4E6RA

Crystal structure of a cytoplasmic protein nck2 (nck2) from homo sapiens at 2.20 a resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
57
structure length
54
Chain Sequence
b'IPAFVFAYVAEREDELSLVGSRVTVMECSDGWWRGSYNGQIGWFPSNYVLEEVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytoplasmic protein NCK2
publication title Crystal structure of a Cytoplasmic protein NCK2 (NCK2) from Homo sapiens at 2.20 A resolution
rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 9
structure length 54
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4e6rA00
1WA7A 4F16A 4QT7A 1K0SA 4AFZC 2VVKA 2XMFA 1H92A 3R6NA 1Y57A 2DX1A 3M0PA 2F2VA 3ZL7C 4LUEA 1VYTA 1XOVA 3VS6A 4E6RA 2DL5A 1X6BA 3RBBB 2AK5A 1AVZC 1VYUA 2A28A 4ESRA 2SEMA 2LX7A 2W0ZA 1M3AA 1HD3A 2HBWA 2L2PA 4RTZA 1ARKA 2GQIA 1WX6A 2D1XA 1KJWA 1V1CA 2O9SA 1B07A 3I9QA 2EYWA 2LQNA 2YDLA 1Y0MA 2DA9A 1WXBA 3VS3A 4AFSC 1PKTA 4IIMA 3QWXX 3LH5A 2CT4A 5IHIA 1EFNA 2CUDA 3VRYA 1ABQA 1PHTA 2LZ6B 1SRLA 1NYFA 2RPNA 2L3PA 1GCQC 1RUWA 1BU1A 2RF0A 5EC7A 4Z89A 3UF4A 4AFQC 3NPFA 2C0IA 2EGAA 1X6GA 2HEQA 2M51A 3VS0A 1GBRA 4J9FA 4EIKA 2DL3A 2X3XD 5IHKA 1W6XA 2KE9A 5GJVB 3VS4A 2CT3A 1WIEA 2L0AA 2W10A 2DLPA 4D8DA 1E6GA 2A37A 1JU5C 1QWFA 2ABLA 5IXBA 4LN2A 1KIKA 1JXOA 1WDXA 2EGCA 2FPEA 2C0TA 1YWPA 3EHRA 1A0NB 1N5ZA 1WI7A 1HJDA 4JZ3A 3QWYA 2QDLA 1YN8A 4OMOA 2JMCA 1OOTA 2JM9A 2KBTA 3REBB 2MIOA 4LE9A 1X43A 1AWOA 1T3LA 3RNJA 1GFCA 2KT1A 3M0SA 2OI3A 2LJ0A 2DVJA 2JW4A 2IIMA 2LP5A 3H0HA 1ZX6A 3I35A 2RQWA 1NYGA 1UG1A 2PTKA 1GCPA 2JXBA 1YWOA 1M3CA 1I0CA 2EVRA 3EG3A 4IIOA 4J9BA 2EGEA 4LNPA 1WLPB 2H8HA 1J3TA 4R0KA 2YUQA 2AKLA 2DMOA 4HVVA 3FJ5A 4OMPA 5FWBA 1TUCA 3JV3A 1GBQA 2KR3A 2E5KA 1NLOC 1Z9QA 4ORZA 2FG0A 3EG0A 2ROLA 2FPDA 2FRWA 2ESWA 4RTTA 1TG0A 1X27A 3NMZC 2KRMA 2FPFA 3PE0A 1UGVA 2KXDA 4Y92A 4J9DA 3H41A 1U06A 2KEAA 1IO6A 1I07A 1GRIA 2RQRA 4DEYA 4JJDA 4J9IA 4HVWA 4K11A 2CSIA 2O88A 2ED1A 1PKSA 3O5ZA 3IQLA 3H0IA 1AWWA 3TSZA 1BK2A 1T0JA 2K7AA 1W70A 4DEXA 2KGTA 3EG1A 3C0CA 1UJYA 4HCKA 2FRYA 2K2MA 1UE9A 2KT8A 2LQWA 1K4US 2NUZA 2GTOA 1OPKA 1M30A 1ZLMA 1QWEA 2RQVA 1FMKA 2EYYA 3M0RA 1B3QA 1ZSGA 2RQUA 2G6FX 1AZGB 2ED0A 2L3SA 2JTEA 2BTTA 2DJQA 5GJWB 2ENMA 2LJ3A 1ABOA 1NG2A 1CKBA 1NLPC 3VS1A 2FEIA 1SPKA 2EBPA 1JQQA 2BZYA 1ZUYA 2F2XA 1CSKA 2YT6A 1E6HA 1AWJA 2CH4A 2PZ1A 2V1RA 2HSPA 3EGUA 4ZNXA 4CC2A 1OEBA 1M8MA 2VWFA 2NWMA 1I1JA 2LCSA 5HCKA 2RQTA 3UATA 1LCKA 1WFWA 2KNBB 4M4ZA 3THKA 2YUOA 2KRSA 1G2BA 1RI9A 1K76A 1MV3A 1VA7A 2J05A 1QLYA 2MCNA 1KFZA 2DRKA 4RTXA 2YSQA 4AG1C 2BZXA 2GGRA 1NM7A 3NGPA 1U5SA 2O31A 1S1NA 2C0OA 2O2OA 1SSHA 1UFFA 4OMLA 1T0HA 2D8JA 3UA7A 3M0QA 1U3OA 2A36A 1GFDA 2JM8A 1ZUKA 5I11A 4RTUA 5IHNA 2KXCA 3M0TA 2J6KA 4RTVA 3CQTA 2L3QA 4JZ4A 4CC4B 1E7OA 2FO0A 2RN8A 2RMOA 2AKKA 2DRMA 2VKNA 1PRLC 3SEMA 2JS0A 2GNCA 1QKWA 2HCKA 2LNHB 2AZVA 1W1FA 1K9AA 1YNZA 3TVTA 4GBQA 4CC7A 1UECA 4GLMA 4FSSA 2DNUA 1K1ZA 2F2WA 2HDAA 4AG2C 1WYXA 1Z9ZA 1GCQA 2DL7A 2V1QA 4F17A 1OV3A 2DL8A 2J7IA 2O9VA 1UUEA 2DBKA 1FYNA 1UJ0A 3ULRB 2LMJA 4J9GA 2KYMA 3UA6A 1AZEA 1PRMC 2YUPA 3SHWA 3VRZA 2J6OA 1K0XA 5IH2A 4OMMA 3EHQA 4J9CA 1YCSB 4OMQA 2GTJA 2BZ8A 1SRMA 2DYBA 4HVUA 4JJCA 1BBZA 4OMNA 1ZBJA 4Z8AA 2OAWA 1AD5A 1QKXA 2KROA 3VS5A 4CC3A 2SRCA 1H3HA 1SHGA 2GBQA 1AEYA 2B86A 1KSWA 5ECAA 4Z88A 1AWXA 1RLQC 2A08A 2KYBA 3TSWA 1BB9A 2ROTA 2AZSA 4WCIA 4X1VA 2EYZA 1WXUA 1AOJA 2CREA 2OJ2A 2X3WD 3VS2A 1NEBA 2ECZA 2EKHA 1UHCA 3NHNA 5FWCA 1JEGA 2D8HA 3I5RA 2M0YA 1X69A 4JJBA 2J6FA 1MV0B 2MOXA 2CUBA 3I5SA 2DL4A 1T3SA 1M27C 4AFUC 4KRTA 2I0NA 1JXMA 4D8KA 1SHFA 2DE0X 2K3BA 4A63B 1CKAA 2DILA 4J9HA 2K9GA 1GL5A 2P4RA 4JPBW 5IXFA 4RTWA 2DBMA 4J9EA 1H8KA 2KRNA 4F14A 1UTIA 3KFVA 2YUNA 1X2QA 2EQIA 3M0UA 1PNJA 2JMAA 2DF6A 1G83A 3VS7A 2JS2A 2DM1A 1JO8A 2CSQA 3H0FA 3U23A 1OPLA 1PWTA 3A98A 2K79A 2K6DA 5FW9A 2CH4W 3PVLA 4LUDA 1UDLA 2PNIA 1QCFA 3EG2A 1SEMA 3PVQA 2D0NA 1WXTA 3GBQA 2EPDA 1VYVA 3REAB 4RUGA 2RNAA 4HXJA 1UHFA 2EYXA 1RLPC 2JT4A 1ZUUA 1NEGA 1HSQA 5I22A 1MUZA 2EW3A 1TUDA 5L23A 1X2KA 2LJ1A 1M3BA 4RTYA 2CDTA 2J06A 1YP5A
chains in the Genus database with same CATH superfamily
4QT7A 1K0SA 1PD0A 1BI3A 5D6XA 4IUUA 2L3RA 1H92A 2V26A 2QXFA 2DX1A 5LJ5e 3CD6A 3A8GB 3M0PA 5GAN8 2D9TA 2KI7A 2YHTA 1AVZC 1VYUA 4ESRA 1VQ5A 1HD3A 2L2PA 1ARKA 1JBMA 1VQ7T 1AT1B 1IGUA 3I9QA 4J7IA 1U8RA 2QTVA 1Y0MA 4C0DC 4JRKA 3J81E 4IIMA 3QWXX 3QHSA 2DD5A 4XTXA 5IHIA 4C92G 3CMEQ 1VQMQ 1EFNA 2DD4A 2LZ6B 1SRLA 1NYFA 2RPNA 3J80E 4BB7A 3L42A 3CC4T 2RF0A 4XU1A 1U1TA 3L2UA 3CBPA 2M51A 1X6GA 3VS0A 4XTYA 1NJIR 3WVDB 4VUBA 4RMOA 1I5OB 2EQMA 4PFZA 2ZPBB 5CKBA 5KE2A 5GJVB 3VS4A 3KXTA 2CT3A 1WIEA 1YCYA 2L0AA 3QZ9B 3MKDA 3R6OA 5GAOp 4PJOA 1RADB 1QWFA 4OP0A 5IXBA 1PC0A 1M9SA 3FIFA 1JXOA 3M57A 3EHRA 3EGDB 3S3OA 4JS5A 1K73R 3X25B 3A8OB 1BCOA 4M77A 1WI7A 1HJDA 3QWYA 2QDLA 1VQNT 1YN8A 4KBMB 3JCMe 2Y90A 3CD6Q 1Q82R 1PSFA 3OYDA 3PGGA 4XTWA 2EQKA 3CC2Q 3H0HA 2LP5A 4IURA 3CC7A 1VQ5Q 3I35A 4A4FA 2PTKA 1Y96B 4IUPA 1YWOA 3QZ5B 1YI2A 4J9BA 4R0KA 2YUQA 2KY9A 2E10A 5FWBA 1D1CA 2KR3A 3G71T 4N4HA 2DPPB 4N0AA 2QQ9A 4ORZA 4MZMA 1IREB 4KGVB 2QQRA 2RHXA 3JCMP 1QVPA 1D0ZA 4LXCA 1JJ2A 4F7UB 4JUVA 2FPFA 3PE0A 4Y92A 2LX9A 1MMGA 2RHYA 3H41A 2RHIA 4HCZA 1OZ2A 1U06A 2E6ZA 3LW5E 5KCOA 2DIGA 4JJDA 4J9IA 2FZCB 4K11A 2BKDN 4F7UF 3OYLA 1PKSA 5DLOA 1TH7A 1YJNQ 3H0IA 2CZ0B 1BK2A 3G6EQ 4L59A 1VQKT 1W4SA 2KGTA 3EG1A 4HCKA 4V2SA 2KT8A 4N4GA 2NUZA 4X9DA 2V8JA 1M30A 2LT1A 2RQVA 2NUTA 4IUQA 3CCEA 1WJQA 3VUBA 4C92D 3FB9A 2VXFA 2XG8D 5HK3A 2G6FX 3RKWA 1D3BA 1G5VA 2L3SA 2ZPIB 2DJQA 1RAHB 5GJWB 1D0XA 3SD4A 1NG2A 2NUPA 1QP2A 1JQQA 3GOXA 1LPLA 4B6MA 1AWJA 4XU0A 2PZ1A 5LL6S 4XQ3A 1OEBA 4N4IA 2VUBA 3CCJQ 3PIOA 1YBYA 2MAMA 3UATA 4M7DB 4A4EA 1HYOA 3KBGA 1M1KR 4HT8A 3OYFA 1M2VA 1OX8A 4C8QE 1MMAA 3MCAB 3HRTA 1MV3A 1MGQA 3MEVA 5KYWA 2MCNA 1KFZA 2DRKA 3VV0A 4M7DF 2Y4YA 2BZXA 2YXYA 4FYWB 1Q86R 1U5SA 2O31A 5GAMd 1UFFA 4OMLA 1WHHA 1RAEB 3E2UA 2D8JA 2QK0A 3M0QA 3NTKA 4DQ2A 2RO0A 3JCMQ 1GFDA 3MPUB 1YJWA 3HFOA 2LDMA 1KHCA 5GANg 3M0TA 4RTVA 5GAMh 3CQTA 4CC4B 2DKGA 2MF2A 1YJ9T 4J7FA 2RMOA 3JAME 4EDUA 3SEMA 2JS0A 3HTRA 2EJFA 3L2VA 3ZEHA 1W1FA 3CCEQ 1UGQB 2E3IA 