A;  1XJW B;  1ACM B;  4R55 A;  2DKG A;  1F1B B;  5C0M A;  2IIM A;  4C0D B;  3OYL A;  3M56 A;  1ZLM A;  3OYG A;  1WHJ A;  4RCB A;  1K73 R;  4M77 A;  1QCO A;  2NUZ A;  2DEU A;  1X2K A;  3JCM J;  2HBW A;  3PMI A;  4J9D A;  3KUF A;  4J6Y A;  1SKU B;  5GAO r;  3OYA A;  1S72 T;  1HSQ A;  5CIU A;  4PL6 A;  1BI3 A;  2J06 A;  4FM4 B;  4C8Q D;  5I21 A;  3OYH A;  1YJ9 A;  1GBR A;  3EFO B;  3OB9 A;  3L2Q A;  3VRY A;  3BDU A;  1IHV A;  4IUV A;  1HD3 A;  2E3H A;  1AZG B;  3G71 A;  3TSW A;  1QP3 A;  3EG9 A;  4FW1 A;  4M77 E;  5IXF A;  2HL5 C;  2GNC A;  1M1K R;  2DJQ A;  2FB7 A;  2P4R A;  4V2S A;  3MJX A;  5J3B A;  3HP9 A;  2O01 E;  3CPF A;  4KUL A;  5LJ3 f;  1Y07 A;  2FRY A;  4EMG A;  4M7D D;  2EYQ A;  2YRD A;  3GOX A;  3LH5 A;  1WZO A;  2KYB A;  1YI2 Q;  3CEY A;  3UA7 A;  1H8K A;  2LQ8 A;  2DEQ A;  2ATC B;  2K3X A;  4F17 A;  4ME7 A;  1AOJ A;  1UHC A;  7AT1 B;  1VQ9 T;  1S72 A;  1S1N A;  2YLC A;  1VQO A;  1H3H A;  1KK7 A;  3L1A A;  4M77 C;  4JS4 A;  2DZC A;  1UUE A;  2A36 A;  4MMK A;  4E7K A;  4IUP A;  1K1Z A;  3H0F A;  4LD6 A;  3VJP A;  2JOY A;  2K5L A;  2Y90 A;  2M16 A;  3G71 T;  3JCM X;  2CZ0 B;  3FJ5 A;  2GCX A;  2AZV A;  3L2R A;  4ZGE B;  1P92 A;  1TWB A;  2BZY A;  2ZPG B;  5KYU B;  4M78 E;  1T0J A;  2KVQ G;  3M0R A;  1BB9 A;  2CDT A;  1SHG A;  3NHN A;  1R0B G;  1VQ4 A;  3QO3 A;  3OS0 A;  2LQN A;  1X2Q A;  5GJV B;  3JCM e;  3PGG A;  2QEX Q;  2QG9 B;  3QG1 A;  2HD0 A;  2OTJ Q;  3QYG B;  2PTK A;  1YHQ T;  3V7C A;  3GPL A;  1WHG A;  3OBY A;  4LUE A;  2RQR A;  4C5H A;  5DLQ E;  1X01 A;  3CCV T;  3INZ A;  1H92 A;  4EMH A;  1WJQ A;  1BKB A;  2SRC A;  1JJ2 S;  2EYY A;  1I5O B;  1QWF A;  2YT6 A;  2PUK B;  5KE3 A;  3CME Q;  4X34 A;  1MGQ A;  1WA7 A;  4DBR A;  1NPR A;  1Q81 R;  2COW A;  3EGU A;  4PJO C;  2DXC A;  2EKH A;  3FLG A;  1D1B A;  5GAM j;  3CMA T;  3OS5 A;  4OB0 B;  2HNI A;  2ESW A;  3G4S Q;  1QP2 A;  3V8L A;  5IN1 A;  3ZL7 C;  4M7A E;  4A4K A;  4KH0 B;  1PRL C;  5CAI A;  4ZN1 A;  3FEO A;  1X43 A;  2DF6 A;  3EGD A;  3CD6 T;  5DY9 A;  1K9M R;  4KUD K;  1FX7 A;  3L2U A;  4M78 C;  4M75 D;  1U1T A;  5LJ3 g;  2FRW A;  4FYY B;  1AEY A;  1YP5 A;  3EGD B;  4TVR A;  3OQ5 A;  2K2V A;  2JTM A;  1B34 A;  3L2V A;  2D1X A;  4OMQ A;  1VQ8 Q;  1UTI A;  2K4Y A;  5KYU A;  2LT1 A;  5FRO A;  4OP0 A;  4MML A;  3RR6 A;  1Q7Y R;  1KC8 C;  3U23 A;  1G3T A;  5IHN A;  2O4X B;  4IUT A;  2H8H A;  5FWB A;  2EYW A;  1U06 A;  1VQL Q;  3CCM A;  2CZ6 B;  3OYK A;  5HCK A;  1VQP A;  2DL4 A;  3REA B;  1W2B P;  1C6V X;  4LN2 A;  1PHT A;  4GY5 A;  4N4I A;  3CD6 A;  2YUQ A;  5KYX B;  4P5N A;  2RK2 A;  5CKF A;  3A8M B;  2BZ8 A;  1WHH A;  3FB9 A;  2DE0 X;  2GFU A;  2OAW A;  4C8Q E;  4GLM A;  5GAM d;  2FZC B;  1YJ9 Q;  1WYX A;  2BKD N;  2AHJ B;  5I11 A;  2XDB A;  3CCU Q;  2NUP B;  2X4Y A;  2GBQ A;  1WPY A;  3KFV A;  1YIT A;  2FPE A;  1XOV A;  2J6O A;  2C0I A;  3E1S A;  