4E71A

Crystal structure of the rho gtpase binding domain of plexin b2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
90
Chain Sequence
EYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRPDSVVLEWRPSTAQILSDLDLTSQRWKRVNTLMHYNVRDGATLILSKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RHO GTPASE binding domain of Plexin B2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Plexin-B2
total genus 20
structure length 90
sequence length 103
ec nomenclature
pdb deposition date 2012-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4e71A00
4MEMA 3AU4A 3H7PB 5G2NA 2KDEB 3PHXB 1OQYA 1WGDA 2R2QA 1WZ0A 2KX3A 3PGEA 4TQ0A 2RPQA 4W9CA 4WJNA 3U30A 4BFRA 3HHMA 1WE7A 2JZZA 4CHKA 2CS4A 1WGYA 3ZUNA 4DWFA 3MJWA 4MGZE 2MX2A 2ZNVC 3V6CB 1U4AA 2KWCA 2BGFA 2KMAA 3A4SC 3RYTA 4HWIB 4IWPA 1WMHA 2N9XA 1HE8A 1P98A 2C7HA 4MM3A 1P3QU 2BWES 4IM0A 4IM3A 4HJKA 4J6IA 3R7RA 3ZRFA 1RRBA 4AWJA 2C9WB 4FADA 2G4DB 4WAAA 4NQLB 1V81A 2KN5A 3PREA 3S2AA 2M1MA 1ZGUB 5AZGA 3QHTA 4NAWB 2EKEC 2CKHB 2A5UA 4HXDA 2QHOA 4M0WB 3ZNID 1WXVA 4CO7A 2BKFA 2GBKA 1D3ZA 1QZEA 2LWPA 4GDLA 3B1LX 1R4MI 2LD9A 2D11A 2MBOA 2MRPA 5AZFA 5CHFA 5DPSA 2N4FA 2KTRA 4XX5A 4ZYNA 3QC8B 4JIOU 1WH3A 4IG7B 2CU1A 4TKNA 1WGRA 3K9PB 1I35A 3QQ8B 4KSLC 2IZVB 2ZPNA 2MCNB 1J19A 2G45B 3A9KB 1EF5A 3VH4B 3DVNV 2LVQA 4G3XB 2KX0A 3ML8A 4KIKA 4KSKC 2ZCCA 4MGIE 2NPTB 4MSMB 4XZ4A 1WR6E 4JLCA 3WA0A 2KDBA 2BKRB 2J0KA 3CSTA 4W9JA 3PLVA 3BINA 3ALBA 3WAMA 2KLGA 2JF5A 2KMCA 1V6EA 1WFYA 3UQBA 3WIMA 1Q1OA 1YIWA 1EO6A 4ICUA 2KHWB 2UWQA 4W9DA 5HKHA 2LRUA 3RT3B 1UZXB 2KDIA 2N9EB 2M0XA 2IYDB 2XEWA 1WI0A 2L05A 2L0TA 1ZKHA 2WDTB 3H6NA 1TBEA 4W9IA 1RFAA 2DENB 2MP2B 5J18A 2MWSB 3NZUA 1LM8B 1IP9A 1YJ1A 1X1MA 2KK8A 2Z59B 3VUWA 2IO2B 4E3CA 2BYVE 2KO3A 1M94A 1YX5B 2ZCBA 4M8NA 3PTFC 3SHQA 2AYOB 1RAXA 2KDFB 2BPSA 2ZZPB 3DQVA 3EHVA 1JRUA 2B3AA 2IY1B 3H7PA 5CTRC 4WWOA 3L13A 2KC1A 4BOSC 4WWPA 1WXMA 1GUAB 3CF6E 3PRZA 5J17A 4OVUA 4TV3A 4KDLB 2ZVOA 2NPTA 3P2BA 2FAZA 2C5LC 4GSWA 3DBRI 3ZW3A 2GOWA 1SGHA 3AXCA 3U7DA 1Y8RC 4NNJB 2JY6A 2JZ3B 2LGXA 4ANWA 3VFKA 1WXAA 4MELA 2EMTA 4IM2A 2Z0EB 4DXAB 4KIKB 2RSUA 1A5RA 4KZ0A 3WAOA 2HTHA 4W9HA 1V86A 3DOWA 2KLCA 3D32A 3IG3A 4JL9A 4W9EA 3HM6X 2NVUI 3DVGY 2O6VD 3VTWA 1NDDA 2MQJA 4K7UA 1ZW7A 2UYZB 2PE9A 3LDZE 4PS8A 3K9OB 4BKSD 4NJ7A 4EZJA 4MSQB 3ECIA 1OEYA 3UQAA 1OGWA 2CHWA 3DBSA 2NBVB 3V6EB 4MDKE 5D94A 1SIFA 1E8YA 3GZNI 2MBEA 1KJTA 4HDOA 4JQWC 2FCQA 3KUZA 2DZJA 1C3TA 5BO4B 2YVCA 2GMIC 2JPHA 3WALA 3B0AA 2MW5A 1XQQA 2BYEA 2GBMA 1V2YA 2MBHA 1WY8A 3EC8A 4M8MA 1TGZB 1XD3B 2NCNA 2ZVNA 1V9JA 1Q5WB 3NOBA 1WJ4A 3A4RA 2LUEA 2N7DA 2AL3A 1WF9A 5EDSA 2DAFA 4BBNF 3N32A 4NJ6A 2OOBB 4A20A 3TL5A 4G11A 5TR5A 5IA7A 2L7RA 3PHWB 4EEWA 4FA6A 4HCNB 5CX3A 5L95C 2G4SA 4WWNA 3DVNU 5KHOA 2XK5B 3CSFA 4MGKE 2MBBB 3WAPA 3RZWC 1P9DU 4DDGD 3RCZA 4GU2A 1WXSA 4E74A 4NAWA 1P1AA 1UBIA 2XK5A 2LI5A 1F9JA 2PPHA 2AWTA 2ZPYA 1E7UA 3V60A 1WM2A 2G3QB 4PYZA 4PS3A 1PQSA 2IO1B 4LDTD 2LGYA 3NS8A 3VAWA 2R2OA 5LXIB 2N9PC 4KV2A 2GBRA 3UINB 3V62A 2WX1A 3ZVVA 3ONSA 3N30A 1VCBA 2DZMA 3A9KA 2K8HA 4GDLB 2IBIB 2HE7A 3NHEB 2D10A 3RULA 5C1ZA 1E5WA 2PE6B 4K81A 2ZJDA 4PS7A 4DHJB 3HK0A 1UBQA 1TZ1A 4FJVB 4ASWC 2DAJA 2FCMA 2Y5BB 3PPAA 4ANVA 1UH6A 2NR2A 1V80A 4PYUA 1AARA 3AU5A 4AJWA 4EUTA 5CHVC 3M95A 4LCDE 3SD5A 4FULA 4IW0A 4EFOA 4WQOB 1KOTA 4IC7B 3MHSD 1UD7A 3B08A 1G6JA 3HM3A 2FUHB 5GMVA 3GOEA 2M4NA 1RLFA 1WJ6A 4NPNA 2L76A 2REXA 1Z2MA 3OJ4B 4NY0A 4W9KA 3A9JB 3IFWB 1L2NA 2LRWA 1E90A 2WX0A 3PLUA 1J0GA 1LFDA 1WGHA 2DHZA 3QWZB 2GBJA 3A9JA 4N9F4 3RD2A 2YLMA 2KTRB 3LJ3A 3DBLI 4ANUA 4KDIC 5DPTA 4DHJD 2NBWB 2AL6A 3A1QB 2W9NA 3APCA 2LASA 4W9LA 5E6PA 5E6NA 5DPWA 2BF8B 4K7WA 5JH5C 3JSVB 3L16A 2N1WA 3M62B 2KJ6A 2LXAA 1UELA 3TMPB 1SE9A 2CHXA 2ZNVB 2ASQA 4FLHA 4IWQA 4II3B 4ZRJA 2WYQA 1Z5SB 2C7NB 3PS6A 3ZKJC 3R66C 2L0FA 1V5OA 3AULA 3DPDA 2N7EA 1WJUA 1I42A 4LDTB 4XC2A 1WMHB 3VUYA 5G55A 2FNJB 1WIAA 1E8WA 1XT9B 2JVCA 2O2VA 3I3TB 3O65B 5D7GA 3ZLZA 4BBNC 2L8JA 4FBJB 3T9LA 3RZFA 1EF1A 2LJ5A 4EZLA 3SU8X 2BYFA 1WZ3A 3L08A 2JUOA 5AZHA 3KVFB 3ZDTA 4DK5A 3X23A 2K6DB 2KFKB 3RUIB 1WGGA 4GDKB 4EZKA 4KZCA 1MG8A 4NQKE 3R7QA 2RR9A 2Z0DB 2NBUA 5D6JB 2L00B 4WJOA 4G50A 2HJ8A 4B9KA 1S3SG 2JXXA 1TTNA 2MSED 2KWVB 2EMSA 2V4LA 2D2QA 5JHBA 2HD5B 2N1VA 1K8RB 1YQBA 4EOYA 3C0RB 2J0JA 3L54A 4E71A 4BVUC 2C7MB 5LXHA 2CR5A 4OVVA 5CHWA 5IAAC 3L17A 4EKUA 4HK2A 2KTFA 2O6VB 4GB9A 4LJPB 3U8ZA 4WJPA 2L3ZA 4FHJA 4ZRKA 3DCGA 4GMVA 3V61A 1VD2A 3KW5B 1GG3A 4HPLB 3NY5A 4I6PA 2KFKA 2MLBA 3IHPC 2LVPA 2CHZA 4JGHB 4F7ZA 2DZIA 4IWOA 4BOZB 2K39A 3HIZA 3A1QA 3UIOB 2KD0A 1J8CA 5AEKB 4KVGB 3VVWB 3IVFA 2NS5A 3T8MA 1BT0A 3CMMB 3EECA 4B95A 4BKSA 2XBBC 1R4NI 2IO3B 4HCPB 3TJPA 3H1UA 4MJSA 4LJOB 2FIFA 4F8CB 4BKTA 5J2RA 4TUUA 2FCNA 3PT2B 3WANA 4RM8A 3X0WA 4K1RB 3EFUA 4GN1A 2AEHA 1E8ZA 2DYBA 4FHKA 2KZRA 3VUXA 3ZDMC 5KHQA 4FJYA 1WYWB 4G0NB 4W9FA 4W9GA 1WX9A 4B6WA 3Q3FA 1YX6B 5JZEB 4RMAA 3ZNZB 1WRDB 2K8BA 1OTRB 3OAWA 1WM3A 2KWUB 2K6QA 3PV1A 2VRRB 2KFJA 4URKA 1FXTB 2MA9B 3W1SC 3ZO5B 2V3SA 2LXCA 4DHZE 4ZDVA 3DVGX 3UGBB 4MH0E 1GC7A 1NI2A 1V49A 2DZKA 3KUCB 3TCAA 3JVZX 4CYEA 1IYFA 2KJRA 2DX5B 2O2VB 3H7SA 3R3MA 4GOCA 1CMXB 4HLEA 3ENEA 4ZRIA 5C23A 2FCSA 2LZ6A 4FN2A 2JRIB 4IUMB 3OLMD 4HDQA 5D2MB 1WJNA 3M3JA 3TIXA 2MBQA 3QAQA 5DCNA 3AI5A 3W1YA 2IY0B 2KQSA 1GC6A 4GGQA 5L83A 2GBNA 3PRPB 2M8SA 2K1FA 1E8XA 5FR6A 3ZTCA 4FJZA 1OEYJ 4GDKA 2C60A 3ZRCA 3M63B 3VHTC 3VTVA 2PJHA 1KLVA 4ICVA 3JW0X 5LLIA 3IBEA 2KOXA 3PSEB 2FIDA 2O6VA 3DBHI 3KYDD 3ZNHB 4X57B 2JT4B 4DHZB 5DPRA 3QX1A 1GNUA 4BKGA 3KYCD 1WX8A 3QCAA 2KQ7A 2D3GA 2KVRA 1T0YA 1E7VA 3N3KB 2KXJA 2DYMA 4DBGA 4F1SA 4GIVA 2I1KA 4GXBA 1V5TA 3ZNGC 1WR1A 3NZSA 1WX7A 3VXWA 3JYUA 4HPMB 4ANXA 2A4ZA 1UGMA 3APFA 2K25A 1LXDA 1GJZA 2WWZA 1YD8U 2OJRA 3KUDB 2JWZA 4AOFA 3A33B 1P0RA 1ISNA 3ZIMA 1H4RA 2KANA 2KC2A 2KNBA 3QK0A 2BWFA 3JSVA 4A3OA 3UIPB 3VQIA 3ZTDA 4P7IA 4MGYE 2ZEQA 3QIJA 3UF8A 2JRHA 3MTNB 3PVLA 1LQBA 2J7QB 3H9DA 2DYOA 4RM9A 4YL8A 1WE6A 3DDCB 1KM7A 1C1YB 1L7YA 2KJHB 2K8CA 4MJSB 4A3PA 3VTUA 3ML9A 5JHAA 2J0MA 3L10B 3PZDA 2KKCA 5E6OA 1Q0WB 4HVBA 1H8CA 3APDA 1EUVB 3VH3B 4II2B 1IPGA 2V1YA 3KH0A 4TQ1A 4AUQC 3OJ3A 3L0WB 2MP2A 4I6NB 4DDID 2D07B 2I1JA 2IO0B 3VDZA 1S1QB 2PEAA 3QARA 4AP4C 3Q3JA 2RD0A 3QA8A 3TBLD 4I6LB 2M17A 4K7SA 4AJYB 3PRMB 3SDLC 3W1SA 2RGFA 2LGDA 3BY4B 3QJZA 2LVOA 1NBFC 4WJQA
chains in the Genus database with same CATH superfamily