2HQHA 1UECA 2MPXC 4GLMA 4FSSA 1KQSA 1WGSA 1KC8U 1Z9ZA 1GCQA 4J6WA 2DL7A 3OSVA 2XD0A 5KYXA 3L2ZA 2R58A 5A2QE 2O9VA 2WSCE 2LNVA 4PJOE 4E2FB 1PRMC 2YUPA 2D0QB 3TREA 3VRZA 4J9CA 4YTLA 1QP3A 1VQNA 1Q7YU 7AT1B 1G3YA 4HVUA 5GAN3 3M9QA 4M77E 4OMNA 4CRIA 4MMLA 2DETA 3BDUA 2R57A 2QASA 1Y07A 4LDVA 4J6YA 3VYHB 2SRCA 1VQ8A 3GIBA 2B86A 3RR6A 5KCHA 2LVMA 2XI9A 3X20B 8AT1B 1VQ6T 1HXDA 1RLQC 3TSWA 1BB9A 2ROTA 2AZSA 2LT4A 3G71A 1BI0A 3QIIA 1YJWQ 3JB9J 2OJ2A 1N6AA 1NEBA 2ECZA 2VC8A 1NPPA 1UHCA 3RDVA 2RHZA 2X4XA 1YIJQ 4QQGA 4JJBA 2DZCA 2J6FA 1VUBA 3H9NA 2CUBA 3I5SA 4KRTA 1NJIU 4M78G 4D8KA 2RA2A 2COZA 3PNWC 4J9HA 3EAEA 2K9GA 5IXFA 2KK4A 4HCBA 1VQ4T 2KRNA 3G4ST 3L1AA 4FT4A 3BW1A 2YUNA 3SWNB 2XIDA 3FEOA 3M0UA 5J26A 2GQVA 2DF6A 1G83A 3VS7A 2DM1A 1W2BP 3H0FA 3EGDA 2FZKB 2MMPA 1N8RC 2CH4W 4PL6A 2K3XA 4PJNA 2RJDA 1VQ8Q 5CKDA 2EPDA 4XTVA 3L2RA 5A0GA 4HXJA 2EYXA 2L5QA 3OYGA 1ZUUA 1W2BA 1Y96A 1VQPQ 4M7AG 1RACB 5A0LA 1TUDA 1FMWA 4Y28E 1X2KA 3QYGB 3EG9A 3A8LB 4JRPA 1RAAB 4M7DC 2VV5A 4RTYA 4GY5A 3QPHA 5GAMe 3UDCA 3G1JA 1YITT 2NYSA 1EIFA 3R6NA 1BCMA 2HMAA 3OYYA 3CCST 1IZ6A 1IXDA 3ZL7C 4JJNK 4PJMA 3V8KA 4LUEA 1XOVA 1M1GA 1Q81C 2DL5A 1S72Q 3N5BB 1K9MC 3OY9A 2A28A 2ZPFB 2HBWA 3EH1A 1WPYA 2YLBA 4F7UA 4RTZA 1DJ7B 3PT9A 1B07A 3I55A 2EYWA 1SG5A 2YDLA 5CAIA 1WXBA 4B9WA 3OW2P 5LJ3f 3VS3A 4IUTA 4JS4A 1AHJB 4PKCC 1YHQT 5GAN6 4DBFA 2OTLQ 1M4ZA 2CT4A 3RMSA 1YJ9A 2HBPA 4C92B 2CUDA 4OGEA 4RG2A 3CCRT 3JRZA 4E7JA 5EC7A 2EGAA 2HEQA 1TSFA 4J9FA 4EIKA 2DL3A 4C92F 3OW2A 4AT1B 5IHKA 5KYUB 1D09B 1W6XA 2VGNA 2E1HA 2QEXQ 3DB3A 2W10A 2DLPA 1E6GA 4M78D 2A37A 1JU5C 1M1FA 4QVCA 4FU6A 2ZPGB 3JB9H 4D6WA 4XU3A 2BE7D 2DXTA 1WDXA 4QVZA 1M5Q1 3V7RA 3ZBDA 3OYBA 3CCVT 1W2BS 2EGCA 4C5IA 5I2MA 2C0TA 1A0NB 1R77A 3QG1A 1M1KU 1N5ZA 2COYA 3CCLA 3V8LA 3WVEB 2CKKA 3REBB 2JZ2A 2R5AA 4LE9A 1AWOA 4M7DA 5M9OA 3RNJA 1GFCA 3E19A 2RQWA 1VQ6A 1UG1A 3BY7A 1OULA 4IIOA 2MK5A 2EGEA 5J3BA 4LNPA 3X28B 1KC8R 2HL5C 3I55Q 2RI2A 2MWOA 1TUCA 1ZA1B 5AYFA 1GBQA 4BE2A 2V8IA 4C5GA 4LDUA 1NLOC 3CCMA 2F5KA 2FG0A 3EG0A 1JRIA 2CZ1B 2ESWA 4RTTA 4M7AD 1KQ1A 1VQ9A 4RKUE 2YRVA 4FYXB 1Q7YR 3CBMA 5GMKh 3QXEB 4NOYA 3EFSA 1EZZB 5DM7R 1GRIA 2RQRA 3QKJA 4DEYA 3OW2S 3Q1JA 4HVWA 4NL3A 2O4XB 2ED1A 1BI1A 1D0YA 1WQ7A 1MMDA 3PTAA 1VQ4A 1R0BG 4DEXA 2CP0A 4ZGDB 3GPLA 1M90C 3C0CA 3SWNC 3PIPA 3CCLQ 1K4US 4BACA 1QWEA 1LNXA 2DTOA 1K8AC 3BDLA 2XHCA 2EWNA 2EYYA 4LDWA 1B3QA 3JCMV 2ED0A 5HK0A 4M75G 4F04B 4PJOD 2ENMA 3H8ZA 3I56A 2LJ3A 5GANd 3G7ZA 1NLPC 1ZBXA 1Y7XA 2EFIA 1VQLT 1SPKA 3OYKA 2EBPA 5LJ5f 2BZYA 2HNIA 2YT6A 1E6HA 4OB2B 2HKQB 5GANh 1I1JA 3CCMQ 4BE0A 2XDPA 2RQTA 1YITA 3CCQA 1MNEA 2E3HA 2KAFA 4XU2A 5LJ3j 2KRSA 1VQ9Q 4E7LA 1K76A 2J05A 4O5VA 3HRUA 1N9RA 2FHDA 2QQBA 2XDBA 3SDZA 3P8DA 3UPUA 3NGPA 4F7UE 3L2WA 1JJ2P 4IKFA 1VQ4Q 4PJLA 4RTUA 5GAOq 3EFOA 2F1LA 3HL8A 2ZCFB 2VB6A 5KYYB 2J6KA 4LDXA 2VASA 2L3QA 2MWPA 3LH0A 5IN1A 4C92C 3CCRA 2AKKA 3LWHA 3SB2A 3WXMB 2GNCA 1IHWA 2HCKA 2QGGA 3LGLA 2LNHB 2CP3A 2LQ8A 3AT1B 4GBQA 1KD1U 3OS2A 5CKEA 2DNUA 1K1ZA 2F2WA 1G8XA 4AG2C 1WYXA 3I56Q 3HP9A 3OYMA 3TQ7P 4F17A 3URGA 1OQKA 1UUEA 2A0FB 3JCMf 1X75C 2DBKA 1FYNA 2KMTA 4KULA 2C06A 5GAN5 1WJRA 3PFSA 4E47A 2LMJA 2RB6A 3CCVA 4Z02A 2KYMA 3UA6A 3X26B 3EGXB 4OGCA 2RJEA 1K0XA 1C1AA 2BIVA 3CCQQ 2B8AA 1SRMA 2ZGWA 3OMCA 1ZBJA 3MP1A 2DVEA 1VQOT 5GMKe 2RHUA 4M7DE 1SHGA 1KSWA 5ECAA 3CCUT 3E9FA 4PNOA 3GNGA 3QJ6A 3CC7Q 4HA8A 2KYBA 4BDZA 4M75D 3OYAA 4MDXA 2QA4A 1YI2Q 2XICA 4WCIA 4X1VA 2IPOB 1AOJA 4JRIA 2HAXA 5GMKl 5FWCA 5HY6A 2D8HA 2OTJA 3QDFA 4MMKA 2P0PA 4KT0E 3JCMW 5FRMA 2DL4A 2EYQA 2RJCA 4J5YA 1OU8A 4C92A 1M27C 4XAXB 2I0NA 2XK0A 5FU7B 4M78B 3NFCA 1JJ2S 1KG1A 2LRQA 3CMAT 4EMHA 1VQ7A 1GL5A 2P4RA 4RTWA 4DBQA 2DBMA 5KYUA 4M78F 1WHLA 3CCVQ 4KGZB 1WJSA 2OAUA 1KQSP 1K73C 2CP7A 2EQIA 4FYYB 2GF7A 5GANe 1PNJA 1D1AA 2JMAA 5LJ5j 2VGMA 2RI3A 1TTHB 5GMKi 5FROA 5GMKm 1OPLA 1Q82C 2RH2A 4HCCA 4KH0B 3PVLA 4LUDA 3CC4A 2DK3A 3FLGA 2PNIA 1QCFA 2DEQA 2RJFA 2G3RA 1MHNA 3PVQA 2DYIA 2DZ9A 3OBYA 1VQLA 2GCXA 4LD9K 2X35A 2RNAA 3TEEA 4A53A 2QA4Q 1RABB 1VIFA 2EW3A 4M7AB 4BI3A 1RAFB 5L23A 2OTJQ 1GXIE 2WACA 3OMGA 1YP5A 1WA7A 3NTIA 2P0KA 1Y57A 3D7SB 4EPCA 4M7AF 3VS6A 1VOMA 5CIUA 4E6RA 4JRQA 1X6BA 3RBBB 2AK5A 3CBOA 1TS9A 4ZGJB 2LX7A 1H641 4QVDA 2X4WA 2DFUA 2D1XA 2X9HA 1FX7A 2BE9B 1V1CA 3LLRA 2LQNA 1VQ7Q 4E7ZA 1MNDA 1SKUB 3DLLA 2O4XA 3QYHB 1PKTA 2RI5A 3CMET 1VQMT 1G3TA 2OX7A 5IT9E 1PD1A 1PHTA 2MI6A 3TCJA 4PJOB 3A8HB 4Y91A 3NPFA 2C0IA 4PLLA 3CC4Q 4WF2A 1GBRA 1IGQA 5GAOr 1BI2A 4PJOF 1KQSS 2X4YA 4D8DA 2P84A 2CZ6B 4L5GA 2ABLA 1KIKA 1VQKA 3OB9A 2M1HA 1M1KC 3OYEA 3C12A 1ZQ1A 3RKXA 2H3EB 4OMOA 3CD6T 5CVIA 1OX9A 1VQNQ 4RCCA 3M53A 1VQOA 1WHKA 1T3LA 2E70A 4L6V5 4LD6A 2GFUA 2KT1A 3M0SA 3CC2T 2OI3A 1VQ5T 2NLUA 1RL2A 4FW2A 2JNGA 2PQWA 1Q86C 2JW4A 1U1SA 1ZX6A 3CCUA 1KD1R 2YWWA 1OYXA 1GCPA 1I0CA 2EVRA 4C8QG 1J3TA 2AKLA 2DMOA 4OMPA 3FJ5A 4XK8E 3V7CA 1QW1A 3JV3A 3QSUA 2E5KA 4WTOB 1O9SA 3FRNA 3ZFJA 1Z9QA 3X24B 3G71Q 1XNIA 4PK4A 1C6VX 5GAN2 3GLXA 3HRSA 5CQYA 5I21A 1TG0A 1X27A 3NMZC 3UWNA 3QO3A 1R0CB 2KRMA 4TVRA 2JUFA 5KYYA 3OYJA 3C4SA 1UGVA 5LJ3g 2KXDA 4DOVA 3HPWA 2P0QA 3P8BB 5FU7C 4M78C 1IO6A 4C92E 2GFAA 2K4YA 5D6YA 2K5LA 2DXCA 2JTFA 1YJNT 4NS5A 2O88A 4R55A 1UGRB 1OU9A 1C0MA 3G6ET 4ATOA 1AWWA 3TSZA 2HQEA 4Q5WA 2K7AA 1IB8A 1W70A 4J6XA 6AT1B 8ATCB 2NUTB 4C5HA 3JB9G 1WHJA 1VQKQ 4EMKB 1WZOA 4QQDA 1UJYA 2DEUA 2FRYA 3M55A 1QCOA 1UE9A 1I4K1 2LQWA 1BKBA 3QDRB 2E64A 4PFOA 3EGXA 3M4GA 3OS1A 2CP2A 1FMKA 1ZSGA 4PJOG 1RI0A 2AHJB 2QGFB 4MDWA 4O6JA 2L89A 2KSSA 2JTEA 2PVDB 3HHTB 3PMIA 4M75B 3INZA 4BDYA 1ABOA 5GAMf 5GANj 2KQWA 3NTHA 1CKBA 3VS1A 1V76A 4HKEA 2EJGA 4M77G 3CPFA 2F2XA 1CSKA 3CCJT 4M75F 5KYWB 3OS0A 4A54A 2V1RA 2HSPA 3EGUA 4ZNXA 2ZAEA 1M8MA 3A1PA 2NWMA 4M7AC 2LCSA 2HD0A 1NBEB 2F5TX 4BY6B 1LCKA 1ZSZB 4OVAA 2HQXA 4EMGA 4M4ZA 3THKA 3MHXA 1RI9A 4J8OA 1VA7A 4MZPA 3JCMc 4RTXA 2YSQA 4AG1C 1RAGB 2Y4XA 1X01A 5CQXA 4BI8B 1NM7A 3PMTA 1XQHA 1Y71A 2C0OA 2O2OA 2DJZA 4FL6A 4M78A 1SSHA 1Q95G 4LDYA 2QQAA 3UA7A 1U3OA 2A36A 4FT2A 4FW1A 1ZUKA 1LJOA 2LC4A 3CMEA 1VQMA 2R5MA 5IHNA 4C8QD 3DKMA 1SF9A 4JZ4A 3ER0A 2FO0A 3ASKA 2VKNA 1PRLC 1N8RU 1YJ9Q 3CCET 5KYXB 