4E71A

Crystal structure of the rho gtpase binding domain of plexin b2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
90
Chain Sequence
EYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRPDSVVLEWRPSTAQILSDLDLTSQRWKRVNTLMHYNVRDGATLILSKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plexin-B2
publication title Crystal structure of the RHO GTPASE binding domain of Plexin B2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 20
structure length 90
sequence length 103
ec nomenclature
pdb deposition date 2012-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4e71A00
3VUYA 1EUVB 3HM6X 2DZJA 2M0XA 4W9LA 1BT0A 1E8YA 3CSFA 4M0WB 4EKUA 4PYUA 2KZRA 4PS7A 1M94A 2DZIA 5E6NA 1GNUA 2C9WB 3SDLC 3VQIA 3R66C 1D3ZA 2KN5A 1WGHA 3IHPC 2KTRA 3H1UA 2D07B 2MBEA 4EZLA 2NBUA 4MEMA 2KO3A 4PYZA 4W9FA 5DPSA 2C5LC 1KM7A 4TKNA 4A3PA 4DDID 4CO7A 2G45B 2FCQA 2GBMA 2OOBB 2N7EA 3AI5A 1V2YA 2HTHA 3HIZA 4G11A 4PS8A 2L76A 1UBQA 1G6JA 1K8RB 4W9IA 2LZ6A 4RMAA 2ZVOA 2MQJA 3UIPB 5LLIA 5JZEB 3QCAA 4NNJB 4ASWC 1LM8B 2JXXA 3L17A 2LXCA 4YL8A 1WZ0A 1IPGA 1KJTA 2MX2A 3L0WB 5JHBA 3PGEA 1KOTA 3ZRCA 4FULA 5AZHA 2LWPA 3ZIMA 1V9JA 2AEHA 3I3TB 4K7WA 1KLVA 2J0MA 1WGGA 4FJYA 2BYVE 2AL6A 1H8CA 3AU4A 2BWES 5DPTA 3VTWA 1R4NI 3PRPB 2HD5B 2LD9A 4EEWA 3H7SA 2FCMA 2KDFB 3KYCD 3SD5A 3C0RB 4LDTB 4LJOB 4FJZA 2J0KA 2KC1A 2FAZA 5JHAA 2JZZA 3RCZA 4MDKE 2L0FA 3VTUA 3PREA 4GOCA 4ZDVA 2WWZA 3ZLZA 3PPAA 2JWZA 3PSEB 3WIMA 1WGDA 4MGKE 5L83A 3PHXB 3KW5B 1Q0WB 5E6PA 2LXAA 1XD3B 4G0NB 1WJUA 1C1YB 2FNJB 3QAQA 4W9HA 4E3CA 1Q1OA 3BINA 4TQ1A 1GJZA 4KIKB 3UINB 4KIKA 2NVUI 4OVVA 1S3SG 4ZRKA 2XK5A 3V6EB 3OJ4B 2QHOA 3VFKA 1WR1A 2KQSA 2IYDB 2K6DB 4FN2A 4WAAA 1I35A 1VCBA 1WE7A 2GBRA 3LJ3A 3L10B 1WGRA 3KUDB 3A9KA 3QHTA 3ENEA 1WGYA 2K8BA 2IO1B 2MRPA 2KXJA 2Z0DB 2N7DA 3AXCA 3ONSA 1YIWA 3PLUA 2N1WA 3N3KB 3DBHI 4DHZE 4HLEA 4AJYB 2L3ZA 2FCNA 1MG8A 2N9PC 2V1YA 3CF6E 4K81A 3PVLA 2I1JA 1JRUA 5HKHA 3WALA 4W9KA 4ANXA 1V6EA 2KTFA 4GB9A 4ZRJA 4KDLB 4HCNB 4MJSB 3N32A 3N30A 2WDTB 4RM9A 2BGFA 3VVWB 3M3JA 3ZRFA 3DOWA 2LI5A 3JSVA 4XZ4A 2DYOA 2MBQA 1HE8A 3V6CB 2JVCA 4DXAB 4IWOA 1E5WA 5CTRC 4I6PA 3IFWB 4MGZE 2A4ZA 5CHFA 2LVQA 3QIJA 1V5OA 1P1AA 2A5UA 2O6VA 4I6LB 4IG7B 2KKCA 2LJ5A 3ZKJC 4IM3A 4GDLB 5CHVC 1E7UA 2K6QA 4WWNA 3W1SA 4B95A 2IY1B 3R7QA 4BFRA 4HDOA 4BKGA 1P0RA 2IO0B 1E8XA 4II2B 3UQAA 1A5RA 5AZGA 3JW0X 3B08A 4NAWB 2D11A 2EMSA 4MGIE 1I42A 1SE9A 2CS4A 3DQVA 3A4RA 2HJ8A 1YJ1A 2O2VB 2MSED 2Z59B 1FXTB 3K9OB 1H4RA 4J6IA 4WWPA 2DZKA 2KLCA 4IWPA 3A4SC 3PHWB 3R3MA 1WFYA 2LGDA 4IW0A 4NY0A 3U8ZA 2ZPYA 4TUUA 4E74A 1WMHB 3PZDA 1WMHA 2L7RA 2ZCCA 4W9GA 4P7IA 2FIDA 3IVFA 5C1ZA 4IWQA 2REXA 4MELA 1AARA 2ZNVB 4JGHB 2KJHB 4KZCA 3U30A 4RM8A 1VD2A 2XBBC 2EKEC 2PE9A 2KDBA 3ZNID 2XEWA 5J17A 4JL9A 3EECA 3TJPA 2DX5B 1UBIA 2PEAA 1YD8U 2LRWA 2UWQA 3KH0A 3RT3B 4BOSC 4XC2A 2KNBA 4DHJD 4FLHA 2HE7A 4W9EA 2PPHA 3WA0A 4ZRIA 4I6NB 5GMVA 5AZFA 4ANWA 2MA9B 3ZDMC 2DZMA 2EMTA 1E7VA 4GN1A 2KQ7A 4BKTA 2CHXA 2WX1A 2KMAA 4JLCA 3A9JB 2RGFA 5D6JB 2JUOA 5D2MB 3UIOB 2VRRB 4BOZB 2NBVB 3V62A 4EZKA 3QC8B 2J7QB 4FHKA 3X23A 4AOFA 2DYBA 2AL3A 4GGQA 3HM3A 1J19A 1WM2A 2YVCA 4KZ0A 3O65B 1Q5WB 4NQKE 4NPNA 5CX3A 2M17A 2KDIA 5IAAC 4BKSD 2R2OA 1V5TA 4KVGB 2G4DB 4JIOU 2MLBA 4MGYE 5DCNA 3PS6A 2DAJA 4B9KA 2LGYA 3V61A 3CSTA 3IBEA 3DBSA 3QK0A 3H7PB 3X0WA 2KWUB 2IY0B 1WX7A 3CMMB 1IP9A 4IUMB 3ZTDA 4WJQA 3ZNGC 4WQOB 2ZEQA 2FIFA 2ZVNA 3KUCB 2KX3A 3APCA 4E71A 3UGBB 5L95C 5LXIB 3ZUNA 4BVUC 3LDZE 4ANVA 4MSMB 1WXVA 3M63B 1YQBA 4WJOA 4CHKA 4DDGD 2ZCBA 4GDKB 4MSQB 3RZWC 3PLVA 2BYFA 4F7ZA 2BF8B 3EC8A 5FR6A 1TZ1A 3DBRI 4CYEA 4ZYNA 5EDSA 2KC2A 3SU8X 2BWFA 1EF1A 3DVGX 4EZJA 3B1LX 3ZNZB 4EOYA 1WX8A 3KYDD 3P2BA 2ASQA 3WAOA 2DENB 4W9DA 3AU5A 3H9DA 1OEYJ 1WXAA 2CR5A 2NR2A 4A20A 3VUWA 2L0TA 4LJPB 2G4SA 3PRZA 4WWOA 4HPMB 2GMIC 3R7RA 4MJSA 3A1QB 3SHQA 3M62B 4BBNF 1GG3A 2LVOA 1NDDA 2OJRA 3QQ8B 1R4MI 5KHQA 2KFKB 3DPDA 3NZUA 3W1SC 1CMXB 3ZDTA 1EF5A 1L2NA 2G3QB 2C7MB 2DHZA 1ZW7A 