5G2NA 1MPEA 1F2RI 2INNE 3B2FA 2R2QA 4TQ0A 4LNKA 1T6BX 4W9CA 3U30A 2JZZA 4CHKA 4DWFA 3MJWA 2ZNVC 2KWCA 2LHDA 4LNFA 3RYTA 1WMHA 1FXIA 1HE8A 1I4GA 2BWES 4IM0A 4HJKA 2G4DB 2LGSA 2W82A 3FAHA 1ZGUB 3FC4A 4J3OD 1ZP0B 1YJJA 1DYQA 2A5UA 4HXDA 3ZNID 1AN8A 3AEBB 4KGRA 1RFKA 2LD9A 2MRPA 1NYRA 3QC8B 4TKNA 3K9PB 1I35A 1SXTA 3Q8BA 2ZPNA 2Z8LA 3A9KB 5E6JA 3NJTA 3DBHB 4G3XB 1K53A 1DGJA 2ZCCA 1ZUD2 2NPTB 4XZ4A 1IBXA 4KGSA 3BYTB 3AEGB 2QSDA 3GZNB 3PLVA 3BINA 3ALBA 2KLGA 2JF5A 2KMCA 3RMKC 3WIMA 1JROA 4ICUA 2KHWB 4W9DA 1UZXB 2Q5WD 2WXMA 2M0XA 1WI0A 2WDTB 3H6NA 2DENB 2BTEA 3FILB 2MWSB 4KX6B 1N5WA 4N6EB 2BYVE 2ZCBA 2SEBD 3DQVA 1I7HA 3EHVA 2IY1B 3H7PA 1GPXA 4WWOA 3R2IA 1WXMA 1F2RC 4ITKA 4OZAA 1WSPA 1P7EA 4OW0A 4M01A 4JWUC 3P2BA 3UI3A 3ZW3A 1SGHA 2JZ3B 5IP4D 1N61A 1QOGA 1HTQA 2IGGA 1D5XC 4KZ0A 1ZDXA 3WAOA 2BB5A 1CZPA 1V86A 1I4QA 1RYJA 3BK2A 2WLBA 2UYZB 3K9OB 4BKSD 4NJ7A 4EZJA 2CHWA 3DBSA 3GZNI 2MBEA 2M19A 3RI7C 2DZJA 1J7AA 5BO4B 2GMIC 1XF5L 2BT6A 4PT5A 2RDBC 3V3XA 3Q14C 2BYEA 2GBMA 1V2YA 2MBHA 1D6EC 3EC8A 1XD3B 3KWLA 4YXDB 1WJ4A 2N7DA 2JXTA 4YTMB 2DAFA 2VH2A 3AE4B 3N32A 3B2GA 1QF6A 2KT7A 2G4SA 2XK5B 4MGKE 4C80A 1P9DU 4DDGD 4GU2A 4KKIA 1WXSA 4NAWA 2XK5A 1QOAA 1F9JA 2ZPYA 2LEKA 5BYQA 3V60A 1WM2A 4PS3A 2IO1B 2XN9C 1C4PA 3NS8A 3MC8A 5GXGB 1JCKB 3ONSA 3N30A 1TYGB 3AE1B 3IAM1 3RULA 5C1ZA 2RPVA 4K81A 2FBWB 3O13A 4ANVA 2NR2A 4PYUA 4EUTA 1UWXA 3ABVB 4IW0A 4YTNB 2JWUA 3B08A 1YMHE 2BQQA 4L1BA 2UU7A 4N58A 2M4NA 1PGBA 3OJ4B 4NY0A 4W9KA 1L2NA 2KYWA 2LRWA 1F77A 2GBJA 4ZRQA 2BB6A 3RD2A 2YLMA 2KTRB 4HROA 1R4MB 1P7FA 3NRZA 2MJEA 1CK1A 5IO9A 3RN9C 4DHJD 2NBWB 2IPKD 3PZ8A 4M00A 2LASA 5E6PA 2WXFA 2KJ6A 1JALA 2CHXA 2ASQA 3PS6A 2KDMA 1GAQB 2WXKA 3R66C 2L0FA 1V5OA 3DPDA 1I42A 4NJCA 2FNJB 2O2VA 3O65B 3I63C 1RM6C 3OG5A 2K22A 3RZFA 1T5XD 3SU8X 2BYFA 3Q8FA 1QILA 3ZDTA 1YN4A 3C8YA 2JZPA 3RUIB 1MG8A 1V97A 2V0GA 2NBUA 4G50A 4B9KA 4US9A 2MSED 2MEKA 1TS2A 2IDYA 2EMSA 3IAS1 2N1VA 4TSSA 3AN1A 4EOYA 1SJED 2K5PA 2ZW1A 3R2TA 4HK2A 2KTFA 3U8ZA 1AYFA 1VD2A 2Y5PA 4HKZE 1Y56A 2KFKA 3IHPC 2KAJA 2DZIA 4IWOA 3WCQA 1XXGA 4KVGB 2NS5A 3CMMB 3EECA 2XBBC 1R4NI 3TJPA 1A70A 4MJSA 4F8CB 4BKTA 2WXLA 2MHJA 2FCNA 1NENB 1TJEA 4RM8A 1E8ZA 1ZOYB 1WXQA 3VUXA 3ZDMC 4FJYA 1TS3A 3SFEB 3Q3MC 3ZXRA 3TUOA 2QC8A 1R7SA 2VRRB 2GRIA 2W3SA 3DVGX 2BBCA 4YSXB 4C7ZA 1NI2A 2DZKA 3JVZX 2DX5B 2RDGA 2O2VB 3H7SA 4GOCA 3ENEA 4ZRIA 4RGMA 2LZ6A 1YN5A 4FN2A 2HDEA 3P4SB 3ETRA 3M3JA 3QAQA 3W1YA 3AMZA 4R3DA 2K9XA 1E6EB 4OVZA 3PRPB 1FRRA 2W3RA 2K1FA 5FK9C 3VHTC 3VTVA 3JW0X 3IBEA 1TY2A 2JT4B 5DPRA 1SEBD 1WX8A 3N3KB 2KXJA 4GIVA 4WWMA 4HRSA 1WX7A 3U4EG 1SB3C 4HPMB 1GB4A 2A4ZA 2K25A 4REZA 2WWZA 3A33B 4ZRPA 3ZIMA 1IGDA 3QK0A 3VQIA 4MGYE 4RGTA 2JRHA 3MTNB 1WE6A 2VH1A 1C1YB 2KJHB 4MJSB 3VTUA 1M4VA 1XLQA 5FR3A 4KKJA 5JHAA 3L10B 3PZDA 4HVBA 3APDA 3NVVA 2J53A 3OJ3A 4I6NB 4DDID 5LNK1 1L0XB 3VDZA 1S1QB 3GE8C 4I6LB 2LUMA 3PRMB 5HHDG 4A9AA 3QJZA 1NBFC 4WJQA 2KVZA 4NAMA 3PHXB 2I38A 1OQYA 1WGDA 4WJNA 3AE8B 1SF0A 1WGYA 2B76B 3E9SA 3ZUNA 2MX2A 3V6CB 1U4AA 3Q2AC 2DBYA 2KMAA 3A4SC 3U7ZA 4IWPA 2C7HA 1P98A 1P3QU 3URYA 4IM3A 3R7RA 3RNAC 4NQLB 2FUG1 3MC0B 3DBRB 4IOIE 2KN5A 1N5XA 4K3CA 5AZGA 5IOIA 1ZE3D 2CKHB 4CO7A 4M0WB 1WXVA 1D3ZA 2BKFA 2GBKA 1QZEA 2ACZB 3B1LX 3DBLB 1VDVA 4C4VB 2KTRA 1TKEA 4N59A 4XX5A 3VR9B 1SE2A 3QQ8B 3NS1A 3SFDB 2IZVB 2MCNB 4LTUA 2QJLA 3P63A 2LVQA 1VZ6A 4KGTA 1WR6E 3WA0A 2KDBA 3ZGZA 3WAMA 2PVOD 1Q1OA 2UWQA 4MM3B 1BUIC 1RFAA 2BS4B 4RNAA 1K50A 1UUPA 1LM8B 1B9RA 1X1MA 5G5HA 4M02A 2KK8A 2IO2B 2KO3A 4M8NA 3PTFC 3SHQA 2ZZPB 5D3DA 2B3AA 3AH7A 4OVUA 4TV3A 2ZVOA 4NZLB 1ROEA 2FAZA 4PK1A 1EM7A 3U7DA 1Y8RC 3N9YC 2LGXA 1BMLC 2EMTA 2Z0EB 4KIKB 3B9JA 4W9HA 2WDQB 3KLSX 4P1CC 2ONQA 4QAYA 4WURA 2NVUI 1TS4A 2GI9A 1NDDA 1ZXIA 3LDZE 4MSQB 3ECIA 3UQAA 1TY0A 3V6EB 1D4BA 4K3BA 4JQWC 3MHZA 3CIRB 2YVCA 2JPHA 2L32A 2MW5A 1XQQA 1DOXA 3P4QB 1TKGA 4M8MA 1AW7A 1TGZB 2WU2B 4HJGE 4C4VA 1XLPA 1WF9A 1L6UA 2CU3A 4NJ6A 2OOBB 3TL5A 5IA7A 2L7RA 3PHWB 4EEWA 4FA6A 4HCNB 4XGAB 4P1BC 5KHOA 3WAPA 1JW9D 4RCOA 4JWSC 2LI5A 2PPHA 1E7UA 4PYZA 1PQSA 4LDTD 3BVGA 2LGYA 1T0QC 3VAWA 4IDIA 4KV2A 4A90A 2WX1A 1VCBA 1FM0D 2DZMA 3A9KA 2K8HA 2IBIB 2GLSA 3P42A 2KMMA 1JWAD 3EGRA 2ZJDA 3ZJVA 1UBQA 1TZ1A 2FCMA 1DOIA 3PPAA 1V80A 1AARA 1HA5A 3AU5A 5EE1A 3M95A 3SD5A 4FULA 4WQOB 1KOTA 1G6JA 4AQ7A 4YT0B 2FUHB 1MI0A 2L76A 2REXA 3DWMA 3A9JB 4XYCA 1HQRD 1PYWD 2WX0A 3PLUA 1J0GA 4P6VF 1LFDA 2N9KA 3A9JA 1I4HA 4XWWA 1STEA 3DBLI 1I4PA 2L52A 2AX5A 3A1QB 2N0SB 4W9LA 1SE3A 5E6NA 3JSVB 3M62B 2LXAA 1UELA 4LNOA 4IWQA 4II3B 4ZRJA 2WYQA 2XNAC 1ENFA 4XC2A 1WMHB 3ZJUA 3VUYA 1SIJA 2I2YA 4ARCA 1WIAA 1E8WA 1XT9B 2JVCA 3I3TB 5D7GA 3W2DA 5IN7A 3T9LA 2JU6X 1EF1A 2LJ5A 5HI1A 5AZHA 1GB1A 4DK5A 3X23A 2K6DB 2KFKB 2ZW0A 1WGGA 2WXJA 3N20C 1OQQA 3NVYA 1JRPA 2Y3AA 4WJOA 4RGNA 2HJ8A 1S3SG 1TTNA 2V4LA 2WQYB 2D2QA 3AE9B 5JHBA 4WQMA 1K8RB 1YQBA 3C0RB 2SAKA 2WP9B 3VRBB 4ZRKA 3DCGA 4GMVA 4HPLB 4I6PA 1KF6B 2CHZA 1J8CA 5BYSA 1PDXA 3VVWB 4B95A 1QKZA 1FFVA 4BKSA 2WS3B 3H1UA 4LJOB 1KLGD 5I4DA 2J4XA 3EFUA 5KHQA 4G0NB 1F0ZA 2JYEA 1WX9A 1YX6B 5JZEB 2JQRB 1WRDB 2K8BA 3OAWA 5BYRA 3DHIC 1XO3A 1WRIA 2W54A 2LXCA 3C19A 4CYEA 1IYFA 2IJ0A 4C00A 2EELA 5C2TB 3KQ4A 1T0RC 1WJNA 3TIXA 2WXRA 3N1XC 2KQSA 1GC6A 4GGQA 2WDVB 1ACCA 1N6ZA 3ZTCA 4FJZA 3ZRCA 1KLVA 2C60A 3M63B 5JXVA 2O6VA 1RWSA 2H89B 4DHZB 4HEA1 4BKGA 3KYCD 3QCAA 1YOVB 2D3GA 1E7VA 2YEPB 3U2SC 2DYMA 3RNFC 2I1KA 3VXWA 1XEEA 2YEPF 4ANXA 3APFA 3HVZA 2DNFA 1P0RA 2WXGA 3AE6B 2BWFA 3JSVA 3UIPB 1YJIA 2ZEQA 1LQBA 2DYOA 3Q8EA 4RM9A 4YL8A 3EUB2 4A3PA 1SBBB 3ML9A 1H8CA 1EUVB 3VH3B 1IPGA 3AECB 3KH0A 2LFIA 2KWDA 2MP2A 2D07B 2IO0B 4RGOS 4AP4C 3Q3JA 3QA8A 3TBLD 2RGFA 2LGDA 3BY4B 3DHGC 2LVOA 1OFFA 2VZKD 4MEMA 3AU4A 3H7PB 2KDEB 3N1YC 1L0YB 1L4DB 2KX3A 1N62A 4BFRA 3HHMA 1WE7A 3ZJTA 4MGZE 1I4RA 2BGFA 2KQ4X 4HWIB 4XDDA 3ZXVA 2N9XA 4MM3A 1CJEA 4J6IA 3ZRFA 2OHFA 1JMLA 1GOZA 2WDRB 3NG0A 3S2AA 3QHTA 2EKEC 3J9CA 2K0PA 5T8IA 2LWPA 1R4MI 2D11A 5AZFA 2N4FA 4JIOU 1JWBD 1WH3A 3V05A 4KSLC 4P16A 3AE3B 1SJHD 4HPPA 2G45B 3LYYA 3VH4B 1L0VB 3DVNV 2KX0A 2MH7A 5AUIA 3EA6A 4MSMB 4JLCA 2D3BA 2J0KA 1YQ4B 1NYQA 1WFYA 3UQBA 1EO6A 3NVZA 2LRUA 3RT3B 2KDIA 2N9EB 3ZQ4A 2XEWA 2W55A 2L05A 2L0TA 1TBEA 5J18A 3NZUA 1YJ1A 4H2AA 2Z59B 4E3CA 2QEJC 2INPE 2BPSA 4C7YA 1KTKA 2PKOA 1JRUA 1I4XA 2KC1A 4A8XC 3FKYA 1GUAB 5G5GA 5C3JB 2LJIA 4KDLB 4WAFA 2C5LC 4GSWA 2GOWA 3LB8C 1D5MC 2JY6A 3T3NA 1VJKA 3Q3NC 4ANWA 3VFKA 1WXAA 4IM2A 2V3NA 2RSUA 1A5RA 2HTHA 1D5ZC 3DOWA 1V8CA 2KLCA 5TSSA 3VRAB 3IG3A 4JL9A 1JWSD 1FPYA 3HM6X 3VTWA 2D3AA 1ZW7A 2PE9A 4PS8A 1OGWA 2NBVB 4ACFA 3MFGA 1SIFA 4HDOA 2WNMA 5HG2A 2FCQA 1C3TA 3B0AA 1WY8A 1V9JA 1ET9A 1T0SC 2AL3A 4YWGG 2MJDA 5EDSA 3TSSA 5TR5A 5L95C 3RNEC 4WWNA 2MBBB 3RCZA 4E74A 1IUEA 1N63A 1P1AA 1UBIA 2RDHA 2AWTA 1FCLA 3GB1A 1YN3A 1OQRA 2G3QB 1KLUD 1HTOA 2N9PC 1WYGA 2GBRA 2M56B 3V62A 3ZVVA 3BWUD 4GDLB 2HE7A 3AE7B 4MH8A 5FKAC 4B0EA 3NHEB 4YSZB 4PS7A 4XDCA 4DHJB 4FJVB 4ASWC 2Y5BB 3AE2B 1UH6A 4O1NA 2N7JA 4AJWA 4EFOA 4IC7B 3ZYYX 3MHSD 1UD7A 2J52A 2AQ3B 3HM3A 4A6QA 1FIQA 3L4PA 1NEKB 1UGJA 2AQ1B 1RLFA 4NPNA 2WXPA 3IFWB 2K3UA 1E90A 4JE3B 2R61A 1WGHA 2DHZA 4WIPA 4N9F4 3HUIA 2BYTA 4ANUA 1EU3A 5DPTA 2PTLA 3I57A 2LHEA 2AL6A 2JSVX 2PLPA 2W9NA 5DPWA 5JH5C 1FNUA 3L16A 2N1WA 3BVMA 1SE9A 1ZXHA 1Z5SB 2V9HA 3ZKJC 4ZYSA 3TEWA 2V3PA 1K52A 4LDTB 2G9HD 1KH0A 2INCC 1FXAA 3ZLZA 2L8JA 1FNVA 4BAXA 4L23A 2QMTA 2QIEB 4EZLA 2WHIA 2JUOA 1QQRA 4GDKB 2PW9A 4NQKE 3E56A 2PIAA 1B1ZA 1C77A 4XE0A 2JXXA 2KWVB 3KWVA 1FFUA 3SEBA 2J42A 4E71A 2EKIA 2C7MB 2CR5A 3AEAB 4OVVA 5CHWA 5IAAC 3L17A 4LJPB 4GB9A 4WJPA 4MACA 2L3ZA 3V61A 3KW5B 1JWMD 4RF1A 2MLBA 4JX1C 2LVPA 4JGHB 5AUKA 2K39A 3HIZA 3PZ7A 3IVFA 3T8MA 5HFYA 2ICIA 2E3TA 3BYYB 1JQ4A 2RMMA 2FIFA 1E0ZA 5J2RA 4TUUA 4ARIA 1MHHE 3PT2B 3WANA 3X0WA 4K1RB 2IGDA 4FHKA 1SE4A 2KZRA 3NVWA 3DHHC 2JYTA 4B6WA 3Q3FA 4RMAA 2KFJA 4URKA 2M0AA 4XWTA 3DWGC 3ZO5B 2V3SA 4IKGA 1FMAD 4DHZE 4ZDVA 3UGBB 3KUCB 3TCAA 2KJRA 3R3MA 5H92C 1CMXB 3NZ3A 