4PJOC 2AZVA 3DLMA 1YNZA 3OA6A 3TVTA 4CC7A 3OSSC 3OYCA 2DL8A 2J7IA 1UJ0A 3ULRB 3DB4A 4ZN1A 4J9GA 9ATCB 2FL7A 1D1BA 5IAYA 3G4SA 1QVFP 4QKUA 3EHQA 4ANJA 1FXXA 1YCSB 4JLIA 2PUKB 4XTUA 2GTJA 3JB9D 3RKYA 4R56A 4M7AA 1BBZA 4MZTA 5LJ5g 1Q81U 3CC2A 1PM3A 1K9MU 2OAWA 1QKXA 4BD3A 1I8FA 4CC3A 1H3HA 4FSXA 1LOJA 4N0AC 1KQ2A 2GBQA 2JN0A 3C95A 4XTZA 4Z88A 1AWXA 1QVFA 1VQ6Q 1YJWT 2QI2A 1IRXA 1G3SA 2RK2A 2X4JA 2KDSA 4OB0B 2X3WD 1YIJT 2EKHA 3T9NA 3NHNA 1JEGA 1X69A 4M77D 2CS7A 2ZZDA 3MP8A 2WSEE 3ME9A 2QQSA 3CCSA 1ZA2B 4QW2A 4FIBA 1KK7A 1YJNA 2K3BA 3E9GA 3QBYA 2WSFE 5D6WA 3MEWA 4A63B 1CKAA 3VUZA 2VXEA 3L2QA 3G6EA 2DILA 3OYIA 4JPBW 3GP8A 2L8DA 5CR2A 3M58A 3M4YA 4J9EA 2HKNA 1BIBA 1H8KA 2E6NA 4F14A 5GAMj 1UTIA 3KFVA 5CKFA 1UEBA 1WHGA 3TU4K 4DBHA 2M0OA 2XDDA 3G4SQ 3META 4EMKC 1M2OA 3JCMX 1YHQA 2FZGB 3JCMg 3A98A 2K79A 5FW9A 1TUGB 3SWNA 1VQ8T 2DTIA 1I81A 2CGHA 2E41A 4M75C 1KC8C 1NE8A 3EG9B 3GBQA 3RMQA 2E65A 1QVFS 5C0MA 2HZYA 4RUGA 3CXCP 1UHFA 3JSCA 2JT4A 1RLPC 3CCJA 1VQPT 2ATCB 1WQWA 3QUIA 3MEUA 2PVGB 3OS5A 4BY6C 2LJ1A 1M3BA 5DLQE 1ZSZC 1ZHIA 2LTOA 5CKHA 4F16A 2RK1A 4AFZC 2VVKA 2XMFA 1Q7YC 1YITQ 2F2VA 1S72T 1VYTA 3CCSQ 3P8HA 1PSEA 3FC3A 3CXCA 2SEMA 2W0ZA 1XJWB 1M3AA 2GQIA 1WX6A 2EAYA 4PFPA 1KJWA 2O9SA 1TOVA 3VYGA 2DA9A 4AMCA 2I2LA 3FDRA 4M78E 1M90U 4AFSC 2OTLT 2M9UA 2D6FA 4HT9A 4P5NA 3RERA 4OB1B 2DIQA 2DTHA 3LH5A 5L8RE 2F69A 1YHQQ 2YRCA 2E12A 3VRYA 1ABQA 5CK9A 1SSFA 3MP6A 2L3PA 1GCQC 3M54A 1K8AU 5C6SA 1RUWA 4EMKA 1BU1A 3CCRQ 4Z89A 1FMVA 3UF4A 4AFQC 2CZ7B 2IVWA 2QEXT 1NJIC 2X3XD 1QCNA 3LYIA 2KE9A 3V7SA 2EKOA 2M16A 4A4KA 1WNLA 3KUFA 4KUDK 2HSEB 4X9CA 4M75A 3OYHA 4LN2A 3C94A 4QQ6A 1X6OA 5LJ3d 2FPEA 1YWPA 1LVKA 2EIFA 5FRNA 5KYNA 1M8VA 4E7SA 4JZ3A 2K57A 4BUGA 2JMCA 1OOTA 2JM9A 2KBTA 2MIOA 1X43A 5LJ3h 1G3WA 1ZSZA 2LCCA 4M7AE 1N8RR 2LJ0A 3CXCS 2DVJA 2IIMA 1F1BB 1NYGA 4IUVA 2QYZA 1VIEA 2JXBA 3S3NA 1B34B 3I55T 1M3CA 2PU9B 3EG3A 3FJPA 1WLPB 2H8HA 4C8QB 2EQJA 4HVVA 4A4GA 4DA4A 5AT1B 1TU0B 1YIJA 2AIRB 3LX7A 3M59A 2CYZB 1B7TA 5CCAA 2ROLA 2FPDA 3CPWP 2FRWA 4C8QF 2YRDA 4ME7A 3VKIA 3EFRA 4F7UG 4UC4A 1HK9A 1UGPB 3QJYA 4J9DA 5EG2A 1IHVA 3MO8A 5GANf 1Q81R 5HKCA 2KEAA 1K9MR 1I07A 2VYTA 2CSIA 3O5ZA 4ELZC 3IQLA 3CPWA 4RG8A 1YFNA 1T0JA 3BFMA 4E7HA 1QVGP 3O8VA 5A0DA 2QDYB 2JJ9A 2DXUA 2DXBA 3CCLT 2K2MA 4B9XA 2GTOA 1OPKA 1BYMA 1ZLMA 2ZPEB 4JDSA 5I2SA 3JB9F 3HSBA 4C5EA 3M0RA 4DOWA 2RQUA 1AZGB 5FLXE 2H3JA 4ELYC 2BTTA 4OB3B 3S3MA 1QVGA 5KH6A 4NL2A 3EH2A 2FEIA 2ZPHB 1VQPA 1VQLQ 5GAOn 1ZUYA 4PJJA 4M77B 3CCMT 2CH4A 2Z0WA 4CC2A 2VWFA 5FU6B 2JVVA 1JB0E 1OZ3A 5HCKA 4M7DG 3LWIA 1WFWA 2JTMA 2KNBB 1WHMA 2FYKA 1VQ9T 2YUOA 2K3YA 4DBRA 3GNFB 4M77F 1S72A 1G2BA 3MJXA 5D7UA 3VU3C 4KGXB 3JB9I 1QLYA 2BUDA 2GGRA 3EFOB 3OYNA 1TXQA 1S1NA 1NZ9A 4ZTJA 2EQUA 3CEYA 1T0HA 2IG0A 4C0DB 3CPWS 2OTLA 2JM8A 3SFMA 3RIRA 2RD1A 5I11A 5LJ5d 3MEAA 5J39A 1K73U 3A8MB 4ZTFA 2KXCA 3S6WA 2DERA 3BE3A 4OMFB 3AHUA 1E7OA 1Q82U 2RN8A 2DRMA 1P92A 5GMKj 5LJ5h 2XKOC 5CO7A 1QKWA 1K9AA 4RCBA 3RESA 5GAOl 5LJ3e 1N9SA 2QEXA 2V8KA 3I56T 3UT1A 2HDAA 1QVGS 4FYVB 1EX4A 2V1QA 2E4HA 3HFNA 1OV3A 4II1A 3CMAA 2CP5A 3LGFA 1NPRA 1R8OB 2P4TA 1AZEA 2QG9B 1UGSB 2A7YA 4M75E 4OF1A 3RUXA 1UB4A 3SHWA 2J6OA 5IH2A 3CCQT 4OMMA 2HL3A 1M90R 4OMQA 5GAMg 4CI0C 2FVUA 1D3BB 2BZ8A 2K5FA 3H6ZA 5GAN4 2DYBA 4JJCA 4E7KA 2LQKA 4Z8AA 3OBWA 2XU8A 1AD5A 2NUPB 4A4HA 2KROA 3JCMJ 3F70A 1K8AR 3VS5A 4E7IA 1VQOQ 3A5ZB 3OQ5A 1AEYA 3CC7T 1I5LA 5GAOm 2DO3A 2QTXA 4FCYA 1QMCA 2A08A 3CCUQ 1YI2T 4C8QC 4KH1B 1PG5B 2EYZA 2K5IA 3JCMd 1WXUA 1M2VB 5GAN7 1MMNA 1O75A 2CREA 2QAZA 2RM4A 1V29B 3VS2A 1KHIA 3M56A 3I5RA 2LCLA 2M0YA 3JCMh 4C0GA 1ACMB 2O01E 4X34A 1MV0B 2MOXA 1H3ZA 4M7DD 1T3SA 4AFUC 1OI1A 1JXMA 3GF5A 4KUIA 1SHFA 2DE0X 2K2VA 1BIAA 2MYSA 3E1SA 4ZGEB 1XTDA 2DAQA 4PLIA 3CMAQ 4C0FA 4FM4B 3J7AF 1PCXA 3VJPA 1X2QA 2KVQG 4GLKA 2X51A 2JS2A 2A3LA 1JO8A 4C0ZA 2CSQA 1TWBA 2PUOB 3M5AA 3U23A 1N27A 1PWTA 2K6DA 5KE3A 4BE1A 1Q86U 2EJ9A 4J83A 3V8JA 1UDLA 1RAIB 2AT1B 1KD1C 3EG2A 2PVOB 1SEMA 3JCMb 2COWA 1WXTA 2D0NA 1VYVA 2M02A 2FB7A 2QA4T 4JLGA 3REAB 2YLCA 1FWZA 4BI4A 2CP6A 1NEGA 2JOYA 2E5QA 4M77C 1B34A 1HSQA 5I22A 1MUZA 2OTJT 5DY9A 1QQJA 5FU6C 4C8QA 4ZN3A 3HKSA 2CDTA 2J06A
chains in the Genus database with same CATH topology
1WA7A 4F16A 4QT7A 1K0SA 4AFZC 2VVKA 2XMFA 1H92A 3R6NA 1Y57A 2DX1A 3M0PA 2F2VA 3ZL7C 4LUEA 1VYTA 1XOVA 3VS6A 4E6RA 2DL5A 1X6BA 3RBBB 2AK5A 1AVZC 1VYUA 2A28A 4ESRA 2SEMA 2LX7A 2W0ZA 1M3AA 1HD3A 2HBWA 2L2PA 4RTZA 1ARKA 2GQIA 1WX6A 2D1XA 1KJWA 1V1CA 2O9SA 1B07A 3I9QA 2EYWA 2LQNA 2YDLA 1Y0MA 2DA9A 1WXBA 3VS3A 4AFSC 1PKTA 4IIMA 3QWXX 3LH5A 2CT4A 5IHIA 1EFNA 2CUDA 3VRYA 1ABQA 1PHTA 2LZ6B 1SRLA 1NYFA 2RPNA 2L3PA 1GCQC 1RUWA 1BU1A 2RF0A 5EC7A 4Z89A 3UF4A 4AFQC 3NPFA 2C0IA 2EGAA 1X6GA 2HEQA 2M51A 3VS0A 1GBRA 4J9FA 4EIKA 2DL3A 2X3XD 5IHKA 1W6XA 2KE9A 5GJVB 3VS4A 2CT3A 1WIEA 2L0AA 2W10A 2DLPA 4D8DA 1E6GA 2A37A 1JU5C 1QWFA 2ABLA 5IXBA 4LN2A 1KIKA 1JXOA 1WDXA 2EGCA 2FPEA 2C0TA 1YWPA 3EHRA 1A0NB 1N5ZA 1WI7A 1HJDA 4JZ3A 3QWYA 2QDLA 1YN8A 4OMOA 2JMCA 1OOTA 2JM9A 2KBTA 3REBB 2MIOA 4LE9A 1X43A 1AWOA 1T3LA 3RNJA 1GFCA 2KT1A 3M0SA 2OI3A 2LJ0A 2DVJA 2JW4A 2IIMA 2LP5A 3H0HA 1ZX6A 3I35A 2RQWA 1NYGA 1UG1A 2PTKA 1GCPA 2JXBA 1YWOA 1M3CA 1I0CA 2EVRA 3EG3A 4IIOA 4J9BA 2EGEA 4LNPA 1WLPB 2H8HA 1J3TA 4R0KA 2YUQA 2AKLA 2DMOA 4HVVA 3FJ5A 4OMPA 5FWBA 1TUCA 3JV3A 1GBQA 2KR3A 2E5KA 1NLOC 1Z9QA 4ORZA 2FG0A 3EG0A 2ROLA 2FPDA 2FRWA 2ESWA 4RTTA 1TG0A 1X27A 3NMZC 2KRMA 2FPFA 3PE0A 1UGVA 2KXDA 4Y92A 4J9DA 3H41A 1U06A 2KEAA 1IO6A 1I07A 1GRIA 2RQRA 4DEYA 4JJDA 4J9IA 4HVWA 4K11A 2CSIA 2O88A 2ED1A 1PKSA 3O5ZA 3IQLA 3H0IA 1AWWA 3TSZA 1BK2A 1T0JA 2K7AA 1W70A 4DEXA 2KGTA 3EG1A 3C0CA 1UJYA 4HCKA 2FRYA 2K2MA 1UE9A 2KT8A 2LQWA 1K4US 2NUZA 2GTOA 1OPKA 1M30A 1ZLMA 1QWEA 2RQVA 1FMKA 2EYYA 3M0RA 1B3QA 1ZSGA 2RQUA 2G6FX 1AZGB 2ED0A 2L3SA 2JTEA 2BTTA 2DJQA 5GJWB 2ENMA 2LJ3A 1ABOA 1NG2A 1CKBA 1NLPC 3VS1A 2FEIA 1SPKA 2EBPA 1JQQA 2BZYA 1ZUYA 2F2XA 1CSKA 2YT6A 1E6HA 1AWJA 2CH4A 2PZ1A 2V1RA 2HSPA 3EGUA 4ZNXA 4CC2A 1OEBA 1M8MA 2VWFA 2NWMA 1I1JA 2LCSA 5HCKA 2RQTA 3UATA 1LCKA 1WFWA 2KNBB 4M4ZA 3THKA 2YUOA 2KRSA 1G2BA 1RI9A 1K76A 