2JT4B 2MW5A 4LDTD 1WI0A 3U7DA 3OJ3A 5J2RA 2GBKA 4PS3A 4LCDE 4M8NA 2PJHA 2LASA 2R2QA 2RD0A 5C23A 3GZNI 2L05A 4DWFA 1IYFA 4GDLA 2MCNB 3DVGY 2C7HA 4F8CB 2PE6B 3VH4B 2AYOB 3WAMA 1V49A 1C3TA 2K25A 3T8MA 2BPSA 3RZFA 2K1FA 4JQWC 2MBHA 5DPWA 2FUHB 4IM0A 2KMCA 4GSWA 3DCGA 4II3B 4NAWA 4FBJB 2V4LA 2J0JA 3JVZX 4MM3A 1WYWB 4XX5A 2O2VA 1UELA 4FADA 5IA7A 3ML8A 1OTRB 1TGZB 4TV3A 3S2AA 2IZVB 2NS5A 2CU1A 3UF8A 4HCPB 4AUQC 1E8WA 1WM3A 5D94A 1SGHA 4AP4C 2B3AA 1UGMA 2K8CA 2YLMA 2MP2B 4FHJA 5AEKB 3QARA 4K7UA 5LXHA 2JY6A 2KOXA 2GBJA 2NCNA 5E6OA 3VDZA 2WYQA 2V3SA 1X1MA 3RUIB 2CHZA 4HVBA 4GMVA 3VAWA 3QWZB 4DBGA 3TL5A 3HK0A 1YX6B 4OVUA 3ZW3A 3GOEA 4GU2A 3JYUA 1WJ6A 1XQQA 3APDA 4HXDA 2CKHB 2KWVB 2KTRB 2K8HA 3A33B 2MBBB 3A9JA 1SIFA 3K9PB 4K1RB 3B0AA 2N9EB 2FCSA 3BY4B 4M8MA 3MJWA 4HK2A 1YX5B 3MTNB 4A3OA 2KD0A 2MWSB 1P98A 2O6VD 2KANA 2M8SA 3V60A 4MH0E 3L54A 3M95A 4KV2A 4EUTA 3W1YA 3ECIA 1WX9A 1NBFC 4GXBA 2Z0EB 2I1KA 3QJZA 4ICUA 1RRBA 1OGWA 3MHSD 2BKRB 3NHEB 3VTVA 1UD7A 2D2QA 2L00B 2BYEA 2K39A 4URKA 3L16A 4FJVB 3NZSA 4HPLB 2JRHA 1V86A 3H7PA 3IG3A 2IO3B 1P3QU 1V81A 2RR9A 3RULA 1XT9B 1GC6A 3HHMA 4DK5A 3H6NA 2JZ3B 1WRDB 3UQBA 4KDIC 4AJWA 2KDEB 1E90A 1WIAA 5KHOA 4X57B 3ZNHB 4AWJA 2W9NA 4GDKA 4IC7B 4HDQA 3PT2B 4N9F4 2M4NA 2KWCA 4DHZB 3ALBA 3VUXA 1Z2MA 2ZJDA 5G55A 2IO2B 1T0YA 1WJ4A 3VXWA 2GOWA 2NPTB 3NY5A 2GBNA 2NPTA 4W9JA 3TIXA 3RYTA 3EHVA 3TMPB 4K7SA 2D10A 4NJ6A 2UYZB 2WX0A 1QZEA 5BO4B 3TBLD 3T9LA 2NBWB 3WANA 3D32A 2LRUA 1WE6A 4W9CA 2JF5A 2KHWB 2MBOA 4NJ7A 2KFJA 2N9XA 3RD2A 2IBIB 1UZXB 1WJNA 2KJRA 3DVNV 5DPRA 4KSKC 3ML9A 1J0GA 2XK5B 3KVFB 5D7GA 1WR6E 3A1QA 3VH3B 4FA6A 2LGXA 1GC7A 4G3XB 3L13A 2ZZPB 2KFKA 1RAXA 2KK8A 3DDCB 1GUAB 1TTNA 2ZPNA 3A9KB 3PTFC 3QA8A 2JPHA 4BBNC 1U4AA 1LFDA 1RFAA 1S1QB 2D3GA 2M1MA 2KVRA 3Q3FA 4GIVA 4IM2A 5CHWA 3WAPA 1E8ZA 3NS8A 2Y5BB 1WY8A 2KLGA 4HJKA 3OLMD 1NI2A 2L8JA 1PQSA 4DHJB 4B6WA 2N4FA 4G50A 3EFUA 1RLFA 1ZKHA 2C7NB 1UH6A 2C60A 3Q3JA 3ZVVA 4EFOA 5JH5C 2DYMA 1WZ3A 4NQLB 3AULA 1J8CA 3DBLI 1L7YA 2KX0A 2JRIB 4KSLC 3ZO5B 3ZTCA 1WXSA 3JSVB 4TQ0A 2ZNVC 1Y8RC 3L08A 4WJPA 5G2NA 2CHWA 1OQYA 2RPQA 5TR5A 2BKFA 1P9DU 1Z5SB 1LQBA 1LXDA 1WF9A 4ANUA 1V80A 2AWTA 4HWIB 1WH3A 1TBEA 2N1VA 2O6VB 3DVNU 3TCAA 1WXMA 3VHTC 5J18A 3NOBA 1F9JA 2LUEA 3KUZA 1ISNA 1OEYA 4BKSA 3PRMB 2DAFA 3QX1A 3OAWA 1EO6A 2MP2A 3APFA 2LVPA 2RSUA 3PV1A 1ZGUB 4WJNA 2KJ6A 4F1SA 4ICVA
chains in the Genus database with same CATH superfamily
1F52A 4B0EA 2M0XA 4M0WA 5E6NA 2L52A 2WXHA 2KAJA 1D3ZA 1WGHA 2KTRA 1E0ZA 4OHJA 4PYZA 2C5LC 3CWIA 2FCQA 3BK2A 1MI0A 3HRDD 2IGDA 1ZDXA 1V2YA 2HTHA 1TS4A 1JQ4A 1WGKA 1OQQA 4NNJB 2JU6X 4TSSA 1FNUA 4C56C 5JHBA 3PGEA 1KOTA 3ZRCA 4K7WA 1KLVA 1WGGA 2WU2B 4FJYA 2AL6A 2HD5B 1C9FA 3H7SA 2FCMA 1QOGA 3ZXRA 4LDTB 5JHAA 4GOCA 4JX1C 3Q8FA 4ZRQA 3PPAA 3IT6B 3PSEB 4AQ7A 1WGDA 4ZHOA 5L83A 1IUEA 5E6PA 3KQ4A 1XD3B 1HZ5A 1C1YB 4TQ1A 3BVMA 1V1OA 4RCOA 4ZRKA 1K52A 3VFKA 2K6DB 4J3OD 3GP7A 2XN9C 1I35A 1WE7A 3LJ3A 3AEBB 1F77A 3KUDB 2FUG1 4HEA1 2KXJA 2N1WA 3DBHI 2LJIA 4AJYB 1MG8A 3PVLA 3Q8AA 2GLSA 4W9KA 4KDLB 4MJSB 5HFYA 3TEZA 3N30A 2WDTB 3VVWB 2RPVA 3DOWA 3JSVA 4M00A 1HE8A 2PVGC 2JVCA 2A4ZA 4RF1A 5CHFA 3QIJA 4IG7B 4US9A 3OWEB 3ZKJC 4GDLB 1E7UA 4YTNB 3BK1A 1XLQA 3ZJUA 4RF0A 2PIAA 1T0RC 2D11A 3P4QB 4XWWA 1SE9A 1D5MC 2O2VB 5EE0A 3K9OB 1FXTB 1H4RA 2DZKA 2CU3A 2KLCA 1T5XD 4IWPA 1AW7A 4IW0A 3U8ZA 1I4XA 3NVWA 3NVVA 4P7IA 3IVFA 5C1ZA 4YTMB 4A6QA 1VD2A 2EKEC 5J17A 2XEWA 3TJPA 2PEAA 2LRWA 3RPFC 4BOSC 5D3IB 4ZRIA 1BUIC 2ICIA 2E3TA 5AZFA 4ANWA 1VLBA 5BMHA 4GN1A 3BVGA 4OW0A 2WX1A 2KMAA 3URYA 3I5JC 2D3CA 3UIOB 4BOZB 3V62A 2NTSA 2KT7A 4AOFA 2AL3A 3R8BA 3AE9B 4C7ZA 5CX3A 2M17A 5IAAC 3UQAA 2R2OA 4KVGB 4JIOU 4KX6B 4B9KA 3V61A 2IY0B 1C76A 3ZNGC 3CIRB 4WQOB 2ZEQA 5EE1A 2FIFA 3Q3MC 2KX3A 2VH2A 1MHHE 1WXVA 3M63B 1TKYA 4WJOA 2G1EA 4MSQB 4GDKB 3RZWC 4HRSA 1JALA 3EC8A 1EWCA 4CYEA 2KC2A 1MG4A 2INNE 1EF1A 1ZP0B 3DVGX 1UNSA 3W5VB 2ZW0A 4EZJA 4EOYA 1WX8A 4W9DA 4C4VB 3AU5A 3VRAB 3AE6B 1XLPA 