4ZOHC 5C23A 2FCSA 2JRIB 4IUMB 3OLMD 5D2MB 2IGHA 5DCNA 1QT9A 4ZHOA 5L83A 2GBNA 1KFYB 2G1EA 4GDKA 3W9CB 1NI3A 4ICVA 5LLIA 2KOXA 3PSEB 2HJ1A 3KYDD 4X57B 3QX1A 1GNUA 4LNNA 1KRHA 1VZ7A 2KVRA 2PVGC 1TIFA 4F1SA 1E10A 3ZNGC 1WR1A 3NZSA 1V1PA 3FILA 3JYUA 1ZDVA 2BS3B 1UGMA 3GS2A 1GJZA 1YD8U 3KUDB 2JWZA 4EE2A 1ISNA 1UF0A 3BIID 4YTPB 1HZ5A 2KC2A 2KNBA 4A3OA 4P7IA 3UF8A 3PVLA 3H9DA 2J7QB 5BMIA 5BMGA 1KM7A 1L7YA 1T3QA 1V1OA 2KKCA 1Q0WB 1XCQL 2V1YA 3EFCA 4TQ1A 5H8YE 4OZBA 1C76A 2I1JA 2KN4A 4M0WA 1JWUD 1EU4A 3BK1A 1MG4A 2RD0A 4OHJA 1FO4A 3W1SA 1YNTE 2WGSA 3Q69A 1L4ZB 1WZ0A 3PGEA 4DXFA 2RPQA 4D2KA 3W5UB 2CS4A 3MP9A 3R8BA 3Q8AA 2D3CA 1SSNA 2NTTA 5EE0A 1FEHA 1RRBA 4AWJA 2C9WB 4FADA 4WAAA 2PMVA 1PFDA 1V81A 1HZ6A 3PREA 2M1MA 1QLBB 4AS1A 4NAWB 2CJNA 1MHXA 2QHOA 3Q6BA 4GDLA 3IT6B 2MBOA 5CHFA 5DPSA 1E9MA 4ZYNA 2INDC 4IG7B 2CU1A 1WGRA 1R4NB 4L2YA 1J19A 1EF5A 2X38A 3ML8A 1TKYA 4KIKA 4KSKC 4MGIE 2BKRB 3CSTA 4W9JA 1V6EA 4CQNA 1YIWA 5HKHA 3AB5A 2IYDB 3SR6A 1ZKHA 4LLGM 4W9IA 2MP2B 1IP9A 1AWDA 3VUWA 1XLNA 1M94A 1YX5B 2AYOB 1RAXA 2KDFB 1C79A 1MJDA 5CTRC 3L13A 4BOSC 4WWPA 4C56C 3CF6E 3PRZA 5J17A 1QOBA 3P4PB 4US8A 2NPTA 3DBRI 3AXCA 4NNJB 4MELA 1IBXB 4DXAB 3AEEB 2N9LA 2TSSA 3TEZA 3D32A 4W9EA 3DVGY 2O6VD 1VRAB 2MQJA 4K7UA 3RNBC 1OEYA 1FCCC 1ESFA 4MDKE 5D94A 1E8YA 1KJTA 3RNGC 1LO5D 3KUZA 3WALA 2NCNA 2BW2A 2ZVNA 1Q5WB 2JX5A 3NOBA 3A4RA 2LUEA 4BBNF 3RFZB 4A20A 4G11A 4USAA 5CX3A 3DVNU 1VLBA 3CSFA 3RZWC 4RF0A 2LMCA 1EWYC 1N60A 1WWTA 3T3OA 1IGCA 2R2OA 5LXIB 2FE8A 4YSYB 3N1ZC 3UINB 4DXGA 2D10A 2NMQA 1E5WA 2PE6B 1E7PB 3HK0A 4LNIA 1HEZE 2DAJA 5BMHA 2V4IB 4RFBA 2BS2B 5CHVC 4LCDE 4A55A 5GMVA 3GOEA 4GLSC 3P1MA 1WJ6A 5EE9A 1Z2MA 3AM9A 1BXTA 3QWZB 1PUTA 3H8HA 2L83A 3AV8A 2D5GA 3LJ3A 3P4RB 2QCZA 4KDIC 4S0RA 5MPOA 3VR8B 3W5VB 3APCA 2BF8B 2H88B 4K7WA 3HVDA 3TMPB 4ZHPA 1EWCA 1C4AA 2ZNVB 4FLHA 2KACA 2C7NB 3AULA 2WXIA 2N7EA 1WJUA 3IXSA 2AQ2B 1WGKA 2WXOA 5G55A 3Q3OC 1DOYA 4BBNC 1VR9A 4FBJB 1L5PA 1XCTL 1WZ3A 3L08A 4BZAA 3KVFB 3PO0A 1PGXA 1J7CA 1J7BA 4S17A 1ZPSA 4EZKA 4KZCA 3TEXA 3R7QA 2RR9A 1C9FA 2LGIA 2Z0DB 3GE3C 5D6JB 1FRDA 2L00B 3AEDB 4UDUC 2VZKB 3RNCC 2HD5B 3RPFC 4OZCA 2J0JA 3L54A 4BVUC 5LXHA 2DWQA 3BVZA 4EKUA 2O6VB 5IKCM 4FHJA 1TZOA 4RH6A 1GG3A 1C78A 3NY5A 4LK0M 4MT5A 2L1AA 4F7ZA 4BOZB 3UIOB 2OEDA 3A1QA 3GP7A 2KD0A 4DQOC 5AEKB 1Q10A 3CWIA 1BT0A 4HCPB 2IO3B 1VZ8A 3MC9A 1MFWA 2Y5CA 4WH4A 4GN1A 2AEHA 2DYBA 4B0MA 1HXYD 3I5JC 1LGRA 1WYWB 1ET6A 4W9FA 1QOFA 1L6VA 2ON8A 4W9GA 2WXHA 3ZNZB 3I9V1 3LXFA 1OTRB 1WM3A 2KWUB 2K6QA 3PV1A 1FD6A 1FXTB 2MA9B 3W1SC 3U52E 1V1PB 3OWEB 4MH0E 2OJWA 1GC7A 1V49A 4HLEA 4TMAB 4HDQA 3Q8CA 2MBQA 2QDFA 3TEYA 3AI5A 2CJOA 2IY0B 3HRDD 4Q2JA 2M8SA 1E8XA 4FXCA 5FR6A 2WXQA 1OEYJ 1NVID 2PJHA 2FIDA 3DBHI 1TT5B 3ZNHB 1YQ3B 2KQ7A 3IT4B 1T0YA 2WXNA 1C4CA 3NUHB 1FNWA 4DBGA 2MJ3A 1F52A 4GXBA 1V5TA 4JPSA 1LXDA 3AE5B 2OJRA 4AOFA 2HTME 1H4RA 2KANA 5EE3A 2GB1A 2BVCA 3ZTDA 1UWMA 2X8XX 3QIJA 5D3IB 1CQVA 3DDCB 3MJ5A 2K8CA 1TS5A 3BZDB 2E6XA 2NTSA 2J0MA 5E6OA 3AEFB 4II2B 4AUQC 3L0WB 1UNSA 2DLBA 2PEAA 3QARA 1F1HA 1K51A 2WU5B 4HKQA 1MVKA 1PGAA 2M17A 4K7SA 4AJYB 3SDLC 2QILA 1XLOA
chains in the Genus database with same CATH topology
4MEMA 3AU4A 3H7PB 5G2NA 2KDEB 3PHXB 1OQYA 1WGDA 2R2QA 1WZ0A 2KX3A 3PGEA 4TQ0A 2RPQA 4W9CA 4WJNA 3U30A 4BFRA 3HHMA 1WE7A 2JZZA 4CHKA 2CS4A 1WGYA 3ZUNA 4DWFA 3MJWA 4MGZE 2MX2A 2ZNVC 3V6CB 1U4AA 2KWCA 2BGFA 2KMAA 3A4SC 3RYTA 4HWIB 4IWPA 1WMHA 2N9XA 1HE8A 1P98A 2C7HA 4MM3A 1P3QU 2BWES 4IM0A 4IM3A 4HJKA 4J6IA 3R7RA 3ZRFA 1RRBA 4AWJA 2C9WB 4FADA 2G4DB 4WAAA 4NQLB 1V81A 2KN5A 3PREA 3S2AA 2M1MA 1ZGUB 5AZGA 3QHTA 4NAWB 2EKEC 2CKHB 2A5UA 4HXDA 2QHOA 4M0WB 3ZNID 1WXVA 4CO7A 2BKFA 2GBKA 1D3ZA 1QZEA 2LWPA 4GDLA 3B1LX 1R4MI 2LD9A 2D11A 2MBOA 2MRPA 5AZFA 5CHFA 5DPSA 2N4FA 2KTRA 4XX5A 4ZYNA 3QC8B 4JIOU 1WH3A 4IG7B 2CU1A 4TKNA 1WGRA 3K9PB 1I35A 3QQ8B 4KSLC 2IZVB 2ZPNA 2MCNB 1J19A 2G45B 3A9KB 1EF5A 3VH4B 3DVNV 2LVQA 4G3XB 2KX0A 3ML8A 4KIKA 4KSKC 2ZCCA 4MGIE 2NPTB 4MSMB 4XZ4A 1WR6E 4JLCA 3WA0A 2KDBA 2BKRB 2J0KA 3CSTA 4W9JA 3PLVA 3BINA 3ALBA 3WAMA 2KLGA 2JF5A 2KMCA 1V6EA 1WFYA 3UQBA 3WIMA 1Q1OA 1YIWA 1EO6A 4ICUA 2KHWB 2UWQA 4W9DA 5HKHA 2LRUA 3RT3B 1UZXB 2KDIA 2N9EB 2M0XA 2IYDB 2XEWA 1WI0A 2L05A 2L0TA 1ZKHA 2WDTB 3H6NA 1TBEA 4W9IA 1RFAA 2DENB 2MP2B 5J18A 2MWSB 3NZUA 1LM8B 1IP9A 1YJ1A 1X1MA 2KK8A 2Z59B 3VUWA 2IO2B 4E3CA 2BYVE 2KO3A 1M94A 1YX5B 2ZCBA 4M8NA 3PTFC 3SHQA 2AYOB 1RAXA 2KDFB 2BPSA 2ZZPB 3DQVA 3EHVA 1JRUA 2B3AA 2IY1B 3H7PA 5CTRC 4WWOA 3L13A 2KC1A 4BOSC 4WWPA 1WXMA 1GUAB 3CF6E 3PRZA 5J17A 4OVUA 4TV3A 4KDLB 2ZVOA 2NPTA 3P2BA 2FAZA 2C5LC 4GSWA 3DBRI 3ZW3A 2GOWA 1SGHA 3AXCA 3U7DA 1Y8RC 4NNJB 2JY6A 2JZ3B 2LGXA 4ANWA 3VFKA 1WXAA 4MELA 2EMTA 4IM2A 2Z0EB 4DXAB 4KIKB 2RSUA 1A5RA 4KZ0A 3WAOA 2HTHA 4W9HA 1V86A 3DOWA 2KLCA 3D32A 3IG3A 4JL9A 4W9EA 3HM6X 2NVUI 3DVGY 2O6VD 3VTWA 1NDDA 2MQJA 4K7UA 1ZW7A 2UYZB 2PE9A 3LDZE 4PS8A 3K9OB 4BKSD 4NJ7A 4EZJA 4MSQB 3ECIA 1OEYA 3UQAA 1OGWA 2CHWA 3DBSA 2NBVB 3V6EB 4MDKE 5D94A 1SIFA 1E8YA 3GZNI 2MBEA 1KJTA 4HDOA 4JQWC 2FCQA 3KUZA 2DZJA 1C3TA 5BO4B 2YVCA 2GMIC 2JPHA 3WALA 3B0AA 2MW5A 1XQQA 2BYEA 2GBMA 1V2YA 2MBHA 1WY8A 3EC8A 4M8MA 1TGZB 1XD3B 2NCNA 2ZVNA 1V9JA 1Q5WB 3NOBA 1WJ4A 3A4RA 2LUEA 2N7DA 2AL3A 1WF9A 5EDSA 2DAFA 4BBNF 3N32A 4NJ6A 2OOBB 4A20A 3TL5A 4G11A 5TR5A 5IA7A 2L7RA 3PHWB 4EEWA 4FA6A 4HCNB 5CX3A 5L95C 2G4SA 4WWNA 3DVNU 5KHOA 2XK5B 3CSFA 4MGKE 2MBBB 3WAPA 3RZWC 1P9DU 4DDGD 3RCZA 4GU2A 1WXSA 4E74A 4NAWA 1P1AA 1UBIA 2XK5A 2LI5A 1F9JA 2PPHA 2AWTA 2ZPYA 1E7UA 3V60A 1WM2A 2G3QB 4PYZA 4PS3A 1PQSA 2IO1B 4LDTD 2LGYA 3NS8A 3VAWA 2R2OA 5LXIB 2N9PC 4KV2A 2GBRA 3UINB 3V62A 2WX1A 3ZVVA 3ONSA 3N30A 1VCBA 2DZMA 3A9KA 2K8HA 4GDLB 2IBIB 2HE7A 3NHEB 2D10A 3RULA 5C1ZA 1E5WA 2PE6B 4K81A 2ZJDA 4PS7A 4DHJB 3HK0A 1UBQA 1TZ1A 4FJVB 4ASWC 2DAJA 2FCMA 2Y5BB 3PPAA 4ANVA 1UH6A 2NR2A 1V80A 4PYUA 1AARA 3AU5A 4AJWA 4EUTA 5CHVC 3M95A 4LCDE 3SD5A 4FULA 4IW0A 4EFOA 4WQOB 1KOTA 4IC7B 3MHSD 1UD7A 3B08A 1G6JA 3HM3A 2FUHB 5GMVA 3GOEA 2M4NA 1RLFA 1WJ6A 4NPNA 2L76A 2REXA 1Z2MA 3OJ4B 4NY0A 4W9KA 3A9JB 3IFWB 1L2NA 2LRWA 1E90A 2WX0A 3PLUA 1J0GA 1LFDA 1WGHA 2DHZA 3QWZB 2GBJA 3A9JA 4N9F4 3RD2A 2YLMA 2KTRB 3LJ3A 3DBLI 4ANUA 4KDIC 5DPTA 4DHJD 2NBWB 2AL6A 3A1QB 2W9NA 3APCA 2LASA 4W9LA 5E6PA 5E6NA 5DPWA 2BF8B 4K7WA 5JH5C 3JSVB 3L16A 2N1WA 3M62B 2KJ6A 2LXAA 1UELA 3TMPB 1SE9A 2CHXA 2ZNVB 2ASQA 4FLHA 4IWQA 4II3B 4ZRJA 2WYQA 1Z5SB 2C7NB 3PS6A 3ZKJC 3R66C 2L0FA 1V5OA 3AULA 3DPDA 2N7EA 1WJUA 1I42A 4LDTB 4XC2A 1WMHB 3VUYA 5G55A 2FNJB 1WIAA 1E8WA 1XT9B 2JVCA 2O2VA 3I3TB 3O65B 5D7GA 3ZLZA 4BBNC 2L8JA 4FBJB 3T9LA 3RZFA 1EF1A 2LJ5A 4EZLA 3SU8X 2BYFA 1WZ3A 3L08A 2JUOA 5AZHA 3KVFB 3ZDTA 4DK5A 3X23A 2K6DB 2KFKB 3RUIB 1WGGA 4GDKB 4EZKA 4KZCA 1MG8A 4NQKE 3R7QA 2RR9A 2Z0DB 2NBUA 5D6JB 2L00B 4WJOA 4G50A 2HJ8A 4B9KA 1S3SG 2JXXA 1TTNA 2MSED 2KWVB 2EMSA 2V4LA 2D2QA 5JHBA 2HD5B 2N1VA 1K8RB 1YQBA 4EOYA 3C0RB 2J0JA 3L54A 4E71A 4BVUC 2C7MB 5LXHA 2CR5A 4OVVA 5CHWA 5IAAC 3L17A 4EKUA 4HK2A 2KTFA 2O6VB 4GB9A 4LJPB 3U8ZA 4WJPA 2L3ZA 4FHJA 4ZRKA 3DCGA 4GMVA 3V61A 1VD2A 3KW5B 1GG3A 4HPLB 3NY5A 4I6PA 2KFKA 2MLBA 3IHPC 2LVPA 2CHZA 4JGHB 4F7ZA 2DZIA 4IWOA 4BOZB 2K39A 3HIZA 