1MV3A 1VA7A 2J05A 1QLYA 2MCNA 1KFZA 2DRKA 4RTXA 2YSQA 4AG1C 2BZXA 2GGRA 1NM7A 3NGPA 1U5SA 2O31A 1S1NA 2C0OA 2O2OA 1SSHA 1UFFA 4OMLA 1T0HA 2D8JA 3UA7A 3M0QA 1U3OA 2A36A 1GFDA 2JM8A 1ZUKA 5I11A 4RTUA 5IHNA 2KXCA 3M0TA 2J6KA 4RTVA 3CQTA 2L3QA 4JZ4A 4CC4B 1E7OA 2FO0A 2RN8A 2RMOA 2AKKA 2DRMA 2VKNA 1PRLC 3SEMA 2JS0A 2GNCA 1QKWA 2HCKA 2LNHB 2AZVA 1W1FA 1K9AA 1YNZA 3TVTA 4GBQA 4CC7A 1UECA 4GLMA 4FSSA 2DNUA 1K1ZA 2F2WA 2HDAA 4AG2C 1WYXA 1Z9ZA 1GCQA 2DL7A 2V1QA 4F17A 1OV3A 2DL8A 2J7IA 2O9VA 1UUEA 2DBKA 1FYNA 1UJ0A 3ULRB 2LMJA 4J9GA 2KYMA 3UA6A 1AZEA 1PRMC 2YUPA 3SHWA 3VRZA 2J6OA 1K0XA 5IH2A 4OMMA 3EHQA 4J9CA 1YCSB 4OMQA 2GTJA 2BZ8A 1SRMA 2DYBA 4HVUA 4JJCA 1BBZA 4OMNA 1ZBJA 4Z8AA 2OAWA 1AD5A 1QKXA 2KROA 3VS5A 4CC3A 2SRCA 1H3HA 1SHGA 2GBQA 1AEYA 2B86A 1KSWA 5ECAA 4Z88A 1AWXA 1RLQC 2A08A 2KYBA 3TSWA 1BB9A 2ROTA 2AZSA 4WCIA 4X1VA 2EYZA 1WXUA 1AOJA 2CREA 2OJ2A 2X3WD 3VS2A 1NEBA 2ECZA 2EKHA 1UHCA 3NHNA 5FWCA 1JEGA 2D8HA 3I5RA 2M0YA 1X69A 4JJBA 2J6FA 1MV0B 2MOXA 2CUBA 3I5SA 2DL4A 1T3SA 1M27C 4AFUC 4KRTA 2I0NA 1JXMA 4D8KA 1SHFA 2DE0X 2K3BA 4A63B 1CKAA 2DILA 4J9HA 2K9GA 1GL5A 2P4RA 4JPBW 5IXFA 4RTWA 2DBMA 4J9EA 1H8KA 2KRNA 4F14A 1UTIA 3KFVA 2YUNA 1X2QA 2EQIA 3M0UA 1PNJA 2JMAA 2DF6A 1G83A 3VS7A 2JS2A 2DM1A 1JO8A 2CSQA 3H0FA 3U23A 1OPLA 1PWTA 3A98A 2K79A 2K6DA 5FW9A 2CH4W 3PVLA 4LUDA 1UDLA 2PNIA 1QCFA 3EG2A 1SEMA 3PVQA 2D0NA 1WXTA 3GBQA 2EPDA 1VYVA 3REAB 4RUGA 2RNAA 4HXJA 1UHFA 2EYXA 1RLPC 2JT4A 1ZUUA 1NEGA 1HSQA 5I22A 1MUZA 2EW3A 1TUDA 5L23A 1X2KA 2LJ1A 1M3BA 4RTYA 2CDTA 2J06A 1YP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA7 A;  4F16 A;  4QT7 A;  1K0S A;  4AFZ C;  2VVK A;  2XMF A;  1H92 A;  3R6N A;  1Y57 A;  2DX1 A;  3M0P A;  2F2V A;  3ZL7 C;  4LUE A;  1VYT A;  1XOV A;  3VS6 A;  4E6R A;  2DL5 A;  1X6B A;  3RBB B;  2AK5 A;  1AVZ C;  1VYU A;  2A28 A;  4ESR A;  2SEM A;  2LX7 A;  2W0Z A;  1M3A A;  1HD3 A;  2HBW A;  2L2P A;  4RTZ A;  1ARK A;  2GQI A;  1WX6 A;  2D1X A;  1KJW A;  1V1C A;  2O9S A;  1B07 A;  3I9Q A;  2EYW A;  2LQN A;  2YDL A;  1Y0M A;  2DA9 A;  1WXB A;  3VS3 A;  4AFS C;  1PKT A;  4IIM A;  3QWX X;  3LH5 A;  2CT4 A;  5IHI A;  1EFN A;  2CUD A;  3VRY A;  1ABQ A;  1PHT A;  2LZ6 B;  1SRL A;  1NYF A;  2RPN A;  2L3P A;  1GCQ C;  1RUW A;  1BU1 A;  2RF0 A;  5EC7 A;  4Z89 A;  3UF4 A;  4AFQ C;  3NPF A;  2C0I A;  2EGA A;  1X6G A;  2HEQ A;  2M51 A;  3VS0 A;  1GBR A;  4J9F A;  4EIK A;  2DL3 A;  2X3X D;  5IHK A;  1W6X A;  2KE9 A;  5GJV B;  3VS4 A;  2CT3 A;  1WIE A;  2L0A A;  2W10 A;  2DLP A;  4D8D A;  1E6G A;  2A37 A;  1JU5 C;  1QWF A;  2ABL A;  5IXB A;  4LN2 A;  1KIK A;  1JXO A;  1WDX A;  2EGC A;  2FPE A;  2C0T A;  1YWP A;  3EHR A;  1A0N B;  1N5Z A;  1WI7 A;  1HJD A;  4JZ3 A;  3QWY A;  2QDL A;  1YN8 A;  4OMO A;  2JMC A;  1OOT A;  2JM9 A;  2KBT A;  3REB B;  2MIO A;  4LE9 A;  1X43 A;  1AWO A;  1T3L A;  3RNJ A;  1GFC A;  2KT1 A;  3M0S A;  2OI3 A;  2LJ0 A;  2DVJ A;  2JW4 A;  2IIM A;  2LP5 A;  3H0H A;  1ZX6 A;  3I35 A;  2RQW A;  1NYG A;  1UG1 A;  2PTK A;  1GCP A;  2JXB A;  1YWO A;  1M3C A;  1I0C A;  2EVR A;  3EG3 A;  4IIO A;  4J9B A;  2EGE A;  4LNP A;  1WLP B;  2H8H A;  1J3T A;  4R0K A;  2YUQ A;  2AKL A;  2DMO A;  4HVV A;  3FJ5 A;  4OMP A;  5FWB A;  1TUC A;  3JV3 A;  1GBQ A;  2KR3 A;  2E5K A;  1NLO C;  1Z9Q A;  4ORZ A;  2FG0 A;  3EG0 A;  2ROL A;  2FPD A;  2FRW A;  2ESW A;  4RTT A;  1TG0 A;  1X27 A;  3NMZ C;  2KRM A;  2FPF A;  3PE0 A;  1UGV A;  2KXD A;  4Y92 A;  4J9D A;  3H41 A;  1U06 A;  2KEA A;  1IO6 A;  1I07 A;  1GRI A;  2RQR A;  4DEY A;  4JJD A;  4J9I A;  4HVW A;  4K11 A;  2CSI A;  2O88 A;  2ED1 A;  1PKS A;  3O5Z A;  3IQL A;  3H0I A;  1AWW A;  3TSZ A;  1BK2 A;  1T0J A;  2K7A A;  1W70 A;  4DEX A;  2KGT A;  3EG1 A;  3C0C A;  1UJY A;  4HCK A;  2FRY A;  2K2M A;  1UE9 A;  2KT8 A;  2LQW A;  1K4U S;  2NUZ A;  2GTO A;  1OPK A;  1M30 A;  1ZLM A;  1QWE A;  2RQV A;  1FMK A;  2EYY A;  3M0R A;  1B3Q A;  1ZSG A;  2RQU A;  2G6F X;  1AZG B;  2ED0 A;  2L3S A;  2JTE A;  2BTT A;  2DJQ A;  5GJW B;  2ENM A;  2LJ3 A;  1ABO A;  1NG2 A;  1CKB A;  1NLP C;  3VS1 A;  2FEI A;  1SPK A;  2EBP A;  1JQQ A;  2BZY A;  1ZUY A;  2F2X A;  1CSK A;  2YT6 A;  1E6H A;  1AWJ A;  2CH4 A;  2PZ1 A;  2V1R A;  2HSP A;  3EGU A;  4ZNX A;  4CC2 A;  1OEB A;  1M8M A;  2VWF A;  2NWM A;  1I1J A;  2LCS A;  5HCK A;  2RQT A;  3UAT A;  1LCK A;  1WFW A;  2KNB B;  4M4Z A;  3THK A;  2YUO A;  2KRS A;  1G2B A;  1RI9 A;  1K76 A;  1MV3 A;  1VA7 A;  2J05 A;  1QLY A;  2MCN A;  1KFZ A;  2DRK A;  4RTX A;  2YSQ A;  4AG1 C;  2BZX A;  2GGR A;  1NM7 A;  3NGP A;  1U5S A;  2O31 A;  1S1N A;  2C0O A;  2O2O A;  1SSH A;  1UFF A;  4OML A;  1T0H A;  2D8J A;  3UA7 A;  3M0Q A;  1U3O A;  2A36 A;  1GFD A;  2JM8 A;  1ZUK A;  5I11 A;  4RTU A;  5IHN A;  2KXC A;  3M0T A;  2J6K A;  4RTV A;  3CQT A;  2L3Q A;  4JZ4 A;  4CC4 B;  1E7O A;  2FO0 A;  2RN8 A;  2RMO A;  2AKK A;  2DRM A;  2VKN A;  1PRL C;  3SEM A;  2JS0 A;  2GNC A;  1QKW A;  2HCK A;  2LNH B;  2AZV A;  1W1F A;  1K9A A;  1YNZ A;  3TVT A;  4GBQ A;  4CC7 A;  1UEC A;  4GLM A;  4FSS A;  2DNU A;  1K1Z A;  2F2W A;  2HDA A;  4AG2 C;  1WYX A;  1Z9Z A;  1GCQ A;  2DL7 A;  2V1Q A;  4F17 A;  1OV3 A;  2DL8 A;  2J7I A;  2O9V A;  1UUE A;  2DBK A;  1FYN A;  1UJ0 A;  3ULR B;  2LMJ A;  4J9G A;  2KYM A;  3UA6 A;  1AZE A;  1PRM C;  2YUP A;  3SHW A;  3VRZ A;  2J6O A;  1K0X A;  5IH2 A;  4OMM A;  3EHQ A;  4J9C A;  1YCS B;  4OMQ A;  2GTJ A;  2BZ8 A;  1SRM A;  2DYB A;  4HVU A;  4JJC A;  1BBZ A;  4OMN A;  1ZBJ A;  4Z8A A;  2OAW A;  1AD5 A;  1QKX A;  2KRO A;  3VS5 A;  4CC3 A;  2SRC A;  1H3H A;  1SHG A;  2GBQ A;  1AEY A;  2B86 A;  1KSW A;  5ECA A;  4Z88 A;  1AWX A;  1RLQ C;  2A08 A;  2KYB A;  3TSW A;  1BB9 A;  2ROT A;  2AZS A;  4WCI A;  4X1V A;  2EYZ A;  1WXU A;  1AOJ A;  2CRE A;  2OJ2 A;  2X3W D;  3VS2 A;  1NEB A;  2ECZ A;  2EKH A;  1UHC A;  3NHN A;  5FWC A;  1JEG A;  2D8H A;  3I5R A;  2M0Y A;  1X69 A;  4JJB A;  2J6F A;  1MV0 B;  2MOX A;  2CUB A;  3I5S A;  2DL4 A;  1T3S A;  1M27 C;  4AFU C;  4KRT A;  2I0N A;  1JXM A;  4D8K A;  1SHF A;  2DE0 X;  2K3B A;  4A63 B;  1CKA A;  2DIL A;  4J9H A;  2K9G A;  1GL5 A;  2P4R A;  4JPB W;  5IXF A;  4RTW A;  2DBM A;  4J9E A;  1H8K A;  2KRN A;  4F14 A;  1UTI A;  3KFV A;  2YUN A;  1X2Q A;  2EQI A;  3M0U A;  1PNJ A;  2JMA A;  2DF6 A;  1G83 A;  3VS7 A;  2JS2 A;  2DM1 A;  1JO8 A;  2CSQ A;  3H0F A;  3U23 A;  1OPL A;  1PWT A;  3A98 A;  2K79 A;  2K6D A;  5FW9 A;  2CH4 W;  3PVL A;  4LUD A;  1UDL A;  2PNI A;  1QCF A;  3EG2 A;  1SEM A;  3PVQ A;  2D0N A;  1WXT A;  3GBQ A;  2EPD A;  1VYV A;  3REA B;  4RUG A;  2RNA A;  4HXJ A;  1UHF A;  2EYX A;  1RLP C;  2JT4 A;  1ZUU A;  1NEG A;  1HSQ A;  5I22 A;  1MUZ A;  2EW3 A;  1TUD A;  5L23 A;  1X2K A;  2LJ1 A;  1M3B A;  4RTY A;  2CDT A;  2J06 A;  1YP5 A; 