4IUU A;  4M7D A;  2P4T A;  2K7A A;  5L23 A;  2PUO B;  2EAY A;  1VQL A;  3OMC A;  2D0N A;  3OMG A;  4OMF B;  2ROL A;  3OW2 A;  5GAM e;  2A28 A;  2W10 A;  3I5R A;  2M0Y A;  1D0X A;  4M4Z A;  4AMC A;  4HCB A;  1M1K U;  1W1F A;  3X26 B;  2DX1 A;  2RMO A;  3OA6 A;  3N5B B;  3DKM A;  3RKW A;  4C8Q A;  4Z89 A;  8ATC B;  1IXD A;  1Y57 A;  4A4E A;  3MEA A;  2ED1 A;  2DL8 A;  4M7A A;  1YHQ Q;  3VS7 A;  2HKQ B;  1HJD A;  5FW9 A;  3G6E T;  1M27 C;  3QDR B;  1G3W A;  5CR2 A;  4PJN A;  3CCV Q;  2OTL A;  1YCY A;  1OYX A;  2L3Q A;  1AWX A;  2ABL A;  4M75 F;  4II1 A;  3OYD A;  1WX6 A;  5FRN A;  4Y92 A;  1WNL A;  3A8O B;  1CSK A;  4XU2 A;  1D0Z A;  5GAO p;  3EG1 A;  2BUD A;  1GL5 A;  2VVK A;  3CXC P;  4BI8 B;  3UPU A;  3CCE T;  2KXC A;  1LNX A;  2RD1 A;  4OMO A;  4JZ3 A;  3CME A;  2OAU A;  4LDV A;  4MDX A;  3OYE A;  1QVP A;  4N0A A;  2XU8 A;  2LT4 A;  4ZGJ B;  2DBM A;  3JB9 H;  4M7D B;  4F14 A;  4RTU A;  4Y28 E;  4EDU A;  5IT9 E;  3GBQ A;  3UT1 A;  1EIF A;  2CH4 A;  5EC7 A;  1QLY A;  1NE8 A;  1PRM C;  4BDZ A;  2CP7 A;  4Y91 A;  2DIL A;  1W6X A;  4ORZ A;  1BIB A;  3JCM g;  2MF2 A;  5GAN f;  1OPK A;  4XTU A;  1C1A A;  4JLI A;  5FU6 B;  1KD1 R;  2DRK A;  5CVI A;  1NZ9 A;  3JCM V;  1WXU A;  2DXU A;  1NJI R;  5IXB A;  1IRX A;  2RI2 A;  3MEV A;  1BYM A;  2DLP A;  1LJO A;  3R6O A;  5L8R E;  4PJO E;  3CCL Q;  5LJ5 g;  3PIO A;  2FG0 A;  1KSW A;  3M0S A;  1JU5 C;  2ZCF B;  1VQ9 Q;  4PJL A;  1B07 A;  1BK2 A;  2BIV A;  2PNI A;  3J80 E;  2FEI A;  1X6O A;  2KBT A;  3I35 A;  4Z02 A;  2GTO A;  1A0N B;  1ZUU A;  1NG2 A;  4E7J A;  4XU1 A;  3HRU A;  4PFZ A;  1YFN A;  1YWO A;  3MP8 A;  2MOX A;  4PLL A;  2LC4 A;  1W2B A;  1OX8 A;  4M75 E;  2CP3 A;  2AT1 B;  4EMK A;  4F7U G;  2ZPH B;  4MZT A;  1ZSZ C;  3PIP A;  2CP2 A;  1RAH B;  3JV3 A;  2NLU A;  4OB2 B;  1G3S A;  2F1L A;  4OMP A;  4JRP A;  5GAN h;  2K5I A;  3KBG A;  2P0K A;  1UJ0 A;  1WHL A;  2LQW A;  3ZBD A;  2V26 A;  1XTD A;  2JZ2 A;  1TS9 A;  1R8O B;  1TTH B;  2PQW A;  4J9B A;  4DEX A;  3SD4 A;  1UB4 A;  4M77 G;  3VS2 A;  2DO3 A;  3RDV A;  3S3N A;  2DL3 A;  2RPN A;  1EX4 A;  4J9H A;  1M1K C;  2MK5 A;  3ZEH A;  1T3L A;  1K9M C;  4J9I A;  4PK4 A;  3UA6 A;  3VS4 A;  3CCU A;  3HSB A;  4XTX A;  1G83 A;  2QA4 T;  4JDS A;  3MP1 A;  2CUB A;  3S3M A;  3REB B;  1BI0 A;  1NJI C;  2COY A;  2FVU A;  3FC3 A;  2DK3 A;  2KY9 A;  1YNZ A;  4PJO F;  4F7U F;  1GCQ C;  2R5M A;  1Y71 A;  4DBF A;  3OYC A;  3ULR B;  1HK9 A;  2HBP A;  2HQH A;  2IVW A;  3VS5 A;  2EVR A;  3TEE A;  4WCI A;  3LWI A;  4F7U E;  5GAN 5;  5IH2 A;  3I55 Q;  4O6J A;  1QKX A;  1PG5 B;  4OGC A;  2GGR A;  1BCM A;  1OZ2 A;  4KUI A;  2HZY A;  1M3B A;  3EGX B;  2KYM A;  1BCO A;  2KI7 A;  1RAE B;  1YHQ A;  2M51 A;  4C92 C;  1PNJ A;  2P84 A;  2WSC E;  1O9S A;  1AVZ C;  1YIJ Q;  2DA9 A;  2O2O A;  3CCV A;  2OTL Q;  3EAE A;  2XI9 A;  1AD5 A;  4KT0 E;  4RG2 A;  2YRV A;  