4E71A

Crystal structure of the rho gtpase binding domain of plexin b2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
90
Chain Sequence
EYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRPDSVVLEWRPSTAQILSDLDLTSQRWKRVNTLMHYNVRDGATLILSKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RHO GTPASE binding domain of Plexin B2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Plexin-B2
total genus 20
structure length 90
sequence length 103
ec nomenclature
pdb deposition date 2012-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4e71A00
4PYUA 1IYFA 4K81A 1WXSA 1KLVA 5J18A 3IHPC 3VAWA 2IO1B 4B95A 4ICVA 1WM2A 4IM0A 4MGKE 2NPTB 3N32A 2NBWB 4MJSB 2KWUB 4W9GA 4HCNB 4DBGA 3ECIA 3B1LX 4E71A 3VXWA 2JXXA 1V86A 4HPMB 4W9HA 3EFUA 4JQWC 5GMVA 3V6CB 3ZNZB 4DDGD 4HXDA 3WA0A 2BKRB 4MJSA 4EZJA 2NBUA 4KSLC 3PHWB 1SIFA 1UZXB 2CHXA 2UWQA 4GXBA 2FCMA 1E5WA 3S2AA 3RULA 4HVBA 2CU1A 2D2QA 4GN1A 2L0FA 2HJ8A 3ZTDA 1OTRB 3KVFB 1LM8B 1E90A 4CO7A 2N4FA 2MBOA 3QAQA 5L95C 4DHZB 2MQJA 2N9EB 2J7QB 3X23A 3SDLC 4ANUA 2G4DB 2NS5A 2PE6B 2GBRA 3H6NA 3AU4A 1WIAA 2DENB 2KJHB 3WAOA 5D94A 4HLEA 4ZRIA 1YX5B 4ANWA 3DBHI 1E8XA 5J17A 2KX3A 3V60A 3H7SA 3DVGX 2AEHA 1E7UA 1WR6E 2B3AA 1PQSA 5DPSA 3K9PB 5IA7A 4TUUA 1WMHA 2KVRA 3SHQA 2FNJB 3U8ZA 3L16A 3PGEA 1P0RA 1WGHA 4GU2A 4BFRA 4MGZE 2KC2A 4FJZA 1WGDA 4PS3A 3VTVA 2N9XA 2LXCA 2ZCCA 2L3ZA 2N7DA 4FADA 1WYWB 4HPLB 2JY6A 4KZCA 2IY0B 3RZWC 4NPNA 3VTUA 4B6WA 1WMHB 3B0AA 2OOBB 2D3GA 3EC8A 4AWJA 3UQBA 1I35A 3TCAA 1V2YA 5FR6A 2JRIB 4IWQA 4KIKB 4X57B 1WRDB 3AI5A 5D6JB 3ZW3A 4B9KA 4G0NB 3DCGA 3AXCA 1WJ6A 2IY1B 4IWOA 5CHWA 1V6EA 2DX5B 3QARA 5DPRA 1ISNA 1YX6B 2JT4B 4HK2A 2W9NA 3QIJA 2MCNB 4II2B 2N7EA 2LXAA 2ZCBA 3P2BA 3VUXA 1R4NI 1P3QU 2WX1A 1FXTB 4K7WA 5EDSA 1S1QB 1WF9A 3VDZA 2KC1A 4A20A 4WJPA 4RMAA 3VTWA 3UINB 5LXHA 4KSKC 3L10B 2PE9A 3A9JB 2M4NA 1WFYA 4A3PA 3M95A 1TGZB 1YQBA 2KMCA 4EZLA 2DYBA 3NHEB 2CHZA 4KIKA 3WAPA 2ZNVC 2JZZA 2KLGA 4HDOA 3L13A 4TV3A 2KKCA 2Z0DB 3OJ4B 5TR5A 4LDTB 3TIXA 2BWES 4WQOB 2ASQA 2DZIA 2PEAA 5CX3A 5LLIA 1WZ0A 2MX2A 3RYTA 4FN2A 2FUHB 3PRZA 4W9FA 1RFAA 4KDIC 2LVPA 3L17A 5CTRC 4BKSD 2LVOA 2K8CA 4NQLB 2C60A 3UF8A 1Z2MA 3D32A 4ZRKA 1V9JA 1Q1OA 3QC8B 2Y5BB 3A1QB 3DVGY 1GG3A 2MBHA 1EO6A 3T9LA 2ZZPB 1P98A 3ALBA 1TBEA 4GDKB 2RR9A 1WXMA 2BWFA 4NJ7A 3ZNID 1WXAA 2JWZA 1E7VA 5AEKB 3SU8X 3H7PA 4E74A 2DYOA 1WE6A 2KD0A 1GJZA 3EHVA 3DBRI 1SE9A 4W9KA 3A4RA 3PVLA 4A3OA 3TL5A 1Q0WB 2HD5B 4BKGA 1TTNA 3ZVVA 5KHQA 3ML9A 4CYEA 4MH0E 4IG7B 2LRWA 2IYDB 4LCDE 4I6PA 1BT0A 3PREA 3L54A 4ZDVA 3HIZA 1L2NA 4EFOA 3IFWB 3HM6X 3VFKA 1V5OA 1V5TA 2KWVB 1WM3A 2IO2B 1XQQA 3MJWA 3R66C 5JHBA 1IP9A 1F9JA 3NOBA 4HJKA 1C3TA 2KJ6A 4FHJA 4WJOA 3PRPB 4FJVB 2YVCA 4NAWB 2G3QB 2K8HA 2R2QA 1KM7A 1GC6A 3H9DA 2AL6A 2ZVNA 5BO4B 3ZUNA 5JH5C 2JPHA 3OJ3A 3VHTC 1UD7A 1WH3A 2LASA 3LJ3A 3ZNGC 4W9IA 4AUQC 2KQSA 2KDIA 1UH6A 1UBIA 4PS8A 2KN5A 1Y8RC 3H1UA 4XX5A 2JUOA 2MLBA 4I6LB 5JZEB 3UGBB 2EMSA 3KW5B 3PSEB 3ZDTA 2KTRB 3CSFA 1WX8A 3L0WB 2A4ZA 2WX0A 3NY5A 1XD3B 2CKHB 2JZ3B 2CHWA 2K25A 1K8RB 2MBBB 3VUYA 1X1MA 3L08A 4G50A 3AU5A 5LXIB 1OEYA 4LDTD 2KTRA 4DHZE 2LGYA 3TBLD 1LQBA 3NZUA 4NNJB 5G2NA 3B08A 1S3SG 4K7SA 3ENEA 1GC7A 2BGFA 3ZRCA 3M63B 2DZJA 2LZ6A 3QJZA 3QHTA 4RM8A 2ZEQA 1P1AA 2IO3B 3BINA 5C1ZA 3WALA 4GMVA 2MA9B 4IUMB 1T0YA 1WY8A 4G3XB 2LRUA 2FIDA 2VRRB 5E6NA 4YL8A 1JRUA 1E8ZA 4I6NB 2KHWB 1ZGUB 1G6JA 4PYZA 3QWZB 3CSTA 4FHKA 4IW0A 3PRMB 3GOEA 1IPGA 2PJHA 2KLCA 3JSVA 5DCNA 3VH4B 4BVUC 4AOFA 2REXA 3DVNV 4KZ0A 4IM2A 4XC2A 5E6PA 4OVUA 4DWFA 3K9OB 4NJ6A 2M0XA 4EEWA 4GGQA 2GBMA 2K39A 2O2VB 1P9DU 3PHXB 5AZHA 4TQ0A 2IBIB 2KXJA 3DPDA 3ZLZA 1WR1A 2C7HA 3KUCB 2KK8A 3QA8A 1J19A 1Z5SB 4MDKE 2KX0A 2J0KA 5D7GA 2IZVB 4LJOB 1RLFA 4KV2A 1MG8A 4RM9A 4AJYB 3O65B 3ZDMC 3ZRFA 2DHZA 3MTNB 2DAFA 2FCSA 4M0WB 3VQIA 4ANVA 4GDKA 4DHJB 4URKA 3TJPA 2LUEA 2Z0EB 2O6VB 2L0TA 2I1JA 2G4SA 3BY4B 4GIVA 2OJRA 4KDLB 2LGDA 3LDZE 2ZNVB 3VH3B 2KFJA 3IG3A 3W1SC 3I3TB 4P7IA 1J0GA 3GZNI 3DDCB 1L7YA 4M8MA 2C5LC 2I1KA 4ICUA 4DDID 5AZFA 3RD2A 3R7QA 3T8MA 4FA6A 4HDQA 2JVCA 2MBQA 4MGYE 2EKEC 2LGXA 4KVGB 3IVFA 2K6DB 1C1YB 4FULA 3W1SA 1KJTA 3JVZX 2K6QA 2N9PC 2RPQA 2WDTB 2V1YA 1CMXB 3OAWA 5CHVC 4FLHA 2J0MA 3R7RA 2BPSA 2D11A 3SD5A 3APFA 2KO3A 4NAWA 2LVQA 3VUWA 4BOSC 1TZ1A 4II3B 4W9EA 2AWTA 3DBLI 2LWPA 3N30A 3A9KA 1H8CA 3ZIMA 2O6VA 4MSQB 1WJNA 2L76A 1WZ3A 1GUAB 4E3CA 5CHFA 2IO0B 2C7NB 1D3ZA 2XEWA 4W9CA 1E8WA 4EKUA 2KTFA 2V3SA 1WXVA 1OGWA 1HE8A 1VD2A 2DZKA 3DBSA 2DAJA 2LI5A 4MGIE 3RUIB 1UBQA 1QZEA 1XT9B 2XBBC 1NI2A 3X0WA 2GMIC 4JLCA 1VCBA 4GDLB 3WAMA 4EOYA 2BKFA 3VVWB 1I42A 2DYMA 4OVVA 2C9WB 2O2VA 3RCZA 3R3MA 3PS6A 2MBEA 4GDLA 2KFKA 4WWPA 4GOCA 1R4MI 3W1YA 2ZJDA 4BOZB 4ANXA 4W9DA 3PLVA 1WX9A 3Q3JA 2J0JA 3OLMD 2NR2A 3QX1A 2PPHA 4ZRJA 5JHAA 2JF5A 2QHOA 2BYEA 4NQKE 1WGGA 2ZPNA 3UIPB 3V61A 1ZKHA 4WWOA 2FIFA 2DZMA 4JGHB 4EUTA 3QCAA 1WJ4A 4WJNA 2ZPYA 4K1RB 2GBJA 2KOXA 3A33B 3PV1A 4CHKA 3QK0A 2RSUA 1NDDA 4MSMB 4TQ1A 2FCQA 4GB9A 4WJQA 1NBFC 1YJ1A 3RT3B 2NVUI 1V80A 3ZKJC 3ZO5B 2C7MB 5DPWA 1LFDA 1YD8U 3PZDA 5G55A 3TMPB 2GBNA 4DK5A 4FBJB 3ZTCA 3HHMA 3DVNU 2FAZA 2KDBA 1EF5A 3JYUA 3AULA 4HCPB 4DHJD 1A5RA 2KDEB 2UYZB 2MP2A 1J8CA 2O6VD 1ZW7A 3DQVA 5HKHA 2NBVB 1KOTA 2CS4A 3M3JA 3V62A 2BYFA 4F7ZA 2L8JA 3A9JA 5J2RA 1SGHA 2EMTA 2XK5B 3KYCD 3ML8A 2MRPA 5L83A 1UELA 5D2MB 2LD9A 1EUVB 3ZNHB 2K1FA 2KZRA 4XZ4A 2YLMA 1WJUA 2FCNA 1WE7A 2ZVOA 4TKNA 2XK5A 1RRBA 1OQYA 2WYQA 3KUDB 2CR5A 2BYVE 4K7UA 3HM3A 3KUZA 3U7DA 4F1SA 2D07B 2NCNA 3C0RB 4J6IA 2GBKA 4AJWA 4IM3A 2N1WA 4HWIB 4ASWC 5DPTA 1WI0A 5E6OA 2L7RA 4WWNA 4BKTA 1OEYJ 2MW5A 3KYDD 3Q3FA 2MSED 1YIWA 2MP2B 2AL3A 4M8NA 2JRHA 1WGYA 4MELA 2R2OA 2LJ5A 5KHOA 2M17A 2NPTA 3EECA 2KDFB 2L05A 1M94A 2A5UA 3WIMA 3RZFA 2N1VA 3KH0A 1UGMA 1V81A 2GOWA 2WWZA 3IBEA 3CMMB 3JSVB 4IC7B 4MEMA 2L00B 2Z59B 4JIOU 3JW0X 3V6EB 4W9LA 2G45B 2KJRA 1E8YA 1U4AA 3PT2B 2HTHA 3NS8A 4MM3A 3PLUA 3NZSA 2M8SA 3A4SC 3APDA 4GSWA 2V4LA 3N3KB 2K8BA 5AZGA 4BBNF 3UQAA 2RD0A 3CF6E 1WX7A 3DOWA 2KFKB 4NY0A 1LXDA 3QQ8B 3M62B 4FJYA 3UIOB 4F8CB 3WANA 2KNBA 2RGFA 4N9F4 1EF1A 4W9JA 4JL9A 2MWSB 4EZKA 3U30A 3H7PB 1AARA 3HK0A 4ZYNA 1Q5WB 3ONSA 3PTFC 4IWPA 4BKSA 3APCA 2KANA 2M1MA 1GNUA 4PS7A 1RAXA 2BF8B 2HE7A 4G11A 2AYOB 4DXAB 1WGRA 1V49A 3PPAA 2KMAA 5C23A 4AP4C 4LJPB 4WAAA 3A1QA 4BBNC 2D10A 3A9KB 2KQ7A 1H4RA 2KWCA 3MHSD 5IAAC
chains in the Genus database with same CATH superfamily