2L0TA 3BYYB 4HPMB 4MJSA 3SHQA 4BBNF 3M62B 1GG3A 2LVOA 2ZW1A 4WWMA 3AEFB 1R4MI 5KHQA 1I4HA 4P16A 4LNKA 2C7MB 2J53A 2MW5A 2IPKD 4Q2JA 1PFDA 4PS3A 3BZDB 4LCDE 4M8NA 2QDFA 4GDLA 2MCNB 1OFFA 1D5ZC 2BS4B 2PE6B 5HHDG 2BW2A 2K25A 2BPSA 1D5XC 4IM0A 1FM0D 2KMCA 3DCGA 4GSWA 2V4LA 3MHZA 4RGNA 3JVZX 2O2VA 1UELA 4FADA 5IA7A 3Q6BA 2CU1A 3UF8A 4HCPB 2MJ3A 1E8WA 1I4RA 1CQVA 2KN4A 1SGHA 1TZOA 1UGMA 1EM7A 1JWAD 2YLMA 4FHJA 4B0MA 5AEKB 3QARA 5C3JB 4K7UA 2KQ4X 2NCNA 2WYQA 4EE2A 4HVBA 2CHZA 3GB1A 3VAWA 2H89B 1SJHD 4HKZE 3APDA 1HQRD 1XQQA 2CKHB 2K8HA 4P1CC 4M02A 2N9EB 4A3OA 2MWSB 1P98A 1P7EA 1J7AA 3L54A 1YJJA 1D4BA 3ECIA 1NBFC 4GXBA 5FKAC 2Z0EB 1RRBA 3N1YC 1IBXB 3O13A 2W82A 1MVKA 3MHSD 3NHEB 1UD7A 1VRAB 1QOAA 3MP9A 4FJVB 2WXRA 2WXJA 2IO3B 1V81A 4RGTA 2RR9A 1XT9B 1GC6A 1YNTE 3N9YC 3SFEB 3H6NA 2K0PA 2DWQA 2KMMA 4AJWA 2PW9A 2KDEB 2W9NA 4GDKA 3NZ3A 3PT2B 4WQMA 5BYSA 3RFZB 4LNFA 1V97A 1JWBD 1FFUA 1WJ4A 3VXWA 2NPTB 3TIXA 3GE3C 2GRIA 2UYZB 2LGIA 3LYYA 3TBLD 3T9LA 1N61A 5AUKA 3AEGB 3SEBA 3AE1B 3WANA 2MBOA 4WH4A 4C4VA 1ET6A 5DPRA 3ML9A 1FO4A 4DQOC 2ZZPB 4DDID 2ZPNA 2EKIA 1S1QB 2D3GA 4GIVA 1E8ZA 2Y5BB 1WY8A 1NI2A 2L8JA 3P42A 4H2AA 1UH6A 1NYQA 3AULA 1QLBB 1GOZA 3N20C 2N0SB 2WDQB 1Y8RC 4WJPA 1OQYA 2RPQA 2BKFA 1A70A 4HWIB 1WH3A 1WXMA 4WURA 4L1BA 3AE7B 1ISNA 3PRMB 4IOIE 1EO6A 2DLBA 1K50A 2LVPA 5FK9C 3PV1A 1YQ4B 4F1SA 2I38A 3VUYA 1EUVB 3DBHB 1SE3A 4W9LA 3IAS1 1E8YA 1NYRA 3CSFA 4M0WB 4EKUA 5BMIA 2W3SA 1FPYA 1QOFA 3IHPC 1WWTA 2WLBA 2UU7A 1FXIA 4MEMA 5DPSA 4S0RA 1KM7A 2G45B 2GBMA 2N7EA 3AI5A 3P4SB 3NS1A 1XLOA 1UBQA 2L76A 4RMAA 5LLIA 1IBXA 1TT5B 2IJ0A 1LM8B 2JXXA 4BAXA 2LXCA 1YOVB 1KJTA 3DHHC 3FC4A 5AZHA 2Y5CA 1V9JA 1ZPSA 4P6VF 2BWES 4CQNA 3EUB2 3PRPB 2KDFB 1HTQA 3SD5A 5IO9A 3W9CB 4FJZA 2J0KA 1E10A 2WGSA 4LTUA 3VTUA 3PREA 3OG5A 1PGAA 3WIMA 3PHXB 3KW5B 2GB1A 4ARIA 5AUIA 4W9HA 1ZXHA 1Q1OA 1GJZA 4US8A 5TSSA 4KIKA 3OJ4B 2QHOA 1WR1A 2KQSA 1ACCA 1I4QA 2IYDB 3NRZA 2WXPA 3L10B 2DBYA 4A8XC 4YSZB 1WGYA 1KH0A 2MRPA 4WAFA 3ONSA 3B2FA 4HLEA 4YT0B 2I1JA 3KLSX 4JPSA 2LGSA 3ZJTA 2KTFA 1QKZA 1N6ZA 3N32A 3HUIA 4RM9A 3V3XA 1C79A 3M3JA 1K53A 2DYOA 1KF6B 3V6CB 5IKCM 2INPE 4NJCA 1FIQA 2JSVX 2QC8A 4I6LB 2LJ5A 2PVOD 4IM3A 4WWNA 1P0RA 2IO0B 1A5RA 2N9KA 3B08A 4MGIE 1I42A 2BS2B 2CS4A 1JWMD 3RNGC 2IGHA 4RFBA 4WWPA 3A4SC 1E9MA 3HVDA 2ZPYA 2I2YA 4XYCA 1HZ6A 4OVZA 1ZXIA 2OEDA 4MELA 1TJEA 1R4MB 1FNWA 3Q8CA 2XBBC 2MJEA 2KDBA 3ZNID 3KH0A 2WDRB 2UWQA 3RT3B 2M19A 1JWUD 3P4PB 2Q5WD 1E7VA 2KQ7A 2CHXA 5IOIA 3ZQ4A 2RGFA 5D6JB 2VRRB 1ESFA 1V8CA 2FBWB 2NBVB 2J7QB 3X23A 2HJ1A 4GGQA 1CK1A 3HM3A 1J19A 3AB5A 2YVCA 1Q5WB 2LHDA 3P4RB 4YWGG 1SEBD 4NPNA 2KDIA 5DCNA 2DAJA 2INDC 3CSTA 3IBEA 3QK0A 2KWUB 1NEKB 2WHIA 5LXIB 3KUCB 4E71A 3UGBB 2X38A 5HG2A 4BVUC 1J7BA 1Y56A 1T6BX 4F7ZA 1WRIA 3NG0A 5FR6A 3RNFC 1TZ1A 3DBRI 2AQ3B 1ZE3D 3SU8X 4DXFA 2BVCA 2SAKA 5IN7A 1QQRA 3AN1A 3B1LX 2LMCA 1KRHA 3RI7C 3NVYA 1L6VA 4A20A 3R7RA 3A1QB 2OJRA 3AV8A 3DPDA 2RDHA 3W1SC 2YEPB 4ARCA 3AM9A 1C4CA 2HDEA 5J2RA 4BZAA 2NTTA 3ZYYX 2PJHA 2LASA 2RD0A 1IYFA 3SR6A 3DVGY 2C7HA 1C4PA 4S17A 3VH4B 4F8CB 3WAMA 1V49A 3C8YA 3RZFA 2K1FA 2MBHA 4JE3B 4II3B 4LNOA 3ML8A 1OTRB 2LEKA 2D3BA 2HTME 4N59A 3L4PA 4AS1A 1P7FA 1TS5A 1TY2A 5C2TB 1XXGA 4YTPB 2MP2B 1F1HA 1FRRA 4NZLB 2KOXA 3VDZA 5E6OA 2KACA 2V4IB 4L23A 2Z8LA 3TL5A 4MT5A 1TS3A 1EU3A 1XF5L 1PDXA 2LUMA 2MBBB 3A33B 2FCSA 3MJWA 3MTNB 1TY0A 2KD0A 3V60A 3DWGC 2QJLA 3W1YA 1WX9A 2N9LA 3VRBB 2D2QA 1FCLA 2K39A 1V86A 1DOIA 3R2TA 4L2YA 3MC9A 3LXFA 1SXTA 1T3QA 1E6EB 4KDIC 1DYQA 5I4DA 1GB4A 4AWJA 1YJIA 4IC7B 2J42A 3B2GA 1Z2MA 2ZJDA 1L5PA 2GOWA 3T3NA 3KWVA 4ITKA 4W9JA 3EHVA 3TMPB 1AYFA 4NJ6A 4K3BA 2YEPF 3VR9B 2NBWB 3VR8B 2LRUA 1WE6A 1N5XA 4NJ7A 3RD2A 2IBIB 3DVNV 2WXNA 2XK5B 5JXVA 2L83A 3A1QA 1WSPA 4FA6A 1GC7A 1RAXA 2KK8A 3SFDB 3A9KB 2MJDA 1LFDA 1RFAA 2M1MA 4IM2A 5CHWA 3WAPA 3NS8A 4IDIA 3BVZA 4WIPA 4B6WA 2N4FA 2WXMA 3EFUA 1ZDVA 1L4ZB 2C60A 4NQLB 1L7YA 1OQRA 3ZO5B 1CZPA 4OZCA 3ZTCA 1C77A 2ZNVC 2CHWA 1LQBA 1V80A 