5HKC A;  1WI7 A;  1U3O A;  4FU6 A;  4M7A F;  2F2V A;  3M0Q A;  4RTT A;  3AHU A;  1PKS A;  4C92 F;  5GAN 7;  4AG1 C;  4FYX B;  1LPL A;  2DTO A;  1MND A;  2Z0W A;  2FPF A;  4M7A G;  3NTH A;  2DNU A;  3UF4 A;  1MNE A;  1FMW A;  1MMA A;  1W70 A;  1VQ8 A;  1WJR A;  3M54 A;  2X3X D;  3SWN A;  4DQ2 A;  2ENM A;  2RJF A;  3QUI A;  1RAB B;  2LRQ A;  5LJ3 j;  3QHS A;  2D9T A;  2R57 A;  2G6F X;  4B6M A;  3GP8 A;  1N9S A;  3H8Z A;  1OUL A;  1SPK A;  3WXM B;  1IO6 A;  4PKC C;  5D6W A;  2K3B A;  4HKE A;  1N8R U;  2R5A A;  3PMT A;  4GBQ A;  2LTO A;  2K79 A;  2YXY A;  1NBE B;  3BE3 A;  1NEG A;  4BD3 A;  1OX9 A;  2VAS A;  5ECA A;  4KGX B;  3QDF A;  2LJ0 A;  2ZPF B;  4JS5 A;  3O8V A;  3HL8 A;  1UEB A;  4JJD A;  3I9Q A;  4XTZ A;  4HVU A;  4A4H A;  4IIM A;  2OJ2 A;  4AT1 B;  3RKY A;  1X69 A;  4E7I A;  1E6H A;  1M2V A;  2QYZ A;  3CCM T;  3GNG A;  3M5A A;  1M2O A;  2X51 A;  4C8Q G;  1VQP T;  4J9F A;  1RLP C;  4M7A D;  1Q86 C;  4M7D C;  4C5G A;  1M8M A;  1UJY A;  2L3P A;  4A53 A;  1OI1 A;  2P0P A;  2V8J A;  4M78 F;  3QKJ A;  4JJB A;  1N27 A;  2EPD A;  1J3T A;  1MMD A;  1VYT A;  2PU9 B;  2QGF B;  3RIR A;  1MMG A;  4CC2 A;  4PFP A;  5KYN A;  1VQ5 A;  1RI0 A;  2L3R A;  2KT1 A;  2JVV A;  2XDD A;  1WDX A;  3MEU A;  5LJ5 h;  2ZPB B;  4M7A B;  1YIT Q;  1PM3 A;  3CPW A;  1UGV A;  4OVA A;  4E7Z A;  3A1P A;  1QVG S;  1GFC A;  3CMA A;  1ABO A;  1JEG A;  2F5T X;  1GBQ A;  4QQ6 A;  4QVC A;  3I55 A;  1GCQ A;  5GMK m;  2KNB B;  4RCC A;  1UDL A;  5CKB A;  2GFA A;  4C5E A;  5GAM f;  3OYJ A;  1TXQ A;  3NPF A;  2CP5 A;  9ATC B;  1JQQ A;  1TUG B;  3VYG A;  1W2B S;  4GLK A;  2V1R A;  4BDY A;  3S3O A;  3BDL A;  2RH2 A;  3VKI A;  2RNA A;  5D6Y A;  3CCE Q;  3O5Z A;  3CC7 Q;  4RG8 A;  2RF0 A;  2CZ1 B;  5KYX A;  2YDL A;  3CC2 Q;  1H3Z A;  4X9D A;  3A98 A;  2XID A;  3WVD B;  2E41 A;  2J7I A;  3LGF A;  3G4S A;  1V76 A;  5GAN g;  2DER A;  4M78 A;  4E6R A;  4FT2 A;  2JMC A;  2NWM A;  4XTW A;  2DXT A;  1OU9 A;  3V7S A;  2DTH A;  2DZ9 A;  5KYW A;  3A8H B;  5GAN 8;  3HHT B;  3M4Y A;  1QVF S;  2I0N A;  2E3I A;  2QEX A;  3RBB B;  1UE9 A;  1OZ3 A;  1Q81 C;  3MPU B;  2XD0 A;  5CKE A;  1RAD B;  4A4G A;  3RUX A;  4BUG A;  4OMM A;  1XNI A;  1TU0 B;  1UGQ B;  1AT1 B;  5D7U A;  3QZ5 B;  2DVJ A;  3CCE A;  1I5L A;  3JCM W;  3PVQ A;  1GFD A;  3HKS A;  1I4K 1;  2R58 A;  3VV0 A;  3CME T;  3SDZ A;  4ESR A;  1VQ6 Q;  2IPO B;  5DM7 R;  5CQX A;  3H6Z A;  1RI9 A;  5CKH A;  1KHI A;  5GAO q;  3G7Z A;  2QAS A;  3I56 Q;  3CPW S;  1MV3 A;  2ECZ A;  1TSF A;  2YLB A;  1YBY A;  1M1G A;  2O88 A;  1OU8 A;  2GQV A;  2MPX C;  1VQM A;  2DTI A;  2CYZ B;  2V1Q A;  1RAC B;  2EGE A;  5FU6 C;  1VQL T;  1HYO A;  1NYF A;  1VQO Q;  2KGT A;  3VUZ A;  3SFM A;  1X6B A;  4J6W A;  3TVT A;  4J9E A;  3LLR A;  1ZX6 A;  2MWO A;  4FYW B;  1Z9Z A;  3NTK A;  4KRT A;  4RTV A;  2QK0 A;  4UC4 A;  2BTT A;  2E5Q A;  2FZG B;  2XKO