4HKZE 1ZPSA 2KDMA 5J18A 3EGRA 3VAWA 1WM2A 3BVMA 2NPTB 4MJSB 1SE4A 4HCNB 4E71A 1RWSA 4FXCA 1E6EB 3BVZA 4DDGD 3PHWB 3BK1A 1QOGA 1E0ZA 1E5WA 3S2AA 3RULA 2CU1A 5G5GA 1STEA 1HTQA 1E90A 4CO7A 3QAQA 2MBOA 4NJCA 4A9AA 2MQJA 1K51A 1JWSD 1UWMA 1C78A 1QOFA 3H7SA 3DVGX 2AEHA 1E7UA 2B3AA 5IA7A 3K9PB 4TUUA 4C4VA 5MPOA 1CQVA 1LGRA 1ET9A 2DWQA 3TEZA 2KC2A 1L6VA 3VTVA 4MM3B 2L3ZA 2N7DA 4FADA 3P4SB 2JY6A 2KVZA 1KF6B 1YOVB 1I4QA 2OOBB 3EC8A 1I35A 2BQQA 2V3PA 4US9A 2ON8A 3TCAA 2JRIB 4IWQA 3Q69A 3ZW3A 2WXRA 3TEYA 3DCGA 1WJ6A 2IY1B 2SAKA 4IWOA 1ISNA 1YX6B 1A70A 1FO4A 2N7EA 2LXAA 4P16A 4OW0A 3AEBB 2INCC 3VTWA 1BMLC 1M4VA 4WAFA 4KSKC 2PE9A 1WFYA 2FE8A 4GLSC 3NHEB 2CHZA 2ZNVC 5TR5A 2Z0DB 4LDTB 2BWES 2ASQA 2DZIA 2PEAA 5CX3A 3RNAC 3GB1A 3L17A 4NQLB 1Z2MA 2WU2B 3D32A 5BYRA 1Q1OA 2Y5BB 1BUIC 3DVGY 3T9LA 2ZZPB 2HTME 1V1PB 1VDVA 1PYWD 1E7VA 5AEKB 2LUMA 1KFYB 1SE9A 4A3OA 4YSYB 1OFFA 3ZVVA 5EE0A 3GP7A 2V4IB 4IG7B 2OHFA 4I6PA 4ZDVA 1WM3A 3R66C 2KJ6A 4FHJA 1V97A 3PRPB 4LLGM 2YVCA 2R2QA 2AL6A 3DBLB 1L4DB 4MH8A 3OJ3A 4W9IA 5FR3A 2KDIA 2LHDA 2JUOA 1GOZA 3RNEC 2WX0A 3AE6B 3NY5A 3IT4B 3OWEB 4BAXA 3UI3A 4G50A 4RNAA 4M0WA 1NYQA 3TBLD 3VRAB 5G2NA 1NYRA 4WWMA 3M63B 2WP9B 4RGTA 2JWUA 2YEPB 2LRUA 2FIDA 2EKIA 1FCCC 4REZA 1ZGUB 3CSTA 3GOEA 2KLCA 3ZGZA 2QJLA 1MFWA 4KZ0A 4XC2A 4A90A 3K9OB 4NJ6A 2M0XA 4JE3B 1B9RA 2K39A 3GZNB 1P9DU 1UUPA 2KXJA 3DPDA 1WR1A 3QA8A 2KX0A 4XWWA 1GB1A 4KV2A 4AJYB 1JWAD 1ZP0B 5EE3A 3O65B 3P4QB 1C77A 1XLQA 3ZRFA 2BS2B 2DHZA 4TSSA 3MTNB 2FCSA 4URKA 4YTNB 1T0QC 3P4RB 4GIVA 2ZNVB 3SEBA 5C3JB 3W1SC 3I3TB 1WGKA 1J0GA 3GZNI 2D3BA 2M0AA 3AE4B 3T8MA 2Y5PA 2PVOD 3W1SA 3JVZX 3ABVB 3EFCA 2N9PC 4PT5A 1CMXB 4FLHA 2J0MA 3V05A 2BPSA 2D11A 4BOSC 2H89B 2N9KA 2L76A 1FXAA 5CHFA 4A6QA 1D3ZA 2KTFA 2V3SA 2PVGC 3DBSA 2DAJA 1UWXA 4MGIE 4R3DA 1UBQA 2WXNA 1T5XD 2GMIC 4GDLB 3WAMA 4OVVA 2C9WB 2NTSA 5BYQA 3Q3JA 2J0JA 2QILA 2BB6A 2QHOA 1WGGA 2ZPNA 1XCTL 1ZKHA 3V61A 2ZPYA 4K1RB 2GBJA 3A33B 3PV1A 2B76B 1NDDA 1NEKB 1NBFC 2C7MB 4IOIE 1YD8U 5G55A 2GBNA 1K50A 2Q5WD 2FAZA 4DHJD 1TS4A 1F0ZA 1DOYA 2MP2A 4C7ZA 1J8CA 3MHZA 1KOTA 1SE3A 4F7ZA 1Q10A 1XLPA 2EMTA 4USAA 5J2RA 3ML8A 2MRPA 4ZOHC 1EUVB 2K1FA 2KZRA 3LB8C 3ZJUA 1WE7A 1OQYA 2CR5A 3KUZA 2GBKA 2L1AA 2N1WA 1FRDA 5DPTA 1VLBA 5E6OA 4WWNA 3R2TA 3Q3FA 1WGYA 2LJ5A 1TYGB 2L05A 3J9CA 2A5UA 3ETRA 1UGMA 1FD6A 3CMMB 4IC7B 2N9LA 4JIOU 3PT2B 4HROA 2JXTA 4GSWA 3N3KB 1PDXA 1EM7A 2RD0A 3CF6E 3DOWA 4FJYA 4F8CB 1OQQA 3W5VB 4N9F4 1EF1A 1QLBB 3AN1A 2WS3B 4EZKA 2WXJA 4ZYNA 1Q5WB 1I4XA 2KANA 4OZAA 2HE7A 2AYOB 2KMAA 1XCQL 2MHJA 1K53A 2K0PA 4N59A 4XE0A 5IAAC 2W55A 4OVZA 2BTEA 1IYFA 1WXSA 1TKGA 3IHPC 3NVZA 2IO1B 4K3CA 4ICVA 4IM0A 2JZPA 3I57A 5FKAC 4B0MA 4DBGA 2R61A 1PUTA 3WA0A 1TT5B 2TSSA 1RYJA 2ZW0A 2BBCA 2D2QA 2L0FA 1OTRB 3KVFB 1LM8B 5L95C 3NUHB 4N58A 2J4XA 3X23A 4ANUA 2LHEA 4A55A 4ACFA 3WAOA 1JWUD 4HLEA 1E8XA 3V60A 1WR6E 1C9FA 3SHQA 2KVRA 4ARCA 3AE3B 4LNIA 4GU2A 3BZDB 1SE2A 2ZCCA 4LNNA 5D3IB 4KZCA 4ZHOA 3RZWC 4NPNA 3RI7C 2DBYA 4B6WA 2HJ1A 2D3GA 1JQ4A 1R7SA 3AI5A 2WXIA 5D6JB 4B9KA 4YXDB 3AXCA 1UNSA 5CHWA 2DX5B 3QARA 5DPRA 3AH7A 3TUOA 2JT4B 2K5PA 4HK2A 2W9NA 1J7CA 2UU7A 3RN9C 4BZAA 1IBXB 3E56A 4II2B 2ZCBA 3P2BA 3B2GA 3GE8C 1I4GA 1FM0D 5EDSA 4WJPA 3URYA 4DXFA 1QOBA 4KGRA 3UINB 5LXHA 1F2RC 3A9JB 4A3PA 4EZLA 2DYBA 1FPYA 4KIKA 1WYGA 3WAPA 1YN4A 1L0XB 5D3DA 4WQOB 3HUIA 2D3CA 3PRZA 1ZDVA 1RFAA 2WNMA 4KDIC 5CTRC 2C60A 2K3UA 1N62A 4IDIA 1KRHA 4NJ7A 4LNKA 1F2RI 4EE2A 3B2FA 3H7PA 4E74A 2DYOA 3EHVA 3DBRI 4W9KA 4BKGA 4TMAB 5KHQA 3ML9A 4MH0E 2LRWA 1JRPA 2PLPA 4J3OD 1JCKB 1E10A 1ZOYB 2BYTA 3HIZA 1L2NA 4EFOA 2IO2B 1XQQA 2VH1A 4HJKA 1C3TA 4WJOA 4FJVB 4RH6A 2JSVX 1KM7A 3H9DA 4RGNA 2ZVNA 5BO4B 1CZPA 3DHGC 3VR9B 5JH5C 2JPHA 2QC8A 3ZNGC 4PS8A 3EUB2 5IN7A 2INNE 4XX5A 4I6LB 4MT5A 3KW5B 2KTRB 3CSFA 1DOIA 3NVVA 2A4ZA 1QOAA 4C56C 1XD3B 2K25A 1K8RB 2MBBB 3VUYA 3L08A 2N7JA 1TY0A 2PW9A 2GLSA 4DHZE 1LQBA 1HZ5A 3B08A 2J42A 2DZJA 2IO3B 3BINA 5C1ZA 3WALA 4GMVA 3AB5A 2INPE 4IUMB 4G3XB 1ZDXA 1VZ8A 2FBWB 1SSNA 2MEKA 1MPEA 1SBBB 3AE9B 3QWZB 2INDC 4FHKA 5I4DA 3PRMB 2PJHA 2WGSA 3CWIA 2OEDA 4IM2A 4DWFA 3IAS1 1GAQB 2RDBC 2IBIB 2C7HA 3KUCB 1YQ3B 5AUIA 4A8XC 1RLFA 1TJEA 2CJOA 4DHJB 2E3TA 2O6VB 2L0TA 3Q6BA 2G4SA 4UDUC 3P63A 5H92C 4P7IA 2J53A 1FMAD 1ZE3D 2C5LC 4DDID 5HHDG 3RD2A 3R7QA 4HDQA 1N5XA 2LGXA 3N1YC 2K6DB 3AECB 4RCOA 1RM6C 3Q8CA 3R7RA 2KO3A 3P1MA 4NAWA 2AWTA 3N30A 3A9KA 1H8CA 3ZIMA 4MSQB 1WJNA 1DOXA 4LK0M 1B1ZA 1HE8A 2XN9C 2DZKA 3RUIB 1QZEA 1XT9B 1NI2A 5LNK1 2VZKB 3Q3MC 1I42A 2DYMA 3RCZA 4JPSA 1JALA 1R4MI 1R4NB 3OLMD 3QX1A 2KT7A 2JF5A 4NQKE 3UIPB 1AN8A 1VR9A 3RNFC 3DWGC 1PGBA 2GI9A 1TZOA 3QK0A 4TQ1A 2FCQA 5AUKA 4ZRPA 3RT3B 1GPXA 5DPWA 4P1CC 3TMPB 4HJGE 1HXYD 4DK5A 3T3NA 3N1XC 3HHMA 1I7HA 1XO3A 4HCPB 3AULA 3FILA 3NZ3A 4RGMA 1ZW7A 1MVKA 5HKHA 3TEWA 2NBVB 2RDGA 4KGTA 2L8JA 3A9JA 4S17A 1SGHA 2I38A 2D5GA 2N0SB 3MP9A 5D2MB 2JYEA 3ZNHB 1SJHD 1QT9A 2WXPA 4XZ4A 1D4BA 4TKNA 2XK5A 2WYQA 3U52E 2BYVE 5HFYA 3U7DA 3GS2A 1FFVA 4HWIB 2AL3A 1AWDA 2NPTA 4RGOS 1M94A 3WIMA 4AQ7A 3RZFA 3AE2B 2N1VA 3KH0A 2YEPF 1TIFA 3JSVB 4MEMA 5EE9A 2L00B 1L6UA 2Z59B 2Z8LA 3V6EB 2KJRA 1E8YA 1U4AA 3NS8A 4JX1C 2KN4A 2M8SA 2V4LA 1AW7A 2AX5A 2KFKB 1LXDA 3M62B 4KGSA 3T3OA 2QMTA 3U4EG 2KNBA 1VZ6A 2RGFA 3PZ8A 2PIAA 3AEFB 3U30A 3IAM1 4XWTA 3ONSA 4IWPA 5IOIA 3O13A 2M1MA 4PS7A 2KQ4X 4LNOA 2Y3AA 4G11A 4DXAB 1V49A 5C23A 4AP4C 3U7ZA 4S0RA 1H4RA 4II3B 3MHSD 2RMMA 4PYUA 3ZJVA 1OQRA 2E6XA 4B95A 3NVWA 4MGKE 3N32A 2NBWB 3VXWA 3HVDA 2JXXA 4WH4A 4W9HA 3AE5B 4QAYA 3EFUA 3ZNZB 1EWYC 4KSLC 3RNBC 1SIFA 1UZXB 2CHXA 2FCMA 1C4AA 1R4MB 1I4HA 2V3NA 4HVBA 4GN1A 3AV8A 2HJ8A 1MI0A 2N4FA 2J7QB 3SDLC 3RNCC 2G4DB 2NS5A 2PE6B 3AU4A 1WIAA 1XXGA 2KJHB 3W5UB 3DBHI 1F77A 2FUG1 1V8CA 1ROEA 1WMHA 2BS3B 1YN3A 4BFRA 4MGZE 1WGDA 1D5MC 3NRZA 1QILA 2N9XA 3DHIC 4LTUA 1WYWB 4HPLB 2IY0B 1KLGD 3VTUA 2Y5CA 4KKIA 5T8IA 3UQBA 4YTPB 1FCLA 3L4PA 2KAJA 4D2KA 4X57B 4G0NB 1V6EA 2ACZB 3AM9A 2LGSA 1C4PA 3QIJA 2MCNB 2JU6X 2M19A 1D6EC 1FXTB 2KC1A 4CQNA 4RMAA 3L10B 2M4NA 2DLBA 3M95A 1FRRA 1YQBA 2KMCA 2ICIA 4TV3A 3OJ4B 2LFIA 3TIXA 1JWMD 1WZ0A 4FN2A 1PGXA 2FUHB 2WXGA 2LVPA 3SFEB 3QC8B 2WXLA 1GG3A 1BXTA 5G5HA 1TBEA 2RR9A 3LYYA 1WXMA 1XLOA 2JWZA 3A4RA 3PVLA 1SIJA 1Q0WB 3TL5A 2HD5B 2IYDB 4XDCA 4YSXB 3MC0B 1BT0A 4C7YA 3L54A 1ZUD2 3IFWB 3VFKA 1C79A 1V5TA 2M56B 5JHBA 1F9JA 2LGIA 4Q2JA 2BT6A 1DYQA 2K8HA 3C8YA 1GC6A 1N6ZA 2JX5A 5EE1A 1UD7A 3LJ3A 1UH6A 1UBIA 1YN5A 3W9CB 2KN5A 2LJIA 3H1UA 2L83A 3PSEB 3ZDTA 5IKCM 3L0WB 3Q3OC 1J7AA 2JZ3B 4B0EA 2CHWA 1NI3A 4NZLB 1X1MA 1XEEA 5LXIB 1OEYA 1C4CA 3P42A 2WXQA 2LGYA 4K7SA 3Q8EA 1I4RA 2BGFA 1VZ7A 2QCZA 2ZEQA 3Q8BA 5HI1A 1KTKA 2MA9B 1T0YA 2VRRB 4YL8A 1JRUA 1F1HA 3RMKC 2KHWB 2LMCA 1G6JA 1L5PA 1YJIA 3JSVA 3GE3C 5E6PA 4OVUA 2K22A 2NTTA 4EEWA 3DBHB 4GGQA 2GBMA 2O2VB 3PHXB 4TQ0A 2AQ2B 2KK8A 4ZYSA 1JROA 1HZ6A 3PO0A 1FNWA 4OZBA 2J0KA 5D7GA 2IZVB 4LJOB 4YWGG 1MG8A 3ZDMC 3N1ZC 2RDHA 1XF5L 2DAFA 4M0WB 4ANVA 4GDKA 3Q8FA 2LUEA 3DWMA 2Z0EB 1GB4A 3BY4B 4ITKA 4WIPA 2WU5B 3VH3B 4OZCA 1P7FA 1L7YA 1QQRA 5AZFA 4JWUC 4C00A 3FILB 2MBQA 2WXFA 4WURA 3VR8B 2EKEC 1C1YB 1MHXA 4O1NA 2BVCA 3OAWA 2V1YA 4YSZB 4M01A 4C80A 1T6BX 1TZ1A 2LWPA 4AS1A 1GUAB 2IO0B 2C7NB 2XEWA 1SF0A 3N9YC 1V1OA 1WXVA 1OGWA 1VD2A 4ARIA 1ENFA 4YTMB 1FNVA 2XBBC 5H8YE 4JLCA 1VCBA 2BKFA 3PS6A 4GDLA 5JXVA 4BOZB 1WSPA 3PLVA 1WX9A 2NR2A 2ONQA 4ZRJA 2BYEA 4WWOA 2MJ3A 2FIFA 2QIEB 4EUTA 1JWBD 1WJ4A 2WDVB 2WQYB 4MSMB 1TY2A 4WJQA 3MFGA 4GB9A 3FC4A 1YJ1A 3ZKJC 2L32A 5BMGA 4FBJB 1ZXIA 4L1BA 3DVNU 2KDBA 1HEZE 2KDEB 2O6VD 3BYTB 3V62A 3I9V1 2BYFA 4HKQA 1L0VB 2I2YA 2SEBD 3ZXRA 3ZQ4A 2XK5B 3KYCD 5L83A 1UELA 2LD9A 3W2DA 2FCNA 2ZVOA 2W3SA 3HM3A 2X38A 2NCNA 4J6IA 4AJWA 2L52A 4IM3A 1FFUA 1T0SC 1WI0A 2L7RA 3Q3NC 1T0RC 2MSED 1YIWA 1EU4A 2MP2B 5IP4D 2JRHA 3I63C 4MELA 2R2OA 1WRIA 3KWLA 3SR6A 1NENB 4L23A 4M02A 1V81A 2GOWA 2WXHA 3KWVA 4K3BA 3JW0X 1EWCA 1HQRD 4DXGA 4MM3A 3NZSA 4HRSA 3A4SC 2K8BA 4BBNF 3UQAA 1WX7A 1XLNA 4NY0A 3WANA 1KLUD 