2AWTA 3AH7A 1TBEA 2N1VA 3DVNU 1LO5D 1I7HA 5J18A 1N63A 1J7CA 2KWDA 2OJWA 1STEA 3QX1A 2MP2A 4A55A 2RSUA 2SEBD 2OHFA 4KGRA 2PMVA 3AE4B 2DZJA 1FXAA 1BT0A 4ZYSA 3AE2B 4PYUA 2KZRA 4PS7A 1M94A 3VQIA 1GNUA 3SDLC 3R66C 2K22A 1T0QC 5EE9A 2D07B 4EZLA 2NBUA 2KO3A 2WXIA 1FRDA 4A3PA 4PS8A 3HIZA 1G6JA 1K8RB 4W9IA 2ZVOA 2MQJA 2CJNA 5JZEB 1PYWD 4ASWC 4YL8A 1WZ0A 2MX2A 3N1ZC 3L0WB 4FULA 4HPPA 2J0MA 2ONQA 2L32A 4HJGE 3AU4A 1H8CA 2LD9A 4EEWA 1XEEA 3IT4B 2FAZA 2DNFA 4KKIA 2QSDA 3RCZA 4MDKE 2L0FA 3FILA 4ZDVA 1JW9D 3AMZA 4MGKE 4C00A 1YQ3B 4E3CA 2EELA 4KIKB 4YSYB 3UINB 2NVUI 3H8HA 4OVVA 3Q3NC 2XK5A 3GE8C 4MACA 1KFYB 4FN2A 1F0ZA 1WGRA 3A9KA 3QHTA 1PUTA 1NENB 2Z0DB 2WXOA 2WU5B 2L3ZA 2FCNA 2N9PC 3CF6E 4K81A 1JRUA 5HKHA 1V6EA 3KWLA 4GB9A 1Q10A 4ZRJA 3ZRFA 2LI5A 4XZ4A 2MBQA 2H88B 2WDVB 4MGZE 3UI3A 4M01A 1IGCA 1P1AA 2KKCA 2N7JA 5G5HA 3MC0B 5MPOA 3DBRB 5CHVC 2K6QA 1I4PA 3W1SA 4B95A 2IY1B 1HXYD 4II2B 1E8XA 5AZGA 3JW0X 4NAWB 4IKGA 4O1NA 3IAM1 4MM3B 3A4RA 2HJ8A 4J6IA 2B76B 1EU4A 3R3MA 1WFYA 2LGDA 4MH8A 4E74A 1I4GA 4K3CA 3PZDA 1WMHA 4GLSC 2L7RA 4W9GA 2FIDA 4IWQA 1AARA 4QAYA 2ZNVB 2KJHB 1HA5A 4JL9A 3EECA 1QF6A 1UBIA 4XC2A 4DHJD 1SBBB 4I6NB 2K9XA 2MA9B 2DZMA 2EMTA 1QILA 2G9HD 3U7ZA 4DXGA 5T8IA 3RN9C 2BT6A 2JUOA 3QC8B 2DYBA 2W55A 4KZ0A 4OZBA 4RGOS 4RGMA 3U52E 2WXFA 1RYJA 4D2KA 4MGYE 2MLBA 2PKOA 3DBSA 4ACFA 1RM6C 3H7PB 1WYGA 3CMMB 3R2IA 3ZGZA 4IUMB 4TMAB 3DHIC 3APCA 5L95C 1ENFA 3RMKC 3RNBC 1YQBA 4JWUC 4DDGD 2BYFA 1L6UA 4ZYNA 5EDSA 2PTLA 1N60A 2RDBC 3IXSA 3ZNZB 1VZ7A 2ASQA 1L0YB 3WAOA 3H9DA 1WXAA 1QOBA 2M56B 2CR5A 4KGTA 4WWOA 2G4SA 2NMQA 2GMIC 3QQ8B 3NZUA 1M4VA 1CMXB 3FAHA 2G3QB 2DHZA 2JT4B 3U7DA 2GBKA 3P63A 2AQ1B 2R2QA 1JWSD 3GZNI 2L05A 4DWFA 2AYOB 2MH7A 5G5GA 1C3TA 5DPWA 2FUHB 1JROA 4NAWA 3EA6A 1YN5A 2WNMA 4MM3A 4XX5A 2QMTA 4TV3A 1C78A 3S2AA 1F2RC 2NS5A 3DWMA 4KGSA 1WM3A 1HTOA 4UDUC 4AP4C 1SE4A 2K8CA 1KLUD 2JY6A 1PGXA 4C7YA 1N5WA 2V3SA 4GMVA 5FR3A 2Y5PA 3QWZB 1KTKA 4DBGA 4OVUA 3ZW3A 3GOEA 1T0SC 4GU2A 3AEDB 3J9CA 4HXDA 2KWVB 5BMGA 1SIFA 3K9PB 4M8MA 4HK2A 1YX5B 4MH0E 2KYWA 4KV2A 4EUTA 4ICUA 2BKRB 3VTVA 2L00B 4LNIA 3NZSA 2JRHA 3H7PA 2AX5A 1VDVA 1P3QU 3RULA 3MJ5A 4P1BC 4REZA 2JZ3B 1WRDB 3LB8C 2V9HA 5KHOA 4YXDB 4X57B 3TEYA 1YN4A 4YSXB 4N9F4 2M4NA 4DHZB 3ALBA 3VUXA 3WCQA 1YN3A 2IO2B 5G55A 2JXTA 5GXGB 3BWUD 1FMAD 3NY5A 4K7SA 2D10A 4A90A 3D32A 3MFGA 4W9CA 2JF5A 2KHWB 2KFJA 3Q8EA 5EE3A 1WJNA 4XDDA 3KVFB 5D7GA 1WR6E 2KVZA 3VH3B 2LGXA 4G3XB 1VZ8A 3W5UB 1GUAB 1TTNA 1XCTL 5H8YE 2JPHA 3Q3FA 3W2DA 5LNK1 2J52A 3Q8BA 4DHJB 4G50A 3TEXA 1RLFA 3NJTA 1UUPA 3Q3JA 5JH5C 2TSSA 4EFOA 2BBCA 2DYMA 1WZ3A 2V3PA 3DBLI 3T3OA 2KX0A 1MFWA 2JRIB 4KSLC 4TQ0A 1RFKA 1TKGA 5TR5A 1P9DU 2VZKD 1WF9A 5BYQA 1ROEA 2O6VB 3TCAA 3NOBA 3KUZA 1OEYA 4BKSA 2DAFA 3APFA 1BXTA 1ZGUB 4WJNA 4R3DA 2WX0A 3HM6X 2QIEB 2K5PA 3ABVB 2DZIA 2C9WB 1VJKA 2KN5A 4XWTA 3H1UA 3AE5B 2MBEA 1UGJA 4W9FA 4TKNA 4CO7A 2OOBB 4G11A 2IGGA 2LZ6A 2W3RA 1SB3C 4ZRPA 3UIPB 2BYTA 3QCAA 3L17A 2IDYA 1IPGA 3I57A 4KKJA 3N1XC 4HROA 1HEZE 2LWPA 3ZIMA 3PZ7A 2AEHA 3I3TB 2BYVE 5DPTA 3VTWA 1R4NI 3KYCD 2AQ2B 3C0RB 4LJOB 4OZAA 4XDCA 2KC1A 3RNEC 2JZZA 4N6EB 1TKEA 3FILB 1L0VB 2WWZA 3ZLZA 2ACZB 2JWZA 1WXQA 3GS2A 4PK1A 1Q0WB 1XO3A 4N58A 1NI3A 2LXAA 4G0NB 1WJUA 2FNJB 3QAQA 3AE8B 3BINA 2WXQA 3Q14C 1S3SG 1B1ZA 3V6EB 1SE2A 4WAAA 1VCBA 2GBRA 3ENEA 2K8BA 2IO1B 2N7DA 3AXCA 1YIWA 3PLUA 3N3KB 4DHZE 2V1YA 3U2SC 3WALA 4ANXA 1VZ6A 2QILA 4HCNB 3AEEB 2BGFA 1MHXA 2LHEA 4DXAB 4IWOA 1E5WA 5CTRC 4I6PA 1ZUD2 2D5GA 3IFWB 2LVQA 3C19A 3I9V1 1V5OA 1SJED 2A5UA 1GB1A 2O6VA 1DOXA 1UWMA 1DOYA 1AN8A 1SIJA 3R7QA 4BFRA 4HDOA 4BKGA 5BYRA 4LNNA 2EMSA 3DQVA 1N62A 1YJ1A 2WP9B 2MSED 2Z59B 3PHWB 4NY0A 4TUUA 1WMHB 1SSNA 2ZCCA 1V1PB 2REXA 4JGHB 4KZCA 3U30A 4RM8A 1FFVA 2BS3B 2PE9A 1D6EC 5IP4D 2DX5B 1YD8U 1JCKB 2KNBA 4FLHA 2HE7A 4W9EA 2PPHA 3WA0A 5GMVA 2V3NA 3GZNB 3ZDMC 1R7SA 5E6JA 3TEWA 4BKTA 4JLCA 2Y3AA 3A9JB 1YMHE 5D2MB 4EZKA 2BTEA 4FHKA 2RMMA 3V05A 4PT5A 3B9JA 1WM2A 3O65B 1ET9A 4NQKE 