3A1QA 3UIOB 2KD0A 1J8CA 5AEKB 4KVGB 3VVWB 3IVFA 2NS5A 3T8MA 1BT0A 3CMMB 3EECA 4B95A 4BKSA 2XBBC 1R4NI 2IO3B 4HCPB 3TJPA 3H1UA 4MJSA 4LJOB 2FIFA 4F8CB 4BKTA 5J2RA 4TUUA 2FCNA 3PT2B 3WANA 4RM8A 3X0WA 4K1RB 3EFUA 4GN1A 2AEHA 1E8ZA 2DYBA 4FHKA 2KZRA 3VUXA 3ZDMC 5KHQA 4FJYA 1WYWB 4G0NB 4W9FA 4W9GA 1WX9A 4B6WA 3Q3FA 1YX6B 5JZEB 4RMAA 3ZNZB 1WRDB 2K8BA 1OTRB 3OAWA 1WM3A 2KWUB 2K6QA 3PV1A 2VRRB 2KFJA 4URKA 1FXTB 2MA9B 3W1SC 3ZO5B 2V3SA 2LXCA 4DHZE 4ZDVA 3DVGX 3UGBB 4MH0E 1GC7A 1NI2A 1V49A 2DZKA 3KUCB 3TCAA 3JVZX 4CYEA 1IYFA 2KJRA 2DX5B 2O2VB 3H7SA 3R3MA 4GOCA 1CMXB 4HLEA 3ENEA 4ZRIA 5C23A 2FCSA 2LZ6A 4FN2A 2JRIB 4IUMB 3OLMD 4HDQA 5D2MB 1WJNA 3M3JA 3TIXA 2MBQA 3QAQA 5DCNA 3AI5A 3W1YA 2IY0B 2KQSA 1GC6A 4GGQA 5L83A 2GBNA 3PRPB 2M8SA 2K1FA 1E8XA 5FR6A 3ZTCA 4FJZA 1OEYJ 4GDKA 2C60A 3ZRCA 3M63B 3VHTC 3VTVA 2PJHA 1KLVA 4ICVA 3JW0X 5LLIA 3IBEA 2KOXA 3PSEB 2FIDA 2O6VA 3DBHI 3KYDD 3ZNHB 4X57B 2JT4B 4DHZB 5DPRA 3QX1A 1GNUA 4BKGA 3KYCD 1WX8A 3QCAA 2KQ7A 2D3GA 2KVRA 1T0YA 1E7VA 3N3KB 2KXJA 2DYMA 4DBGA 4F1SA 4GIVA 2I1KA 4GXBA 1V5TA 3ZNGC 1WR1A 3NZSA 1WX7A 3VXWA 3JYUA 4HPMB 4ANXA 2A4ZA 1UGMA 3APFA 2K25A 1LXDA 1GJZA 2WWZA 1YD8U 2OJRA 3KUDB 2JWZA 4AOFA 3A33B 1P0RA 1ISNA 3ZIMA 1H4RA 2KANA 2KC2A 2KNBA 3QK0A 2BWFA 3JSVA 4A3OA 3UIPB 3VQIA 3ZTDA 4P7IA 4MGYE 2ZEQA 3QIJA 3UF8A 2JRHA 3MTNB 3PVLA 1LQBA 2J7QB 3H9DA 2DYOA 4RM9A 4YL8A 1WE6A 3DDCB 1KM7A 1C1YB 1L7YA 2KJHB 2K8CA 4MJSB 4A3PA 3VTUA 3ML9A 5JHAA 2J0MA 3L10B 3PZDA 2KKCA 5E6OA 1Q0WB 4HVBA 1H8CA 3APDA 1EUVB 3VH3B 4II2B 1IPGA 2V1YA 3KH0A 4TQ1A 4AUQC 3OJ3A 3L0WB 2MP2A 4I6NB 4DDID 2D07B 2I1JA 2IO0B 3VDZA 1S1QB 2PEAA 3QARA 4AP4C 3Q3JA 2RD0A 3QA8A 3TBLD 4I6LB 2M17A 4K7SA 4AJYB 3PRMB 3SDLC 3W1SA 2RGFA 2LGDA 3BY4B 3QJZA 2LVOA 1NBFC 4WJQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEM A;  3AU4 A;  3H7P B;  5G2N A;  2KDE B;  3PHX B;  1OQY A;  1WGD A;  2R2Q A;  1WZ0 A;  2KX3 A;  3PGE A;  4TQ0 A;  2RPQ A;  4W9C A;  4WJN A;  3U30 A;  4BFR A;  3HHM A;  1WE7 A;  2JZZ A;  4CHK A;  2CS4 A;  1WGY A;  3ZUN A;  4DWF A;  3MJW A;  4MGZ E;  2MX2 A;  2ZNV C;  3V6C B;  1U4A A;  2KWC A;  2BGF A;  2KMA A;  3A4S C;  3RYT A;  4HWI B;  4IWP A;  1WMH A;  2N9X A;  1HE8 A;  1P98 A;  2C7H A;  4MM3 A;  1P3Q U;  2BWE S;  4IM0 A;  4IM3 A;  4HJK A;  4J6I A;  3R7R A;  3ZRF A;  1RRB A;  4AWJ A;  2C9W B;  4FAD A;  2G4D B;  4WAA A;  4NQL B;  1V81 A;  2KN5 A;  3PRE A;  3S2A A;  2M1M A;  1ZGU B;  5AZG A;  3QHT A;  4NAW B;  2EKE C;  2CKH B;  2A5U A;  4HXD A;  2QHO A;  4M0W B;  3ZNI D;  1WXV A;  4CO7 A;  2BKF A;  2GBK A;  1D3Z A;  1QZE A;  2LWP A;  4GDL A;  3B1L X;  1R4M I;  2LD9 A;  2D11 A;  2MBO A;  2MRP A;  5AZF A;  5CHF A;  5DPS A;  2N4F A;  2KTR A;  4XX5 A;  4ZYN A;  3QC8 B;  4JIO U;  1WH3 A;  4IG7 B;  2CU1 A;  4TKN A;  1WGR A;  3K9P B;  1I35 A;  3QQ8 B;  4KSL C;  2IZV B;  2ZPN A;  2MCN B;  1J19 A;  2G45 B;  3A9K B;  1EF5 A;  3VH4 B;  3DVN V;  2LVQ A;  4G3X B;  2KX0 A;  3ML8 A;  4KIK A;  4KSK C;  2ZCC A;  4MGI E;  2NPT B;  4MSM B;  4XZ4 A;  1WR6 E;  4JLC A;  3WA0 A;  2KDB A;  2BKR B;  2J0K A;  3CST A;  4W9J A;  3PLV A;  3BIN A;  3ALB A;  3WAM A;  2KLG A;  2JF5 A;  2KMC A;  1V6E A;  1WFY A;  3UQB A;  3WIM A;  1Q1O A;  1YIW A;  1EO6 A;  4ICU A;  2KHW B;  2UWQ A;  4W9D A;  5HKH A;  2LRU A;  3RT3 B;  1UZX B;  2KDI A;  2N9E B;  2M0X A;  2IYD B;  2XEW A;  1WI0 A;  2L05 A;  2L0T A;  1ZKH A;  2WDT B;  3H6N A;  1TBE A;  4W9I A;  1RFA A;  2DEN B;  2MP2 B;  5J18 A;  2MWS B;  3NZU A;  1LM8 B;  1IP9 A;  1YJ1 A;  1X1M A;  2KK8 A;  2Z59 B;  3VUW A;  2IO2 B;  4E3C A;  2BYV E;  2KO3 A;  1M94 A;  1YX5 B;  2ZCB A;  4M8N A;  3PTF C;  3SHQ A;  2AYO B;  1RAX A;  2KDF B;  2BPS A;  2ZZP B;  3DQV A;  3EHV A;  1JRU A;  2B3A A;  2IY1 B;  3H7P A;  5CTR C;  4WWO A;  3L13 A;  2KC1 A;  4BOS C;  4WWP A;  1WXM A;  1GUA B;  3CF6 E;  3PRZ A;  5J17 A;  4OVU A;  4TV3 A;  4KDL B;  2ZVO A;  2NPT A;  3P2B A;  2FAZ A;  2C5L C;  4GSW A;  3DBR I;  3ZW3 A;  2GOW A;  1SGH A;  3AXC A;  3U7D A;  1Y8R C;  4NNJ B;  2JY6 A;  2JZ3 B;  2LGX A;  4ANW A;  3VFK A;  1WXA A;  4MEL A;  2EMT A;  4IM2 A;  2Z0E B;  4DXA B;  4KIK B;  2RSU A;  1A5R A;  4KZ0 A;  3WAO A;  2HTH A;  4W9H A;  1V86 A;  3DOW A;  2KLC A;  3D32 A;  3IG3 A;  4JL9 A;  4W9E A;  3HM6 X;  2NVU I;  3DVG Y;  2O6V D;  3VTW A;  1NDD A;  2MQJ A;  4K7U A;  1ZW7 A;  2UYZ B;  2PE9 A;  3LDZ E;  4PS8 A;  3K9O B;  4BKS D;  4NJ7 A;  4EZJ A;  4MSQ B;  3ECI A;  1OEY A;  3UQA A;  1OGW A;  2CHW A;  3DBS A;  2NBV B;  3V6E B;  4MDK E;  5D94 A;  1SIF A;  1E8Y A;  3GZN I;  2MBE A;  1KJT A;  4HDO A;  4JQW C;  2FCQ A;  3KUZ A;  2DZJ A;  1C3T A;  5BO4 B;  2YVC A;  2GMI C;  2JPH A;  3WAL A;  3B0A A;  2MW5 A;  1XQQ A;  2BYE A;  2GBM A;  1V2Y A;  2MBH A;  1WY8 A;  3EC8 A;  4M8M A;  1TGZ B;  1XD3 B;  2NCN A;  2ZVN A;  1V9J A;  1Q5W B;  3NOB A;  1WJ4 A;  3A4R A;  2LUE A;  2N7D A;  2AL3 A;  1WF9 A;  5EDS A;  2DAF A;  4BBN F;  3N32 A;  4NJ6 A;  2OOB B;  4A20 A;  3TL5 A;  4G11 A;  5TR5 A;  5IA7 A;  2L7R A;  3PHW B;  4EEW A;  4FA6 A;  4HCN B;  5CX3 A;  5L95 C;  2G4S A;  4WWN A;  3DVN U;  5KHO A;  2XK5 B;  3CSF A;  4MGK E;  2MBB B;  3WAP A;  3RZW C;  1P9D U;  4DDG D;  3RCZ A;  4GU2 A;  1WXS A;  4E74 A;  4NAW A;  1P1A A;  1UBI A;  2XK5 A;  2LI5 A;  1F9J A;  2PPH A;  2AWT A;  2ZPY A;  1E7U A;  3V60 A;  1WM2 A;  2G3Q B;  4PYZ A;  4PS3 A;  1PQS A;  2IO1 B;  4LDT D;  2LGY A;  3NS8 A;  3VAW A;  2R2O A;  5LXI B;  2N9P C;  4KV2 A;  2GBR A;  3UIN B;  3V62 A;  2WX1 A;  3ZVV A;  3ONS A;  3N30 A;  1VCB A;  2DZM A;  3A9K A;  2K8H A;  4GDL B;  2IBI B;  2HE7 A;  3NHE B;  2D10 A;  3RUL A;  5C1Z A;  1E5W A;  2PE6 B;  4K81 A;  2ZJD A;  4PS7 A;  4DHJ B;  3HK0 A;  1UBQ A;  1TZ1 A;  4FJV B;  4ASW C;  2DAJ A;  2FCM A;  2Y5B B;  3PPA A;  4ANV A;  1UH6 A;  2NR2 A;  1V80 A;  4PYU A;  1AAR A;  3AU5 A;  4AJW A;  4EUT A;  5CHV C;  3M95 A;  4LCD E;  3SD5 A;  4FUL A;  4IW0 A;  4EFO A;  4WQO B;  1KOT A;  4IC7 B;  3MHS D;  1UD7 A;  3B08 A;  1G6J A;  3HM3 A;  2FUH B;  5GMV A;  3GOE A;  2M4N A;  1RLF A;  1WJ6 A;  4NPN A;  2L76 A;  2REX A;  1Z2M A;  3OJ4 B;  4NY0 A;  4W9K A;  3A9J B;  3IFW B;  1L2N A;  2LRW A;  1E90 A;  2WX0 A;  3PLU A;  1J0G A;  1LFD A;  1WGH A;  2DHZ A;  3QWZ B;  2GBJ A;  3A9J A;  4N9F 4;  3RD2 A;  2YLM A;  2KTR B;  3LJ3 A;  3DBL I;  4ANU A;  4KDI C;  5DPT A;  4DHJ D;  2NBW B;  2AL6 A;  3A1Q B;  2W9N A;  3APC A;  2LAS A;  4W9L A;  5E6P A;  5E6N A;  5DPW A;  2BF8 B;  4K7W A;  5JH5 C;  3JSV B;  3L16 A;  2N1W A;  3M62 B;  2KJ6 A;  2LXA A;  1UEL A;  3TMP B;  1SE9 A;  2CHX A;  2ZNV B;  2ASQ A;  4FLH A;  4IWQ A;  4II3 B;  4ZRJ A;  2WYQ A;  1Z5S B;  2C7N B;  3PS6 A;  3ZKJ C;  3R66 C;  2L0F A;  1V5O A;  3AUL A;  3DPD A;  2N7E A;  1WJU A;  1I42 A;  4LDT B;  4XC2 A;  1WMH B;  3VUY A;  5G55 A;  2FNJ B;  1WIA A;  1E8W A;  1XT9 B;  2JVC A;  2O2V A;  3I3T B;  3O65 B;  5D7G A;  3ZLZ A;  4BBN C;  2L8J A;  4FBJ B;  3T9L A;  3RZF A;  1EF1 A;  2LJ5 A;  4EZL A;  3SU8 X;  2BYF A;  1WZ3 A;  3L08 A;  2JUO A;  5AZH A;  3KVF B;  3ZDT A;  4DK5 A;  3X23 A;  2K6D B;  2KFK B;  3RUI B;  1WGG A;  4GDK B;  4EZK A;  4KZC A;  1MG8 A;  4NQK E;  3R7Q A;  2RR9 A;  2Z0D B;  