#chains in the Genus database with same CATH topology
 4QT7 A;  1K0S A;  1PD0 A;  1BI3 A;  5D6X A;  4IUU A;  2L3R A;  1H92 A;  2V26 A;  2QXF A;  2DX1 A;  5LJ5 e;  3CD6 A;  3A8G B;  3M0P A;  5GAN 8;  2D9T A;  2KI7 A;  2YHT A;  1AVZ C;  1VYU A;  4ESR A;  1VQ5 A;  1HD3 A;  2L2P A;  1ARK A;  1JBM A;  1VQ7 T;  1AT1 B;  1IGU A;  3I9Q A;  4J7I A;  1U8R A;  2QTV A;  1Y0M A;  4C0D C;  4JRK A;  3J81 E;  4IIM A;  3QWX X;  3QHS A;  2DD5 A;  4XTX A;  5IHI A;  4C92 G;  3CME Q;  1VQM Q;  1EFN A;  2DD4 A;  2LZ6 B;  1SRL A;  1NYF A;  2RPN A;  3J80 E;  4BB7 A;  3L42 A;  3CC4 T;  2RF0 A;  4XU1 A;  1U1T A;  3L2U A;  3CBP A;  2M51 A;  1X6G A;  3VS0 A;  4XTY A;  1NJI R;  3WVD B;  4VUB A;  4RMO A;  1I5O B;  2EQM A;  4PFZ A;  2ZPB B;  5CKB A;  5KE2 A;  5GJV B;  3VS4 A;  3KXT A;  2CT3 A;  1WIE A;  1YCY A;  2L0A A;  3QZ9 B;  3MKD A;  3R6O A;  5GAO p;  4PJO A;  1RAD B;  1QWF A;  4OP0 A;  5IXB A;  1PC0 A;  1M9S A;  3FIF A;  1JXO A;  3M57 A;  3EHR A;  3EGD B;  3S3O A;  4JS5 A;  1K73 R;  3X25 B;  3A8O B;  1BCO A;  4M77 A;  1WI7 A;  1HJD A;  3QWY A;  2QDL A;  1VQN T;  1YN8 A;  4KBM B;  3JCM e;  2Y90 A;  3CD6 Q;  1Q82 R;  1PSF A;  3OYD A;  3PGG A;  4XTW A;  2EQK A;  3CC2 Q;  3H0H A;  2LP5 A;  4IUR A;  3CC7 A;  1VQ5 Q;  3I35 A;  4A4F A;  2PTK A;  1Y96 B;  4IUP A;  1YWO A;  3QZ5 B;  1YI2 A;  4J9B A;  4R0K A;  2YUQ A;  2KY9 A;  2E10 A;  5FWB A;  1D1C A;  2KR3 A;  3G71 T;  4N4H A;  2DPP B;  4N0A A;  2QQ9 A;  4ORZ A;  4MZM A;  1IRE B;  4KGV B;  2QQR A;  2RHX A;  3JCM P;  1QVP A;  1D0Z A;  4LXC A;  1JJ2 A;  4F7U B;  4JUV A;  2FPF A;  3PE0 A;  4Y92 A;  2LX9 A;  1MMG A;  2RHY A;  3H41 A;  2RHI A;  4HCZ A;  1OZ2 A;  1U06 A;  2E6Z A;  3LW5 E;  5KCO A;  2DIG A;  4JJD A;  4J9I A;  2FZC B;  4K11 A;  2BKD N;  4F7U F;  3OYL A;  1PKS A;  5DLO A;  1TH7 A;  1YJN Q;  3H0I A;  2CZ0 B;  1BK2 A;  3G6E Q;  4L59 A;  1VQK T;  1W4S A;  2KGT A;  3EG1 A;  4HCK A;  4V2S A;  2KT8 A;  4N4G A;  2NUZ A;  4X9D A;  2V8J A;  1M30 A;  2LT1 A;  2RQV A;  2NUT A;  4IUQ A;  3CCE A;  1WJQ A;  3VUB A;  4C92 D;  3FB9 A;  2VXF A;  2XG8 D;  5HK3 A;  2G6F X;  3RKW A;  1D3B A;  1G5V A;  2L3S A;  2ZPI B;  2DJQ A;  1RAH B;  5GJW B;  1D0X A;  3SD4 A;  1NG2 A;  2NUP A;  1QP2 A;  1JQQ A;  3GOX A;  1LPL A;  4B6M A;  1AWJ A;  4XU0 A;  2PZ1 A;  5LL6 S;  4XQ3 A;  1OEB A;  4N4I A;  2VUB A;  3CCJ Q;  3PIO A;  1YBY A;  2MAM A;  3UAT A;  4M7D B;  4A4E A;  1HYO A;  3KBG A;  1M1K R;  4HT8 A;  3OYF A;  1M2V A;  1OX8 A;  4C8Q E;  1MMA A;  3MCA B;  3HRT A;  1MV3 A;  1MGQ A;  3MEV A;  5KYW A;  2MCN A;  1KFZ A;  2DRK A;  3VV0 A;  4M7D F;  2Y4Y A;  2BZX A;  2YXY A;  4FYW B;  1Q86 R;  1U5S A;  2O31 A;  5GAM d;  1UFF A;  4OML A;  1WHH A;  1RAE B;  3E2U A;  2D8J A;  2QK0 A;  3M0Q A;  3NTK A;  4DQ2 A;  2RO0 A;  3JCM Q;  1GFD A;  3MPU B;  1YJW A;  3HFO A;  2LDM A;  1KHC A;  5GAN g;  3M0T A;  4RTV A;  5GAM h;  3CQT A;  4CC4 B;  2DKG A;  2MF2 A;  1YJ9 T;  4J7F A;  2RMO A;  3JAM E;  4EDU A;  3SEM A;  2JS0 A;  3HTR A;  2EJF A;  3L2V A;  3ZEH A;  1W1F A;  3CCE Q;  1UGQ B;  2E3I A;  2HQH A;  1UEC A;  2MPX C;  4GLM A;  4FSS A;  1KQS A;  1WGS A;  1KC8 U;  1Z9Z A;  1GCQ A;  4J6W A;  2DL7 A;  3OSV A;  2XD0 A;  5KYX A;  3L2Z A;  2R58 A;  5A2Q E;  2O9V A;  2WSC E;  2LNV A;  4PJO E;  4E2F B;  1PRM C;  2YUP A;  2D0Q B;  3TRE A;  3VRZ A;  4J9C A;  4YTL A;  1QP3 A;  1VQN A;  1Q7Y U;  7AT1 B;  1G3Y A;  4HVU A;  5GAN 3;  3M9Q A;  4M77 E;  4OMN A;  4CRI A;  4MML A;  2DET A;  3BDU A;  2R57 A;  2QAS A;  1Y07 A;  4LDV A;  4J6Y A;  3VYH B;  2SRC A;  1VQ8 A;  3GIB A;  2B86 A;  3RR6 A;  5KCH A;  2LVM A;  2XI9 A;  3X20 B;  8AT1 B;  1VQ6 T;  1HXD A;  1RLQ C;  3TSW A;  1BB9 A;  2ROT A;  2AZS A;  2LT4 A;  3G71 A;  1BI0 A;  3QII A;  1YJW Q;  3JB9 J;  2OJ2 A;  1N6A A;  1NEB A;  2ECZ A;  2VC8 A;  1NPP A;  1UHC A;  3RDV A;  2RHZ A;  2X4X A;  1YIJ Q;  4QQG A;  4JJB A;  2DZC A;  2J6F A;  1VUB A;  3H9N A;  2CUB A;  3I5S A;  4KRT A;  1NJI U;  4M78 G;  4D8K A;  2RA2 A;  2COZ A;  3PNW C;  4J9H A;  3EAE A;  2K9G A;  5IXF A;  2KK4 A;  4HCB A;  1VQ4 T;  2KRN A;  3G4S T;  3L1A A;  4FT4 A;  3BW1 A;  2YUN A;  3SWN B;  2XID A;  3FEO A;  3M0U A;  5J26 A;  2GQV A;  2DF6 A;  1G83 A;  3VS7 A;  2DM1 A;  1W2B P;  3H0F A;  3EGD A;  2FZK B;  2MMP A;  1N8R C;  2CH4 W;  4PL6 A;  2K3X A;  4PJN A;  2RJD A;  1VQ8 Q;  5CKD A;  2EPD A;  4XTV A;  3L2R A;  5A0G A;  4HXJ A;  2EYX A;  2L5Q A;  3OYG A;  1ZUU A;  1W2B A;  1Y96 A;  1VQP Q;  4M7A G;  1RAC B;  5A0L A;  1TUD A;  1FMW A;  4Y28 E;  1X2K A;  3QYG B;  3EG9 A;  3A8L B;  4JRP A;  1RAA B;  4M7D C;  2VV5 A;  4RTY A;  4GY5 A;  3QPH A;  5GAM e;  3UDC A;  3G1J A;  1YIT T;  2NYS A;  1EIF A;  3R6N A;  1BCM A;  2HMA A;  3OYY A;  3CCS T;  1IZ6 A;  1IXD A;  3ZL7 C;  4JJN K;  4PJM A;  3V8K A;  4LUE A;  1XOV A;  1M1G A;  1Q81 C;  2DL5 A;  1S72 Q;  3N5B B;  1K9M C;  3OY9 A;  2A28 A;  2ZPF B;  2HBW A;  3EH1 A;  1WPY A;  2YLB A;  4F7U A;  4RTZ A;  1DJ7 B;  3PT9 A;  1B07 A;  3I55 A;  2EYW A;  1SG5 A;  2YDL A;  5CAI A;  1WXB A;  4B9W A;  3OW2 P;  5LJ3 f;  3VS3 A;  4IUT A;  4JS4 A;  1AHJ B;  4PKC C;  1YHQ T;  5GAN 6;  4DBF A;  2OTL Q;  1M4Z A;  2CT4 A;  3RMS A;  1YJ9 A;  2HBP A;  4C92 B;  2CUD A;  4OGE A;  4RG2 A;  3CCR T;  3JRZ A;  4E7J A;  5EC7 A;  2EGA A;  2HEQ A;  1TSF A;  4J9F A;  4EIK A;  2DL3 A;  4C92 F;  3OW2 A;  4AT1 B;  5IHK A;  5KYU B;  1D09 B;  1W6X A;  2VGN A;  2E1H A;  2QEX Q;  3DB3 A;  2W10 A;  2DLP A;  