2V0GA 2INCC 4XE0A 4BKSD 1V5TA 2G4DB 1MPEA 3PS6A 2WXLA 2LGYA 4A9AA 3I63C 3X0WA 1WX7A 2RDGA 1IP9A 3ZTDA 4WJQA 2ZVNA 1K51A 3ZUNA 3LDZE 4ANVA 4MSMB 2JQRB 1FCCC 4CHKA 2ZCBA 3PLVA 2BF8B 3U4EG 3PZ8A 3RNAC 2KDMA 2VZKB 2BB6A 1SF0A 2MHJA 3BYTB 2BWFA 5HI1A 2W54A 3KYDD 3P2BA 2DENB 3TUOA 1OEYJ 2LFIA 2ON8A 4FXCA 2NR2A 3VUWA 4LJPB 1RWSA 3PRZA 2X8XX 2JZPA 3EFCA 1NDDA 2KFKB 1ZOYB 3AE3B 3ZDTA 1EF5A 1L2NA 1ZW7A 4LDTD 3HVZA 1WI0A 3OJ3A 1F2RI 1C4AA 1TS2A 3TSSA 5C23A 2R61A 1LGRA 3PO0A 3T8MA 2GI9A 4JQWC 1IGDA 3Q2AC 4FBJB 2J0JA 1TYGB 1WYWB 2BB5A 1TGZB 3Q69A 2FE8A 1E7PB 2IZVB 4AUQC 1VR9A 5D94A 4LLGM 2B3AA 1V1PA 5LXHA 1KLGD 2GBJA 3P1MA 1DGJA 3RNCC 1X1MA 3RUIB 3HK0A 1YX6B 3JYUA 2BQQA 1WJ6A 2KTRB 3DBLB 3FKYA 4ZOHC 2XNAC 3A9JA 4K1RB 3B0AA 2VH1A 1CJEA 2WXGA 2QCZA 3BY4B 4LK0M 4RNAA 3ZJVA 2O6VD 1UWXA 2KANA 2M8SA 3AEAB 1FD6A 3M95A 1AWDA 4HKQA 2I1KA 3QJZA 1OGWA 2MEKA 2D3AA 2BYEA 3DHGC 1FEHA 3L16A 3Q3OC 3EGRA 4URKA 4HPLB 2PLPA 3IG3A 1NVID 1L0XB 4ZHPA 1TIFA 2L1AA 3HHMA 4DK5A 3UQBA 3MC8A 1E90A 1WIAA 4C80A 4XGAB 3ZNHB 5H92C 4HDQA 2E6XA 2KWCA 2M0AA 3E56A 3E9SA 1B9RA 1T0YA 2GBNA 2NPTA 4NAMA 2JYEA 3RYTA 2K3UA 2QEJC 1XCQL 1JMLA 1QZEA 5BO4B 4JWSC 2WQYB 2N9XA 4USAA 2J4XA 1UZXB 2KJRA 1EWYC 3AECB 4KSKC 2JWUA 1J0GA 1FNVA 1GPXA 3L13A 2KFKA 3DDCB 3QA8A 3PTFC 4BBNC 1U4AA 2KVRA 1MJDA 1R4NB 1UF0A 2KLGA 4HJKA 1L4DB 3ZXVA 3OLMD 2JYTA 1PGBA 1PQSA 3BIID 1ZKHA 2C7NB 3ZVVA 4RH6A 1J8CA 1WXSA 2CJOA 3JSVB 3L08A 5G2NA 1XLNA 3NVZA 5D3DA 1Z5SB 1LXDA 4ANUA 2WXKA 3ETRA 1GAQB 1QT9A 3VHTC 2WS3B 1F9JA 1JRPA 2LUEA 3NUHB 3OAWA 2JX5A 1BMLC 2KJ6A 4ICVA
chains in the Genus database with same CATH topology
3VUYA 1EUVB 3HM6X 2DZJA 2M0XA 4W9LA 1BT0A 1E8YA 3CSFA 4M0WB 4EKUA 4PYUA 2KZRA 4PS7A 1M94A 2DZIA 5E6NA 1GNUA 2C9WB 3SDLC 3VQIA 3R66C 1D3ZA 2KN5A 1WGHA 3IHPC 2KTRA 3H1UA 2D07B 2MBEA 4EZLA 2NBUA 4MEMA 2KO3A 4PYZA 4W9FA 5DPSA 2C5LC 1KM7A 4TKNA 4A3PA 4DDID 4CO7A 2G45B 2FCQA 2GBMA 2OOBB 2N7EA 3AI5A 1V2YA 2HTHA 3HIZA 4G11A 4PS8A 2L76A 1UBQA 1G6JA 1K8RB 4W9IA 2LZ6A 4RMAA 2ZVOA 2MQJA 3UIPB 5LLIA 5JZEB 3QCAA 4NNJB 4ASWC 1LM8B 2JXXA 3L17A 2LXCA 4YL8A 1WZ0A 1IPGA 1KJTA 2MX2A 3L0WB 5JHBA 3PGEA 1KOTA 3ZRCA 4FULA 5AZHA 2LWPA 3ZIMA 1V9JA 2AEHA 3I3TB 4K7WA 1KLVA 2J0MA 1WGGA 4FJYA 2BYVE 2AL6A 1H8CA 3AU4A 2BWES 5DPTA 3VTWA 1R4NI 3PRPB 2HD5B 2LD9A 4EEWA 3H7SA 2FCMA 2KDFB 3KYCD 3SD5A 3C0RB 4LDTB 4LJOB 4FJZA 2J0KA 2KC1A 2FAZA 5JHAA 2JZZA 3RCZA 4MDKE 2L0FA 3VTUA 3PREA 4GOCA 4ZDVA 2WWZA 3ZLZA 3PPAA 2JWZA 3PSEB 3WIMA 1WGDA 4MGKE 5L83A 3PHXB 3KW5B 1Q0WB 5E6PA 2LXAA 1XD3B 4G0NB 1WJUA 1C1YB 2FNJB 3QAQA 4W9HA 4E3CA 1Q1OA 3BINA 4TQ1A 1GJZA 4KIKB 3UINB 4KIKA 2NVUI 4OVVA 1S3SG 4ZRKA 2XK5A 3V6EB 3OJ4B 2QHOA 3VFKA 1WR1A 2KQSA 2IYDB 2K6DB 4FN2A 4WAAA 1I35A 1VCBA 1WE7A 2GBRA 3LJ3A 3L10B 1WGRA 3KUDB 3A9KA 3QHTA 3ENEA 1WGYA 2K8BA 2IO1B 2MRPA 2KXJA 2Z0DB 2N7DA 3AXCA 3ONSA 1YIWA 3PLUA 2N1WA 3N3KB 3DBHI 4DHZE 4HLEA 4AJYB 2L3ZA 2FCNA 1MG8A 2N9PC 2V1YA 3CF6E 4K81A 3PVLA 2I1JA 1JRUA 5HKHA 3WALA 4W9KA 4ANXA 1V6EA 2KTFA 4GB9A 4ZRJA 4KDLB 4HCNB 4MJSB 3N32A 3N30A 2WDTB 4RM9A 2BGFA 3VVWB 3M3JA 3ZRFA 3DOWA 2LI5A 3JSVA 4XZ4A 2DYOA 2MBQA 1HE8A 3V6CB 2JVCA 4DXAB 4IWOA 1E5WA 5CTRC 4I6PA 3IFWB 4MGZE 2A4ZA 5CHFA 2LVQA 3QIJA 1V5OA 1P1AA 2A5UA 2O6VA 4I6LB 4IG7B 2KKCA 2LJ5A 3ZKJC 4IM3A 4GDLB 5CHVC 1E7UA 2K6QA 4WWNA 3W1SA 4B95A 2IY1B 3R7QA 4BFRA 4HDOA 4BKGA 1P0RA 2IO0B 1E8XA 4II2B 3UQAA 1A5RA 5AZGA 3JW0X 3B08A 4NAWB 2D11A 2EMSA 4MGIE 1I42A 1SE9A 2CS4A 3DQVA 3A4RA 2HJ8A 1YJ1A 2O2VB 2MSED 2Z59B 1FXTB 3K9OB 1H4RA 4J6IA 4WWPA 2DZKA 2KLCA 4IWPA 3A4SC 3PHWB 3R3MA 1WFYA 2LGDA 4IW0A 4NY0A 3U8ZA 2ZPYA 4TUUA 4E74A 1WMHB 3PZDA 1WMHA 2L7RA 2ZCCA 4W9GA 4P7IA 2FIDA 3IVFA 5C1ZA 4IWQA 2REXA 4MELA 1AARA 2ZNVB 4JGHB 2KJHB 4KZCA 3U30A 4RM8A 1VD2A 2XBBC 2EKEC 2PE9A 2KDBA 3ZNID 2XEWA 5J17A 4JL9A 3EECA 3TJPA 2DX5B 1UBIA 2PEAA 1YD8U 2LRWA 2UWQA 3KH0A 3RT3B 4BOSC 4XC2A 2KNBA 4DHJD 4FLHA 2HE7A 4W9EA 2PPHA 3WA0A 4ZRIA 4I6NB 5GMVA 5AZFA 4ANWA 2MA9B 3ZDMC 2DZMA 2EMTA 