5IO9A 3AEDB 3PTFC 2AQ3B 1RAXA 1WGRA 3PPAA 4WAAA 1TKYA 3A1QA 3U2SC 4BBNC 2D10A 1L4ZB 5BYSA 4K81A 1ACCA 1KLVA 2K9XA 2KWUB 2W54A 4W9GA 2D3AA 3ECIA 2PMVA 2CU3A 3B1LX 2RPVA 1V86A 4HPMB 3FAHA 4JQWC 5GMVA 3V6CB 4HXDA 2BKRB 1J7BA 3BK2A 4MJSA 4EZJA 2NBUA 1Y56A 1FXIA 2MJDA 2UWQA 4GXBA 2BS4B 3OG5A 2WXKA 2HDEA 3AEGB 2MJEA 3ZTDA 1IBXA 4L2YA 3ZJTA 4H2AA 2GRIA 2XNAC 4XDDA 4DHZB 2N9EB 2GBRA 3H6NA 2DENB 1LO5D 5D94A 4ZRIA 1YX5B 4ANWA 1FIQA 5J17A 2KX3A 3WCQA 1PQSA 5DPSA 4RF0A 3NS1A 2FNJB 3U8ZA 3L16A 3PGEA 1P0RA 2IJ0A 1WGHA 2WXOA 4FJZA 2AQ1B 4PS3A 2G9HD 2LXCA 2DNFA 1WMHB 3B0AA 1JW9D 4AWJA 1V2YA 5FR6A 2WLBA 4KIKB 1CJEA 1WRDB 3I5JC 1IGDA 3R2IA 2KMMA 2PTLA 3HVZA 1FNUA 3P4PB 2W3RA 3VUXA 1R4NI 1P3QU 2WX1A 4K7WA 1S1QB 1WF9A 3VDZA 1I4PA 3Q14C 4MACA 4A20A 3AE1B 3Q8AA 1TGZB 3MC8A 5GXGB 1RFKA 1YNTE 3C19A 2JZZA 2KLGA 4HDOA 3L13A 1QF6A 2KKCA 1N61A 5LLIA 2MX2A 3RYTA 4W9FA 4DQOC 2JYTA 4BKSD 2LVOA 1N60A 2K8CA 3UF8A 4ZRKA 1V9JA 3A1QB 3NVYA 4M00A 2MBHA 4PK1A 1EO6A 1P98A 3ALBA 4N6EB 4GDKB 3AMZA 1WWTA 2BWFA 3ZNID 1EU3A 3EA6A 1WXAA 1SB3C 3SU8X 4US8A 1WE6A 2KD0A 1GJZA 5E6JA 1MG4A 3V3XA 1TTNA 4CYEA 2IGHA 1QKZA 1SEBD 2JQRB 4LCDE 4KKJA 3RFZB 3PREA 1VJKA 1E7PB 3KQ4A 1WXQA 2OJWA 3BVGA 3HM6X 1V5OA 3Q2AC 2KWVB 3MJWA 1IP9A 3NOBA 4RF1A 4NAWB 4IKGA 2G3QB 2IGGA 2J52A 3ZUNA 3AEAB 2IDYA 1YMHE 5BMHA 3VHTC 2LASA 1WH3A 4AUQC 1HA5A 3VRBB 2KQSA 3H8HA 5BMIA 1Y8RC 2MLBA 3KLSX 5JZEB 3UGBB 2EMSA 1ET6A 4KX6B 4P6VF 1WX8A 1PFDA 4HPPA 1FEHA 2CKHB 4ZRQA 1E9MA 3AU5A 2GB1A 4LDTD 2KTRA 1TS2A 3RPFC 1ZXHA 3NZUA 4NNJB 1S3SG 3ENEA 1GC7A 3ZRCA 2X8XX 2LZ6A 3QJZA 3QHTA 4RM8A 1P1AA 1NVID 1JMLA 3ZXVA 1PGAA 3IT6B 3R8BA 1WY8A 5E6NA 1E8ZA 4I6NB 2KACA 2BW2A 3E9SA 4PYZA 1P7EA 4IW0A 1IPGA 3VH4B 5DCNA 4BVUC 4AOFA 2REXA 3DVNV 1L0YB 4HEA1 4WQMA 4OHJA 4C4VB 5C2TB 1HTOA 5AZHA 3ZLZA 1D5XC 4MDKE 1J19A 1Z5SB 4RM9A 2IGDA 2QSDA 3AE8B 2BB5A 3VQIA 3TJPA 1DGJA 2I1JA 1MHHE 2OJRA 4KDLB 2LGDA 2W82A 3LDZE 2KFJA 2WHIA 3IG3A 3DDCB 4M8MA 2I1KA 4ICUA 1N5WA 1F52A 4FA6A 2JVCA 4MGYE 1AYFA 3DHHC 3IVFA 3N20C 4KVGB 5HG2A 4FULA 2KWDA 1C76A 1KJTA 2K6QA 2RPQA 2WDTB 5CHVC 2LEKA 3MJ5A 3SD5A 3APFA 2LVQA 3VUWA 4W9EA 3DBLI 2QDFA 1N63A 1T3QA 2O6VA 1WZ3A 4E3CA 4W9CA 1E8WA 1TKEA 4EKUA 1TS5A 3PZ7A 2LI5A 3X0WA 3SFDB 4EOYA 4JWSC 3VVWB 3BIID 2O2VA 3R3MA 2MBEA 4WWPA 2KFKA 4GOCA 2CJNA 1UF0A 2ZJDA 3W1YA 4ANXA 4W9DA 2PPHA 3ZYYX 5JHAA 1ESFA 2H88B 3BWUD 2DZMA 4JGHB 3QCAA 4WJNA 2VZKD 2KOXA 4RFBA 3NJTA 4CHKA 2RSUA 4P1BC 2NVUI 1V80A 3ZO5B 2PKOA 1LFDA 3PZDA 1SJED 3IXSA 3RNGC 3ZTCA 1EF5A 3JYUA 1A5RA 2UYZB 4XYCA 3AEEB 3DQVA 1SXTA 2CS4A 3M3JA 3HRDD 5TSSA 2EELA 2NMQA 3FKYA 1MJDA 3LXFA 2G1EA 3MC9A 3B9JA 4YT0B 2YLMA 1WJUA 1RRBA 2V0GA 3KUDB 4K7UA 4F1SA 2D07B 3C0RB 3NG0A 2WDRB 1D5ZC 4ASWC 4BKTA 4NAMA 1OEYJ 2MW5A 3KYDD 1K52A 3BYYB 1KH0A 2WDQB 4M8NA 4XGAB 5KHOA 1UGJA 2M17A 3EECA 2KDFB 1TS3A 1YQ4B 1VRAB 1YJJA 2MH7A 4LNFA 2WWZA 3IBEA 3TSSA 4W9LA 1CK1A 2G45B 1IUEA 2HTHA 2QEJC 2V9HA 1IGCA 3PLUA 2KYWA 3APDA 5AZGA 2IPKD 3QQ8B 3UIOB 4ZHPA 3DBRB 4W9JA 3AE7B 4JL9A 2MWSB 3H7PB 3CIRB 1AARA 3HK0A 3TEXA 4BKSA 5FK9C 3APCA 1GNUA 2BF8B 2VH2A 2WXMA 2ZW1A 4LJPB 1V1PA 3A9KB 2KQ7A 2KWCA
chains in the Genus database with same CATH topology
4PYUA 1IYFA 4K81A 1WXSA 1KLVA 5J18A 3IHPC 3VAWA 2IO1B 4B95A 4ICVA 1WM2A 4IM0A 4MGKE 2NPTB 3N32A 2NBWB 4MJSB 2KWUB 4W9GA 4HCNB 4DBGA 3ECIA 3B1LX 4E71A 3VXWA 2JXXA 1V86A 4HPMB 4W9HA 3EFUA 4JQWC 5GMVA 3V6CB 3ZNZB 4DDGD 4HXDA 3WA0A 2BKRB 4MJSA 4EZJA 2NBUA 4KSLC 3PHWB 1SIFA 1UZXB 2CHXA 2UWQA 4GXBA 2FCMA 1E5WA 3S2AA 3RULA 4HVBA 2CU1A 2D2QA 4GN1A 2L0FA 2HJ8A 3ZTDA 1OTRB 3KVFB 1LM8B 1E90A 4CO7A 2N4FA 2MBOA 3QAQA 5L95C 4DHZB 2MQJA 2N9EB 2J7QB 3X23A 3SDLC 4ANUA 2G4DB 2NS5A 2PE6B 2GBRA 3H6NA 3AU4A 1WIAA 2DENB 2KJHB 3WAOA 5D94A 4HLEA 4ZRIA 1YX5B 4ANWA 3DBHI 1E8XA 5J17A 2KX3A 3V60A 3H7SA 3DVGX 2AEHA 1E7UA 1WR6E 2B3AA 1PQSA 5DPSA 3K9PB 5IA7A 4TUUA 1WMHA 2KVRA 3SHQA 2FNJB 3U8ZA 3L16A 3PGEA 1P0RA 1WGHA 4GU2A 4BFRA 4MGZE 2KC2A 4FJZA 1WGDA 4PS3A 3VTVA 2N9XA 2LXCA 2ZCCA 2L3ZA 2N7DA 4FADA 1WYWB 4HPLB 2JY6A 4KZCA 2IY0B 3RZWC 4NPNA 3VTUA 4B6WA 1WMHB 3B0AA 2OOBB 2D3GA 3EC8A 4AWJA 3UQBA 1I35A 3TCAA 1V2YA 5FR6A 2JRIB 4IWQA 4KIKB 4X57B 1WRDB 3AI5A 5D6JB 3ZW3A 4B9KA 4G0NB 3DCGA 3AXCA 1WJ6A 2IY1B 4IWOA 5CHWA 1V6EA 2DX5B 3QARA 5DPRA 1ISNA 1YX6B 2JT4B 4HK2A 2W9NA 3QIJA 2MCNB 4II2B 2N7EA 2LXAA 2ZCBA 3P2BA 3VUXA 1R4NI 1P3QU 2WX1A 1FXTB 4K7WA 5EDSA 1S1QB 1WF9A 3VDZA 2KC1A 4A20A 4WJPA 4RMAA 3VTWA 3UINB 5LXHA 4KSKC 3L10B 2PE9A 3A9JB 2M4NA 1WFYA 4A3PA 3M95A 1TGZB 1YQBA 2KMCA 4EZLA 2DYBA 3NHEB 2CHZA 4KIKA 3WAPA 2ZNVC 2JZZA 2KLGA 4HDOA 3L13A 4TV3A 2KKCA 2Z0DB 3OJ4B 5TR5A 4LDTB 3TIXA 2BWES 4WQOB 2ASQA 2DZIA 2PEAA 5CX3A 5LLIA 1WZ0A 2MX2A 3RYTA 4FN2A 2FUHB 3PRZA 4W9FA 1RFAA 4KDIC 2LVPA 3L17A 5CTRC 4BKSD 2LVOA 2K8CA 4NQLB 2C60A 3UF8A 1Z2MA 3D32A 4ZRKA 1V9JA 1Q1OA 3QC8B 2Y5BB 3A1QB 3DVGY 1GG3A 2MBHA 1EO6A 3T9LA 2ZZPB 1P98A 3ALBA 1TBEA 4GDKB 2RR9A 1WXMA 2BWFA 4NJ7A 3ZNID 1WXAA 2JWZA 1E7VA 5AEKB 3SU8X 3H7PA 4E74A 2DYOA 1WE6A 2KD0A 1GJZA 3EHVA 3DBRI 1SE9A 4W9KA 3A4RA 3PVLA 4A3OA 3TL5A 1Q0WB 2HD5B 4BKGA 1TTNA 3ZVVA 5KHQA 3ML9A 4CYEA 4MH0E 4IG7B 2LRWA 2IYDB 4LCDE 4I6PA 1BT0A 3PREA 3L54A 4ZDVA 3HIZA 1L2NA 4EFOA 3IFWB 3HM6X 3VFKA 1V5OA 1V5TA 2KWVB 1WM3A 2IO2B 1XQQA 3MJWA 3R66C 5JHBA 1IP9A 1F9JA 3NOBA 4HJKA 1C3TA 2KJ6A 4FHJA 4WJOA 3PRPB 4FJVB 2YVCA 4NAWB 2G3QB 2K8HA 2R2QA 1KM7A 1GC6A 3H9DA 2AL6A 2ZVNA 5BO4B 3ZUNA 5JH5C 2JPHA 3OJ3A 3VHTC 1UD7A 1WH3A 2LASA 3LJ3A 3ZNGC 4W9IA 4AUQC 2KQSA 2KDIA 1UH6A 1UBIA 4PS8A 2KN5A 1Y8RC 3H1UA 4XX5A 2JUOA 2MLBA 4I6LB 5JZEB 3UGBB 2EMSA 3KW5B 3PSEB 3ZDTA 2KTRB 3CSFA 1WX8A 3L0WB 2A4ZA 2WX0A 3NY5A 1XD3B 2CKHB 2JZ3B 2CHWA 2K25A 1K8RB 2MBBB 3VUYA 1X1MA 3L08A 4G50A 3AU5A 5LXIB 1OEYA 4LDTD 2KTRA 4DHZE 2LGYA 3TBLD 1LQBA 3NZUA 4NNJB 5G2NA 3B08A 1S3SG 4K7SA 3ENEA 1GC7A 2BGFA 3ZRCA 3M63B 2DZJA 2LZ6A 3QJZA 3QHTA 4RM8A 2ZEQA 1P1AA 2IO3B 3BINA 5C1ZA 3WALA 4GMVA 2MA9B 4IUMB 1T0YA 1WY8A 4G3XB 2LRUA 2FIDA 2VRRB 5E6NA 4YL8A 1JRUA 1E8ZA 4I6NB 2KHWB 1ZGUB 1G6JA 4PYZA 3QWZB 3CSTA 4FHKA 4IW0A 3PRMB 3GOEA 1IPGA 2PJHA 2KLCA 3JSVA 5DCNA 3VH4B 4BVUC 4AOFA 2REXA 3DVNV 4KZ0A 4IM2A 4XC2A 5E6PA 4OVUA 4DWFA 3K9OB 4NJ6A 2M0XA 4EEWA 4GGQA 2GBMA 2K39A 2O2VB 1P9DU 3PHXB 5AZHA 4TQ0A 2IBIB 2KXJA 3DPDA 3ZLZA 1WR1A 2C7HA 3KUCB 2KK8A 3QA8A 1J19A 1Z5SB 4MDKE 2KX0A 2J0KA 5D7GA 2IZVB 4LJOB 1RLFA 4KV2A 1MG8A 4RM9A 4AJYB 3O65B 3ZDMC 3ZRFA 2DHZA 3MTNB 2DAFA 2FCSA 4M0WB 3VQIA 4ANVA 4GDKA 4DHJB 4URKA 3TJPA 2LUEA 2Z0EB 2O6VB 2L0TA 2I1JA 2G4SA 3BY4B 4GIVA 2OJRA 4KDLB 2LGDA 3LDZE 2ZNVB 3VH3B 2KFJA 3IG3A 3W1SC 3I3TB 4P7IA 1J0GA 3GZNI 3DDCB 1L7YA 4M8MA 2C5LC 2I1KA 4ICUA 4DDID 5AZFA 3RD2A 3R7QA 3T8MA 4FA6A 4HDQA 2JVCA 2MBQA 4MGYE 2EKEC 2LGXA 4KVGB 3IVFA 2K6DB 1C1YB 4FULA 3W1SA 1KJTA 3JVZX 2K6QA 2N9PC 2RPQA 2WDTB 2V1YA 1CMXB 3OAWA 5CHVC 4FLHA 2J0MA 3R7RA 2BPSA 2D11A 3SD5A 3APFA 2KO3A 4NAWA 2LVQA 3VUWA 4BOSC 1TZ1A 4II3B 4W9EA 2AWTA 3DBLI 2LWPA 3N30A 3A9KA 1H8CA 3ZIMA 2O6VA 4MSQB 1WJNA 2L76A 1WZ3A 1GUAB 4E3CA 5CHFA 2IO0B 2C7NB 1D3ZA 2XEWA 4W9CA 1E8WA 4EKUA 2KTFA 2V3SA 1WXVA 1OGWA 1HE8A 1VD2A 2DZKA 3DBSA 2DAJA 2LI5A 4MGIE 3RUIB 1UBQA 1QZEA 1XT9B 2XBBC 1NI2A 3X0WA 2GMIC 4JLCA 1VCBA 4GDLB 