C;  2KRN A;  4M78 B;  3JSC A;  2K2M A;  2PVD B;  2IG0 A;  1VOM A;  3OYF A;  4BAC A;  2RO0 A;  3OY9 A;  3G6E A;  3NTI A;  2BZX A;  2CS7 A;  3HFN A;  3QJY A;  1ZSZ B;  1RAI B;  3ZFJ A;  2ED0 A;  2CP0 A;  2EQM A;  4JRQ A;  2AKL A;  2LX7 A;  2RQT A;  4E2F B;  3CCR Q;  3C94 A;  3OS2 A;  4O5V A;  2RJE A;  2MYS A;  2V8K A;  4CC3 A;  1N5Z A;  2DIQ A;  4J7I A;  1AWJ A;  5IHK A;  1YJN A;  4D8K A;  2DM1 A;  1DJ7 B;  1V1C A;  1X75 C;  1D1A A;  3J7A F;  2NYS A;  3CC4 Q;  3EG9 B;  2KRS A;  4C92 D;  3M9Q A;  1NJI U;  2FZK B;  4IUR A;  1V29 B;  3CC2 T;  1FWZ A;  2DD5 A;  4F16 A;  1LCK A;  2E10 A;  3CC7 T;  1IZ6 A;  2CGH A;  3VS1 A;  3VU3 C;  2EYX A;  2HQE A;  3CCR T;  5CQY A;  1K8A C;  3UDC A;  2RQV A;  5GAO m;  2X9H A;  1E7O A;  2JW4 A;  2LJ1 A;  1R0C B;  2Y4Y A;  2XIC A;  4N4H A;  3BFM A;  3C95 A;  2W0Z A;  3CCL T;  1K73 U;  1WJS A;  5LJ5 f;  1U1S A;  1YJN T;  2GQI A;  1PC0 A;  3QYH B;  4HXJ A;  2G3R A;  2QA4 Q;  2FO0 A;  4FCY A;  2EJF A;  3HRS A;  2XK0 A;  5KYY A;  1VQ6 A;  1K0X A;  4OF1 A;  2RN8 A;  2DXB A;  2EJ9 A;  2DET A;  2C0O A;  3HFO A;  4M77 B;  1N9R A;  1CKB A;  2BE7 D;  1Y96 B;  2LQK A;  2O31 A;  4HCK A;  3CXC S;  3DLL A;  4J7F A;  1Y96 A;  3JAM E;  1YI2 T;  1T3S A;  6AT1 B;  5HK3 A;  3RNJ A;  1B3Q A;  3X20 B;  2CT4 A;  2YRC A;  3CCL A;  1M5Q 1;  2COZ A;  5GAN 2;  4B9W A;  4AFQ C;  2E6N A;  2JTF A;  4F04 B;  1VQ6 T;  4LD9 K;  4ANJ A;  1VQ8 T;  3OW2 P;  5A2Q E;  3BY7 A;  4LXC A;  1FXX A;  5J39 A;  2L89 A;  2B8A A;  3M57 A;  3UWN A;  2B86 A;  2J6K A;  2QTX A;  2V8I A;  2F5K A;  2JMA A;  1KQS S;  1KHC A;  2VXF A;  1VQN T;  3WVE B;  2LCC A;  1IGQ A;  2LNV A;  3HRT A;  3NFC A;  4JJN K;  4CRI A;  3EG2 A;  5KE2 A;  3CCU T;  2XG8 D;  4C0D C;  2HMA A;  2EYZ A;  1SF9 A;  1AHJ B;  1VIE A;  4JZ4 A;  3JCM d;  2VYT A;  4F7U B;  1Q82 U;  3QZ9 B;  5GAO n;  2DD4 A;  3E9F A;  1VQ7 A;  5I2S A;  2D8J A;  3EH1 A;  2CH4 W;  2O9V A;  3JB9 F;  2QQR A;  2X3W D;  2XMF A;  2CP6 A;  1IHW A;  2JS2 A;  1M8V A;  1UGS B;  5IHI A;  3L2W A;  1KQS A;  1VQ9 A;  5IAY A;  4PFO A;  2EFI A;  4K11 A;  1K4U S;  3IQL A;  5HY6 A;  4ZTF A;  4J83 A;  1ZBX A;  2YSQ A;  3CC4 A;  4AFZ C;  2DRM A;  3C0C A;  4E47 A;  2JN0 A;  2RHX A;  4XAX B;  4Z88 A;  1KD1 C;  3JCM f;  3X28 B;  1VQK A;  2A7Y A;  3FIF A;  4JUV A;  1YWP A;  2RHI A;  5GAN d;  3R6N A;  4C92 E;  4C8Q F;  1KQ2 A;  3CCJ T;  2QQ9 A;  3J81 E;  1OV3 A;  4LDX A;  1TOV A;  1D1C A;  2KXD A;  1ZA1 B;  1XQH A;  3PVL A;  1YCS B;  1NLP C;  5EG2 A;  4A63 B;  5GAN 4;  3RER A;  1GCP A;  1TUD A;  3OS1 A;  2MAM A;  4NL3 A;  1OPL A;  1KD1 U;  4E7H A;  2M9U A;  3JB9 I;  1VQP Q;  2F2X A;  3JCM c;  1BU1 A;  3TSZ A;  4BE2 A;  1NPP A;  2RK1 A;  2DMO A;  2HCK A;  4ZNX A;  3E2U A;  2QDY B;  4B9X A;  1BI1 A;  1D3B A;  1M30 A;  1VQK T;  2J6F A;  4M75 B;  2X35 A;  1EFN A;  2PVO B;  1S72 Q;  2X4J A;  4E7S A;  4PJO A;  3PT9 A;  2E65 A;  