2NBU A;  5D6J B;  2L00 B;  4WJO A;  4G50 A;  2HJ8 A;  4B9K A;  1S3S G;  2JXX A;  1TTN A;  2MSE D;  2KWV B;  2EMS A;  2V4L A;  2D2Q A;  5JHB A;  2HD5 B;  2N1V A;  1K8R B;  1YQB A;  4EOY A;  3C0R B;  2J0J A;  3L54 A;  4E71 A;  4BVU C;  2C7M B;  5LXH A;  2CR5 A;  4OVV A;  5CHW A;  5IAA C;  3L17 A;  4EKU A;  4HK2 A;  2KTF A;  2O6V B;  4GB9 A;  4LJP B;  3U8Z A;  4WJP A;  2L3Z A;  4FHJ A;  4ZRK A;  3DCG A;  4GMV A;  3V61 A;  1VD2 A;  3KW5 B;  1GG3 A;  4HPL B;  3NY5 A;  4I6P A;  2KFK A;  2MLB A;  3IHP C;  2LVP A;  2CHZ A;  4JGH B;  4F7Z A;  2DZI A;  4IWO A;  4BOZ B;  2K39 A;  3HIZ A;  3A1Q A;  3UIO B;  2KD0 A;  1J8C A;  5AEK B;  4KVG B;  3VVW B;  3IVF A;  2NS5 A;  3T8M A;  1BT0 A;  3CMM B;  3EEC A;  4B95 A;  4BKS A;  2XBB C;  1R4N I;  2IO3 B;  4HCP B;  3TJP A;  3H1U A;  4MJS A;  4LJO B;  2FIF A;  4F8C B;  4BKT A;  5J2R A;  4TUU A;  2FCN A;  3PT2 B;  3WAN A;  4RM8 A;  3X0W A;  4K1R B;  3EFU A;  4GN1 A;  2AEH A;  1E8Z A;  2DYB A;  4FHK A;  2KZR A;  3VUX A;  3ZDM C;  5KHQ A;  4FJY A;  1WYW B;  4G0N B;  4W9F A;  4W9G A;  1WX9 A;  4B6W A;  3Q3F A;  1YX6 B;  5JZE B;  4RMA A;  3ZNZ B;  1WRD B;  2K8B A;  1OTR B;  3OAW A;  1WM3 A;  2KWU B;  2K6Q A;  3PV1 A;  2VRR B;  2KFJ A;  4URK A;  1FXT B;  2MA9 B;  3W1S C;  3ZO5 B;  2V3S A;  2LXC A;  4DHZ E;  4ZDV A;  3DVG X;  3UGB B;  4MH0 E;  1GC7 A;  1NI2 A;  1V49 A;  2DZK A;  3KUC B;  3TCA A;  3JVZ X;  4CYE A;  1IYF A;  2KJR A;  2DX5 B;  2O2V B;  3H7S A;  3R3M A;  4GOC A;  1CMX B;  4HLE A;  3ENE A;  4ZRI A;  5C23 A;  2FCS A;  2LZ6 A;  4FN2 A;  2JRI B;  4IUM B;  3OLM D;  4HDQ A;  5D2M B;  1WJN A;  3M3J A;  3TIX A;  2MBQ A;  3QAQ A;  5DCN A;  3AI5 A;  3W1Y A;  2IY0 B;  2KQS A;  1GC6 A;  4GGQ A;  5L83 A;  2GBN A;  3PRP B;  2M8S A;  2K1F A;  1E8X A;  5FR6 A;  3ZTC A;  4FJZ A;  1OEY J;  4GDK A;  2C60 A;  3ZRC A;  3M63 B;  3VHT C;  3VTV A;  2PJH A;  1KLV A;  4ICV A;  3JW0 X;  5LLI A;  3IBE A;  2KOX A;  3PSE B;  2FID A;  2O6V A;  3DBH I;  3KYD D;  3ZNH B;  4X57 B;  2JT4 B;  4DHZ B;  5DPR A;  3QX1 A;  1GNU A;  4BKG A;  3KYC D;  1WX8 A;  3QCA A;  2KQ7 A;  2D3G A;  2KVR A;  1T0Y A;  1E7V A;  3N3K B;  2KXJ A;  2DYM A;  4DBG A;  4F1S A;  4GIV A;  2I1K A;  4GXB A;  1V5T A;  3ZNG C;  1WR1 A;  3NZS A;  1WX7 A;  3VXW A;  3JYU A;  4HPM B;  4ANX A;  2A4Z A;  1UGM A;  3APF A;  2K25 A;  1LXD A;  1GJZ A;  2WWZ A;  1YD8 U;  2OJR A;  3KUD B;  2JWZ A;  4AOF A;  3A33 B;  1P0R A;  1ISN A;  3ZIM A;  1H4R A;  2KAN A;  2KC2 A;  2KNB A;  3QK0 A;  2BWF A;  3JSV A;  4A3O A;  3UIP B;  3VQI A;  3ZTD A;  4P7I A;  4MGY E;  2ZEQ A;  3QIJ A;  3UF8 A;  2JRH A;  3MTN B;  3PVL A;  1LQB A;  2J7Q B;  3H9D A;  2DYO A;  4RM9 A;  4YL8 A;  1WE6 A;  3DDC B;  1KM7 A;  1C1Y B;  1L7Y A;  2KJH B;  2K8C A;  4MJS B;  4A3P A;  3VTU A;  3ML9 A;  5JHA A;  2J0M A;  3L10 B;  3PZD A;  2KKC A;  5E6O A;  1Q0W B;  4HVB A;  1H8C A;  3APD A;  1EUV B;  3VH3 B;  4II2 B;  1IPG A;  2V1Y A;  3KH0 A;  4TQ1 A;  4AUQ C;  3OJ3 A;  3L0W B;  2MP2 A;  4I6N B;  4DDI D;  2D07 B;  2I1J A;  2IO0 B;  3VDZ A;  1S1Q B;  2PEA A;  3QAR A;  4AP4 C;  3Q3J A;  2RD0 A;  3QA8 A;  3TBL D;  4I6L B;  2M17 A;  4K7S A;  4AJY B;  3PRM B;  3SDL C;  3W1S A;  2RGF A;  2LGD A;  3BY4 B;  3QJZ A;  2LVO A;  1NBF C;  4WJQ A; 
#chains in the Genus database with same CATH topology
 5G2N A;  1MPE A;  1F2R I;  2INN E;  3B2F A;  2R2Q A;  4TQ0 A;  4LNK A;  1T6B X;  4W9C A;  3U30 A;  2JZZ A;  4CHK A;  4DWF A;  3MJW A;  2ZNV C;  2KWC A;  2LHD A;  4LNF A;  3RYT A;  1WMH A;  1FXI A;  1HE8 A;  1I4G A;  2BWE S;  4IM0 A;  4HJK A;  2G4D B;  2LGS A;  2W82 A;  3FAH A;  1ZGU B;  3FC4 A;  4J3O D;  1ZP0 B;  1YJJ A;  1DYQ A;  2A5U A;  4HXD A;  3ZNI D;  1AN8 A;  3AEB B;  4KGR A;  1RFK A;  2LD9 A;  2MRP A;  1NYR A;  3QC8 B;  4TKN A;  3K9P B;  1I35 A;  1SXT A;  3Q8B A;  2ZPN A;  2Z8L A;  3A9K B;  5E6J A;  3NJT A;  3DBH B;  4G3X B;  1K53 A;  1DGJ A;  2ZCC A;  1ZUD 2;  2NPT B;  4XZ4 A;  1IBX A;  4KGS A;  3BYT B;  3AEG B;  2QSD A;  3GZN B;  3PLV A;  3BIN A;  3ALB A;  2KLG A;  2JF5 A;  2KMC A;  3RMK C;  3WIM A;  1JRO A;  4ICU A;  2KHW B;  4W9D A;  1UZX B;  2Q5W D;  2WXM A;  2M0X A;  1WI0 A;  2WDT B;  3H6N A;  2DEN B;  2BTE A;  3FIL B;  2MWS B;  4KX6 B;  1N5W A;  4N6E B;  2BYV E;  2ZCB A;  2SEB D;  3DQV A;  1I7H A;  3EHV A;  2IY1 B;  3H7P A;  1GPX A;  4WWO A;  3R2I A;  1WXM A;  1F2R C;  4ITK A;  4OZA A;  1WSP A;  1P7E A;  4OW0 A;  4M01 A;  4JWU C;  3P2B A;  3UI3 A;  3ZW3 A;  1SGH A;  2JZ3 B;  5IP4 D;  1N61 A;  1QOG A;  1HTQ A;  2IGG A;  1D5X C;  4KZ0 A;  1ZDX A;  3WAO A;  2BB5 A;  1CZP A;  1V86 A;  1I4Q A;  1RYJ A;  3BK2 A;  2WLB A;  2UYZ B;  3K9O B;  4BKS D;  4NJ7 A;  4EZJ A;  2CHW A;  3DBS A;  3GZN I;  2MBE A;  2M19 A;  3RI7 C;  2DZJ A;  1J7A A;  5BO4 B;  2GMI C;  1XF5 L;  2BT6 A;  4PT5 A;  2RDB C;  3V3X A;  3Q14 C;  2BYE A;  2GBM A;  1V2Y A;  2MBH A;  1D6E C;  3EC8 A;  1XD3 B;  3KWL A;  4YXD B;  1WJ4 A;  2N7D A;  2JXT A;  4YTM B;  2DAF A;  2VH2 A;  3AE4 B;  3N32 A;  3B2G A;  1QF6 A;  2KT7 A;  2G4S A;  2XK5 B;  4MGK E;  4C80 A;  1P9D U;  4DDG D;  4GU2 A;  4KKI A;  1WXS A;  4NAW A;  2XK5 A;  1QOA A;  1F9J A;  2ZPY A;  2LEK A;  5BYQ A;  3V60 A;  1WM2 A;  4PS3 A;  2IO1 B;  2XN9 C;  1C4P A;  3NS8 A;  3MC8 A;  5GXG B;  1JCK B;  3ONS A;  3N30 A;  1TYG B;  3AE1 B;  3IAM 1;  3RUL A;  5C1Z A;  2RPV A;  4K81 A;  2FBW B;  3O13 A;  4ANV A;  2NR2 A;  4PYU A;  4EUT A;  1UWX A;  3ABV B;  4IW0 A;  4YTN B;  2JWU A;  3B08 A;  1YMH E;  2BQQ A;  4L1B A;  2UU7 A;  4N58 A;  2M4N A;  1PGB A;  3OJ4 B;  4NY0 A;  4W9K A;  1L2N A;  2KYW A;  2LRW A;  1F77 A;  2GBJ A;  4ZRQ A;  2BB6 A;  3RD2 A;  2YLM A;  2KTR B;  4HRO A;  1R4M B;  1P7F A;  3NRZ A;  2MJE A;  1CK1 A;  5IO9 A;  3RN9 C;  4DHJ D;  2NBW B;  2IPK D;  3PZ8 A;  4M00 A;  2LAS A;  5E6P A;  2WXF A;  2KJ6 A;  1JAL A;  2CHX A;  2ASQ A;  3PS6 A;  2KDM A;  1GAQ B;  2WXK A;  3R66 C;  2L0F A;  1V5O A;  3DPD A;  1I42 A;  4NJC A;  2FNJ B;  2O2V A;  3O65 B;  3I63 C;  1RM6 C;  3OG5 A;  2K22 A;  3RZF A;  1T5X D;  3SU8 X;  2BYF A;  3Q8F A;  1QIL A;  3ZDT A;  1YN4 A;  3C8Y A;  2JZP A;  3RUI B;  1MG8 A;  1V97 A;  2V0G A;  2NBU A;  4G50 A;  4B9K A;  4US9 A;  2MSE D;  2MEK A;  1TS2 A;  2IDY A;  2EMS A;  3IAS 1;  2N1V A;  4TSS A;  3AN1 A;  4EOY A;  1SJE D;  2K5P A;  2ZW1 A;  3R2T A;  4HK2 A;  2KTF A;  3U8Z A;  1AYF A;  1VD2 A;  2Y5P A;  4HKZ E;  1Y56 A;  2KFK A;  3IHP C;  2KAJ A;  2DZI A;  4IWO A;  3WCQ A;  1XXG A;  4KVG B;  2NS5 A;  3CMM B;  3EEC A;  2XBB C;  1R4N I;  3TJP A;  1A70 A;  4MJS A;  4F8C B;  4BKT A;  2WXL A;  2MHJ A;  2FCN A;  1NEN B;  1TJE A;  4RM8 A;  1E8Z A;  1ZOY B;  1WXQ A;  3VUX A;  3ZDM C;  4FJY A;  1TS3 A;  3SFE B;  3Q3M C;  3ZXR A;  3TUO A;  2QC8 A;  1R7S A;  2VRR B;  2GRI A;  2W3S A;  3DVG X;  2BBC A;  4YSX B;  4C7Z A;  1NI2 A;  2DZK A;  3JVZ X;  2DX5 B;  2RDG A;  2O2V B;  3H7S A;  4GOC A;  3ENE A;  4ZRI A;  4RGM A;  2LZ6 A;  1YN5 A;  4FN2 A;  2HDE A;  3P4S B;  3ETR A;  3M3J A;  3QAQ A;  3W1Y A;  3AMZ A;  4R3D A;  2K9X A;  1E6E B;  4OVZ A;  3PRP B;  1FRR A;  2W3R A;  2K1F A;  5FK9 C;  3VHT C;  3VTV A;  3JW0 X;  3IBE A;  1TY2 A;  2JT4 B;  5DPR A;  1SEB