3WAMA 4EOYA 2BKFA 3VVWB 1I42A 2DYMA 4OVVA 2C9WB 2O2VA 3RCZA 3R3MA 3PS6A 2MBEA 4GDLA 2KFKA 4WWPA 4GOCA 1R4MI 3W1YA 2ZJDA 4BOZB 4ANXA 4W9DA 3PLVA 1WX9A 3Q3JA 2J0JA 3OLMD 2NR2A 3QX1A 2PPHA 4ZRJA 5JHAA 2JF5A 2QHOA 2BYEA 4NQKE 1WGGA 2ZPNA 3UIPB 3V61A 1ZKHA 4WWOA 2FIFA 2DZMA 4JGHB 4EUTA 3QCAA 1WJ4A 4WJNA 2ZPYA 4K1RB 2GBJA 2KOXA 3A33B 3PV1A 4CHKA 3QK0A 2RSUA 1NDDA 4MSMB 4TQ1A 2FCQA 4GB9A 4WJQA 1NBFC 1YJ1A 3RT3B 2NVUI 1V80A 3ZKJC 3ZO5B 2C7MB 5DPWA 1LFDA 1YD8U 3PZDA 5G55A 3TMPB 2GBNA 4DK5A 4FBJB 3ZTCA 3HHMA 3DVNU 2FAZA 2KDBA 1EF5A 3JYUA 3AULA 4HCPB 4DHJD 1A5RA 2KDEB 2UYZB 2MP2A 1J8CA 2O6VD 1ZW7A 3DQVA 5HKHA 2NBVB 1KOTA 2CS4A 3M3JA 3V62A 2BYFA 4F7ZA 2L8JA 3A9JA 5J2RA 1SGHA 2EMTA 2XK5B 3KYCD 3ML8A 2MRPA 5L83A 1UELA 5D2MB 2LD9A 1EUVB 3ZNHB 2K1FA 2KZRA 4XZ4A 2YLMA 1WJUA 2FCNA 1WE7A 2ZVOA 4TKNA 2XK5A 1RRBA 1OQYA 2WYQA 3KUDB 2CR5A 2BYVE 4K7UA 3HM3A 3KUZA 3U7DA 4F1SA 2D07B 2NCNA 3C0RB 4J6IA 2GBKA 4AJWA 4IM3A 2N1WA 4HWIB 4ASWC 5DPTA 1WI0A 5E6OA 2L7RA 4WWNA 4BKTA 1OEYJ 2MW5A 3KYDD 3Q3FA 2MSED 1YIWA 2MP2B 2AL3A 4M8NA 2JRHA 1WGYA 4MELA 2R2OA 2LJ5A 5KHOA 2M17A 2NPTA 3EECA 2KDFB 2L05A 1M94A 2A5UA 3WIMA 3RZFA 2N1VA 3KH0A 1UGMA 1V81A 2GOWA 2WWZA 3IBEA 3CMMB 3JSVB 4IC7B 4MEMA 2L00B 2Z59B 4JIOU 3JW0X 3V6EB 4W9LA 2G45B 2KJRA 1E8YA 1U4AA 3PT2B 2HTHA 3NS8A 4MM3A 3PLUA 3NZSA 2M8SA 3A4SC 3APDA 4GSWA 2V4LA 3N3KB 2K8BA 5AZGA 4BBNF 3UQAA 2RD0A 3CF6E 1WX7A 3DOWA 2KFKB 4NY0A 1LXDA 3QQ8B 3M62B 4FJYA 3UIOB 4F8CB 3WANA 2KNBA 2RGFA 4N9F4 1EF1A 4W9JA 4JL9A 2MWSB 4EZKA 3U30A 3H7PB 1AARA 3HK0A 4ZYNA 1Q5WB 3ONSA 3PTFC 4IWPA 4BKSA 3APCA 2KANA 2M1MA 1GNUA 4PS7A 1RAXA 2BF8B 2HE7A 4G11A 2AYOB 4DXAB 1WGRA 1V49A 3PPAA 2KMAA 5C23A 4AP4C 4LJPB 4WAAA 3A1QA 4BBNC 2D10A 3A9KB 2KQ7A 1H4RA 2KWCA 3MHSD 5IAAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYU A;  1IYF A;  4K81 A;  1WXS A;  1KLV A;  5J18 A;  3IHP C;  3VAW A;  2IO1 B;  4B95 A;  4ICV A;  1WM2 A;  4IM0 A;  4MGK E;  2NPT B;  3N32 A;  2NBW B;  4MJS B;  2KWU B;  4W9G A;  4HCN B;  4DBG A;  3ECI A;  3B1L X;  4E71 A;  3VXW A;  2JXX A;  1V86 A;  4HPM B;  4W9H A;  3EFU A;  4JQW C;  5GMV A;  3V6C B;  3ZNZ B;  4DDG D;  4HXD A;  3WA0 A;  2BKR B;  4MJS A;  4EZJ A;  2NBU A;  4KSL C;  3PHW B;  1SIF A;  1UZX B;  2CHX A;  2UWQ A;  4GXB A;  2FCM A;  1E5W A;  3S2A A;  3RUL A;  4HVB A;  2CU1 A;  2D2Q A;  4GN1 A;  2L0F A;  2HJ8 A;  3ZTD A;  1OTR B;  3KVF B;  1LM8 B;  1E90 A;  4CO7 A;  2N4F A;  2MBO A;  3QAQ A;  5L95 C;  4DHZ B;  2MQJ A;  2N9E B;  2J7Q B;  3X23 A;  3SDL C;  4ANU A;  2G4D B;  2NS5 A;  2PE6 B;  2GBR A;  3H6N A;  3AU4 A;  1WIA A;  2DEN B;  2KJH B;  3WAO A;  5D94 A;  4HLE A;  4ZRI A;  1YX5 B;  4ANW A;  3DBH I;  1E8X A;  5J17 A;  2KX3 A;  3V60 A;  3H7S A;  3DVG X;  2AEH A;  1E7U A;  1WR6 E;  2B3A A;  1PQS A;  5DPS A;  3K9P B;  5IA7 A;  4TUU A;  1WMH A;  2KVR A;  3SHQ A;  2FNJ B;  3U8Z A;  3L16 A;  3PGE A;  1P0R A;  1WGH A;  4GU2 A;  4BFR A;  4MGZ E;  2KC2 A;  4FJZ A;  1WGD A;  4PS3 A;  3VTV A;  2N9X A;  2LXC A;  2ZCC A;  2L3Z A;  2N7D A;  4FAD A;  1WYW B;  4HPL B;  2JY6 A;  4KZC A;  2IY0 B;  3RZW C;  4NPN A;  3VTU A;  4B6W A;  1WMH B;  3B0A A;  2OOB B;  2D3G A;  3EC8 A;  4AWJ A;  3UQB A;  1I35 A;  3TCA A;  1V2Y A;  5FR6 A;  2JRI B;  4IWQ A;  4KIK B;  4X57 B;  1WRD B;  3AI5 A;  5D6J B;  3ZW3 A;  4B9K A;  4G0N B;  3DCG A;  3AXC A;  1WJ6 A;  2IY1 B;  4IWO A;  5CHW A;  1V6E A;  2DX5 B;  3QAR A;  5DPR A;  1ISN A;  1YX6 B;  2JT4 B;  4HK2 A;  2W9N A;  3QIJ A;  2MCN B;  4II2 B;  2N7E A;  2LXA A;  2ZCB A;  3P2B A;  3VUX A;  1R4N I;  1P3Q U;  2WX1 A;  1FXT B;  4K7W A;  5EDS A;  1S1Q B;  1WF9 A;  3VDZ A;  2KC1 A;  4A20 A;  4WJP A;  4RMA A;  3VTW A;  3UIN B;  5LXH A;  4KSK C;  3L10 B;  2PE9 A;  3A9J B;  2M4N A;  1WFY A;  4A3P A;  3M95 A;  1TGZ B;  1YQB A;  2KMC A;  4EZL A;  2DYB A;  3NHE B;  2CHZ A;  4KIK A;  3WAP A;  2ZNV C;  2JZZ A;  2KLG A;  4HDO A;  3L13 A;  4TV3 A;  2KKC A;  2Z0D B;  3OJ4 B;  5TR5 A;  4LDT B;  3TIX A;  2BWE S;  4WQO B;  2ASQ A;  2DZI A;  2PEA A;  5CX3 A;  5LLI A;  1WZ0 A;  2MX2 A;  3RYT A;  4FN2 A;  2FUH B;  3PRZ A;  4W9F A;  1RFA A;  4KDI C;  2LVP A;  3L17 A;  5CTR C;  4BKS D;  2LVO A;  2K8C A;  4NQL B;  2C60 A;  3UF8 A;  1Z2M A;  3D32 A;  4ZRK A;  1V9J A;  1Q1O A;  3QC8 B;  2Y5B B;  3A1Q B;  3DVG Y;  1GG3 A;  2MBH A;  1EO6 A;  3T9L A;  2ZZP B;  1P98 A;  3ALB A;  1TBE A;  4GDK B;  2RR9 A;  1WXM A;  2BWF A;  4NJ7 A;  3ZNI D;  1WXA A;  2JWZ A;  1E7V A;  5AEK B;  3SU8 X;  3H7P A;  4E74 A;  2DYO A;  1WE6 A;  2KD0 A;  1GJZ A;  3EHV A;  3DBR I;  1SE9 A;  4W9K A;  3A4R A;  3PVL A;  4A3O A;  3TL5 A;  1Q0W B;  2HD5 B;  4BKG A;  1TTN A;  3ZVV A;  5KHQ A;  3ML9 A;  4CYE A;  4MH0 E;  4IG7 B;  2LRW A;  2IYD B;  4LCD E;  4I6P A;  1BT0 A;  3PRE A;  3L54 A;  4ZDV A;  3HIZ A;  1L2N A;  4EFO A;  3IFW B;  3HM6 X;  3VFK A;  1V5O A;  1V5T A;  2KWV B;  1WM3 A;  2IO2 B;  1XQQ A;  3MJW A;  3R66 C;  5JHB A;  1IP9 A;  1F9J A;  3NOB A;  4HJK A;  1C3T A;  2KJ6 A;  4FHJ A;  4WJO A;  3PRP B;  4FJV B;  2YVC A;  4NAW B;  2G3Q B;  2K8H A;  2R2Q A;  1KM7 A;  1GC6 A;  3H9D A;  2AL6 A;  2ZVN A;  5BO4 B;  3ZUN A;  5JH5 C;  2JPH A;  3OJ3 A;  3VHT C;  1UD7 A;  1WH3 A;  2LAS A;  3LJ3 A;  3ZNG C;  4W9I A;  4AUQ C;  2KQS A;  2KDI A;  1UH6 A;  1UBI A;  4PS8 A;  2KN5 A;  1Y8R C;  3H1U A;  4XX5 A;  2JUO A;  2MLB A;  4I6L B;  5JZE B;  3UGB B;  2EMS A;  3KW5 B;  3PSE B;  3ZDT A;  2KTR B;  3CSF A;  1WX8 A;  3L0W B;  2A4Z A;  2WX0 A;  3NY5 A;  1XD3 B;  2CKH B;  2JZ3 B;  2CHW A;  2K25 A;  1K8R B;  2MBB B;  3VUY A;  1X1M A;  3L08 A;  4G50 A;  3AU5 A;  5LXI B;  1OEY A;  4LDT D;  2KTR A;  4DHZ E;  2LGY A;  3TBL D;  1LQB A;  3NZU A;  4NNJ B;  5G2N A;  3B08 A;  1S3S G;  4K7S A;  3ENE A;  1GC7 A;  2BGF A;  3ZRC A;  3M63 B;  2DZJ A;  2LZ6 A;  3QJZ A;  3QHT A;  4RM8 A;  2ZEQ A;  1P1A A;  2IO3 B;  3BIN A;  5C1Z A;  3WAL A;  4GMV A;  2MA9 B;  4IUM B;  1T0Y A;  1WY8 A;  4G3X B;  2LRU A;  2FID A;  2VRR B;  5E6N A;  4YL8 A;  1JRU A;  1E8Z A;  4I6N B;  2KHW B;  1ZGU B;  1G6J A;  4PYZ A;  3QWZ B;  3CST A;  4FHK A;  4IW0 A;  3PRM B;  3GOE A;  1IPG A;  2PJH A;  2KLC A;  3JSV A;  5DCN A;  3VH4 B;  4BVU C;  4AOF A;  2REX A;  3DVN V;  4KZ0 A;  4IM2 A;  4XC2 A;  5E6P A;  4OVU A;  4DWF A;  3K9O B;  4NJ6 A;  2M0X A;  4EEW A;  4GGQ A;  2GBM A;  2K39 A;  2O2V B;  1P9D U;  3PHX B;  5AZH A;  4TQ0 A;  2IBI B;  2KXJ A;  3DPD A;  3ZLZ A;  1WR1 A;  2C7H A;  3KUC B;  2KK8 A;  3QA8 A;  1J19 A;  1Z5S B;  4MDK E;  2KX0 A;  2J0K A;  5D7G A;  2IZV B;  4LJO B;  1RLF A;  4KV2 A;  1MG8 A;  4RM9 A;  4AJY B;  3O65 B;  3ZDM C;  3ZRF A;  2DHZ A;  3MTN B;  2DAF A;  2FCS A;  4M0W B;  3VQI A;  4ANV A;  4GDK A;  4DHJ B;  4URK A;  3TJP A;  2LUE A;  2Z0E B;  2O6V B;  2L0T A;  2I1J A;  2G4S A;  3BY4 B;  4GIV A;  2OJR A;  4KDL B;  2LGD A;  3LDZ E;  2ZNV B;  3VH3 B;  2KFJ A;  3IG3 A;  3W1S C;  3I3T B;  4P7I A;  1J0G A;  3GZN I;  3DDC B;  1L7Y A;  4M8M A;  2C5L C;  2I1K A;  4ICU A;  4DDI D;  5AZF A;  3RD2 A;  3R7Q A;  3T8M A;  4FA6 A;  4HDQ A;  2JVC A;  2MBQ A;  4MGY E;  2EKE C;  2LGX A;  4KVG B;  3IVF A;  2K6D B;  1C1Y B;  4FUL A;  3W1S A;  1KJT A;  3JVZ X;  2K6Q A;  2N9P C;  