1E6G A;  4M78 D;  2A37 A;  1JU5 C;  1M1F A;  4QVC A;  4FU6 A;  2ZPG B;  3JB9 H;  4D6W A;  4XU3 A;  2BE7 D;  2DXT A;  1WDX A;  4QVZ A;  1M5Q 1;  3V7R A;  3ZBD A;  3OYB A;  3CCV T;  1W2B S;  2EGC A;  4C5I A;  5I2M A;  2C0T A;  1A0N B;  1R77 A;  3QG1 A;  1M1K U;  1N5Z A;  2COY A;  3CCL A;  3V8L A;  3WVE B;  2CKK A;  3REB B;  2JZ2 A;  2R5A A;  4LE9 A;  1AWO A;  4M7D A;  5M9O A;  3RNJ A;  1GFC A;  3E19 A;  2RQW A;  1VQ6 A;  1UG1 A;  3BY7 A;  1OUL A;  4IIO A;  2MK5 A;  2EGE A;  5J3B A;  4LNP A;  3X28 B;  1KC8 R;  2HL5 C;  3I55 Q;  2RI2 A;  2MWO A;  1TUC A;  1ZA1 B;  5AYF A;  1GBQ A;  4BE2 A;  2V8I A;  4C5G A;  4LDU A;  1NLO C;  3CCM A;  2F5K A;  2FG0 A;  3EG0 A;  1JRI A;  2CZ1 B;  2ESW A;  4RTT A;  4M7A D;  1KQ1 A;  1VQ9 A;  4RKU E;  2YRV A;  4FYX B;  1Q7Y R;  3CBM A;  5GMK h;  3QXE B;  4NOY A;  3EFS A;  1EZZ B;  5DM7 R;  1GRI A;  2RQR A;  3QKJ A;  4DEY A;  3OW2 S;  3Q1J A;  4HVW A;  4NL3 A;  2O4X B;  2ED1 A;  1BI1 A;  1D0Y A;  1WQ7 A;  1MMD A;  3PTA A;  1VQ4 A;  1R0B G;  4DEX A;  2CP0 A;  4ZGD B;  3GPL A;  1M90 C;  3C0C A;  3SWN C;  3PIP A;  3CCL Q;  1K4U S;  4BAC A;  1QWE A;  1LNX A;  2DTO A;  1K8A C;  3BDL A;  2XHC A;  2EWN A;  2EYY A;  4LDW A;  1B3Q A;  3JCM V;  2ED0 A;  5HK0 A;  4M75 G;  4F04 B;  4PJO D;  2ENM A;  3H8Z A;  3I56 A;  2LJ3 A;  5GAN d;  3G7Z A;  1NLP C;  1ZBX A;  1Y7X A;  2EFI A;  1VQL T;  1SPK A;  3OYK A;  2EBP A;  5LJ5 f;  2BZY A;  2HNI A;  2YT6 A;  1E6H A;  4OB2 B;  2HKQ B;  5GAN h;  1I1J A;  3CCM Q;  4BE0 A;  2XDP A;  2RQT A;  1YIT A;  3CCQ A;  1MNE A;  2E3H A;  2KAF A;  4XU2 A;  5LJ3 j;  2KRS A;  1VQ9 Q;  4E7L A;  1K76 A;  2J05 A;  4O5V A;  3HRU A;  1N9R A;  2FHD A;  2QQB A;  2XDB A;  3SDZ A;  3P8D A;  3UPU A;  3NGP A;  4F7U E;  3L2W A;  1JJ2 P;  4IKF A;  1VQ4 Q;  4PJL A;  4RTU A;  5GAO q;  3EFO A;  2F1L A;  3HL8 A;  2ZCF B;  2VB6 A;  5KYY B;  2J6K A;  4LDX A;  2VAS A;  2L3Q A;  2MWP A;  3LH0 A;  5IN1 A;  4C92 C;  3CCR A;  2AKK A;  3LWH A;  3SB2 A;  3WXM B;  2GNC A;  1IHW A;  2HCK A;  2QGG A;  3LGL A;  2LNH B;  2CP3 A;  2LQ8 A;  3AT1 B;  4GBQ A;  1KD1 U;  3OS2 A;  5CKE A;  2DNU A;  1K1Z A;  2F2W A;  1G8X A;  4AG2 C;  1WYX A;  3I56 Q;  3HP9 A;  3OYM A;  3TQ7 P;  4F17 A;  3URG A;  1OQK A;  1UUE A;  2A0F B;  3JCM f;  1X75 C;  2DBK A;  1FYN A;  2KMT A;  4KUL A;  2C06 A;  5GAN 5;  1WJR A;  3PFS A;  4E47 A;  2LMJ A;  2RB6 A;  3CCV A;  4Z02 A;  2KYM A;  3UA6 A;  3X26 B;  3EGX B;  4OGC A;  2RJE A;  1K0X A;  1C1A A;  2BIV A;  3CCQ Q;  2B8A A;  1SRM A;  2ZGW A;  3OMC A;  1ZBJ A;  3MP1 A;  2DVE A;  1VQO T;  5GMK e;  2RHU A;  4M7D E;  1SHG A;  1KSW A;  5ECA A;  3CCU T;  3E9F A;  4PNO A;  3GNG A;  3QJ6 A;  3CC7 Q;  4HA8 A;  2KYB A;  4BDZ A;  4M75 D;  3OYA A;  4MDX A;  2QA4 A;  1YI2 Q;  2XIC A;  4WCI A;  4X1V A;  2IPO B;  1AOJ A;  4JRI A;  2HAX A;  5GMK l;  5FWC A;  5HY6 A;  2D8H A;  2OTJ A;  3QDF A;  4MMK A;  2P0P A;  4KT0 E;  3JCM W;  5FRM A;  2DL4 A;  2EYQ A;  2RJC A;  4J5Y A;  1OU8 A;  4C92 A;  1M27 C;  4XAX B;  2I0N A;  2XK0 A;  5FU7 B;  4M78 B;  3NFC A;  1JJ2 S;  1KG1 A;  2LRQ A;  3CMA T;  4EMH A;  1VQ7 A;  1GL5 A;  2P4R A;  4RTW A;  4DBQ A;  2DBM A;  5KYU A;  4M78 F;  1WHL A;  3CCV Q;  4KGZ B;  1WJS A;  2OAU A;  1KQS P;  1K73 C;  2CP7 A;  2EQI A;  4FYY B;  2GF7 A;  5GAN e;  1PNJ A;  1D1A A;  2JMA A;  5LJ5 j;  2VGM A;  2RI3 A;  1TTH B;  5GMK i;  5FRO A;  5GMK m;  1OPL A;  1Q82 C;  2RH2 A;  4HCC A;  4KH0 B;  3PVL A;  4LUD A;  3CC4 A;  2DK3 A;  3FLG A;  2PNI A;  1QCF A;  2DEQ A;  2RJF A;  2G3R A;  1MHN A;  3PVQ A;  2DYI A;  2DZ9 A;  3OBY A;  1VQL A;  2GCX A;  4LD9 K;  2X35 A;  2RNA A;  3TEE A;  4A53 A;  2QA4 Q;  1RAB B;  1VIF A;  2EW3 A;  4M7A B;  4BI3 A;  1RAF B;  5L23 A;  2OTJ Q;  1GXI E;  2WAC A;  3OMG A;  1YP5 A;  1WA7 A;  3NTI A;  2P0K A;  1Y57 A;  3D7S B;  4EPC A;  4M7A F;  3VS6 A;  1VOM A;  5CIU A;  4E6R A;  4JRQ A;  1X6B A;  3RBB B;  2AK5 A;  3CBO A;  1TS9 A;  4ZGJ B;  2LX7 A;  1H64 1;  4QVD A;  2X4W A;  2DFU A;  2D1X A;  2X9H A;  1FX7 A;  2BE9 B;  1V1C A;  3LLR A;  2LQN A;  1VQ7 Q;  4E7Z A;  1MND A;  1SKU B;  3DLL A;  2O4X A;  3QYH B;  1PKT A;  2RI5 A;  3CME T;  1VQM T;  1G3T A;  2OX7 A;  5IT9 E;  1PD1 A;  1PHT A;  2MI6 A;  3TCJ A;  4PJO B;  3A8H B;  4Y91 A;  3NPF A;  2C0I A;  4PLL A;  3CC4 Q;  4WF2 A;  1GBR A;  1IGQ A;  5GAO r;  1BI2 A;  4PJO F;  1KQS S;  2X4Y A;  4D8D A;  2P84 A;  2CZ6 B;  4L5G A;  2ABL A;  1KIK A;  1VQK A;  3OB9 A;  2M1H A;  1M1K C;  3OYE A;  3C12 A;  1ZQ1 A;  3RKX A;  2H3E B;  4OMO A;  3CD6 T;  5CVI A;  1OX9 A;  1VQN Q;  4RCC A;  3M53 A;  1VQO A;  1WHK A;  1T3L A;  2E70 A;  4L6V 5;  4LD6 A;  2GFU A;  2KT1 A;  3M0S A;  3CC2 T;  2OI3 A;  1VQ5 T;  2NLU A;  1RL2 A;  4FW2 A;  2JNG A;  2PQW A;  1Q86 C;  2JW4 A;  1U1S A;  1ZX6 A;  3CCU A;  1KD1 R;  2YWW A;  1OYX A;  1GCP A;  1I0C A;  2EVR A;  4C8Q G;  1J3T A;  2AKL A;  2DMO A;  4OMP A;  3FJ5 A;  4XK8 E;  3V7C A;  1QW1 A;  3JV3 A;  3QSU A;  2E5K A;  4WTO B;  1O9S A;  3FRN A;  3ZFJ A;  1Z9Q A;  3X24 B;  3G71 Q;  1XNI A;  4PK4 A;  1C6V X;  5GAN 2;  3GLX A;  3HRS A;  5CQY A;  5I21 A;  1TG0 A;  1X27 A;  3NMZ C;  3UWN A;  3QO3 A;  1R0C B;  2KRM A;  4TVR A;  2JUF A;  5KYY A;  3OYJ A;  3C4S A;  1UGV A;  5LJ3 g;  2KXD A;  4DOV A;  3HPW A;  2P0Q A;  3P8B B;  5FU7 C;  4M78 C;  1IO6 A;  4C92 E;  2GFA A;  2K4Y A;  5D6Y A;  2K5L A;  2DXC A;  2JTF A;  1YJN T;  4NS5 A;  2O88 A;  4R55 A;  1UGR B;  1OU9 A;  1C0M A;  3G6E T;  4ATO A;  1AWW A;  3TSZ A;  2HQE A;  4Q5W A;  2K7A A;  1IB8 A;  1W70 A;  4J6X A;  6AT1 B;  8ATC B;  2NUT B;  4C5H A;  3JB9 G;  1WHJ A;  1VQK Q;  4EMK B;  1WZO A;  4QQD A;  1UJY A;  2DEU A;  2FRY A;  3M55 A;  1QCO A;  1UE9 A;  1I4K 1;  2LQW A;  1BKB A;  3QDR B;  2E64 A;  4PFO A;  3EGX A;  3M4G A;  3OS1 A;  2CP2 A;  1FMK A;  1ZSG A;  4PJO G;  1RI0 A;  2AHJ B;  2QGF B;  4MDW A;  4O6J A;  2L89 A;  2KSS A;  2JTE A;  2PVD B;  3HHT B;  3PMI A;  4M75 B;  3INZ A;  4BDY A;  1ABO A;  5GAM f;  5GAN j;  2KQW A;  3NTH A;  1CKB A;  3VS1 A;  1V76 A;  4HKE A;  2EJG A;  4M77 G;  3CPF A;  2F2X A;  1CSK A;  3CCJ T;  4M75 F;  5KYW B;  3OS0 A;  4A54 A;  2V1R A;  2HSP A;  3EGU A;  4ZNX A;  2ZAE A;  1M8M A;  3A1P A;  2NWM A;  4M7A C;  2LCS A;  2HD0 A;  1NBE B;  2F5T X;  4BY6 B;  1LCK A;  1ZSZ B;  4OVA A;  2HQX A;  4EMG A;  4M4Z A;  3THK A;  3MHX A;  1RI9 A;  4J8O A;  1VA7 A;  4MZP A;  3JCM c;  4RTX A;  2YSQ A;  4AG1 C;  1RAG B;  2Y4X A;  1X01 A;  5CQX A;  4BI8 B;  1NM7 A;  3PMT A;  1XQH A;  1Y71 A;  2C0O A;  2O2O A;  2DJZ A;  4FL6 A;  4M78 A;  1SSH A;  1Q95 G;  4LDY A;  2QQA A;  3UA7 A;  1U3O A;  2A36 A;  4FT2 A;  4FW1 A;  1ZUK A;  1LJO A;  2LC4 A;  3CME A;  1VQM A;  2R5M A;  5IHN A;  4C8Q D;  3DKM A;  1SF9 A;  4JZ4 A;  3ER0 A;  2FO0 A;  3ASK A;  2VKN A;  1PRL C;  1N8R U;  1YJ9 Q;  3CCE T;  5KYX B;  4PJO C;  2AZV A;  3DLM A;  1YNZ A;  3OA6 A;  3TVT A;  4CC7 A;  3OSS C;  3OYC A;  2DL8 A;  2J7I A;  1UJ0 A;  3ULR B;  3DB4 A;  4ZN1 A;  4J9G A;  9ATC B;  2FL7 A;  1D1B A;  5IAY A;  3G4S A;  1QVF P;  4QKU A;  3EHQ A;  4ANJ A;  1FXX A;  1YCS B;  4JLI A;  2PUK B;  4XTU A;  2GTJ A;  3JB9 D;  3RKY A;  4R56 A;  4M7A A;  1BBZ A;  4MZT A;  5LJ5 g;  1Q81 U;  3CC2 A;  1PM3 A;  1K9M U;  2OAW A;  1QKX A;  4BD3 A;  1I8F A;  4CC3 A;  1H3H A;  4FSX A;  1LOJ A;  4N0A C;  1KQ2 A;  2GBQ A;  2JN0 A;  3C95 A;  4XTZ A;  4Z88 A;  1AWX A;  1QVF A;  1VQ6 Q;  1YJW T;  2QI2 A;  1IRX A;  1G3S A;  2RK2 A;  2X4J A;  2KDS A;  4OB0 B;  2X3W D;  1YIJ T;  2EKH A;  3T9N A;  3NHN A;  1JEG A;  1X69 A;  4M77 D;  2CS7 A;  2ZZD A;  3MP8 A;  2WSE E;  3ME9 A;  2QQS A;  3CCS A;  1ZA2 B;  4QW2 A;  4FIB A;  1KK7 A;  1YJN A;  2K3B A;  3E9G A;  3QBY A;  2WSF E;  5D6W A;  3MEW A;  4A63 B;  1CKA A;  3VUZ A;  2VXE A;  3L2Q A;  3G6E A;  2DIL A;  3OYI A;  4JPB W;  3GP8 A;  2L8D A;  5CR2 A;  3M58 A;  3M4Y A;  4J9E A;  2HKN A;  1BIB A;  1H8K A;  2E6N A;  4F14 A;  5GAM j;  1UTI A;  3KFV A;  5CKF A;  1UEB A;  1WHG A;  3TU4 K;  4DBH A;  2M0O A;  2XDD A;  3G4S Q;  3MET A;  4EMK C;  1M2O A;  3JCM X;  1YHQ A;  2FZG B;  3JCM g;  3A98 A;  2K79 A;  5FW9 A;  1TUG B;  3SWN A;  1VQ8 T;  2DTI A;  1I81 A;  2CGH A;  2E41 A;  4M75 C;  1KC8 C;  1NE8 A;  3EG9 B;  3GBQ A;  3RMQ A;  2E65 A;  1QVF S;  5C0M A;  2HZY A;  4RUG A;  3CXC P;  1UHF A;  3JSC A;  2JT4 A;  1RLP C;  3CCJ A;  1VQP T;  2ATC B;  1WQW A;  3QUI A;  3MEU A;  2PVG B;  3OS5 A;  4BY6 C;  2LJ1 A;  1M3B A;  5DLQ E;  1ZSZ C;  1ZHI A;  2LTO A;  5CKH A;  4F16 A;  2RK1 A;  4AFZ C;  2VVK A;  2XMF A;  1Q7Y C;  1YIT Q;  2F2V A;  1S72 T;  1VYT A;  3CCS Q;  3P8H A;  1PSE A;  3FC3 A;  3CXC A;  2SEM A;  2W0Z A;  1XJW B;  1M3A A;  2GQI A;  1WX6 A;  2EAY A;  4PFP A;  1KJW A;  2O9S A;  1TOV A;  3VYG A;  2DA9 A;  4AMC A;  2I2L A;  3FDR A;  4M78 E;  1M90 U;  4AFS C;  2OTL T;  2M9U A;  2D6F A;  4HT9 A;  4P5N A;  3RER A;  4OB1 B;  2DIQ A;  2DTH A;  3LH5 A;  5L8R E;  2F69 A;  1YHQ Q;  2YRC A;  2E12 A;  3VRY A;  1ABQ A;  5CK9 A;  1SSF A;  3MP6 A;  2L3P A;  1GCQ C;  3M54 A;  1K8A U;  5C6S A;  1RUW A;  4EMK A;  1BU1 A;  3CCR Q;  4Z89 A;  1FMV A;  3UF4 A;  4AFQ C;  2CZ7 B;  2IVW A;  2QEX T;  1NJI C;  2X3X D;  1QCN A;  3LYI A;  2KE9 A;  3V7S A;  2EKO A;  2M16 A;  4A4K A;  1WNL A;  3KUF A;  4KUD K;  2HSE B;  4X9C A;  4M75 A;  3OYH A;  4LN2 A;  3C94 A;  4QQ6 A;  1X6O A;  5LJ3 d;  2FPE A;  1YWP A;  1LVK A;  2EIF A;  5FRN A;  5KYN A;  1M8V A;  4E7S A;  4JZ3 A;  2K57 A;  4BUG A;  2JMC A;  1OOT A;  2JM9 A;  2KBT A;  2MIO A;  1X43 A;  5LJ3 h;  1G3W A;  1ZSZ A;  2LCC A;  4M7A E;  1N8R R;  2LJ0 A;  3CXC S;  2DVJ A;  2IIM A;  1F1B B;  1NYG A;  4IUV A;  2QYZ A;  1VIE A;  2JXB A;  3S3N A;  1B34 B;  3I55 T;  1M3C A;  2PU9 B;  3EG3 A;  3FJP A;  1WLP B;  2H8H A;  4C8Q B;  2EQJ A;  4HVV A;  4A4G A;  4DA4 A;  5AT1 B;  1TU0 B;  1YIJ A;  2AIR B;  3LX7 A;  3M59 A;  2CYZ B;  1B7T A;  5CCA A;  2ROL A;  2FPD A;  3CPW P;  2FRW A;  4C8Q F;  2YRD A;  4ME7 A;  3VKI A;  3EFR A;  4F7U G;  4UC4 A;  1HK9 A;  1UGP B;  3QJY A;  4J9D A;  5EG2 A;  1IHV A;  3MO8 A;  5GAN f;  1Q81 R;  5HKC A;  2KEA A;  1K9M R;  1I07 A;  2VYT A;  2CSI A;  3O5Z A;  4ELZ C;  3IQL A;  3CPW A;  4RG8 A;  1YFN A;  1T0J A;  3BFM A;  4E7H A;  1QVG P;  3O8V A;  5A0D A;  2QDY B;  2JJ9 A;  2DXU A;  2DXB A;  3CCL T;  2K2M A;  4B9X A;  2GTO A;  1OPK A;  1BYM A;  1ZLM A;  2ZPE B;  4JDS A;  5I2S A;  3JB9 F;  3HSB A;  4C5E A;  3M0R A;  4DOW A;  2RQU A;  1AZG B;  5FLX E;  2H3J A;  4ELY C;  2BTT A;  4OB3 B;  3S3M A;  1QVG A;  5KH6 A;  4NL2 A;  3EH2 A;  2FEI A;  2ZPH B;  1VQP A;  1VQL Q;  5GAO n;  1ZUY A;  4PJJ A;  4M77 B;  3CCM T;  2CH4 A;  2Z0W A;  4CC2 A;  2VWF A;  5FU6 B;  2JVV A;  1JB0 E;  1OZ3 A;  5HCK A;  4M7D G;  3LWI A;  1WFW A;  2JTM A;  2KNB B;  1WHM A;  2FYK A;  1VQ9 T;  2YUO A;  2K3Y A;  4DBR A;  3GNF B;  4M77 F;  1S72 A;  1G2B A;  3MJX A;  5D7U A;  3VU3 C;  4KGX B;  3JB9 I;  1QLY A;  2BUD A;  2GGR A;  3EFO B;  3OYN A;  1TXQ A;  1S1N A;  1NZ9 A;  4ZTJ A;  2EQU A;  3CEY A;  1T0H A;  2IG0 A;  4C0D B;  3CPW S;  2OTL A;  2JM8 A;  3SFM A;  3RIR A;  2RD1 A;  5I11 A;  5LJ5 d;  3MEA A;  5J39 A;  1K73 U;  3A8M B;  4ZTF A;  2KXC A;  3S6W A;  2DER A;  3BE3 A;  4OMF B;  3AHU A;  1E7O A;  1Q82 U;  2RN8 A;  2DRM A;  1P92 A;  5GMK j;  5LJ5 h;  2XKO C;  5CO7 A;  1QKW A;  1K9A A;  4RCB A;  3RES A;  5GAO l;  5LJ3 e;  1N9S A;  2QEX A;  2V8K A;  3I56 T;  3UT1 A;  2HDA A;  1QVG S;  4FYV B;  1EX4 A;  2V1Q A;  2E4H A;  3HFN A;  1OV3 A;  4II1 A;  3CMA A;  2CP5 A;  3LGF A;  1NPR A;  1R8O B;  2P4T A;  1AZE A;  2QG9 B;  1UGS B;  2A7Y A;  4M75 E;  4OF1 A;  3RUX A;  1UB4 A;  3SHW A;  2J6O A;  5IH2 A;  3CCQ T;  4OMM A;  2HL3 A;  1M90 R;  4OMQ A;  5GAM g;  4CI0 C;  2FVU A;  1D3B B;  2BZ8 A;  2K5F A;  3H6Z A;  5GAN 4;  2DYB A;  4JJC A;  4E7K A;  2LQK A;  4Z8A A;  3OBW A;  2XU8 A;  1AD5 A;  2NUP B;  4A4H A;  2KRO A;  3JCM J;  3F70 A;  1K8A R;  3VS5 A;  4E7I A;  1VQO Q;  3A5Z B;  3OQ5 A;  1AEY A;  3CC7 T;  1I5L A;  5GAO m;  2DO3 A;  2QTX A;  4FCY A;  1QMC A;  2A08 A;  3CCU Q;  1YI2 T;  4C8Q C;  4KH1 B;  1PG5 B;  2EYZ A;  2K5I A;  3JCM d;  1WXU A;  1M2V B;  5GAN 7;  1MMN A;  1O75 A;  2CRE A;  2QAZ A;  2RM4 A;  1V29 B;  3VS2 A;  1KHI A;  3M56 A;  3I5R A;  2LCL A;  2M0Y A;  3JCM h;  4C0G A;  1ACM B;  2O01 E;  4X34 A;  1MV0 B;  2MOX A;  1H3Z A;  4M7D D;  1T3S A;  4AFU C;  1OI1 A;  1JXM A;  3GF5 A;  4KUI A;  1SHF A;  2DE0 X;  2K2V A;  1BIA A;  2MYS A;  3E1S A;  4ZGE B;  1XTD A;  2DAQ A;  4PLI A;  3CMA Q;  4C0F A;  4FM4 B;  3J7A F;  1PCX A;  3VJP A;  1X2Q A;  2KVQ G;  4GLK A;  2X51 A;  2JS2 A;  2A3L A;  1JO8 A;  4C0Z A;  2CSQ A;  1TWB A;  2PUO B;  3M5A A;  3U23 A;  1N27 A;  1PWT A;  2K6D A;  5KE3 A;  4BE1 A;  1Q86 U;  2EJ9 A;  4J83 A;  3V8J A;  1UDL A;  1RAI B;  2AT1 B;  1KD1 C;  3EG2 A;  2PVO B;  1SEM A;  3JCM b;  2COW A;  1WXT A;  2D0N A;  1VYV A;  2M02 A;  2FB7 A;  2QA4 T;  4JLG A;  3REA B;  2YLC A;  1FWZ A;  4BI4 A;  2CP6 A;  1NEG A;  2JOY A;  2E5Q A;  4M77 C;  1B34 A;  1HSQ A;  5I22 A;  1MUZ A;  2OTJ T;  5DY9 A;  1QQJ A;  5FU6 C;  4C8Q A;  4ZN3 A;  3HKS A;  2CDT A;  2J06 A; 