1E7VA 4GN1A 2KQ7A 4BKTA 2CHXA 2WX1A 2KMAA 4JLCA 3A9JB 2RGFA 5D6JB 2JUOA 5D2MB 3UIOB 2VRRB 4BOZB 2NBVB 3V62A 4EZKA 3QC8B 2J7QB 4FHKA 3X23A 4AOFA 2DYBA 2AL3A 4GGQA 3HM3A 1J19A 1WM2A 2YVCA 4KZ0A 3O65B 1Q5WB 4NQKE 4NPNA 5CX3A 2M17A 2KDIA 5IAAC 4BKSD 2R2OA 1V5TA 4KVGB 2G4DB 4JIOU 2MLBA 4MGYE 5DCNA 3PS6A 2DAJA 4B9KA 2LGYA 3V61A 3CSTA 3IBEA 3DBSA 3QK0A 3H7PB 3X0WA 2KWUB 2IY0B 1WX7A 3CMMB 1IP9A 4IUMB 3ZTDA 4WJQA 3ZNGC 4WQOB 2ZEQA 2FIFA 2ZVNA 3KUCB 2KX3A 3APCA 4E71A 3UGBB 5L95C 5LXIB 3ZUNA 4BVUC 3LDZE 4ANVA 4MSMB 1WXVA 3M63B 1YQBA 4WJOA 4CHKA 4DDGD 2ZCBA 4GDKB 4MSQB 3RZWC 3PLVA 2BYFA 4F7ZA 2BF8B 3EC8A 5FR6A 1TZ1A 3DBRI 4CYEA 4ZYNA 5EDSA 2KC2A 3SU8X 2BWFA 1EF1A 3DVGX 4EZJA 3B1LX 3ZNZB 4EOYA 1WX8A 3KYDD 3P2BA 2ASQA 3WAOA 2DENB 4W9DA 3AU5A 3H9DA 1OEYJ 1WXAA 2CR5A 2NR2A 4A20A 3VUWA 2L0TA 4LJPB 2G4SA 3PRZA 4WWOA 4HPMB 2GMIC 3R7RA 4MJSA 3A1QB 3SHQA 3M62B 4BBNF 1GG3A 2LVOA 1NDDA 2OJRA 3QQ8B 1R4MI 5KHQA 2KFKB 3DPDA 3NZUA 3W1SC 1CMXB 3ZDTA 1EF5A 1L2NA 2G3QB 2C7MB 2DHZA 1ZW7A 2JT4B 2MW5A 4LDTD 1WI0A 3U7DA 3OJ3A 5J2RA 2GBKA 4PS3A 4LCDE 4M8NA 2PJHA 2LASA 2R2QA 2RD0A 5C23A 3GZNI 2L05A 4DWFA 1IYFA 4GDLA 2MCNB 3DVGY 2C7HA 4F8CB 2PE6B 3VH4B 2AYOB 3WAMA 1V49A 1C3TA 2K25A 3T8MA 2BPSA 3RZFA 2K1FA 4JQWC 2MBHA 5DPWA 2FUHB 4IM0A 2KMCA 4GSWA 3DCGA 4II3B 4NAWA 4FBJB 2V4LA 2J0JA 3JVZX 4MM3A 1WYWB 4XX5A 2O2VA 1UELA 4FADA 5IA7A 3ML8A 1OTRB 1TGZB 4TV3A 3S2AA 2IZVB 2NS5A 2CU1A 3UF8A 4HCPB 4AUQC 1E8WA 1WM3A 5D94A 1SGHA 4AP4C 2B3AA 1UGMA 2K8CA 2YLMA 2MP2B 4FHJA 5AEKB 3QARA 4K7UA 5LXHA 2JY6A 2KOXA 2GBJA 2NCNA 5E6OA 3VDZA 2WYQA 2V3SA 1X1MA 3RUIB 2CHZA 4HVBA 4GMVA 3VAWA 3QWZB 4DBGA 3TL5A 3HK0A 1YX6B 4OVUA 3ZW3A 3GOEA 4GU2A 3JYUA 1WJ6A 1XQQA 3APDA 4HXDA 2CKHB 2KWVB 2KTRB 2K8HA 3A33B 2MBBB 3A9JA 1SIFA 3K9PB 4K1RB 3B0AA 2N9EB 2FCSA 3BY4B 4M8MA 3MJWA 4HK2A 1YX5B 3MTNB 4A3OA 2KD0A 2MWSB 1P98A 2O6VD 2KANA 2M8SA 3V60A 4MH0E 3L54A 3M95A 4KV2A 4EUTA 3W1YA 3ECIA 1WX9A 1NBFC 4GXBA 2Z0EB 2I1KA 3QJZA 4ICUA 1RRBA 1OGWA 3MHSD 2BKRB 3NHEB 3VTVA 1UD7A 2D2QA 2L00B 2BYEA 2K39A 4URKA 3L16A 4FJVB 3NZSA 4HPLB 2JRHA 1V86A 3H7PA 3IG3A 2IO3B 1P3QU 1V81A 2RR9A 3RULA 1XT9B 1GC6A 3HHMA 4DK5A 3H6NA 2JZ3B 1WRDB 3UQBA 4KDIC 4AJWA 2KDEB 1E90A 1WIAA 5KHOA 4X57B 3ZNHB 4AWJA 2W9NA 4GDKA 4IC7B 4HDQA 3PT2B 4N9F4 2M4NA 2KWCA 4DHZB 3ALBA 3VUXA 1Z2MA 2ZJDA 5G55A 2IO2B 1T0YA 1WJ4A 3VXWA 2GOWA 2NPTB 3NY5A 2GBNA 2NPTA 4W9JA 3TIXA 3RYTA 3EHVA 3TMPB 4K7SA 2D10A 4NJ6A 2UYZB 2WX0A 1QZEA 5BO4B 3TBLD 3T9LA 2NBWB 3WANA 3D32A 2LRUA 1WE6A 4W9CA 2JF5A 2KHWB 2MBOA 4NJ7A 2KFJA 2N9XA 3RD2A 2IBIB 1UZXB 1WJNA 2KJRA 3DVNV 5DPRA 4KSKC 3ML9A 1J0GA 2XK5B 3KVFB 5D7GA 1WR6E 3A1QA 3VH3B 4FA6A 2LGXA 1GC7A 4G3XB 3L13A 2ZZPB 2KFKA 1RAXA 2KK8A 3DDCB 1GUAB 1TTNA 2ZPNA 3A9KB 3PTFC 3QA8A 2JPHA 4BBNC 1U4AA 1LFDA 1RFAA 1S1QB 2D3GA 2M1MA 2KVRA 3Q3FA 4GIVA 4IM2A 5CHWA 3WAPA 1E8ZA 3NS8A 2Y5BB 1WY8A 2KLGA 4HJKA 3OLMD 1NI2A 2L8JA 1PQSA 4DHJB 4B6WA 2N4FA 4G50A 3EFUA 1RLFA 1ZKHA 2C7NB 1UH6A 2C60A 3Q3JA 3ZVVA 4EFOA 5JH5C 2DYMA 1WZ3A 4NQLB 3AULA 1J8CA 3DBLI 1L7YA 2KX0A 2JRIB 4KSLC 3ZO5B 3ZTCA 1WXSA 3JSVB 4TQ0A 2ZNVC 1Y8RC 3L08A 4WJPA 5G2NA 2CHWA 1OQYA 2RPQA 5TR5A 2BKFA 1P9DU 1Z5SB 1LQBA 1LXDA 1WF9A 4ANUA 1V80A 2AWTA 4HWIB 1WH3A 1TBEA 2N1VA 2O6VB 3DVNU 3TCAA 1WXMA 3VHTC 5J18A 3NOBA 1F9JA 2LUEA 3KUZA 1ISNA 1OEYA 4BKSA 3PRMB 2DAFA 3QX1A 3OAWA 1EO6A 2MP2A 3APFA 2LVPA 2RSUA 3PV1A 1ZGUB 4WJNA 2KJ6A 4F1SA 4ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUY A;  1EUV B;  3HM6 X;  2DZJ A;  2M0X A;  4W9L A;  1BT0 A;  1E8Y A;  3CSF A;  4M0W B;  4EKU A;  4PYU A;  2KZR A;  4PS7 A;  1M94 A;  2DZI A;  5E6N A;  1GNU A;  2C9W B;  3SDL C;  3VQI A;  3R66 C;  1D3Z A;  2KN5 A;  1WGH A;  3IHP C;  2KTR A;  3H1U A;  2D07 B;  2MBE A;  4EZL A;  2NBU A;  4MEM A;  2KO3 A;  4PYZ A;  4W9F A;  5DPS A;  2C5L C;  1KM7 A;  4TKN A;  4A3P A;  4DDI D;  4CO7 A;  2G45 B;  2FCQ A;  2GBM A;  2OOB B;  2N7E A;  3AI5 A;  1V2Y A;  2HTH A;  3HIZ A;  4G11 A;  4PS8 A;  2L76 A;  