2RPQ A;  2WDT B;  2V1Y A;  1CMX B;  3OAW A;  5CHV C;  4FLH A;  2J0M A;  3R7R A;  2BPS A;  2D11 A;  3SD5 A;  3APF A;  2KO3 A;  4NAW A;  2LVQ A;  3VUW A;  4BOS C;  1TZ1 A;  4II3 B;  4W9E A;  2AWT A;  3DBL I;  2LWP A;  3N30 A;  3A9K A;  1H8C A;  3ZIM A;  2O6V A;  4MSQ B;  1WJN A;  2L76 A;  1WZ3 A;  1GUA B;  4E3C A;  5CHF A;  2IO0 B;  2C7N B;  1D3Z A;  2XEW A;  4W9C A;  1E8W A;  4EKU A;  2KTF A;  2V3S A;  1WXV A;  1OGW A;  1HE8 A;  1VD2 A;  2DZK A;  3DBS A;  2DAJ A;  2LI5 A;  4MGI E;  3RUI B;  1UBQ A;  1QZE A;  1XT9 B;  2XBB C;  1NI2 A;  3X0W A;  2GMI C;  4JLC A;  1VCB A;  4GDL B;  3WAM A;  4EOY A;  2BKF A;  3VVW B;  1I42 A;  2DYM A;  4OVV A;  2C9W B;  2O2V A;  3RCZ A;  3R3M A;  3PS6 A;  2MBE A;  4GDL A;  2KFK A;  4WWP A;  4GOC A;  1R4M I;  3W1Y A;  2ZJD A;  4BOZ B;  4ANX A;  4W9D A;  3PLV A;  1WX9 A;  3Q3J A;  2J0J A;  3OLM D;  2NR2 A;  3QX1 A;  2PPH A;  4ZRJ A;  5JHA A;  2JF5 A;  2QHO A;  2BYE A;  4NQK E;  1WGG A;  2ZPN A;  3UIP B;  3V61 A;  1ZKH A;  4WWO A;  2FIF A;  2DZM A;  4JGH B;  4EUT A;  3QCA A;  1WJ4 A;  4WJN A;  2ZPY A;  4K1R B;  2GBJ A;  2KOX A;  3A33 B;  3PV1 A;  4CHK A;  3QK0 A;  2RSU A;  1NDD A;  4MSM B;  4TQ1 A;  2FCQ A;  4GB9 A;  4WJQ A;  1NBF C;  1YJ1 A;  3RT3 B;  2NVU I;  1V80 A;  3ZKJ C;  3ZO5 B;  2C7M B;  5DPW A;  1LFD A;  1YD8 U;  3PZD A;  5G55 A;  3TMP B;  2GBN A;  4DK5 A;  4FBJ B;  3ZTC A;  3HHM A;  3DVN U;  2FAZ A;  2KDB A;  1EF5 A;  3JYU A;  3AUL A;  4HCP B;  4DHJ D;  1A5R A;  2KDE B;  2UYZ B;  2MP2 A;  1J8C A;  2O6V D;  1ZW7 A;  3DQV A;  5HKH A;  2NBV B;  1KOT A;  2CS4 A;  3M3J A;  3V62 A;  2BYF A;  4F7Z A;  2L8J A;  3A9J A;  5J2R A;  1SGH A;  2EMT A;  2XK5 B;  3KYC D;  3ML8 A;  2MRP A;  5L83 A;  1UEL A;  5D2M B;  2LD9 A;  1EUV B;  3ZNH B;  2K1F A;  2KZR A;  4XZ4 A;  2YLM A;  1WJU A;  2FCN A;  1WE7 A;  2ZVO A;  4TKN A;  2XK5 A;  1RRB A;  1OQY A;  2WYQ A;  3KUD B;  2CR5 A;  2BYV E;  4K7U A;  3HM3 A;  3KUZ A;  3U7D A;  4F1S A;  2D07 B;  2NCN A;  3C0R B;  4J6I A;  2GBK A;  4AJW A;  4IM3 A;  2N1W A;  4HWI B;  4ASW C;  5DPT A;  1WI0 A;  5E6O A;  2L7R A;  4WWN A;  4BKT A;  1OEY J;  2MW5 A;  3KYD D;  3Q3F A;  2MSE D;  1YIW A;  2MP2 B;  2AL3 A;  4M8N A;  2JRH A;  1WGY A;  4MEL A;  2R2O A;  2LJ5 A;  5KHO A;  2M17 A;  2NPT A;  3EEC A;  2KDF B;  2L05 A;  1M94 A;  2A5U A;  3WIM A;  3RZF A;  2N1V A;  3KH0 A;  1UGM A;  1V81 A;  2GOW A;  2WWZ A;  3IBE A;  3CMM B;  3JSV B;  4IC7 B;  4MEM A;  2L00 B;  2Z59 B;  4JIO U;  3JW0 X;  3V6E B;  4W9L A;  2G45 B;  2KJR A;  1E8Y A;  1U4A A;  3PT2 B;  2HTH A;  3NS8 A;  4MM3 A;  3PLU A;  3NZS A;  2M8S A;  3A4S C;  3APD A;  4GSW A;  2V4L A;  3N3K B;  2K8B A;  5AZG A;  4BBN F;  3UQA A;  2RD0 A;  3CF6 E;  1WX7 A;  3DOW A;  2KFK B;  4NY0 A;  1LXD A;  3QQ8 B;  3M62 B;  4FJY A;  3UIO B;  4F8C B;  3WAN A;  2KNB A;  2RGF A;  4N9F 4;  1EF1 A;  4W9J A;  4JL9 A;  2MWS B;  4EZK A;  3U30 A;  3H7P B;  1AAR A;  3HK0 A;  4ZYN A;  1Q5W B;  3ONS A;  3PTF C;  4IWP A;  4BKS A;  3APC A;  2KAN A;  2M1M A;  1GNU A;  4PS7 A;  1RAX A;  2BF8 B;  2HE7 A;  4G11 A;  2AYO B;  4DXA B;  1WGR A;  1V49 A;  3PPA A;  2KMA A;  5C23 A;  4AP4 C;  4LJP B;  4WAA A;  3A1Q A;  4BBN C;  2D10 A;  3A9K B;  2KQ7 A;  1H4R A;  2KWC A;  3MHS D;  5IAA C; 
#chains in the Genus database with same CATH topology
 4HKZ E;  1ZPS A;  2KDM A;  5J18 A;  3EGR A;  3VAW A;  1WM2 A;  3BVM A;  2NPT B;  4MJS B;  1SE4 A;  4HCN B;  4E71 A;  1RWS A;  4FXC A;  1E6E B;  3BVZ A;  4DDG D;  3PHW B;  3BK1 A;  1QOG A;  1E0Z A;  1E5W A;  3S2A A;  3RUL A;  2CU1 A;  5G5G A;  1STE A;  1HTQ A;  1E90 A;  4CO7 A;  3QAQ A;  2MBO A;  4NJC A;  4A9A A;  2MQJ A;  1K51 A;  1JWS D;  1UWM A;  1C78 A;  1QOF A;  3H7S A;  3DVG X;  2AEH A;  1E7U A;  2B3A A;  5IA7 A;  3K9P B;  4TUU A;  4C4V A;  5MPO A;  1CQV A;  1LGR A;  1ET9 A;  2DWQ A;  3TEZ A;  2KC2 A;  1L6V A;  3VTV A;  4MM3 B;  2L3Z A;  2N7D A;  4FAD A;  3P4S B;  2JY6 A;  2KVZ A;  1KF6 B;  1YOV B;  1I4Q A;  2OOB B;  3EC8 A;  1I35 A;  2BQQ A;  2V3P A;  4US9 A;  2ON8 A;  3TCA A;  2JRI B;  4IWQ A;  3Q69 A;  3ZW3 A;  2WXR A;  3TEY A;  3DCG A;  1WJ6 A;  2IY1 B;  2SAK A;  4IWO A;  1ISN A;  1YX6 B;  1A70 A;  1FO4 A;  2N7E A;  2LXA A;  4P16 A;  4OW0 A;  3AEB B;  2INC C;  3VTW A;  1BML C;  1M4V A;  4WAF A;  4KSK C;  2PE9 A;  1WFY A;  2FE8 A;  4GLS C;  3NHE B;  2CHZ A;  2ZNV C;  5TR5 A;  2Z0D B;  4LDT B;  2BWE S;  2ASQ A;  2DZI A;  2PEA A;  5CX3 A;  3RNA C;  3GB1 A;  3L17 A;  4NQL B;  1Z2M A;  2WU2 B;  3D32 A;  5BYR A;  1Q1O A;  2Y5B B;  1BUI C;  3DVG Y;  3T9L A;  2ZZP B;  2HTM E;  1V1P B;  1VDV A;  1PYW D;  1E7V A;  5AEK B;  2LUM A;  1KFY B;  1SE9 A;  4A3O A;  4YSY B;  1OFF A;  3ZVV A;  5EE0 A;  3GP7 A;  2V4I B;  4IG7 B;  2OHF A;  4I6P A;  4ZDV A;  1WM3 A;  3R66 C;  2KJ6 A;  4FHJ A;  1V97 A;  3PRP B;  4LLG M;  2YVC A;  2R2Q A;  2AL6 A;  3DBL B;  1L4D B;  4MH8 A;  3OJ3 A;  4W9I A;  5FR3 A;  2KDI A;  2LHD A;  2JUO A;  1GOZ A;  3RNE C;  2WX0 A;  3AE6 B;  3NY5 A;  3IT4 B;  3OWE B;  4BAX A;  3UI3 A;  4G50 A;  4RNA A;  4M0W A;  1NYQ A;  3TBL D;  3VRA B;  5G2N A;  1NYR A;  4WWM A;  3M63 B;  2WP9 B;  4RGT A;  2JWU A;  2YEP B;  2LRU A;  2FID A;  2EKI A;  1FCC C;  4REZ A;  1ZGU B;  3CST A;  3GOE A;  2KLC A;  3ZGZ A;  2QJL A;  1MFW A;  4KZ0 A;  4XC2 A;  4A90 A;  3K9O B;  4NJ6 A;  2M0X A;  4JE3 B;  1B9R A;  2K39 A;  3GZN B;  1P9D U;  1UUP A;  2KXJ A;  3DPD A;  1WR1 A;  3QA8 A;  2KX0 A;  4XWW A;  1GB1 A;  4KV2 A;  4AJY B;  1JWA D;  1ZP0 B;  5EE3 A;  3O65 B;  3P4Q B;  1C77 A;  1XLQ A;  3ZRF A;  2BS2 B;  2DHZ A;  4TSS A;  3MTN B;  2FCS A;  4URK A;  4YTN B;  1T0Q C;  3P4R B;  4GIV A;  2ZNV B;  3SEB A;  5C3J B;  3W1S C;  3I3T B;  1WGK A;  1J0G A;  3GZN I;  2D3B A;  2M0A A;  3AE4 B;  3T8M A;  2Y5P A;  2PVO D;  3W1S A;  3JVZ X;  3ABV B;  3EFC A;  2N9P C;  4PT5 A;  1CMX B;  4FLH A;  2J0M A;  3V05 A;  2BPS A;  2D11 A;  4BOS C;  2H89 B;  2N9K A;  2L76 A;  1FXA A;  5CHF A;  4A6Q A;  1D3Z A;  2KTF A;  2V3S A;  2PVG C;  3DBS A;  2DAJ A;  1UWX A;  4MGI E;  4R3D A;  1UBQ A;  2WXN A;  1T5X D;  2GMI C;  4GDL B;  3WAM A;  4OVV A;  2C9W B;  2NTS A;  5BYQ A;  3Q3J A;  2J0J A;  2QIL A;  2BB6 A;  2QHO A;  1WGG A;  2ZPN A;  1XCT L;  1ZKH A;  3V61 A;  2ZPY A;  4K1R B;  2GBJ A;  3A33 B;  3PV1 A;  2B76 B;  1NDD A;  1NEK B;  1NBF C;  2C7M B;  4IOI E;  1YD8 U;  5G55 A;  2GBN A;  1K50 A;  2Q5W D;  2FAZ A;  4DHJ D;  1TS4 A;  1F0Z A;  1DOY A;  2MP2 A;  4C7Z A;  1J8C A;  3MHZ A;  1KOT A;  1SE3 A;  4F7Z A;  1Q10 A;  1XLP A;  2EMT A;  4USA A;  5J2R A;  3ML8 A;  2MRP A;  4ZOH C;  1EUV B;  2K1F A;  2KZR A;  3LB8 C;  3ZJU A;  1WE7 A;  1OQY A;  2CR5 A;  3KUZ A;  2GBK A;  2L1A A;  2N1W A;  1FRD A;  5DPT A;  1VLB A;  5E6O A;  4WWN A;  3R2T A;  3Q3F A;  1WGY A;  2LJ5 A;  1TYG B;  2L05 A;  3J9C A;  2A5U A;  3ETR A;  1UGM A;  1FD6 A;  3CMM B;  4IC7 B;  2N9L A;  4JIO U;  3PT2 B;  4HRO A;  2JXT A;  4GSW A;  3N3K B;  1PDX A;  1EM7 A;  2RD0 A;  3CF6 E;  3DOW A;  4FJY A;  4F8C B;  1OQQ A;  3W5V B;  4N9F 4;  1EF1 A;  1QLB B;  3AN1 A;  2WS3 B;  4EZK A;  2WXJ A;  4ZYN A;  1Q5W B;  1I4X A;  2KAN A;  4OZA A;  2HE7 A;  2AYO B;  2KMA A;  1XCQ L;  2MHJ A;  1K53 A;  2K0P A;  4N59 A;  4XE0 A;  5IAA C;  2W55 A;  4OVZ A;  2BTE A;  1IYF A;  1WXS A;  1TKG A;  3IHP C;  3NVZ A;  2IO1 B;  4K3C A;  4ICV A;  4IM0 A;  2JZP A;  3I57 A;  5FKA C;  4B0M A;  4DBG A;  2R61 A;  1PUT A;  3WA0 A;  1TT5 B;  2TSS A;  1RYJ A;  2ZW0 A;  2BBC A;  2D2Q A;  2L0F A;  1OTR B;  3KVF B;  1LM8 B;  5L95 C;  3NUH B;  4N58 A;  2J4X A;  3X23 A;  4ANU A;  2LHE A;  4A55 A;  4ACF A;  3WAO A;  1JWU D;  4HLE A;  1E8X A;  3V60 A;  1WR6 E;  1C9F A;  3SHQ A;  2KVR A;  4ARC A;  3AE3 B;  4LNI A;  4GU2 A;  3BZD B;  1SE2 A;  2ZCC A;  4LNN A;  5D3I B;  4KZC A;  4ZHO A;  3RZW C;  4NPN A;  3RI7 C;  2DBY A;  4B6W A;  2HJ1 A;  2D3G A;  1JQ4 A;  1R7S A;  3AI5 A;  2WXI A;  5D6J B;  4B9K A;  4YXD B;  3AXC A;  1UNS A;  5CHW A;  2DX5 B;  3QAR A;  5DPR A;  3AH7 A;  3TUO A;  2JT4 B;  2K5P A;  4HK2 A;  2W9N A;  1J7C A;  2UU7 A;  3RN9 C;  4BZA A;  1IBX B;  3E56 A;  4II2 B;  2ZCB A;  3P2B A;  3B2G A;  3GE8 C;  1I4G A;  1FM0 D;  5EDS A;  4WJP A;  3URY A;  4DXF A;  1QOB A;  4KGR A;  3UIN B;  5LXH A;  1F2R C;  3A9J B;  4A3P A;  4EZL A;  2DYB A;  1FPY A;  4KIK A;  1WYG A;  3WAP A;  1YN4 A;  1L0X B;  5D3D A;  4WQO B;  3HUI A;  2D3C A;  3PRZ A;  1ZDV A;  1RFA A;  2WNM A;  4KDI C;  5CTR C;  2C60 A;  2K3U A;  1N62 A;  4IDI A;  1KRH A;  4NJ7 A;  4LNK A;  1F2R I;  4EE2 A;  3B2F A;  3H7P A;  4E74 A;  2DYO A;  3EHV A;  3DBR I;  4W9K A;  4BKG A;  4TMA B;  5KHQ A;  3ML9 A;  4MH0 E;  2LRW A;  1JRP A;  2PLP A;  4J3O D;  1JCK B;  1E10 A;  1ZOY B;  2BYT A;  3HIZ A;  1L2N A;  4EFO A;  2IO2 B;  1XQQ A;  2VH1 A;  4HJK A;  1C3T A;  4WJO A;  4FJV B;  4RH6 A;  2JSV X;  1KM7 A;  3H9D A;  4RGN A;  2ZVN A;  5BO4 B;  1CZP A;  3DHG C;  3VR9 B;  5JH5 C;  2JPH A;  2QC8 A;  3ZNG C;  4PS8 A;  3EUB 2;  5IN7 A;  2INN E;  4XX5 A;  4I6L B;  4MT5 A;  3KW5 B;  2KTR B;  3CSF A;  1DOI A;  3NVV A;  2A4Z A;  1QOA A;  4C56 C;  1XD3 B;  2K25 A;  1K8R B;  2MBB B;  3VUY A;  3L08 A;  2N7J A;  1TY0 A;  2PW9 A;  2GLS A;  4DHZ E;  1LQB A;  1HZ5 A;  3B08 A;  2J42 A;  2DZJ A;  2IO3 B;  3BIN A;  5C1Z A;  3WAL A;  4GMV A;  3AB5 A;  2INP E;  4IUM B;  4G3X B;  1ZDX A;  1VZ8 A;  2FBW B;  1SSN A;  2MEK A;  1MPE A;  1SBB B;  3AE9 B;  3QWZ B;  2IND C;  4FHK A;  5I4D A;  3PRM B;  2PJH A;  2WGS A;  3CWI A;  2OED A;  4IM2 A;  4DWF A;  3IAS 1;  1GAQ B;  2RDB C;  2IBI B;  2C7H A;  3KUC B;  1YQ3 B;  5AUI A;  4A8X C;  1RLF A;  1TJE A;  2CJO A;  4DHJ B;  2E3T A;  2O6V B;  2L0T A;  3Q6B A;  2G4S A;  4UDU C;  3P63 A;  5H92 C;  4P7I A;  2J53 A;  1FMA D;  1ZE3 D;  2C5L C;  4DDI D;  5HHD G;  3RD2 A;  3R7Q A;  4HDQ A;  1N5X A;  2LGX A;  3N1Y C;  2K6D B;  3AEC B;  4RCO A;  1RM6 C;  3Q8C A;  3R7R A;  2KO3 A;  3P1M A;  4NAW A;  2AWT A;  3N30 A;  3A9K A;  1H8C A;  3ZIM A;  4MSQ B;  1WJN A;  1DOX A;  4LK0 M;  1B1Z A;  1HE8 A;  2XN9 C;  2DZK A;  3RUI B;  1QZE A;  1XT9 B;  1NI2 A;  5LNK 1;  2VZK B;  3Q3M C;  1I42 A;  2DYM A;  3RCZ A;  4JPS A;  1JAL A;  1R4M I;  1R4N B;  3OLM D;  3QX1 A;  2KT7 A;  2JF5 A;  4NQK E;  3UIP B;  1AN8 A;  1VR9 A;  3RNF C;  3DWG C;  1PGB A;  2GI9 A;  1TZO A;  3QK0 A;  4TQ1 A;  2FCQ A;  5AUK A;  4ZRP A;  3RT3 B;  1GPX A;  5DPW A;  4P1C C;  3TMP B;  4HJG E;  1HXY D;  4DK5 A;  3T3N A;  3N1X C;  3HHM A;  1I7H A;  1XO3 A;  4HCP B;  3AUL A;  3FIL A;  3NZ3 A;  4RGM A;  1ZW7 A;  1MVK A;  5HKH A;  3TEW A;  2NBV B;  2RDG A;  4KGT A;  2L8J A;  3A9J A;  4S17 A;  1SGH A;  2I38 A;  2D5G A;  2N0S B;  3MP9 A;  5D2M B;  2JYE A;  3ZNH B;  1SJH D;  1QT9 A;  2WXP A;  4XZ4 A;  1D4B A;  4TKN A;  2XK5 A;  2WYQ A;  3U52 E;  2BYV E;  5HFY A;  3U7D A;  3GS2 A;  1FFV A;  4HWI B;  2AL3 A;  1AWD A;  2NPT A;  4RGO S;  1M94 A;  3WIM A;  4AQ7 A;  3RZF A;  3AE2 B;  2N1V A;  3KH0 A;  2YEP F;  1TIF A;  3JSV B;  4MEM A;  5EE9 A;  2L00 B;  1L6U A;  2Z59 B;  2Z8L A;  3V6E B;  2KJR A;  1E8Y A;  1U4A A;  3NS8 A;  4JX1 C;  2KN4 A;  2M8S A;  2V4L A;  1AW7 A;  2AX5 A;  2KFK B;  1LXD A;  3M62 B;  4KGS A;  3T3O A;  2QMT A;  3U4E G;  2KNB A;  1VZ6 A;  2RGF A;  3PZ8 A;  2PIA A;  3AEF B;  3U30 A;  3IAM 1;  4XWT A;  3ONS A;  4IWP A;  5IOI A;  3O13 A;  2M1M A;  4PS7 A;  2KQ4 X;  4LNO A;  2Y3A A;  4G11 A;  4DXA B;  1V49 A;  5C23 A;  4AP4 C;  3U7Z A;  4S0R A;  1H4R A;  4II3 B;  3MHS D;  2RMM A;  4PYU A;  3ZJV A;  1OQR A;  2E6X A;  4B95 A;  3NVW A;  4MGK E;  3N32 A;  2NBW B;  3VXW A;  3HVD A;  2JXX A;  4WH4 A;  4W9H A;  3AE5 B;  4QAY A;  3EFU A;  3ZNZ B;  1EWY C;  4KSL C;  3RNB C;  1SIF A;  1UZX B;  2CHX A;  2FCM A;  1C4A A;  1R4M B;  1I4H A;  2V3N A;  4HVB A;  4GN1 A;  3AV8 A;  2HJ8 A;  1MI0 A;  2N4F A;  2J7Q B;  3SDL C;  3RNC C;  2G4D B;  2NS5 A;  2PE6 B;  3AU4 A;  1WIA A;  1XXG A;  2KJH B;  3W5U B;  3DBH I;  1F77 A;  2FUG 1;  1V8C A;  1ROE A;  1WMH A;  2BS3 B;  1YN3 A;  4BFR A;  4MGZ E;  1WGD A;  1D5M C;  3NRZ A;  1QIL A;  2N9X A;  3DHI C;  4LTU A;  1WYW B;  4HPL B;  2IY0 B;  1KLG D;  3VTU A;  2Y5C A;  4KKI A;  5T8I A;  3UQB A;  4YTP B;  1FCL A;  3L4P A;  2KAJ A;  4D2K A;  4X57 B;  4G0N B;  1V6E A;  2ACZ B;  3AM9 A;  2LGS A;  1C4P A;  3QIJ A;  2MCN B;  2JU6 X;  2M19 A;  1D6E C;  1FXT B;  2KC1 A;  4CQN A;  4RMA A;  3L10 B;  2M4N A;  2DLB A;  3M95 A;  1FRR A;  1YQB A;  2KMC A;  2ICI A;  4TV3 A;  3OJ4 B;  2LFI A;  3TIX A;  1JWM D;  1WZ0 A;  4FN2 A;  1PGX A;  2FUH B;  2WXG A;  2LVP A;  3SFE B;  3QC8 B;  2WXL A;  1GG3 A;  1BXT A;  5G5H A;  1TBE A;  2RR9 A;  3LYY A;  1WXM A;  1XLO A;  2JWZ A;  3A4R A;  3PVL A;  1SIJ A;  1Q0W B;  3TL5 A;  2HD5 B;  2IYD B;  4XDC A;  4YSX B;  3MC0 B;  1BT0 A;  4C7Y A;  3L54 A;  1ZUD 2;  3IFW B;  3VFK A;  1C79 A;  1V5T A;  2M56 B;  5JHB A;  1F9J A;  2LGI A;  4Q2J A;  2BT6 A;  1DYQ A;  2K8H A;  3C8Y A;  1GC6 A;  1N6Z A;  2JX5 A;  5EE1 A;  1UD7 A;  3LJ3 A;  1UH6 A;  1UBI A;  1YN5 A;  3W9C B;  2KN5 A;  2LJI A;  3H1U A;  2L83 A;  3PSE B;  3ZDT A;  5IKC M;  3L0W B;  3Q3O C;  1J7A A;  2JZ3 B;  4B0E A;  2CHW A;  1NI3 A;  4NZL B;  1X1M A;  1XEE A;  5LXI B;  1OEY A;  1C4C A;  3P42 A;  2WXQ A;  2LGY A;  4K7S A;  3Q8E A;  1I4R A;  2BGF A;  1VZ7 A;  2QCZ A;  2ZEQ A;  3Q8B A;  5HI1 A;  1KTK A;  2MA9 B;  1T0Y A;  2VRR B;  4YL8 A;  1JRU A;  1F1H A;  3RMK C;  2KHW B;  2LMC A;  1G6J A;  1L5P A;  1YJI A;  3JSV A;  3GE3 C;  5E6P A;  4OVU A;  2K22 A;  2NTT A;  4EEW A;  3DBH B;  4GGQ A;  2GBM A;  2O2V B;  3PHX B;  4TQ0 A;  2AQ2 B;  2KK8 A;  4ZYS A;  1JRO A;  1HZ6 A;  3PO0 A;  1FNW A;  4OZB A;  2J0K A;  5D7G A;  2IZV B;  4LJO B;  4YWG G;  1MG8 A;  3ZDM C;  3N1Z C;  2RDH A;  1XF5 L;  2DAF A;  4M0W B;  4ANV A;  4GDK A;  3Q8F A;  2LUE A;  3DWM A;  2Z0E B;  1GB4 A;  3BY4 B;  4ITK A;  4WIP A;  2WU5 B;  3VH3 B;  4OZC A;  1P7F A;  1L7Y A;  1QQR A;  5AZF A;  4JWU C;  4C00 A;  3FIL B;  2MBQ A;  2WXF A;  4WUR A;  3VR8 B;  2EKE C;  1C1Y B;  1MHX A;  4O1N A;  2BVC A;  3OAW A;  2V1Y A;  4YSZ B;  4M01 A;  4C80 A;  1T6B X;  1TZ1 A;  2LWP A;  4AS1 A;  1GUA B;  2IO0 B;  2C7N B;  2XEW A;  1SF0 A;  3N9Y C;  1V1O A;  1WXV A;  1OGW A;  1VD2 A;  4ARI A;  1ENF A;  4YTM B;  1FNV A;  2XBB C;  5H8Y E;  4JLC A;  1VCB A;  2BKF A;  3PS6 A;  4GDL A;  5JXV A;  4BOZ B;  1WSP A;  3PLV A;  1WX9 A;  2NR2 A;  2ONQ A;  4ZRJ A;  2BYE