#chains in the Genus database with same CATH homology
 1WA7 A;  4F16 A;  4QT7 A;  1K0S A;  4AFZ C;  2VVK A;  2XMF A;  1H92 A;  3R6N A;  1Y57 A;  2DX1 A;  3M0P A;  2F2V A;  3ZL7 C;  4LUE A;  1VYT A;  1XOV A;  3VS6 A;  4E6R A;  2DL5 A;  1X6B A;  3RBB B;  2AK5 A;  1AVZ C;  1VYU A;  2A28 A;  4ESR A;  2SEM A;  2LX7 A;  2W0Z A;  1M3A A;  1HD3 A;  2HBW A;  2L2P A;  4RTZ A;  1ARK A;  2GQI A;  1WX6 A;  2D1X A;  1KJW A;  1V1C A;  2O9S A;  1B07 A;  3I9Q A;  2EYW A;  2LQN A;  2YDL A;  1Y0M A;  2DA9 A;  1WXB A;  3VS3 A;  4AFS C;  1PKT A;  4IIM A;  3QWX X;  3LH5 A;  2CT4 A;  5IHI A;  1EFN A;  2CUD A;  3VRY A;  1ABQ A;  1PHT A;  2LZ6 B;  1SRL A;  1NYF A;  2RPN A;  2L3P A;  1GCQ C;  1RUW A;  1BU1 A;  2RF0 A;  5EC7 A;  4Z89 A;  3UF4 A;  4AFQ C;  3NPF A;  2C0I A;  2EGA A;  1X6G A;  2HEQ A;  2M51 A;  3VS0 A;  1GBR A;  4J9F A;  4EIK A;  2DL3 A;  2X3X D;  5IHK A;  1W6X A;  2KE9 A;  5GJV B;  3VS4 A;  2CT3 A;  1WIE A;  2L0A A;  2W10 A;  2DLP A;  4D8D A;  1E6G A;  2A37 A;  1JU5 C;  1QWF A;  2ABL A;  5IXB A;  4LN2 A;  1KIK A;  1JXO A;  1WDX A;  2EGC A;  2FPE A;  2C0T A;  1YWP A;  3EHR A;  1A0N B;  1N5Z A;  1WI7 A;  1HJD A;  4JZ3 A;  3QWY A;  2QDL A;  1YN8 A;  4OMO A;  2JMC A;  1OOT A;  2JM9 A;  2KBT A;  3REB B;  2MIO A;  4LE9 A;  1X43 A;  1AWO A;  1T3L A;  3RNJ A;  1GFC A;  2KT1 A;  3M0S A;  2OI3 A;  2LJ0 A;  2DVJ A;  2JW4 A;  2IIM A;  2LP5 A;  3H0H A;  1ZX6 A;  3I35 A;  2RQW A;  1NYG A;  1UG1 A;  2PTK A;  1GCP A;  2JXB A;  1YWO A;  1M3C A;  1I0C A;  2EVR A;  3EG3 A;  4IIO A;  4J9B A;  2EGE A;  4LNP A;  1WLP B;  2H8H A;  1J3T A;  4R0K A;  2YUQ A;  2AKL A;  2DMO A;  4HVV A;  3FJ5 A;  4OMP A;  5FWB A;  1TUC A;  3JV3 A;  1GBQ A;  2KR3 A;  2E5K A;  1NLO C;  1Z9Q A;  4ORZ A;  2FG0 A;  3EG0 A;  2ROL A;  2FPD A;  2FRW A;  2ESW A;  4RTT A;  1TG0 A;  1X27 A;  3NMZ C;  2KRM A;  2FPF A;  3PE0 A;  1UGV A;  2KXD A;  4Y92 A;  4J9D A;  3H41 A;  1U06 A;  2KEA A;  1IO6 A;  1I07 A;  1GRI A;  2RQR A;  4DEY A;  4JJD A;  4J9I A;  4HVW A;  4K11 A;  2CSI A;  2O88 A;  2ED1 A;  1PKS A;  3O5Z A;  3IQL A;  3H0I A;  1AWW A;  3TSZ A;  1BK2 A;  1T0J A;  2K7A A;  1W70 A;  4DEX A;  2KGT A;  3EG1 A;  3C0C A;  1UJY A;  4HCK A;  2FRY A;  2K2M A;  1UE9 A;  2KT8 A;  2LQW A;  1K4U S;  2NUZ A;  2GTO A;  1OPK A;  1M30 A;  1ZLM A;  1QWE A;  2RQV A;  1FMK A;  2EYY A;  3M0R A;  1B3Q A;  1ZSG A;  2RQU A;  2G6F X;  1AZG B;  2ED0 A;  2L3S A;  2JTE A;  2BTT A;  2DJQ A;  5GJW B;  2ENM A;  2LJ3 A;  1ABO A;  1NG2 A;  1CKB A;  1NLP C;  3VS1 A;  2FEI A;  1SPK A;  2EBP A;  1JQQ A;  2BZY A;  1ZUY A;  2F2X A;  1CSK A;  2YT6 A;  1E6H A;  1AWJ A;  2CH4 A;  2PZ1 A;  2V1R A;  2HSP A;  3EGU A;  4ZNX A;  4CC2 A;  1OEB A;  1M8M A;  2VWF A;  2NWM A;  1I1J A;  2LCS A;  5HCK A;  2RQT A;  3UAT A;  1LCK A;  1WFW A;  2KNB B;  4M4Z A;  3THK A;  2YUO A;  2KRS A;  1G2B A;  1RI9 A;  1K76 A;  1MV3 A;  1VA7 A;  2J05 A;  1QLY A;  2MCN A;  1KFZ A;  2DRK A;  4RTX A;  2YSQ A;  4AG1 C;  2BZX A;  2GGR A;  1NM7 A;  3NGP A;  1U5S A;  2O31 A;  1S1N A;  2C0O A;  2O2O A;  1SSH A;  1UFF A;  4OML A;  1T0H A;  2D8J A;  3UA7 A;  3M0Q A;  1U3O A;  2A36 A;  1GFD A;  2JM8 A;  1ZUK A;  5I11 A;  4RTU A;  5IHN A;  2KXC A;  3M0T A;  2J6K A;  4RTV A;  3CQT A;  2L3Q A;  4JZ4 A;  4CC4 B;  1E7O A;  2FO0 A;  2RN8 A;  2RMO A;  2AKK A;  2DRM A;  2VKN A;  1PRL C;  3SEM A;  2JS0 A;  2GNC A;  1QKW A;  2HCK A;  2LNH B;  2AZV A;  1W1F A;  1K9A A;  1YNZ A;  3TVT A;  4GBQ A;  4CC7 A;  1UEC A;  4GLM A;  4FSS A;  2DNU A;  1K1Z A;  2F2W A;  2HDA A;  4AG2 C;  1WYX A;  1Z9Z A;  1GCQ A;  2DL7 A;  2V1Q A;  4F17 A;  1OV3 A;  2DL8 A;  2J7I A;  2O9V A;  1UUE A;  2DBK A;  1FYN A;  1UJ0 A;  3ULR B;  2LMJ A;  4J9G A;  2KYM A;  3UA6 A;  1AZE A;  1PRM C;  2YUP A;  3SHW A;  3VRZ A;  2J6O A;  1K0X A;  5IH2 A;  4OMM A;  3EHQ A;  4J9C A;  1YCS B;  4OMQ A;  2GTJ A;  2BZ8 A;  1SRM A;  2DYB A;  4HVU A;  4JJC A;  1BBZ A;  4OMN A;  1ZBJ A;  4Z8A A;  2OAW A;  1AD5 A;  1QKX A;  2KRO A;  3VS5 A;  4CC3 A;  2SRC A;  1H3H A;  1SHG A;  2GBQ A;  1AEY A;  2B86 A;  1KSW A;  5ECA A;  4Z88 A;  1AWX A;  1RLQ C;  2A08 A;  2KYB A;  3TSW A;  1BB9 A;  2ROT A;  2AZS A;  4WCI A;  4X1V A;  2EYZ A;  1WXU A;  1AOJ A;  2CRE A;  2OJ2 A;  2X3W D;  3VS2 A;  1NEB A;  2ECZ A;  2EKH A;  1UHC A;  3NHN A;  5FWC A;  1JEG A;  2D8H A;  3I5R A;  2M0Y A;  1X69 A;  4JJB A;  2J6F A;  1MV0 B;  2MOX A;  2CUB A;  3I5S A;  2DL4 A;  1T3S A;  1M27 C;  4AFU C;  4KRT A;  2I0N A;  1JXM A;  4D8K A;  1SHF A;  2DE0 X;  2K3B A;  4A63 B;  1CKA A;  2DIL A;  4J9H A;  2K9G A;  1GL5 A;  2P4R A;  4JPB W;  5IXF A;  4RTW A;  2DBM A;  4J9E A;  1H8K A;  2KRN A;  4F14 A;  1UTI A;  3KFV A;  2YUN A;  1X2Q A;  2EQI A;  3M0U A;  1PNJ A;  2JMA A;  2DF6 A;  1G83 A;  3VS7 A;  2JS2 A;  2DM1 A;  1JO8 A;  2CSQ A;  3H0F A;  3U23 A;  1OPL A;  1PWT A;  3A98 A;  2K79 A;  2K6D A;  5FW9 A;  2CH4 W;  3PVL A;  4LUD A;  1UDL A;  2PNI A;  1QCF A;  3EG2 A;  1SEM A;  3PVQ A;  2D0N A;  1WXT A;  3GBQ A;  2EPD A;  1VYV A;  3REA B;  4RUG A;  2RNA A;  4HXJ A;  1UHF A;  2EYX A;  1RLP C;  2JT4 A;  1ZUU A;  1NEG A;  1HSQ A;  5I22 A;  1MUZ A;  2EW3 A;  1TUD A;  5L23 A;  1X2K A;  2LJ1 A;  1M3B A;  4RTY A;  2CDT A;  2J06 A;  1YP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...