D;  1WX8 A;  3N3K B;  2KXJ A;  4GIV A;  4WWM A;  4HRS A;  1WX7 A;  3U4E G;  1SB3 C;  4HPM B;  1GB4 A;  2A4Z A;  2K25 A;  4REZ A;  2WWZ A;  3A33 B;  4ZRP A;  3ZIM A;  1IGD A;  3QK0 A;  3VQI A;  4MGY E;  4RGT A;  2JRH A;  3MTN B;  1WE6 A;  2VH1 A;  1C1Y B;  2KJH B;  4MJS B;  3VTU A;  1M4V A;  1XLQ A;  5FR3 A;  4KKJ A;  5JHA A;  3L10 B;  3PZD A;  4HVB A;  3APD A;  3NVV A;  2J53 A;  3OJ3 A;  4I6N B;  4DDI D;  5LNK 1;  1L0X B;  3VDZ A;  1S1Q B;  3GE8 C;  4I6L B;  2LUM A;  3PRM B;  5HHD G;  4A9A A;  3QJZ A;  1NBF C;  4WJQ A;  2KVZ A;  4NAM A;  3PHX B;  2I38 A;  1OQY A;  1WGD A;  4WJN A;  3AE8 B;  1SF0 A;  1WGY A;  2B76 B;  3E9S A;  3ZUN A;  2MX2 A;  3V6C B;  1U4A A;  3Q2A C;  2DBY A;  2KMA A;  3A4S C;  3U7Z A;  4IWP A;  2C7H A;  1P98 A;  1P3Q U;  3URY A;  4IM3 A;  3R7R A;  3RNA C;  4NQL B;  2FUG 1;  3MC0 B;  3DBR B;  4IOI E;  2KN5 A;  1N5X A;  4K3C A;  5AZG A;  5IOI A;  1ZE3 D;  2CKH B;  4CO7 A;  4M0W B;  1WXV A;  1D3Z A;  2BKF A;  2GBK A;  1QZE A;  2ACZ B;  3B1L X;  3DBL B;  1VDV A;  4C4V B;  2KTR A;  1TKE A;  4N59 A;  4XX5 A;  3VR9 B;  1SE2 A;  3QQ8 B;  3NS1 A;  3SFD B;  2IZV B;  2MCN B;  4LTU A;  2QJL A;  3P63 A;  2LVQ A;  1VZ6 A;  4KGT A;  1WR6 E;  3WA0 A;  2KDB A;  3ZGZ A;  3WAM A;  2PVO D;  1Q1O A;  2UWQ A;  4MM3 B;  1BUI C;  1RFA A;  2BS4 B;  4RNA A;  1K50 A;  1UUP A;  1LM8 B;  1B9R A;  1X1M A;  5G5H A;  4M02 A;  2KK8 A;  2IO2 B;  2KO3 A;  4M8N A;  3PTF C;  3SHQ A;  2ZZP B;  5D3D A;  2B3A A;  3AH7 A;  4OVU A;  4TV3 A;  2ZVO A;  4NZL B;  1ROE A;  2FAZ A;  4PK1 A;  1EM7 A;  3U7D A;  1Y8R C;  3N9Y C;  2LGX A;  1BML C;  2EMT A;  2Z0E B;  4KIK B;  3B9J A;  4W9H A;  2WDQ B;  3KLS X;  4P1C C;  2ONQ A;  4QAY A;  4WUR A;  2NVU I;  1TS4 A;  2GI9 A;  1NDD A;  1ZXI A;  3LDZ E;  4MSQ B;  3ECI A;  3UQA A;  1TY0 A;  3V6E B;  1D4B A;  4K3B A;  4JQW C;  3MHZ A;  3CIR B;  2YVC A;  2JPH A;  2L32 A;  2MW5 A;  1XQQ A;  1DOX A;  3P4Q B;  1TKG A;  4M8M A;  1AW7 A;  1TGZ B;  2WU2 B;  4HJG E;  4C4V A;  1XLP A;  1WF9 A;  1L6U A;  2CU3 A;  4NJ6 A;  2OOB B;  3TL5 A;  5IA7 A;  2L7R A;  3PHW B;  4EEW A;  4FA6 A;  4HCN B;  4XGA B;  4P1B C;  5KHO A;  3WAP A;  1JW9 D;  4RCO A;  4JWS C;  2LI5 A;  2PPH A;  1E7U A;  4PYZ A;  1PQS A;  4LDT D;  3BVG A;  2LGY A;  1T0Q C;  3VAW A;  4IDI A;  4KV2 A;  4A90 A;  2WX1 A;  1VCB A;  1FM0 D;  2DZM A;  3A9K A;  2K8H A;  2IBI B;  2GLS A;  3P42 A;  2KMM A;  1JWA D;  3EGR A;  2ZJD A;  3ZJV A;  1UBQ A;  1TZ1 A;  2FCM A;  1DOI A;  3PPA A;  1V80 A;  1AAR A;  1HA5 A;  3AU5 A;  5EE1 A;  3M95 A;  3SD5 A;  4FUL A;  4WQO B;  1KOT A;  1G6J A;  4AQ7 A;  4YT0 B;  2FUH B;  1MI0 A;  2L76 A;  2REX A;  3DWM A;  3A9J B;  4XYC A;  1HQR D;  1PYW D;  2WX0 A;  3PLU A;  1J0G A;  4P6V F;  1LFD A;  2N9K A;  3A9J A;  1I4H A;  4XWW A;  1STE A;  3DBL I;  1I4P A;  2L52 A;  2AX5 A;  3A1Q B;  2N0S B;  4W9L A;  1SE3 A;  5E6N A;  3JSV B;  3M62 B;  2LXA A;  1UEL A;  4LNO A;  4IWQ A;  4II3 B;  4ZRJ A;  2WYQ A;  2XNA C;  1ENF A;  4XC2 A;  1WMH B;  3ZJU A;  3VUY A;  1SIJ A;  2I2Y A;  4ARC A;  1WIA A;  1E8W A;  1XT9 B;  2JVC A;  3I3T B;  5D7G A;  3W2D A;  5IN7 A;  3T9L A;  2JU6 X;  1EF1 A;  2LJ5 A;  5HI1 A;  5AZH A;  1GB1 A;  4DK5 A;  3X23 A;  2K6D B;  2KFK B;  2ZW0 A;  1WGG A;  2WXJ A;  3N20 C;  1OQQ A;  3NVY A;  1JRP A;  2Y3A A;  4WJO A;  4RGN A;  2HJ8 A;  1S3S G;  1TTN A;  2V4L A;  2WQY B;  2D2Q A;  3AE9 B;  5JHB A;  4WQM A;  1K8R B;  1YQB A;  3C0R B;  2SAK A;  2WP9 B;  3VRB B;  4ZRK A;  3DCG A;  4GMV A;  4HPL B;  4I6P A;  1KF6 B;  2CHZ A;  1J8C A;  5BYS A;  1PDX A;  3VVW B;  4B95 A;  1QKZ A;  1FFV A;  4BKS A;  2WS3 B;  3H1U A;  4LJO B;  1KLG D;  5I4D A;  2J4X A;  3EFU A;  5KHQ A;  4G0N B;  1F0Z A;  2JYE A;  1WX9 A;  1YX6 B;  5JZE B;  2JQR B;  1WRD B;  2K8B A;  3OAW A;  5BYR A;  3DHI C;  1XO3 A;  1WRI A;  2W54 A;  2LXC A;  3C19 A;  4CYE A;  1IYF A;  2IJ0 A;  4C00 A;  2EEL A;  5C2T B;  3KQ4 A;  1T0R C;  1WJN A;  3TIX A;  2WXR A;  3N1X C;  2KQS A;  1GC6 A;  4GGQ A;  2WDV B;  1ACC A;  1N6Z A;  3ZTC A;  4FJZ A;  3ZRC A;  1KLV A;  2C60 A;  3M63 B;  5JXV A;  2O6V A;  1RWS A;  2H89 B;  4DHZ B;  4HEA 1;  4BKG A;  3KYC D;  3QCA A;  1YOV B;  2D3G A;  1E7V A;  2YEP B;  3U2S C;  2DYM A;  3RNF C;  2I1K A;  3VXW A;  1XEE A;  2YEP F;  4ANX A;  3APF A;  3HVZ A;  2DNF A;  1P0R A;  2WXG A;  3AE6 B;  2BWF A;  3JSV A;  3UIP B;  1YJI A;  2ZEQ A;  1LQB A;  2DYO A;  3Q8E A;  4RM9 A;  4YL8 A;  3EUB 2;  4A3P A;  1SBB B;  3ML9 A;  1H8C A;  1EUV B;  3VH3 B;  1IPG A;  3AEC B;  3KH0 A;  2LFI A;  2KWD A;  2MP2 A;  2D07 B;  2IO0 B;  4RGO S;  4AP4 C;  3Q3J A;  3QA8 A;  3TBL D;  2RGF A;  2LGD A;  3BY4 B;  3DHG C;  2LVO A;  1OFF A;  2VZK D;  4MEM A;  3AU4 A;  3H7P B;  2KDE B;  3N1Y C;  1L0Y B;  1L4D B;  2KX3 A;  1N62 A;  4BFR A;  3HHM A;  1WE7 A;  3ZJT A;  4MGZ E;  1I4R A;  2BGF A;  2KQ4 X;  4HWI B;  4XDD A;  3ZXV A;  2N9X A;  4MM3 A;  1CJE A;  4J6I A;  3ZRF A;  2OHF A;  1JML A;  1GOZ A;  2WDR B;  3NG0 A;  3S2A A;  3QHT A;  2EKE C;  3J9C A;  2K0P A;  5T8I A;  2LWP A;  1R4M I;  2D11 A;  5AZF A;  2N4F A;  4JIO U;  1JWB D;  1WH3 A;  3V05 A;  4KSL C;  4P16 A;  3AE3 B;  1SJH D;  4HPP A;  2G45 B;  3LYY A;  3VH4 B;  1L0V B;  3DVN V;  2KX0 A;  2MH7 A;  5AUI A;  3EA6 A;  4MSM B;  4JLC A;  2D3B A;  2J0K A;  1YQ4 B;  1NYQ A;  1WFY A;  3UQB A;  1EO6 A;  3NVZ A;  2LRU A;  3RT3 B;  2KDI A;  2N9E B;  3ZQ4 A;  2XEW A;  2W55 A;  2L05 A;  2L0T A;  1TBE A;  5J18 A;  3NZU A;  1YJ1 A;  4H2A A;  2Z59 B;  4E3C A;  2QEJ C;  2INP E;  2BPS A;  4C7Y A;  1KTK A;  2PKO A;  1JRU A;  1I4X A;  2KC1 A;  4A8X C;  3FKY A;  1GUA B;  5G5G A;  5C3J B;  2LJI A;  4KDL B;  4WAF A;  2C5L C;  4GSW A;  2GOW A;  3LB8 C;  1D5M C;  2JY6 A;  3T3N A;  1VJK A;  3Q3N C;  4ANW A;  3VFK A;  1WXA A;  4IM2 A;  2V3N A;  2RSU A;  1A5R A;  2HTH A;  1D5Z C;  3DOW A;  1V8C A;  2KLC A;  5TSS A;  3VRA B;  3IG3 A;  4JL9 A;  1JWS D;  1FPY A;  3HM6 X;  3VTW A;  2D3A A;  1ZW7 A;  2PE9 A;  4PS8 A;  1OGW A;  2NBV B;  4ACF A;  3MFG A;  1SIF A;  4HDO A;  2WNM A;  5HG2 A;  2FCQ A;  1C3T A;  3B0A A;  1WY8 A;  1V9J A;  1ET9 A;  1T0S C;  2AL3 A;  4YWG G;  2MJD A;  5EDS A;  3TSS A;  5TR5 A;  5L95 C;  3RNE C;  4WWN A;  2MBB B;  3RCZ A;  4E74 A;  1IUE A;  1N63 A;  1P1A A;  1UBI A;  2RDH A;  2AWT A;  1FCL A;  3GB1 A;  1YN3 A;  1OQR A;  2G3Q B;  1KLU D;  1HTO A;  2N9P C;  1WYG A;  2GBR A;  2M56 B;  3V62 A;  3ZVV A;  3BWU D;  4GDL B;  2HE7 A;  3AE7 B;  4MH8 A;  5FKA C;  4B0E A;  3NHE B;  4YSZ B;  4PS7 A;  4XDC A;  4DHJ B;  4FJV B;  4ASW C;  2Y5B B;  3AE2 B;  1UH6 A;  4O1N A;  2N7J A;  4AJW A;  4EFO A;  4IC7 B;  3ZYY X;  3MHS D;  1UD7 A;  2J52 A;  2AQ3 B;  3HM3 A;  4A6Q A;  1FIQ A;  3L4P A;  1NEK B;  1UGJ A;  2AQ1 B;  1RLF A;  4NPN A;  2WXP A;  3IFW B;  2K3U A;  1E90 A;  4JE3 B;  2R61 A;  1WGH A;  2DHZ A;  4WIP A;  4N9F 4;  3HUI A;  2BYT A;  4ANU A;  1EU3 A;  5DPT A;  2PTL A;  3I57 A;  2LHE A;  2AL6 A;  2JSV X;  2PLP A;  2W9N A;  5DPW A;  5JH5 C;  1FNU A;  3L16 A;  2N1W A;  3BVM A;  1SE9 A;  1ZXH A;  1Z5S B;  2V9H A;  3ZKJ C;  4ZYS A;  3TEW A;  2V3P A;  1K52 A;  4LDT B;  2G9H D;  1KH0 A;  2INC C;  1FXA A;  3ZLZ A;  2L8J A;  1FNV