1SSF A;  5FWC A;  2NUT B;  2A37 A;  2HQX A;  3EHR A;  3JCM P;  2KEA A;  3A8L B;  3LGL A;  3MCA B;  3RMS A;  1QVG A;  2A0F B;  3FDR A;  1ZBJ A;  1QQJ A;  2E1H A;  2HL3 A;  2RHZ A;  1JXO A;  1Q82 R;  1M90 R;  1RAG B;  1VQM Q;  4OML A;  2L8D A;  1ZUK A;  2K5F A;  2YWW A;  3EFS A;  1SHF A;  1T0H A;  5GAM g;  3NMZ C;  2HSE B;  4C0Z A;  3VYH B;  2DAQ A;  3QXE B;  2OI3 A;  2PZ1 A;  2FL7 A;  1UG1 A;  4DOW A;  3I5S A;  5GAM h;  4ATO A;  3M0P A;  4D6W A;  4IUQ A;  2BE9 B;  3FJP A;  2JTE A;  1BIA A;  2NUP A;  4ELY C;  2ZPE B;  5CCA A;  3G1J A;  4EPC A;  3JB9 J;  2LMJ A;  3V7R A;  1NYG A;  1ZUY A;  2OTL T;  1K9A A;  3GLX A;  4QVD A;  2KDS A;  2WAC A;  3P8B B;  3EH2 A;  4N4G A;  3OYY A;  3CCS A;  2CUD A;  2RHY A;  5I22 A;  2HKN A;  4R56 A;  4PJO G;  4C8Q B;  1WQW A;  5GAO l;  2K3Y A;  1QMC A;  3QPH A;  1QVF P;  1I8F A;  1VYV A;  5A0G A;  5LJ3 d;  1YJN Q;  2KE9 A;  3OYB A;  1IB8 A;  2O4X A;  3OYM A;  4JRK A;  3M0U A;  2L5Q A;  2E12 A;  3VS6 A;  4FSS A;  1KG1 A;  1BBZ A;  1M90 C;  1Q86 U;  1D09 B;  2A08 A;  2D0Q B;  3CPW P;  4LNP A;  2EQI A;  4HCZ A;  5FRM A;  3AT1 B;  5KCO A;  1AZE A;  2XHC A;  4NS5 A;  1QCF A;  4AFU C;  3JCM Q;  3M53 A;  2DBK A;  1PD0 A;  1QVG P;  4DOV A;  2LCL A;  1M1F A;  5C6S A;  1PWT A;  3URG A;  4LDU A;  3ER0 A;  2Y4X A;  2C06 A;  3QII A;  5LJ3 h;  3VRZ A;  4L59 A;  1RUW A;  2EWN A;  4EIK A;  1JRI A;  4YTL A;  2AK5 A;  2GTJ A;  1K73 C;  3CC2 A;  3CBM A;  2HEQ A;  1RAA B;  1PD1 A;  4C92 G;  4PJM A;  2FHD A;  1Q82 C;  5GJW B;  2C0T A;  1N6A A;  3CCQ A;  4OGE A;  1MMN A;  1Z9Q A;  4NL2 A;  4FSX A;  3MEW A;  2RI5 A;  1C0M A;  2RI3 A;  3A5Z B;  3OYI A;  2DFU A;  3L2Z A;  1Q95 G;  2QDL A;  2RQU A;  2RHU A;  5GMK j;  4XTV A;  1JO8 A;  4QVZ A;  1SRM A;  2D8H A;  1ZA2 B;  3M58 A;  4M7D E;  1M4Z A;  1QWE A;  2YUO A;  3JB9 D;  1AWW A;  3T9N A;  4C5I A;  1I0C A;  5KCH A;  4HVW A;  2LVM A;  2DL7 A;  1VA7 A;  3UAT A;  5GAN e;  3E9G A;  1BI2 A;  1WXT A;  4M77 D;  3H0H A;  5GAN 6;  4KGZ B;  3SWN C;  4OB1 B;  1VUB A;  5KH6 A;  3ASK A;  3NGP A;  3CQT A;  2VB6 A;  3S6W A;  5D6X A;  3CBP A;  4FT4 A;  1WGS A;  1I81 A;  3I56 A;  4BY6 C;  3PFS A;  3CCQ T;  4QKU A;  4DBQ A;  1KJW A;  1YI2 A;  2CZ7 B;  1YJ9 T;  2QTV A;  3HPW A;  4DBH A;  2M02 A;  3EGX A;  1G2B A;  1QKW A;  4EMK B;  1QCN A;  4E7L A;  1G8X A;  3M55 A;  4PNO A;  2EQJ A;  1VIF A;  2L3S A;  4FIB A;  3MHX A;  2KAF A;  4M78 G;  4C92 A;  4X9C A;  1ZQ1 A;  3KXT A;  4WTO B;  4DA4 A;  1G3Y A;  4Z8A A;  5GMK i;  3C4S A;  2ZAE A;  5GMK h;  2HDA A;  1ABQ A;  5LJ5 e;  5FLX E;  5KYY B;  2X4X A;  1JJ2 P;  3EG0 A;  4RTY A;  3CCR A;  4ELZ C;  3EFO A;  3I56 T;  3CCS Q;  2QQS A;  3SWN B;  2OX7 A;  2CSQ A;  4ZN3 A;  1VQN A;  1KFZ A;  1KQ1 A;  2QI2 A;  1M3C A;  4R0K A;  5LJ3 e;  4RKU E;  2MCN A;  1YIJ A;  5J26 A;  2JJ9 A;  3D7S B;  1VQN Q;  2KSS A;  1E6G A;  2DYI A;  4XU0 A;  4QQG A;  2ZZD