A;  4WWO A;  2MJ3 A;  2FIF A;  2QIE B;  4EUT A;  1JWB D;  1WJ4 A;  2WDV B;  2WQY B;  4MSM B;  1TY2 A;  4WJQ A;  3MFG A;  4GB9 A;  3FC4 A;  1YJ1 A;  3ZKJ C;  2L32 A;  5BMG A;  4FBJ B;  1ZXI A;  4L1B A;  3DVN U;  2KDB A;  1HEZ E;  2KDE B;  2O6V D;  3BYT B;  3V62 A;  3I9V 1;  2BYF A;  4HKQ A;  1L0V B;  2I2Y A;  2SEB D;  3ZXR A;  3ZQ4 A;  2XK5 B;  3KYC D;  5L83 A;  1UEL A;  2LD9 A;  3W2D A;  2FCN A;  2ZVO A;  2W3S A;  3HM3 A;  2X38 A;  2NCN A;  4J6I A;  4AJW A;  2L52 A;  4IM3 A;  1FFU A;  1T0S C;  1WI0 A;  2L7R A;  3Q3N C;  1T0R C;  2MSE D;  1YIW A;  1EU4 A;  2MP2 B;  5IP4 D;  2JRH A;  3I63 C;  4MEL A;  2R2O A;  1WRI A;  3KWL A;  3SR6 A;  1NEN B;  4L23 A;  4M02 A;  1V81 A;  2GOW A;  2WXH A;  3KWV A;  4K3B A;  3JW0 X;  1EWC A;  1HQR D;  4DXG A;  4MM3 A;  3NZS A;  4HRS A;  3A4S C;  2K8B A;  4BBN F;  3UQA A;  1WX7 A;  1XLN A;  4NY0 A;  3WAN A;  1KLU D;  5IO9 A;  3AED B;  3PTF C;  2AQ3 B;  1RAX A;  1WGR A;  3PPA A;  4WAA A;  1TKY A;  3A1Q A;  3U2S C;  4BBN C;  2D10 A;  1L4Z B;  5BYS A;  4K81 A;  1ACC A;  1KLV A;  2K9X A;  2KWU B;  2W54 A;  4W9G A;  2D3A A;  3ECI A;  2PMV A;  2CU3 A;  3B1L X;  2RPV A;  1V86 A;  4HPM B;  3FAH A;  4JQW C;  5GMV A;  3V6C B;  4HXD A;  2BKR B;  1J7B A;  3BK2 A;  4MJS A;  4EZJ A;  2NBU A;  1Y56 A;  1FXI A;  2MJD A;  2UWQ A;  4GXB A;  2BS4 B;  3OG5 A;  2WXK A;  2HDE A;  3AEG B;  2MJE A;  3ZTD A;  1IBX A;  4L2Y A;  3ZJT A;  4H2A A;  2GRI A;  2XNA C;  4XDD A;  4DHZ B;  2N9E B;  2GBR A;  3H6N A;  2DEN B;  1LO5 D;  5D94 A;  4ZRI A;  1YX5 B;  4ANW A;  1FIQ A;  5J17 A;  2KX3 A;  3WCQ A;  1PQS A;  5DPS A;  4RF0 A;  3NS1 A;  2FNJ B;  3U8Z A;  3L16 A;  3PGE A;  1P0R A;  2IJ0 A;  1WGH A;  2WXO A;  4FJZ A;  2AQ1 B;  4PS3 A;  2G9H D;  2LXC A;  2DNF A;  1WMH B;  3B0A A;  1JW9 D;  4AWJ A;  1V2Y A;  5FR6 A;  2WLB A;  4KIK B;  1CJE A;  1WRD B;  3I5J C;  1IGD A;  3R2I A;  2KMM A;  2PTL A;  3HVZ A;  1FNU A;  3P4P B;  2W3R A;  3VUX A;  1R4N I;  1P3Q U;  2WX1 A;  4K7W A;  1S1Q B;  1WF9 A;  3VDZ A;  1I4P A;  3Q14 C;  4MAC A;  4A20 A;  3AE1 B;  3Q8A A;  1TGZ B;  3MC8 A;  5GXG B;  1RFK A;  1YNT E;  3C19 A;  2JZZ A;  2KLG A;  4HDO A;  3L13 A;  1QF6 A;  2KKC A;  1N61 A;  5LLI A;  2MX2 A;  3RYT A;  4W9F A;  4DQO C;  2JYT A;  4BKS D;  2LVO A;  1N60 A;  2K8C A;  3UF8 A;  4ZRK A;  1V9J A;  3A1Q B;  3NVY A;  4M00 A;  2MBH A;  4PK1 A;  1EO6 A;  1P98 A;  3ALB A;  4N6E B;  4GDK B;  3AMZ A;  1WWT A;  2BWF A;  3ZNI D;  1EU3 A;  3EA6 A;  1WXA A;  1SB3 C;  3SU8 X;  4US8 A;  1WE6 A;  2KD0 A;  1GJZ A;  5E6J A;  1MG4 A;  3V3X A;  1TTN A;  4CYE A;  2IGH A;  1QKZ A;  1SEB D;  2JQR B;  4LCD E;  4KKJ A;  3RFZ B;  3PRE A;  1VJK A;  1E7P B;  3KQ4 A;  1WXQ A;  2OJW A;  3BVG A;  3HM6 X;  1V5O A;  3Q2A C;  2KWV B;  3MJW A;  1IP9 A;  3NOB A;  4RF1 A;  4NAW B;  4IKG A;  2G3Q B;  2IGG A;  2J52 A;  3ZUN A;  3AEA B;  2IDY A;  1YMH E;  5BMH A;  3VHT C;  2LAS A;  1WH3 A;  4AUQ C;  1HA5 A;  3VRB B;  2KQS A;  3H8H A;  5BMI A;  1Y8R C;  2MLB A;  3KLS X;  5JZE B;  3UGB B;  2EMS A;  1ET6 A;  4KX6 B;  4P6V F;  1WX8 A;  1PFD A;  4HPP A;  1FEH A;  2CKH B;  4ZRQ A;  1E9M A;  3AU5 A;  2GB1 A;  4LDT D;  2KTR A;  1TS2 A;  3RPF C;  1ZXH A;  3NZU A;  4NNJ B;  1S3S G;  3ENE A;  1GC7 A;  3ZRC A;  2X8X X;  2LZ6 A;  3QJZ A;  3QHT A;  4RM8 A;  1P1A A;  1NVI D;  1JML A;  3ZXV A;  1PGA A;  3IT6 B;  3R8B A;  1WY8 A;  5E6N A;  1E8Z A;  4I6N B;  2KAC A;  2BW2 A;  3E9S A;  4PYZ A;  1P7E A;  4IW0 A;  1IPG A;  3VH4 B;  5DCN A;  4BVU C;  4AOF A;  2REX A;  3DVN V;  1L0Y B;  4HEA 1;  4WQM A;  4OHJ A;  4C4V B;  5C2T B;  1HTO A;  5AZH A;  3ZLZ A;  1D5X C;  4MDK E;  1J19 A;  1Z5S B;  4RM9 A;  2IGD A;  2QSD A;  3AE8 B;  2BB5 A;  3VQI A;  3TJP A;  1DGJ A;  2I1J A;  1MHH E;  2OJR A;  4KDL B;  2LGD A;  2W82 A;  3LDZ E;  2KFJ A;  2WHI A;  3IG3 A;  3DDC B;  4M8M A;  2I1K A;  4ICU A;  1N5W A;  1F52 A;  4FA6 A;  2JVC A;  4MGY E;  1AYF A;  3DHH C;  3IVF A;  3N20 C;  4KVG B;  5HG2 A;  4FUL A;  2KWD A;  1C76 A;  1KJT A;  2K6Q A;  2RPQ A;  2WDT B;  5CHV C;  2LEK A;  3MJ5 A;  3SD5 A;  3APF A;  2LVQ A;  3VUW A;  4W9E A;  3DBL I;  2QDF A;  1N63 A;  1T3Q A;  2O6V A;  1WZ3 A;  4E3C A;  4W9C A;  1E8W A;  1TKE A;  4EKU A;  1TS5 A;  3PZ7 A;  2LI5 A;  3X0W A;  3SFD B;  4EOY A;  4JWS C;  3VVW B;  3BII D;  2O2V A;  3R3M A;  2MBE A;  4WWP A;  2KFK A;  4GOC A;  2CJN A;  1UF0 A;  2ZJD A;  3W1Y A;  4ANX A;  4W9D A;  2PPH A;  3ZYY X;  5JHA A;  1ESF A;  2H88 B;  3BWU D;  2DZM A;  4JGH B;  3QCA A;  4WJN A;  2VZK D;  2KOX A;  4RFB A;  3NJT A;  4CHK A;  2RSU A;  4P1B C;  2NVU I;  1V80 A;  3ZO5 B;  2PKO A;  1LFD A;  3PZD A;  1SJE D;  3IXS A;  3RNG C;  3ZTC A;  1EF5 A;  3JYU A;  1A5R A;  2UYZ B;  4XYC A;  3AEE B;  3DQV A;  1SXT A;  2CS4 A;  3M3J A;  3HRD D;  5TSS A;  2EEL A;  2NMQ A;  3FKY A;  1MJD A;  3LXF A;  2G1E A;  3MC9 A;  3B9J A;  4YT0 B;  2YLM A;  1WJU A;  1RRB A;  2V0G A;  3KUD B;  4K7U A;  4F1S A;  2D07 B;  3C0R B;  3NG0 A;  2WDR B;  1D5Z C;  4ASW C;  4BKT A;  4NAM A;  1OEY J;  2MW5 A;  3KYD D;  1K52 A;  3BYY B;  1KH0 A;  2WDQ B;  4M8N A;  4XGA B;  5KHO A;  1UGJ A;  2M17 A;  3EEC A;  2KDF B;  1TS3 A;  1YQ4 B;  1VRA B;  1YJJ A;  2MH7 A;  4LNF A;  2WWZ A;  3IBE A;  3TSS A;  4W9L A;  1CK1 A;  2G45 B;  1IUE A;  2HTH A;  2QEJ C;  2V9H A;  1IGC A;  3PLU A;  2KYW A;  3APD A;  5AZG A;  2IPK D;  3QQ8 B;  3UIO B;  4ZHP A;  3DBR B;  4W9J A;  3AE7 B;  4JL9 A;  2MWS B;  3H7P B;  3CIR B;  1AAR A;  3HK0 A;  3TEX A;  4BKS A;  5FK9 C;  3APC A;  1GNU A;  2BF8 B;  2VH2 A;  2WXM A;  2ZW1 A;  4LJP B;  1V1P A;  3A9K B;  2KQ7 A;  2KWC A; 
#chains in the Genus database with same CATH homology
 4PYU A;  1IYF A;  4K81 A;  1WXS A;  1KLV A;  5J18 A;  3IHP C;  3VAW A;  2IO1 B;  4B95 A;  4ICV A;  1WM2 A;  4IM0 A;  4MGK E;  2NPT B;  3N32 A;  2NBW B;  4MJS B;  2KWU B;  4W9G A;  4HCN B;  4DBG A;  3ECI A;  3B1L X;  4E71 A;  3VXW A;  2JXX A;  1V86 A;  4HPM B;  4W9H A;  3EFU A;  4JQW C;  5GMV A;  3V6C B;  3ZNZ B;  4DDG D;  4HXD A;  3WA0 A;  2BKR B;  4MJS A;  4EZJ A;  2NBU A;  4KSL C;  3PHW B;  1SIF A;  1UZX B;  2CHX A;  2UWQ A;  4GXB A;  2FCM A;  1E5W A;  3S2A A;  3RUL A;  4HVB A;  2CU1 A;  2D2Q A;  4GN1 A;  2L0F A;  2HJ8 A;  3ZTD A;  1OTR B;  3KVF B;  1LM8 B;  1E90 A;  4CO7 A;  2N4F A;  2MBO A;  3QAQ A;  5L95 C;  4DHZ B;  2MQJ A;  2N9E B;  2J7Q B;  3X23 A;  3SDL C;  4ANU A;  2G4D B;  2NS5 A;  2PE6 B;  2GBR A;  3H6N A;  3AU4 A;  1WIA A;  2DEN B;  2KJH B;  3WAO A;  5D94 A;  4HLE A;  4ZRI A;  1YX5 B;  4ANW A;  3DBH I;  1E8X A;  5J17 A;  2KX3 A;  3V60 A;  3H7S A;  3DVG X;  2AEH A;  1E7U A;  1WR6 E;  2B3A A;  1PQS A;  5DPS A;  3K9P B;  5IA7 A;  4TUU A;  1WMH A;  2KVR A;  3SHQ A;  2FNJ B;  3U8Z A;  3L16 A;  3PGE A;  1P0R A;  1WGH A;  4GU2 A;  4BFR A;  4MGZ E;  2KC2 A;  4FJZ A;  1WGD A;  4PS3 A;  3VTV A;  2N9X A;  2LXC A;  2ZCC A;  2L3Z A;  2N7D A;  4FAD A;  1WYW B;  4HPL B;  2JY6 A;  4KZC A;  2IY0 B;  3RZW C;  4NPN A;  3VTU A;  4B6W A;  1WMH B;  3B0A A;  2OOB B;  2D3G A;  3EC8 A;  4AWJ A;  3UQB A;  1I35 A;  3TCA A;  1V2Y A;  5FR6 A;  2JRI B;  4IWQ A;  4KIK B;  4X57 B;  1WRD B;  3AI5 A;  5D6J B;  3ZW3 A;  4B9K A;  