A;  4BAX A;  4L23 A;  2QMT A;  2QIE B;  4EZL A;  2WHI A;  2JUO A;  1QQR A;  4GDK B;  2PW9 A;  4NQK E;  3E56 A;  2PIA A;  1B1Z A;  1C77 A;  4XE0 A;  2JXX A;  2KWV B;  3KWV A;  1FFU A;  3SEB A;  2J42 A;  4E71 A;  2EKI A;  2C7M B;  2CR5 A;  3AEA B;  4OVV A;  5CHW A;  5IAA C;  3L17 A;  4LJP B;  4GB9 A;  4WJP A;  4MAC A;  2L3Z A;  3V61 A;  3KW5 B;  1JWM D;  4RF1 A;  2MLB A;  4JX1 C;  2LVP A;  4JGH B;  5AUK A;  2K39 A;  3HIZ A;  3PZ7 A;  3IVF A;  3T8M A;  5HFY A;  2ICI A;  2E3T A;  3BYY B;  1JQ4 A;  2RMM A;  2FIF A;  1E0Z A;  5J2R A;  4TUU A;  4ARI A;  1MHH E;  3PT2 B;  3WAN A;  3X0W A;  4K1R B;  2IGD A;  4FHK A;  1SE4 A;  2KZR A;  3NVW A;  3DHH C;  2JYT A;  4B6W A;  3Q3F A;  4RMA A;  2KFJ A;  4URK A;  2M0A A;  4XWT A;  3DWG C;  3ZO5 B;  2V3S A;  4IKG A;  1FMA D;  4DHZ E;  4ZDV A;  3UGB B;  3KUC B;  3TCA A;  2KJR A;  3R3M A;  5H92 C;  1CMX B;  3NZ3 A;  4ZOH C;  5C23 A;  2FCS A;  2JRI B;  4IUM B;  3OLM D;  5D2M B;  2IGH A;  5DCN A;  1QT9 A;  4ZHO A;  5L83 A;  2GBN A;  1KFY B;  2G1E A;  4GDK A;  3W9C B;  1NI3 A;  4ICV A;  5LLI A;  2KOX A;  3PSE B;  2HJ1 A;  3KYD D;  4X57 B;  3QX1 A;  1GNU A;  4LNN A;  1KRH A;  1VZ7 A;  2KVR A;  2PVG C;  1TIF A;  4F1S A;  1E10 A;  3ZNG C;  1WR1 A;  3NZS A;  1V1P A;  3FIL A;  3JYU A;  1ZDV A;  2BS3 B;  1UGM A;  3GS2 A;  1GJZ A;  1YD8 U;  3KUD B;  2JWZ A;  4EE2 A;  1ISN A;  1UF0 A;  3BII D;  4YTP B;  1HZ5 A;  2KC2 A;  2KNB A;  4A3O A;  4P7I A;  3UF8 A;  3PVL A;  3H9D A;  2J7Q B;  5BMI A;  5BMG A;  1KM7 A;  1L7Y A;  1T3Q A;  1V1O A;  2KKC A;  1Q0W B;  1XCQ L;  2V1Y A;  3EFC A;  4TQ1 A;  5H8Y E;  4OZB A;  1C76 A;  2I1J A;  2KN4 A;  4M0W A;  1JWU D;  1EU4 A;  3BK1 A;  1MG4 A;  2RD0 A;  4OHJ A;  1FO4 A;  3W1S A;  1YNT E;  2WGS A;  3Q69 A;  1L4Z B;  1WZ0 A;  3PGE A;  4DXF A;  2RPQ A;  4D2K A;  3W5U B;  2CS4 A;  3MP9 A;  3R8B A;  3Q8A A;  2D3C A;  1SSN A;  2NTT A;  5EE0 A;  1FEH A;  1RRB A;  4AWJ A;  2C9W B;  4FAD A;  4WAA A;  2PMV A;  1PFD A;  1V81 A;  1HZ6 A;  3PRE A;  2M1M A;  1QLB B;  4AS1 A;  4NAW B;  2CJN A;  1MHX A;  2QHO A;  3Q6B A;  4GDL A;  3IT6 B;  2MBO A;  5CHF A;  5DPS A;  1E9M A;  4ZYN A;  2IND C;  4IG7 B;  2CU1 A;  1WGR A;  1R4N B;  4L2Y A;  1J19 A;  1EF5 A;  2X38 A;  3ML8 A;  1TKY A;  4KIK A;  4KSK C;  4MGI E;  2BKR B;  3CST A;  4W9J A;  1V6E A;  4CQN A;  1YIW A;  5HKH A;  3AB5 A;  2IYD B;  3SR6 A;  1ZKH A;  4LLG M;  4W9I A;  2MP2 B;  1IP9 A;  1AWD A;  3VUW A;  1XLN A;  1M94 A;  1YX5 B;  2AYO B;  1RAX A;  2KDF B;  1C79 A;  1MJD A;  5CTR C;  3L13 A;  4BOS C;  4WWP A;  4C56 C;  3CF6 E;  3PRZ A;  5J17 A;  1QOB A;  3P4P B;  4US8 A;  2NPT A;  3DBR I;  3AXC A;  4NNJ B;  4MEL A;  1IBX B;  4DXA B;  3AEE B;  2N9L A;  2TSS A;  3TEZ A;  3D32 A;  4W9E A;  3DVG Y;  2O6V D;  1VRA B;  2MQJ A;  4K7U A;  3RNB C;  1OEY A;  1FCC C;  1ESF A;  4MDK E;  5D94 A;  1E8Y A;  1KJT A;  3RNG C;  1LO5 D;  3KUZ A;  3WAL A;  2NCN A;  2BW2 A;  2ZVN A;  1Q5W B;  2JX5 A;  3NOB A;  3A4R A;  2LUE A;  4BBN F;  3RFZ B;  4A20 A;  4G11 A;  4USA A;  5CX3 A;  3DVN U;  1VLB A;  3CSF A;  3RZW C;  4RF0 A;  2LMC A;  1EWY C;  1N60 A;  1WWT A;  3T3O A;  1IGC A;  2R2O A;  5LXI B;  2FE8 A;  4YSY B;  3N1Z C;  3UIN B;  4DXG A;  2D10 A;  2NMQ A;  1E5W A;  2PE6 B;  1E7P B;  3HK0 A;  4LNI A;  1HEZ E;  2DAJ A;  5BMH A;  2V4I B;  4RFB A;  2BS2 B;  5CHV C;  4LCD E;  4A55 A;  5GMV A;  3GOE A;  4GLS C;  3P1M A;  1WJ6 A;  5EE9 A;  1Z2M A;  3AM9 A;  1BXT A;  3QWZ B;  1PUT A;  3H8H A;  2L83 A;  3AV8 A;  2D5G A;  3LJ3 A;  3P4R B;  2QCZ A;  4KDI C;  4S0R A;  5MPO A;  3VR8 B;  3W5V B;  3APC A;  2BF8 B;  2H88 B;  4K7W A;  3HVD A;  3TMP B;  4ZHP A;  1EWC A;  1C4A A;  2ZNV B;  4FLH A;  2KAC A;  2C7N B;  3AUL A;  2WXI A;  2N7E A;  1WJU A;  3IXS A;  2AQ2 B;  1WGK A;  2WXO A;  5G55 A;  3Q3O C;  1DOY A;  4BBN C;  1VR9 A;  4FBJ B;  1L5P A;  1XCT L;  1WZ3 A;  3L08 A;  4BZA A;  3KVF B;  3PO0 A;  1PGX A;  1J7C A;  1J7B A;  4S17 A;  1ZPS A;  4EZK A;  4KZC A;  3TEX A;  3R7Q A;  2RR9 A;  1C9F A;  2LGI A;  2Z0D B;  3GE3 C;  5D6J B;  1FRD A;  2L00 B;  3AED B;  4UDU C;  2VZK B;  3RNC C;  2HD5 B;  3RPF C;  4OZC A;  2J0J A;  3L54 A;  4BVU C;  5LXH A;  2DWQ A;  3BVZ A;  4EKU A;  2O6V B;  5IKC M;  4FHJ A;  1TZO A;  4RH6 A;  1GG3 A;  1C78 A;  3NY5 A;  4LK0 M;  4MT5 A;  2L1A A;  4F7Z A;  4BOZ B;  3UIO B;  2OED A;  3A1Q A;  3GP7 A;  2KD0 A;  4DQO C;  5AEK B;  1Q10 A;  3CWI A;  1BT0 A;  4HCP B;  2IO3 B;  1VZ8 A;  3MC9 A;  1MFW A;  2Y5C A;  4WH4 A;  4GN1 A;  2AEH A;  2DYB A;  4B0M A;  1HXY D;  3I5J C;  1LGR A;  1WYW B;  1ET6 A;  4W9F A;  1QOF A;  1L6V A;  2ON8 A;  4W9G A;  2WXH A;  3ZNZ B;  3I9V 1;  3LXF A;  1OTR B;  1WM3 A;  2KWU B;  2K6Q A;  3PV1 A;  1FD6 A;  1FXT B;  2MA9 B;  3W1S C;  3U52 E;  1V1P B;  3OWE B;  4MH0 E;  2OJW A;  1GC7 A;  1V49 A;  4HLE A;  4TMA B;  4HDQ A;  3Q8C A;  2MBQ A;  2QDF A;  3TEY A;  3AI5 A;  2CJO A;  2IY0 B;  3HRD D;  4Q2J A;  2M8S A;  1E8X A;  4FXC A;  5FR6 A;  2WXQ A;  1OEY J;  1NVI D;  2PJH A;  2FID A;  3DBH I;  1TT5 B;  3ZNH B;  1YQ3 B;  2KQ7 A;  3IT4 B;  1T0Y A;  2WXN A;  1C4C A;  3NUH B;  1FNW A;  4DBG A;  2MJ3 A;  1F52 A;  4GXB A;  1V5T A;  4JPS A;  1LXD A;  3AE5 B;  2OJR A;  4AOF A;  2HTM E;  1H4R A;  2KAN A;  5EE3 A;  2GB1 A;  2BVC A;  3ZTD A;  1UWM A;  2X8X X;  3QIJ A;  5D3I B;  1CQV A;  3DDC B;  3MJ5 A;  2K8C A;  1TS5 A;  3BZD B;  2E6X A;  2NTS A;  2J0M A;  5E6O A;  3AEF B;  4II2 B;  4AUQ C;  3L0W B;  1UNS A;  2DLB A;  2PEA A;  3QAR A;  1F1H A;  1K51 A;  2WU5 B;  4HKQ A;  1MVK A;  1PGA A;  2M17 A;  4K7S A;  4AJY B;  3SDL C;  2QIL A;  1XLO A; 
#chains in the Genus database with same CATH homology
 4MEM A;  3AU4 A;  3H7P B;  5G2N A;  2KDE B;  3PHX B;  1OQY A;  1WGD A;  2R2Q A;  1WZ0 A;  2KX3 A;  3PGE A;  4TQ0 A;  2RPQ A;  4W9C A;  4WJN A;  3U30 A;  4BFR A;  3HHM A;  1WE7 A;  2JZZ A;  4CHK A;  2CS4 A;  1WGY A;  3ZUN A;  4DWF A;  3MJW A;  4MGZ E;  2MX2 A;  2ZNV C;  3V6C B;  1U4A A;  2KWC A;  2BGF A;  2KMA A;  3A4S C;  3RYT A;  4HWI B;  4IWP A;  1WMH A;  2N9X A;  1HE8 A;  1P98 A;  2C7H A;  4MM3 A;  1P3Q U;  2BWE S;  4IM0 A;  4IM3 A;  4HJK A;  4J6I A;  3R7R A;  3ZRF A;  1RRB A;  4AWJ A;  2C9W B;  4FAD A;  2G4D B;  4WAA A;  4NQL B;  1V81 A;  2KN5 A;  3PRE A;  3S2A A;  2M1M A;  1ZGU B;  5AZG A;  3QHT A;  4NAW B;  2EKE C;  2CKH B;  2A5U A;  4HXD A;  2QHO A;  4M0W B;  3ZNI D;  1WXV A;  4CO7 A;  2BKF A;  2GBK A;  1D3Z A;  1QZE A;  2LWP A;  4GDL A;  3B1L X;  1R4M I;  2LD9 A;  2D11 A;  2MBO A;  2MRP A;  5AZF A;  5CHF A;  5DPS A;  2N4F A;  2KTR A;  4XX5 A;  4ZYN A;  3QC8 B;  4JIO U;  1WH3 A;  4IG7 B;  2CU1 A;  4TKN A;  1WGR A;  3K9P B;  1I35 A;  3QQ8 B;  4KSL C;  2IZV B;  2ZPN A;  2MCN B;  1J19 A;  2G45 B;  3A9K B;  1EF5 A;  3VH4 B;  3DVN V;  2LVQ A;  4G3X B;  2KX0 A;  3ML8 A;  4KIK A;  4KSK C;  2ZCC A;  4MGI E;  2NPT B;  4MSM B;  4XZ4 A;  1WR6 E;  4JLC A;  3WA0 A;  2KDB A;  2BKR B;  2J0K A;  3CST A;  4W9J A;  3PLV A;  3BIN A;  3ALB A;  3WAM A;  2KLG A;  2JF5 A;  2KMC A;  1V6E A;  1WFY A;  3UQB A;  3WIM A;  1Q1O A;  1YIW A;  1EO6 A;  4ICU A;  2KHW B;  2UWQ A;  4W9D A;  5HKH A;  2LRU A;  3RT3 B;  1UZX B;  2KDI A;  