A;  2EQK A;  1RL2 A;  2QGG A;  2LP5 A;  3C12 A;  1WXB A;  3EFR A;  1WHK A;  4QQD A;  4A54 A;  4QT7 A;  1OEB A;  1PSE A;  2K9G A;  5LJ5 j;  5GMK e;  1VQ4 T;  4RTX A;  2CSI A;  3V8K A;  4M7D F;  2RA2 A;  2VV5 A;  4M78 D;  2FYK A;  1AWO A;  4IIO A;  4M75 C;  3SEM A;  2AIR B;  5CK9 A;  5LL6 S;  3OW2 S;  1OOT A;  3SB2 A;  3MKD A;  2M1H A;  2P0Q A;  2KMT A;  3Q1J A;  4M7D G;  2VUB A;  2EGA A;  3CC4 T;  4KGV B;  3QWX X;  5AYF A;  3RMQ A;  2QA4 A;  4D8D A;  2QQA A;  1YIJ T;  1GRI A;  4RTW A;  2RJC A;  1ZHI A;  1D3B B;  3PTA A;  2MWP A;  4CC4 B;  2EGC A;  4CI0 C;  2LX9 A;  3HTR A;  3DB4 A;  4OB3 B;  3OSV A;  4LE9 A;  1B34 B;  4J9G A;  3PNW C;  1PKT A;  2ZPI B;  2KQW A;  1NM7 A;  1U5S A;  2AKK A;  1ARK A;  1SG5 A;  2QXF A;  3A8G B;  2JM8 A;  4Q5W A;  1KC8 U;  4BY6 B;  8AT1 B;  3MO8 A;  1X27 A;  1HXD A;  1MV0 B;  1R77 A;  1RAF B;  1VQO T;  2PVG B;  4PJJ A;  5M9O A;  1IGU A;  5DLO A;  3CCM Q;  1WIE A;  2EQU A;  3THK A;  2MI6 A;  1Y0M A;  4J9C A;  3H41 A;  4JJC A;  4XQ3 A;  3CD6 Q;  2DJZ A;  2RM4 A;  2KRO A;  1KQS P;  2KT8 A;  4C8Q C;  4IKF A;  2E4H A;  3MP6 A;  4JPB W;  1VQ7 T;  3JCM h;  2CRE A;  1M2V B;  1K0S A;  1MHN A;  2LCS A;  3M4G A;  3LX7 A;  4BB7 A;  2GF7 A;  3JB9 G;  1K8A R;  3CMA Q;  3M0T A;  2VGN A;  1JB0 E;  2JUF A;  3P8D A;  4AG2 C;  4RTZ A;  1Y7X A;  1LOJ A;  4HT9 A;  4HCC A;  4BI4 A;  4HVV A;  3MET A;  4BE0 A;  3GNF B;  2VWF A;  3CXC A;  1H64 1;  4F7U A;  1W4S A;  4J8O A;  2HSP A;  1FYN A;  1UGR B;  1JBM A;  4RMO A;  1VQ7 Q;  3LYI A;  4L5G A;  3RKX A;  3RES A;  1OQK A;  2NUT A;  2M0O A;  1VQ4 Q;  1WHM A;  3VUB A;  1UGP B;  4JLG A;  4CC7 A;  3G4S T;  5AT1 B;  3DB3 A;  4PJO B;  4BE1 A;  4L6V 5;  1UHF A;  2OTJ A;  3CCJ A;  2F2W A;  4M77 F;  1YIT T;  3X24 B;  3DLM A;  2QQB A;  2XDP A;  4FYV B;  2ZGW A;  3E19 A;  4OMN A;  2I2L A;  4JRI A;  2FPD A;  2LDM A;  2JNG A;  4LDY A;  2QEX T;  4LUD A;  4M7A C;  5I2M A;  1RLQ C;  1QVF A;  1ZSG A;  3GIB A;  1IRE B;  1TG0 A;  2DVE A;  2H3J A;  1KC8 R;  3L42 A;  1Q7Y C;  2VKN A;  3QBY A;  1FMK A;  2H3E B;  1NLO C;  3OYN A;  2QAZ A;  1M9S A;  5CO7 A;  1VQ5 T;  2DIG A;  2MIO A;  1Q7Y U;  2EKO A;  1I1J A;  2OTJ T;  1MUZ A;  3X25 B;  2WSF E;  4QW2 A;  3H0I A;  3CCJ Q;  5LJ5 d;  3TQ7 P;  3H9N A;  1PSF A;  3G71 Q;  3I55 T;  1K76 A;  3TU4 K;  1LVK A;  4A4F A;  1NEB A;  4KH1 B;  2JXB A;  3CCQ Q;  3QSU A;  1VYU A;  2RJD A;  4EMK C;  4KBM B;  1M90 U;  4BI3 A;  2LZ6 B;  2L0A A;  4MDW A;  4HT8 A;  5KYW B;  2YUN A;  1D0Y A;  4M75 A;  4NOY A;  4PJO D;  1I07 A;  4C0G A;  2E64 A;  3TRE A;  1M3A A;  1EZZ B;  1FMV A;  3TCJ A;  4XK8 E;  1G5V A;  3QJ6 A;  3PE0 A;  4M75 G;  1JXM A;  1K9M U;  4WF2 A;  2E70 A;  4MZM A;  2EBP A;  4HA8 A;  3CBO A;  2A3L A;  2YUP A;  3G6E Q;  4ZTJ A;  1B7T A;  5GAN j;  1WQ7 A;  2JT4 A;  4RUG A;  3LH0 A;  1Q86 R;  4J6X A;  3CCS T;  1JJ2 A;  1PCX A;  1Q81 U;  4VUB A;  4MZP A;  4DEY