1UBQ A;  1G6J A;  1K8R B;  4W9I A;  2LZ6 A;  4RMA A;  2ZVO A;  2MQJ A;  3UIP B;  5LLI A;  5JZE B;  3QCA A;  4NNJ B;  4ASW C;  1LM8 B;  2JXX A;  3L17 A;  2LXC A;  4YL8 A;  1WZ0 A;  1IPG A;  1KJT A;  2MX2 A;  3L0W B;  5JHB A;  3PGE A;  1KOT A;  3ZRC A;  4FUL A;  5AZH A;  2LWP A;  3ZIM A;  1V9J A;  2AEH A;  3I3T B;  4K7W A;  1KLV A;  2J0M A;  1WGG A;  4FJY A;  2BYV E;  2AL6 A;  1H8C A;  3AU4 A;  2BWE S;  5DPT A;  3VTW A;  1R4N I;  3PRP B;  2HD5 B;  2LD9 A;  4EEW A;  3H7S A;  2FCM A;  2KDF B;  3KYC D;  3SD5 A;  3C0R B;  4LDT B;  4LJO B;  4FJZ A;  2J0K A;  2KC1 A;  2FAZ A;  5JHA A;  2JZZ A;  3RCZ A;  4MDK E;  2L0F A;  3VTU A;  3PRE A;  4GOC A;  4ZDV A;  2WWZ A;  3ZLZ A;  3PPA A;  2JWZ A;  3PSE B;  3WIM A;  1WGD A;  4MGK E;  5L83 A;  3PHX B;  3KW5 B;  1Q0W B;  5E6P A;  2LXA A;  1XD3 B;  4G0N B;  1WJU A;  1C1Y B;  2FNJ B;  3QAQ A;  4W9H A;  4E3C A;  1Q1O A;  3BIN A;  4TQ1 A;  1GJZ A;  4KIK B;  3UIN B;  4KIK A;  2NVU I;  4OVV A;  1S3S G;  4ZRK A;  2XK5 A;  3V6E B;  3OJ4 B;  2QHO A;  3VFK A;  1WR1 A;  2KQS A;  2IYD B;  2K6D B;  4FN2 A;  4WAA A;  1I35 A;  1VCB A;  1WE7 A;  2GBR A;  3LJ3 A;  3L10 B;  1WGR A;  3KUD B;  3A9K A;  3QHT A;  3ENE A;  1WGY A;  2K8B A;  2IO1 B;  2MRP A;  2KXJ A;  2Z0D B;  2N7D A;  3AXC A;  3ONS A;  1YIW A;  3PLU A;  2N1W A;  3N3K B;  3DBH I;  4DHZ E;  4HLE A;  4AJY B;  2L3Z A;  2FCN A;  1MG8 A;  2N9P C;  2V1Y A;  3CF6 E;  4K81 A;  3PVL A;  2I1J A;  1JRU A;  5HKH A;  3WAL A;  4W9K A;  4ANX A;  1V6E A;  2KTF A;  4GB9 A;  4ZRJ A;  4KDL B;  4HCN B;  4MJS B;  3N32 A;  3N30 A;  2WDT B;  4RM9 A;  2BGF A;  3VVW B;  3M3J A;  3ZRF A;  3DOW A;  2LI5 A;  3JSV A;  4XZ4 A;  2DYO A;  2MBQ A;  1HE8 A;  3V6C B;  2JVC A;  4DXA B;  4IWO A;  1E5W A;  5CTR C;  4I6P A;  3IFW B;  4MGZ E;  2A4Z A;  5CHF A;  2LVQ A;  3QIJ A;  1V5O A;  1P1A A;  2A5U A;  2O6V A;  4I6L B;  4IG7 B;  2KKC A;  2LJ5 A;  3ZKJ C;  4IM3 A;  4GDL B;  5CHV C;  1E7U A;  2K6Q A;  4WWN A;  3W1S A;  4B95 A;  2IY1 B;  3R7Q A;  4BFR A;  4HDO A;  4BKG A;  1P0R A;  2IO0 B;  1E8X A;  4II2 B;  3UQA A;  1A5R A;  5AZG A;  3JW0 X;  3B08 A;  4NAW B;  2D11 A;  2EMS A;  4MGI E;  1I42 A;  1SE9 A;  2CS4 A;  3DQV A;  3A4R A;  2HJ8 A;  1YJ1 A;  2O2V B;  2MSE D;  2Z59 B;  1FXT B;  3K9O B;  1H4R A;  4J6I A;  4WWP A;  2DZK A;  2KLC A;  4IWP A;  3A4S C;  3PHW B;  3R3M A;  1WFY A;  2LGD A;  4IW0 A;  4NY0 A;  3U8Z A;  2ZPY A;  4TUU A;  4E74 A;  1WMH B;  3PZD A;  1WMH A;  2L7R A;  2ZCC A;  4W9G A;  4P7I A;  2FID A;  3IVF A;  5C1Z A;  4IWQ A;  2REX A;  4MEL A;  1AAR A;  2ZNV B;  4JGH B;  2KJH B;  4KZC A;  3U30 A;  4RM8 A;  1VD2 A;  2XBB C;  2EKE C;  2PE9 A;  2KDB A;  3ZNI D;  2XEW A;  5J17 A;  4JL9 A;  3EEC A;  3TJP A;  2DX5 B;  1UBI A;  2PEA A;  1YD8 U;  2LRW A;  2UWQ A;  3KH0 A;  3RT3 B;  4BOS C;  4XC2 A;  2KNB A;  4DHJ D;  4FLH A;  2HE7 A;  4W9E A;  2PPH A;  3WA0 A;  4ZRI A;  4I6N B;  5GMV A;  5AZF A;  4ANW A;  2MA9 B;  3ZDM C;  2DZM A;  2EMT A;  1E7V A;  4GN1 A;  2KQ7 A;  4BKT A;  2CHX A;  2WX1 A;  2KMA A;  4JLC A;  3A9J B;  2RGF A;  5D6J B;  2JUO A;  5D2M B;  3UIO B;  2VRR B;  4BOZ B;  2NBV B;  3V62 A;  4EZK A;  3QC8 B;  2J7Q B;  4FHK A;  3X23 A;  4AOF A;  2DYB A;  2AL3 A;  4GGQ A;  3HM3 A;  1J19 A;  1WM2 A;  2YVC A;  4KZ0 A;  3O65 B;  1Q5W B;  4NQK E;  4NPN A;  5CX3 A;  2M17 A;  2KDI A;  5IAA C;  4BKS D;  2R2O A;  1V5T A;  4KVG B;  2G4D B;  4JIO U;  2MLB A;  4MGY E;  5DCN A;  3PS6 A;  2DAJ A;  4B9K A;  2LGY A;  3V61 A;  3CST A;  3IBE A;  3DBS A;  3QK0 A;  3H7P B;  3X0W A;  2KWU B;  2IY0 B;  1WX7 A;  3CMM B;  1IP9 A;  4IUM B;  3ZTD A;  4WJQ A;  3ZNG C;  4WQO B;  2ZEQ A;  2FIF A;  2ZVN A;  3KUC B;  2KX3 A;  3APC A;  4E71 A;  3UGB B;  5L95 C;  5LXI B;  3ZUN A;  4BVU C;  3LDZ E;  4ANV A;  4MSM B;  1WXV A;  3M63 B;  1YQB A;  4WJO A;  4CHK A;  4DDG D;  2ZCB A;  4GDK B;  4MSQ B;  3RZW C;  3PLV A;  2BYF A;  4F7Z A;  2BF8 B;  3EC8 A;  5FR6 A;  1TZ1 A;  3DBR I;  4CYE A;  4ZYN A;  