2N9E B;  2M0X A;  2IYD B;  2XEW A;  1WI0 A;  2L05 A;  2L0T A;  1ZKH A;  2WDT B;  3H6N A;  1TBE A;  4W9I A;  1RFA A;  2DEN B;  2MP2 B;  5J18 A;  2MWS B;  3NZU A;  1LM8 B;  1IP9 A;  1YJ1 A;  1X1M A;  2KK8 A;  2Z59 B;  3VUW A;  2IO2 B;  4E3C A;  2BYV E;  2KO3 A;  1M94 A;  1YX5 B;  2ZCB A;  4M8N A;  3PTF C;  3SHQ A;  2AYO B;  1RAX A;  2KDF B;  2BPS A;  2ZZP B;  3DQV A;  3EHV A;  1JRU A;  2B3A A;  2IY1 B;  3H7P A;  5CTR C;  4WWO A;  3L13 A;  2KC1 A;  4BOS C;  4WWP A;  1WXM A;  1GUA B;  3CF6 E;  3PRZ A;  5J17 A;  4OVU A;  4TV3 A;  4KDL B;  2ZVO A;  2NPT A;  3P2B A;  2FAZ A;  2C5L C;  4GSW A;  3DBR I;  3ZW3 A;  2GOW A;  1SGH A;  3AXC A;  3U7D A;  1Y8R C;  4NNJ B;  2JY6 A;  2JZ3 B;  2LGX A;  4ANW A;  3VFK A;  1WXA A;  4MEL A;  2EMT A;  4IM2 A;  2Z0E B;  4DXA B;  4KIK B;  2RSU A;  1A5R A;  4KZ0 A;  3WAO A;  2HTH A;  4W9H A;  1V86 A;  3DOW A;  2KLC A;  3D32 A;  3IG3 A;  4JL9 A;  4W9E A;  3HM6 X;  2NVU I;  3DVG Y;  2O6V D;  3VTW A;  1NDD A;  2MQJ A;  4K7U A;  1ZW7 A;  2UYZ B;  2PE9 A;  3LDZ E;  4PS8 A;  3K9O B;  4BKS D;  4NJ7 A;  4EZJ A;  4MSQ B;  3ECI A;  1OEY A;  3UQA A;  1OGW A;  2CHW A;  3DBS A;  2NBV B;  3V6E B;  4MDK E;  5D94 A;  1SIF A;  1E8Y A;  3GZN I;  2MBE A;  1KJT A;  4HDO A;  4JQW C;  2FCQ A;  3KUZ A;  2DZJ A;  1C3T A;  5BO4 B;  2YVC A;  2GMI C;  2JPH A;  3WAL A;  3B0A A;  2MW5 A;  1XQQ A;  2BYE A;  2GBM A;  1V2Y A;  2MBH A;  1WY8 A;  3EC8 A;  4M8M A;  1TGZ B;  1XD3 B;  2NCN A;  2ZVN A;  1V9J A;  1Q5W B;  3NOB A;  1WJ4 A;  3A4R A;  2LUE A;  2N7D A;  2AL3 A;  1WF9 A;  5EDS A;  2DAF A;  4BBN F;  3N32 A;  4NJ6 A;  2OOB B;  4A20 A;  3TL5 A;  4G11 A;  5TR5 A;  5IA7 A;  2L7R A;  3PHW B;  4EEW A;  4FA6 A;  4HCN B;  5CX3 A;  5L95 C;  2G4S A;  4WWN A;  3DVN U;  5KHO A;  2XK5 B;  3CSF A;  4MGK E;  2MBB B;  3WAP A;  3RZW C;  1P9D U;  4DDG D;  3RCZ A;  4GU2 A;  1WXS A;  4E74 A;  4NAW A;  1P1A A;  1UBI A;  2XK5 A;  2LI5 A;  1F9J A;  2PPH A;  2AWT A;  2ZPY A;  1E7U A;  3V60 A;  1WM2 A;  2G3Q B;  4PYZ A;  4PS3 A;  1PQS A;  2IO1 B;  4LDT D;  2LGY A;  3NS8 A;  3VAW A;  2R2O A;  5LXI B;  2N9P C;  4KV2 A;  2GBR A;  3UIN B;  3V62 A;  2WX1 A;  3ZVV A;  3ONS A;  3N30 A;  1VCB A;  2DZM A;  3A9K A;  2K8H A;  4GDL B;  2IBI B;  2HE7 A;  3NHE B;  2D10 A;  3RUL A;  5C1Z A;  1E5W A;  2PE6 B;  4K81 A;  2ZJD A;  4PS7 A;  4DHJ B;  3HK0 A;  1UBQ A;  1TZ1 A;  4FJV B;  4ASW C;  2DAJ A;  2FCM A;  2Y5B B;  3PPA A;  4ANV A;  1UH6 A;  2NR2 A;  1V80 A;  4PYU A;  1AAR A;  3AU5 A;  4AJW A;  4EUT A;  5CHV C;  3M95 A;  4LCD E;  3SD5 A;  4FUL A;  4IW0 A;  4EFO A;  4WQO B;  1KOT A;  4IC7 B;  3MHS D;  1UD7 A;  3B08 A;  1G6J A;  3HM3 A;  2FUH B;  5GMV A;  3GOE A;  2M4N A;  1RLF A;  1WJ6 A;  4NPN A;  2L76 A;  2REX A;  1Z2M A;  3OJ4 B;  4NY0 A;  4W9K A;  3A9J B;  3IFW B;  1L2N A;  2LRW A;  1E90 A;  2WX0 A;  3PLU A;  1J0G A;  1LFD A;  1WGH A;  2DHZ A;  3QWZ B;  2GBJ A;  3A9J A;  4N9F 4;  3RD2 A;  2YLM A;  2KTR B;  3LJ3 A;  3DBL I;  4ANU A;  4KDI C;  5DPT A;  4DHJ D;  2NBW B;  2AL6 A;  3A1Q B;  2W9N A;  3APC A;  2LAS A;  4W9L A;  5E6P A;  5E6N A;  5DPW A;  2BF8 B;  4K7W A;  5JH5 C;  3JSV B;  3L16 A;  2N1W A;  3M62 B;  2KJ6 A;  2LXA A;  1UEL A;  3TMP B;  1SE9 A;  2CHX A;  2ZNV B;  2ASQ A;  4FLH A;  4IWQ A;  4II3 B;  4ZRJ A;  2WYQ A;  1Z5S B;  2C7N B;  3PS6 A;  3ZKJ C;  3R66 C;  2L0F A;  1V5O A;  3AUL A;  3DPD A;  2N7E A;  1WJU A;  1I42 A;  4LDT B;  4XC2 A;  1WMH B;  3VUY A;  5G55 A;  2FNJ B;  1WIA A;  1E8W A;  1XT9 B;  2JVC A;  2O2V A;  3I3T B;  3O65 B;  5D7G A;  3ZLZ A;  4BBN C;  2L8J A;  4FBJ B;  3T9L A;  3RZF A;  1EF1 A;  2LJ5 A;  4EZL A;  3SU8 X;  2BYF A;  1WZ3 A;  3L08 A;  2JUO A;  5AZH A;  3KVF B;  3ZDT A;  4DK5 A;  3X23 A;  2K6D B;  2KFK B;  3RUI B;  1WGG A;  4GDK B;  4EZK A;  4KZC A;  1MG8 A;  4NQK E;  3R7Q A;  2RR9 A;  2Z0D B;  2NBU A;  5D6J B;  2L00 B;  4WJO A;  4G50 A;  2HJ8 A;  4B9K A;  1S3S G;  2JXX A;  1TTN A;  2MSE D;  2KWV B;  2EMS A;  2V4L A;  2D2Q A;  5JHB A;  2HD5 B;  2N1V A;  1K8R B;  1YQB A;  4EOY A;  3C0R B;  2J0J A;  3L54 A;  4E71 A;  4BVU C;  2C7M B;  5LXH A;  2CR5 A;  4OVV A;  5CHW A;  5IAA C;  3L17 A;  4EKU A;  4HK2 A;  2KTF A;  2O6V B;  4GB9 A;  4LJP B;  3U8Z A;  4WJP A;  2L3Z A;  4FHJ A;  4ZRK A;  3DCG A;  4GMV A;  3V61 A;  1VD2 A;  3KW5 B;  1GG3 A;  4HPL B;  3NY5 A;  4I6P A;  2KFK A;  2MLB A;  3IHP C;  2LVP A;  2CHZ A;  4JGH B;  4F7Z A;  2DZI A;  4IWO A;  4BOZ B;  2K39 A;  3HIZ A;  3A1Q A;  3UIO B;  2KD0 A;  1J8C A;  5AEK B;  4KVG B;  3VVW B;  3IVF A;  2NS5 A;  3T8M A;  1BT0 A;  3CMM B;  3EEC A;  4B95 A;  4BKS A;  2XBB C;  1R4N I;  2IO3 B;  4HCP B;  3TJP A;  3H1U A;  4MJS A;  4LJO B;  2FIF A;  4F8C B;  4BKT A;  5J2R A;  4TUU A;  2FCN A;  3PT2 B;  3WAN A;  4RM8 A;  3X0W A;  4K1R B;  3EFU A;  4GN1 A;  2AEH A;  1E8Z A;  2DYB A;  4FHK A;  2KZR A;  3VUX A;  3ZDM C;  5KHQ A;  4FJY A;  1WYW B;  4G0N B;  4W9F A;  4W9G A;  1WX9 A;  4B6W A;  3Q3F A;  1YX6 B;  5JZE B;  4RMA A;  3ZNZ B;  1WRD B;  2K8B A;  1OTR B;  3OAW A;  1WM3 A;  2KWU B;  2K6Q A;  3PV1 A;  2VRR B;  2KFJ A;  4URK A;  1FXT B;  2MA9 B;  3W1S C;  3ZO5 B;  2V3S A;  2LXC A;  4DHZ E;  4ZDV A;  3DVG X;  3UGB B;  4MH0 E;  1GC7 A;  1NI2 A;  1V49 A;  2DZK A;  3KUC B;  3TCA A;  3JVZ X;  4CYE A;  1IYF A;  2KJR A;  2DX5 B;  2O2V B;  3H7S A;  3R3M A;  4GOC A;  1CMX B;  4HLE A;  3ENE A;  4ZRI A;  5C23 A;  2FCS A;  2LZ6 A;  4FN2 A;  2JRI B;  4IUM B;  3OLM D;  4HDQ A;  5D2M B;  1WJN A;  3M3J A;  3TIX A;  2MBQ A;  3QAQ A;  5DCN A;  3AI5 A;  3W1Y A;  2IY0 B;  2KQS A;  1GC6 A;  4GGQ A;  5L83 A;  2GBN A;  3PRP B;  2M8S A;  2K1F A;  1E8X A;  5FR6 A;  3ZTC A;  4FJZ A;  1OEY J;  4GDK A;  2C60 A;  3ZRC A;  3M63 B;  3VHT C;  3VTV A;  2PJH A;  1KLV A;  4ICV A;  3JW0 X;  5LLI A;  3IBE A;  2KOX A;  3PSE B;  2FID A;  2O6V A;  3DBH I;  3KYD D;  3ZNH B;  4X57 B;  2JT4 B;  4DHZ B;  5DPR A;  3QX1 A;  1GNU A;  4BKG A;  3KYC D;  1WX8 A;  3QCA A;  2KQ7 A;  2D3G A;  2KVR A;  1T0Y A;  1E7V A;  3N3K B;  2KXJ A;  2DYM A;  4DBG A;  4F1S A;  4GIV A;  2I1K A;  4GXB A;  1V5T A;  3ZNG C;  1WR1 A;  3NZS A;  1WX7 A;  3VXW A;  3JYU A;  4HPM B;  4ANX A;  2A4Z A;  1UGM A;  3APF A;  2K25 A;  1LXD A;  1GJZ A;  2WWZ A;  1YD8 U;  2OJR A;  3KUD B;  2JWZ A;  4AOF A;  3A33 B;  1P0R A;  1ISN A;  3ZIM A;  1H4R A;  2KAN A;  2KC2 A;  2KNB A;  3QK0 A;  2BWF A;  3JSV A;  4A3O A;  3UIP B;  3VQI A;  3ZTD A;  4P7I A;  4MGY E;  2ZEQ A;  3QIJ A;  3UF8 A;  2JRH A;  3MTN B;  3PVL A;  1LQB A;  2J7Q B;  3H9D A;  2DYO A;  4RM9 A;  4YL8 A;  1WE6 A;  3DDC B;  1KM7 A;  1C1Y B;  1L7Y A;  2KJH B;  2K8C A;  4MJS B;  4A3P A;  3VTU A;  3ML9 A;  5JHA A;  2J0M A;  3L10 B;  3PZD A;  2KKC A;  5E6O A;  1Q0W B;  4HVB A;  1H8C A;  3APD A;  1EUV B;  3VH3 B;  4II2 B;  1IPG A;  2V1Y A;  3KH0 A;  4TQ1 A;  4AUQ C;  3OJ3 A;  3L0W B;  2MP2 A;  4I6N B;  4DDI D;  2D07 B;  2I1J A;  2IO0 B;  3VDZ A;  1S1Q B;  2PEA A;  3QAR A;  4AP4 C;  3Q3J A;  2RD0 A;  3QA8 A;  3TBL D;  4I6L B;  2M17 A;  4K7S A;  4AJY B;  3PRM B;  3SDL C;  3W1S A;  2RGF A;  2LGD A;  3BY4 B;  3QJZ A;  2LVO A;  1NBF C;  4WJQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...