A;  4LDW A;  3F70 A;  2SEM A;  2KR3 A;  3JCM b;  2RB6 A;  3VS3 A;  4X1V A;  2WSE E;  2DL5 A;  2LJ3 A;  3EG3 A;  1O75 A;  2JS0 A;  4PLI A;  1YN8 A;  5GMK l;  1CKA A;  4C92 B;  1ZSZ A;  2L2P A;  1UFF A;  4FL6 A;  4ZGD B;  3CC7 A;  2JM9 A;  4N0A C;  3LW5 E;  1VQM T;  1QW1 A;  2EIF A;  3BW1 A;  3V8J A;  5HK0 A;  1GXI E;  2F69 A;  2EJG A;  3EHQ A;  2E5K A;  3M59 A;  1N8R R;  1KIK A;  2K57 A;  2D6F A;  5A0L A;  3LWH A;  1SEM A;  2YHT A;  1N8R C;  2CKK A;  1YJW T;  1K8A U;  1TH7 A;  5GAN 3;  3FRN A;  2AZS A; 
#chains in the Genus database with same CATH homology
 3QWY A;  1SRM A;  1X6G A;  4CC3 A;  2D8H A;  1N5Z A;  2DRK A;  2ROT A;  1SSH A;  1WXU A;  1AWJ A;  1QWE A;  2RQW A;  4D8K A;  2YUO A;  5IHK A;  1AWW A;  2DM1 A;  1V1C A;  1I0C A;  5IXB A;  4HVW A;  2DL7 A;  2KRS A;  1VA7 A;  3UAT A;  2DLP A;  1TUC A;  1WXT A;  3H0H A;  2FG0 A;  2LNH B;  1KSW A;  3M0S A;  4F16 A;  3SHW A;  1JU5 C;  1LCK A;  3NGP A;  3CQT A;  3VS1 A;  1B07 A;  2EYX A;  2EW3 A;  2J05 A;  1BK2 A;  1WFW A;  2RQV A;  2PNI A;  2FEI A;  2CT3 A;  2KBT A;  3I35 A;  2GTO A;  1A0N B;  1ZUU A;  2DYB A;  1NG2 A;  1E7O A;  1KJW A;  2JW4 A;  1SRL A;  1UEC A;  2LJ1 A;  4AFS C;  3VS0 A;  2O9S A;  1YWO A;  2MOX A;  1G2B A;  1QKW A;  2KRM A;  1WLP B;  2K6D A;  2W0Z A;  2L3S A;  2GQI A;  2IIM A;  1ZLM A;  4HXJ A;  3JV3 A;  2FO0 A;  4OMP A;  2NUZ A;  1K0X A;  1X2K A;  1UJ0 A;  4Z8A A;  2RN8 A;  2LQW A;  2C0O A;  2HDA A;  2HBW A;  4J9D A;  1ABQ A;  1CKB A;  3EG0 A;  4RTY A;  2O31 A;  4HCK A;  4J9B A;  4DEX A;  1HSQ A;  3VS2 A;  2J06 A;  2DL3 A;  2RPN A;  1T3S A;  2CSQ A;  4J9H A;  1GBR A;  1KFZ A;  1T3L A;  3RNJ A;  1B3Q A;  4J9I A;  3UA6 A;  3VS4 A;  1M3C A;  4R0K A;  3VRY A;  1G83 A;  2MCN A;  2CT4 A;  1HD3 A;  1AZG B;  2CUB A;  3REB B;  3TSW A;  1E6G A;  5IXF A;  1YNZ A;  4AFQ C;  2GNC A;  2DJQ A;  1GCQ C;  2P4R A;  2LP5 A;  3ULR B;  1WXB A;  3VS5 A;  2FRY A;  4QT7 A;  2EVR A;  1OEB A;  4WCI A;  3LH5 A;  2K9G A;  5IH2 A;  2KYB A;  4RTX A;  3UA7 A;  1QKX A;  2CSI A;  1H8K A;  2GGR A;  4F17 A;  1AOJ A;  1UHC A;  1AWO A;  4IIO A;  3SEM A;  1S1N A;  1H3H A;  1M3B A;  2KYM A;  1OOT A;  2B86 A;  2J6K A;  2JMA A;  2M51 A;  1UUE A;  2A36 A;  1PNJ A;  2EGA A;  1AVZ C;  1K1Z A;  3EG2 A;  3H0F A;  3QWX X;  2DA9 A;  2O2O A;  2EYZ A;  1AD5 A;  4D8D A;  1WI7 A;  1U3O A;  1GRI A;  4RTW A;  4JZ4 A;  2F2V A;  3M0Q A;  4RTT A;  3FJ5 A;  2EGC A;  4CC4 B;  2AZV A;  4LE9 A;  1PKS A;  4J9G A;  4AG1 C;  2BZY A;  1PKT A;  1T0J A;  2D8J A;  1NM7 A;  2CH4 W;  2O9V A;  3M0R A;  1BB9 A;  2CDT A;  1U5S A;  1SHG A;  2AKK A;  2FPF A;  1ARK A;  2DNU A;  3UF4 A;  2X3W D;  2XMF A;  3NHN A;  2JS2 A;  2JM8 A;  1W70 A;  2LQN A;  1X2Q A;  2X3X D;  5GJV B;  5IHI A;  2ENM A;  1X27 A;  1MV0 B;  4K11 A;  1K4U S;  3IQL A;  2PTK A;  2G6F X;  2YSQ A;  1WIE A;  1SPK A;  1IO6 A;  3THK A;  4AFZ C;  2DRM A;  3C0C A;  