4G0N B;  3DCG A;  3AXC A;  1WJ6 A;  2IY1 B;  4IWO A;  5CHW A;  1V6E A;  2DX5 B;  3QAR A;  5DPR A;  1ISN A;  1YX6 B;  2JT4 B;  4HK2 A;  2W9N A;  3QIJ A;  2MCN B;  4II2 B;  2N7E A;  2LXA A;  2ZCB A;  3P2B A;  3VUX A;  1R4N I;  1P3Q U;  2WX1 A;  1FXT B;  4K7W A;  5EDS A;  1S1Q B;  1WF9 A;  3VDZ A;  2KC1 A;  4A20 A;  4WJP A;  4RMA A;  3VTW A;  3UIN B;  5LXH A;  4KSK C;  3L10 B;  2PE9 A;  3A9J B;  2M4N A;  1WFY A;  4A3P A;  3M95 A;  1TGZ B;  1YQB A;  2KMC A;  4EZL A;  2DYB A;  3NHE B;  2CHZ A;  4KIK A;  3WAP A;  2ZNV C;  2JZZ A;  2KLG A;  4HDO A;  3L13 A;  4TV3 A;  2KKC A;  2Z0D B;  3OJ4 B;  5TR5 A;  4LDT B;  3TIX A;  2BWE S;  4WQO B;  2ASQ A;  2DZI A;  2PEA A;  5CX3 A;  5LLI A;  1WZ0 A;  2MX2 A;  3RYT A;  4FN2 A;  2FUH B;  3PRZ A;  4W9F A;  1RFA A;  4KDI C;  2LVP A;  3L17 A;  5CTR C;  4BKS D;  2LVO A;  2K8C A;  4NQL B;  2C60 A;  3UF8 A;  1Z2M A;  3D32 A;  4ZRK A;  1V9J A;  1Q1O A;  3QC8 B;  2Y5B B;  3A1Q B;  3DVG Y;  1GG3 A;  2MBH A;  1EO6 A;  3T9L A;  2ZZP B;  1P98 A;  3ALB A;  1TBE A;  4GDK B;  2RR9 A;  1WXM A;  2BWF A;  4NJ7 A;  3ZNI D;  1WXA A;  2JWZ A;  1E7V A;  5AEK B;  3SU8 X;  3H7P A;  4E74 A;  2DYO A;  1WE6 A;  2KD0 A;  1GJZ A;  3EHV A;  3DBR I;  1SE9 A;  4W9K A;  3A4R A;  3PVL A;  4A3O A;  3TL5 A;  1Q0W B;  2HD5 B;  4BKG A;  1TTN A;  3ZVV A;  5KHQ A;  3ML9 A;  4CYE A;  4MH0 E;  4IG7 B;  2LRW A;  2IYD B;  4LCD E;  4I6P A;  1BT0 A;  3PRE A;  3L54 A;  4ZDV A;  3HIZ A;  1L2N A;  4EFO A;  3IFW B;  3HM6 X;  3VFK A;  1V5O A;  1V5T A;  2KWV B;  1WM3 A;  2IO2 B;  1XQQ A;  3MJW A;  3R66 C;  5JHB A;  1IP9 A;  1F9J A;  3NOB A;  4HJK A;  1C3T A;  2KJ6 A;  4FHJ A;  4WJO A;  3PRP B;  4FJV B;  2YVC A;  4NAW B;  2G3Q B;  2K8H A;  2R2Q A;  1KM7 A;  1GC6 A;  3H9D A;  2AL6 A;  2ZVN A;  5BO4 B;  3ZUN A;  5JH5 C;  2JPH A;  3OJ3 A;  3VHT C;  1UD7 A;  1WH3 A;  2LAS A;  3LJ3 A;  3ZNG C;  4W9I A;  4AUQ C;  2KQS A;  2KDI A;  1UH6 A;  1UBI A;  4PS8 A;  2KN5 A;  1Y8R C;  3H1U A;  4XX5 A;  2JUO A;  2MLB A;  4I6L B;  5JZE B;  3UGB B;  2EMS A;  3KW5 B;  3PSE B;  3ZDT A;  2KTR B;  3CSF A;  1WX8 A;  3L0W B;  2A4Z A;  2WX0 A;  3NY5 A;  1XD3 B;  2CKH B;  2JZ3 B;  2CHW A;  2K25 A;  1K8R B;  2MBB B;  3VUY A;  1X1M A;  3L08 A;  4G50 A;  3AU5 A;  5LXI B;  1OEY A;  4LDT D;  2KTR A;  4DHZ E;  2LGY A;  3TBL D;  1LQB A;  3NZU A;  4NNJ B;  5G2N A;  3B08 A;  1S3S G;  4K7S A;  3ENE A;  1GC7 A;  2BGF A;  3ZRC A;  3M63 B;  2DZJ A;  2LZ6 A;  3QJZ A;  3QHT A;  4RM8 A;  2ZEQ A;  1P1A A;  2IO3 B;  3BIN A;  5C1Z A;  3WAL A;  4GMV A;  2MA9 B;  4IUM B;  1T0Y A;  1WY8 A;  4G3X B;  2LRU A;  2FID A;  2VRR B;  5E6N A;  4YL8 A;  1JRU A;  1E8Z A;  4I6N B;  2KHW B;  1ZGU B;  1G6J A;  4PYZ A;  3QWZ B;  3CST A;  4FHK A;  4IW0 A;  3PRM B;  3GOE A;  1IPG A;  2PJH A;  2KLC A;  3JSV A;  5DCN A;  3VH4 B;  4BVU C;  4AOF A;  2REX A;  3DVN V;  4KZ0 A;  4IM2 A;  4XC2 A;  5E6P A;  4OVU A;  4DWF A;  3K9O B;  4NJ6 A;  2M0X A;  4EEW A;  4GGQ A;  2GBM A;  2K39 A;  2O2V B;  1P9D U;  3PHX B;  5AZH A;  4TQ0 A;  2IBI B;  2KXJ A;  3DPD A;  3ZLZ A;  1WR1 A;  2C7H A;  3KUC B;  2KK8 A;  3QA8 A;  1J19 A;  1Z5S B;  4MDK E;  2KX0 A;  2J0K A;  5D7G A;  2IZV B;  4LJO B;  1RLF A;  4KV2 A;  1MG8 A;  4RM9 A;  4AJY B;  3O65 B;  3ZDM C;  3ZRF A;  2DHZ A;  3MTN B;  2DAF A;  2FCS A;  4M0W B;  3VQI A;  4ANV A;  4GDK A;  4DHJ B;  4URK A;  3TJP A;  2LUE A;  2Z0E B;  2O6V B;  2L0T A;  2I1J A;  2G4S A;  3BY4 B;  4GIV A;  2OJR A;  4KDL B;  2LGD A;  3LDZ E;  2ZNV B;  3VH3 B;  2KFJ A;  3IG3 A;  3W1S C;  3I3T B;  4P7I A;  1J0G A;  3GZN I;  3DDC B;  1L7Y A;  4M8M A;  2C5L C;  2I1K A;  4ICU A;  4DDI D;  5AZF A;  3RD2 A;  3R7Q A;  3T8M A;  4FA6 A;  4HDQ A;  2JVC A;  2MBQ A;  4MGY E;  2EKE C;  2LGX A;  4KVG B;  3IVF A;  2K6D B;  1C1Y B;  4FUL A;  3W1S A;  1KJT A;  3JVZ X;  2K6Q A;  2N9P C;  2RPQ A;  2WDT B;  2V1Y A;  1CMX B;  3OAW A;  5CHV C;  4FLH A;  2J0M A;  3R7R A;  2BPS A;  2D11 A;  3SD5 A;  3APF A;  2KO3 A;  4NAW A;  2LVQ A;  3VUW A;  4BOS C;  1TZ1 A;  4II3 B;  4W9E A;  2AWT A;  3DBL I;  2LWP A;  3N30 A;  3A9K A;  1H8C A;  3ZIM A;  2O6V A;  4MSQ B;  1WJN A;  2L76 A;  1WZ3 A;  1GUA B;  4E3C A;  5CHF A;  2IO0 B;  2C7N B;  1D3Z A;  2XEW A;  4W9C A;  1E8W A;  4EKU A;  2KTF A;  2V3S A;  1WXV A;  1OGW A;  1HE8 A;  1VD2 A;  2DZK A;  3DBS A;  2DAJ A;  2LI5 A;  4MGI E;  3RUI B;  1UBQ A;  1QZE A;  1XT9 B;  2XBB C;  1NI2 A;  3X0W A;  2GMI C;  4JLC A;  1VCB A;  4GDL B;  3WAM A;  4EOY A;  2BKF A;  3VVW B;  1I42 A;  2DYM A;  4OVV A;  2C9W B;  2O2V A;  3RCZ A;  3R3M A;  3PS6 A;  2MBE A;  4GDL A;  2KFK A;  4WWP A;  4GOC A;  1R4M I;  3W1Y A;  2ZJD A;  4BOZ B;  4ANX A;  4W9D A;  3PLV A;  1WX9 A;  3Q3J A;  2J0J A;  3OLM D;  2NR2 A;  3QX1 A;  2PPH A;  4ZRJ A;  5JHA A;  2JF5 A;  2QHO A;  2BYE A;  4NQK E;  1WGG A;  2ZPN A;  3UIP B;  3V61 A;  1ZKH A;  4WWO A;  2FIF A;  2DZM A;  4JGH B;  4EUT A;  3QCA A;  1WJ4 A;  4WJN A;  2ZPY A;  4K1R B;  2GBJ A;  2KOX A;  3A33 B;  3PV1 A;  4CHK A;  3QK0 A;  2RSU A;  1NDD A;  4MSM B;  4TQ1 A;  2FCQ A;  4GB9 A;  4WJQ A;  1NBF C;  1YJ1 A;  3RT3 B;  2NVU I;  1V80 A;  3ZKJ C;  3ZO5 B;  2C7M B;  5DPW A;  1LFD A;  1YD8 U;  3PZD A;  5G55 A;  3TMP B;  2GBN A;  4DK5 A;  4FBJ B;  3ZTC A;  3HHM A;  3DVN U;  2FAZ A;  2KDB A;  1EF5 A;  3JYU A;  3AUL A;  4HCP B;  4DHJ D;  1A5R A;  2KDE B;  2UYZ B;  2MP2 A;  1J8C A;  2O6V D;  1ZW7 A;  3DQV A;  5HKH A;  2NBV B;  1KOT A;  2CS4 A;  3M3J A;  3V62 A;  2BYF A;  4F7Z A;  2L8J A;  3A9J A;  5J2R A;  1SGH A;  2EMT A;  2XK5 B;  3KYC D;  3ML8 A;  2MRP A;  5L83 A;  1UEL A;  5D2M B;  2LD9 A;  1EUV B;  3ZNH B;  2K1F A;  2KZR A;  4XZ4 A;  2YLM A;  1WJU A;  2FCN A;  1WE7 A;  2ZVO A;  4TKN A;  2XK5 A;  1RRB A;  1OQY A;  2WYQ A;  3KUD B;  2CR5 A;  2BYV E;  4K7U A;  3HM3 A;  3KUZ A;  3U7D A;  4F1S A;  2D07 B;  2NCN A;  3C0R B;  4J6I A;  2GBK A;  4AJW A;  4IM3 A;  2N1W A;  4HWI B;  4ASW C;  5DPT A;  1WI0 A;  5E6O A;  2L7R A;  4WWN A;  4BKT A;  1OEY J;  2MW5 A;  3KYD D;  3Q3F A;  2MSE D;  1YIW A;  2MP2 B;  2AL3 A;  4M8N A;  2JRH A;  1WGY A;  4MEL A;  2R2O A;  2LJ5 A;  5KHO A;  2M17 A;  2NPT A;  3EEC A;  2KDF B;  2L05 A;  1M94 A;  2A5U A;  3WIM A;  3RZF A;  2N1V A;  3KH0 A;  1UGM A;  1V81 A;  2GOW A;  2WWZ A;  3IBE A;  3CMM B;  3JSV B;  4IC7 B;  4MEM A;  2L00 B;  2Z59 B;  4JIO U;  3JW0 X;  3V6E B;  4W9L A;  2G45 B;  2KJR A;  1E8Y A;  1U4A A;  3PT2 B;  2HTH A;  3NS8 A;  4MM3 A;  3PLU A;  3NZS A;  2M8S A;  3A4S C;  3APD A;  4GSW A;  2V4L A;  3N3K B;  2K8B A;  5AZG A;  4BBN F;  3UQA A;  2RD0 A;  3CF6 E;  1WX7 A;  3DOW A;  2KFK B;  4NY0 A;  1LXD A;  3QQ8 B;  3M62 B;  4FJY A;  3UIO B;  4F8C B;  3WAN A;  2KNB A;  2RGF A;  4N9F 4;  1EF1 A;  4W9J A;  4JL9 A;  2MWS B;  4EZK A;  3U30 A;  3H7P B;  1AAR A;  3HK0 A;  4ZYN A;  1Q5W B;  3ONS A;  3PTF C;  4IWP A;  4BKS A;  3APC A;  2KAN A;  2M1M A;  1GNU A;  4PS7 A;  1RAX A;  2BF8 B;  2HE7 A;  4G11 A;  2AYO B;  4DXA B;  1WGR A;  1V49 A;  3PPA A;  2KMA A;  5C23 A;  4AP4 C;  4LJP B;  4WAA A;  3A1Q A;  4BBN C;  2D10 A;  3A9K B;  2KQ7 A;  1H4R A;  2KWC A;  3MHS D;  5IAA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...