2K3B A;  4LUE A;  1Y0M A;  2RQR A;  4Z88 A;  4J9C A;  4GBQ A;  3H41 A;  1H92 A;  2K79 A;  4JJC A;  1NEG A;  2SRC A;  1YWP A;  2EYY A;  5ECA A;  1QWF A;  2LJ0 A;  2YT6 A;  2KRO A;  2KT8 A;  3R6N A;  4JPB W;  4JJD A;  3I9Q A;  2CRE A;  1K0S A;  1WA7 A;  4HVU A;  2LCS A;  3EGU A;  1OV3 A;  4IIM A;  2EKH A;  2KXD A;  3PVL A;  2OJ2 A;  1YCS B;  1X69 A;  1E6H A;  1NLP C;  2ESW A;  4A63 B;  1GCP A;  1TUD A;  3M0T A;  3ZL7 C;  4J9F A;  1RLP C;  1OPL A;  1PRL C;  4AG2 C;  4RTZ A;  1M8M A;  1UJY A;  2L3P A;  1X43 A;  2F2X A;  2DF6 A;  1BU1 A;  4HVV A;  3TSZ A;  4JJB A;  2EPD A;  2DMO A;  2HCK A;  2VWF A;  1J3T A;  4ZNX A;  2FRW A;  1AEY A;  1YP5 A;  2HSP A;  1M30 A;  1FYN A;  1VYT A;  2J6F A;  1EFN A;  4CC2 A;  2D1X A;  4OMQ A;  1UTI A;  5FWC A;  2KT1 A;  4CC7 A;  1WDX A;  2A37 A;  3U23 A;  1UHF A;  3EHR A;  2KEA A;  5IHN A;  1UGV A;  2F2W A;  1GFC A;  1ABO A;  2H8H A;  1JEG A;  1ZBJ A;  5FWB A;  2EYW A;  1U06 A;  1GBQ A;  1JXO A;  1GCQ A;  4OMN A;  2KNB B;  4OML A;  1ZUK A;  5HCK A;  2FPD A;  1SHF A;  1T0H A;  1UDL A;  2DL4 A;  3REA B;  3NMZ C;  4LUD A;  4LN2 A;  3NPF A;  1PHT A;  1JQQ A;  1RLQ C;  2YUQ A;  1ZSG A;  2V1R A;  1TG0 A;  2OI3 A;  2VKN A;  2RNA A;  3O5Z A;  2PZ1 A;  2BZ8 A;  1FMK A;  1UG1 A;  2RF0 A;  1NLO C;  3I5S A;  2YDL A;  2DE0 X;  3M0P A;  2OAW A;  3A98 A;  4GLM A;  2JTE A;  2J7I A;  2MIO A;  1WYX A;  1I1J A;  5I11 A;  2LMJ A;  1MUZ A;  1NYG A;  1ZUY A;  4E6R A;  2GBQ A;  1K9A A;  3H0I A;  3KFV A;  2JMC A;  2FPE A;  1XOV A;  2J6O A;  2C0I A;  2NWM A;  1K76 A;  2K7A A;  5L23 A;  1NEB A;  2JXB A;  2CUD A;  2D0N A;  5I22 A;  1VYU A;  2ROL A;  2I0N A;  2A28 A;  2W10 A;  3I5R A;  2M0Y A;  2LZ6 B;  3RBB B;  2L0A A;  1UE9 A;  2YUN A;  4M4Z A;  1VYV A;  1W1F A;  2DX1 A;  2RMO A;  1I07 A;  4OMM A;  4Z89 A;  2DVJ A;  1Y57 A;  3PVQ A;  1GFD A;  2KE9 A;  1M3A A;  2DL8 A;  2ED1 A;  4ESR A;  3PE0 A;  3M0U A;  3VS7 A;  1JXM A;  1HJD A;  3VS6 A;  4FSS A;  1RI9 A;  5FW9 A;  1M27 C;  1BBZ A;  1MV3 A;  2ECZ A;  2EBP A;  2YUP A;  2O88 A;  2A08 A;  2L3Q A;  1AWX A;  2ABL A;  2JT4 A;  2V1Q A;  4RUG A;  2EGE A;  4LNP A;  2EQI A;  1WX6 A;  1NYF A;  4Y92 A;  1AZE A;  2KGT A;  1QCF A;  4AFU C;  1CSK A;  2DBK A;  1X6B A;  3EG1 A;  4DEY A;  3TVT A;  4J9E A;  1GL5 A;  1ZX6 A;  2VVK A;  1Z9Z A;  2SEM A;  2KR3 A;  4KRT A;  1PWT A;  4RTV A;  3VS3 A;  4X1V A;  2DL5 A;  2KXC A;  2BTT A;  2LJ3 A;  4OMO A;  2KRN A;  3EG3 A;  3VRZ A;  1RUW A;  4JZ3 A;  4EIK A;  2AK5 A;  2JS0 A;  1YN8 A;  2K2M A;  2GTJ A;  1CKA A;  2L2P A;  2DBM A;  2HEQ A;  1UFF A;  2BZX A;  4F14 A;  4RTU A;  2JM9 A;  3GBQ A;  5GJW B;  2CH4 A;  2C0T A;  1QLY A;  5EC7 A;  3EHQ A;  2E5K A;  1PRM C;  1KIK A;  1Z9Q A;  2ED0 A;  2DIL A;  2AKL A;  1SEM A;  1W6X A;  4ORZ A;  2LX7 A;  2RQT A;  2QDL A;  2RQU A;  1OPK A;  2AZS A;  1JO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...