5EDS A;  2KC2 A;  3SU8 X;  2BWF A;  1EF1 A;  3DVG X;  4EZJ A;  3B1L X;  3ZNZ B;  4EOY A;  1WX8 A;  3KYD D;  3P2B A;  2ASQ A;  3WAO A;  2DEN B;  4W9D A;  3AU5 A;  3H9D A;  1OEY J;  1WXA A;  2CR5 A;  2NR2 A;  4A20 A;  3VUW A;  2L0T A;  4LJP B;  2G4S A;  3PRZ A;  4WWO A;  4HPM B;  2GMI C;  3R7R A;  4MJS A;  3A1Q B;  3SHQ A;  3M62 B;  4BBN F;  1GG3 A;  2LVO A;  1NDD A;  2OJR A;  3QQ8 B;  1R4M I;  5KHQ A;  2KFK B;  3DPD A;  3NZU A;  3W1S C;  1CMX B;  3ZDT A;  1EF5 A;  1L2N A;  2G3Q B;  2C7M B;  2DHZ A;  1ZW7 A;  2JT4 B;  2MW5 A;  4LDT D;  1WI0 A;  3U7D A;  3OJ3 A;  5J2R A;  2GBK A;  4PS3 A;  4LCD E;  4M8N A;  2PJH A;  2LAS A;  2R2Q A;  2RD0 A;  5C23 A;  3GZN I;  2L05 A;  4DWF A;  1IYF A;  4GDL A;  2MCN B;  3DVG Y;  2C7H A;  4F8C B;  2PE6 B;  3VH4 B;  2AYO B;  3WAM A;  1V49 A;  1C3T A;  2K25 A;  3T8M A;  2BPS A;  3RZF A;  2K1F A;  4JQW C;  2MBH A;  5DPW A;  2FUH B;  4IM0 A;  2KMC A;  4GSW A;  3DCG A;  4II3 B;  4NAW A;  4FBJ B;  2V4L A;  2J0J A;  3JVZ X;  4MM3 A;  1WYW B;  4XX5 A;  2O2V A;  1UEL A;  4FAD A;  5IA7 A;  3ML8 A;  1OTR B;  1TGZ B;  4TV3 A;  3S2A A;  2IZV B;  2NS5 A;  2CU1 A;  3UF8 A;  4HCP B;  4AUQ C;  1E8W A;  1WM3 A;  5D94 A;  1SGH A;  4AP4 C;  2B3A A;  1UGM A;  2K8C A;  2YLM A;  2MP2 B;  4FHJ A;  5AEK B;  3QAR A;  4K7U A;  5LXH A;  2JY6 A;  2KOX A;  2GBJ A;  2NCN A;  5E6O A;  3VDZ A;  2WYQ A;  2V3S A;  1X1M A;  3RUI B;  2CHZ A;  4HVB A;  4GMV A;  3VAW A;  3QWZ B;  4DBG A;  3TL5 A;  3HK0 A;  1YX6 B;  4OVU A;  3ZW3 A;  3GOE A;  4GU2 A;  3JYU A;  1WJ6 A;  1XQQ A;  3APD A;  4HXD A;  2CKH B;  2KWV B;  2KTR B;  2K8H A;  3A33 B;  2MBB B;  3A9J A;  1SIF A;  3K9P B;  4K1R B;  3B0A A;  2N9E B;  2FCS A;  3BY4 B;  4M8M A;  3MJW A;  4HK2 A;  1YX5 B;  3MTN B;  4A3O A;  2KD0 A;  2MWS B;  1P98 A;  2O6V D;  2KAN A;  2M8S A;  3V60 A;  4MH0 E;  3L54 A;  3M95 A;  4KV2 A;  4EUT A;  3W1Y A;  3ECI A;  1WX9 A;  1NBF C;  4GXB A;  2Z0E B;  2I1K A;  3QJZ A;  4ICU A;  1RRB A;  1OGW A;  3MHS D;  2BKR B;  3NHE B;  3VTV A;  1UD7 A;  2D2Q A;  2L00 B;  2BYE A;  2K39 A;  4URK A;  3L16 A;  4FJV B;  3NZS A;  4HPL B;  2JRH A;  1V86 A;  3H7P A;  3IG3 A;  2IO3 B;  1P3Q U;  1V81 A;  2RR9 A;  3RUL A;  1XT9 B;  1GC6 A;  3HHM A;  4DK5 A;  3H6N A;  2JZ3 B;  1WRD B;  3UQB A;  4KDI C;  4AJW A;  2KDE B;  1E90 A;  1WIA A;  5KHO A;  4X57 B;  3ZNH B;  4AWJ A;  2W9N A;  4GDK A;  4IC7 B;  4HDQ A;  3PT2 B;  4N9F 4;  2M4N A;  2KWC A;  4DHZ B;  3ALB A;  3VUX A;  1Z2M A;  2ZJD A;  5G55 A;  2IO2 B;  1T0Y A;  1WJ4 A;  3VXW A;  2GOW A;  2NPT B;  3NY5 A;  2GBN A;  2NPT A;  4W9J A;  3TIX A;  3RYT A;  3EHV A;  3TMP B;  4K7S A;  2D10 A;  4NJ6 A;  2UYZ B;  2WX0 A;  1QZE A;  5BO4 B;  3TBL D;  3T9L A;  2NBW B;  3WAN A;  3D32 A;  2LRU A;  1WE6 A;  4W9C A;  2JF5 A;  2KHW B;  2MBO A;  4NJ7 A;  2KFJ A;  2N9X A;  3RD2 A;  2IBI B;  1UZX B;  1WJN A;  2KJR A;  3DVN V;  5DPR A;  4KSK C;  3ML9 A;  1J0G A;  2XK5 B;  3KVF B;  5D7G A;  1WR6 E;  3A1Q A;  3VH3 B;  4FA6 A;  2LGX A;  1GC7 A;  4G3X B;  3L13 A;  2ZZP B;  2KFK A;  1RAX A;  2KK8 A;  3DDC B;  1GUA B;  1TTN A;  2ZPN A;  3A9K B;  3PTF C;  3QA8 A;  2JPH A;  4BBN C;  1U4A A;  1LFD A;  1RFA A;  1S1Q B;  2D3G A;  2M1M A;  2KVR A;  3Q3F A;  4GIV A;  4IM2 A;  5CHW A;  3WAP A;  1E8Z A;  3NS8 A;  2Y5B B;  1WY8 A;  2KLG A;  4HJK A;  3OLM D;  1NI2 A;  2L8J A;  1PQS A;  4DHJ B;  4B6W A;  2N4F A;  4G50 A;  3EFU A;  1RLF A;  1ZKH A;  2C7N B;  1UH6 A;  2C60 A;  3Q3J A;  3ZVV A;  4EFO A;  5JH5 C;  2DYM A;  1WZ3 A;  4NQL B;  3AUL A;  1J8C A;  3DBL I;  1L7Y A;  2KX0 A;  2JRI B;  4KSL C;  3ZO5 B;  3ZTC A;  1WXS A;  3JSV B;  4TQ0 A;  2ZNV C;  1Y8R C;  3L08 A;  4WJP A;  5G2N A;  2CHW A;  1OQY A;  2RPQ A;  5TR5 A;  2BKF A;  1P9D U;  1Z5S B;  1LQB A;  1LXD A;  1WF9 A;  4ANU A;  1V80 A;  2AWT A;  4HWI B;  1WH3 A;  1TBE A;  2N1V A;  2O6V B;  3DVN U;  3TCA A;  1WXM A;  3VHT C;  5J18 A;  3NOB A;  1F9J A;  2LUE A;  3KUZ A;  1ISN A;  1OEY A;  4BKS A;  3PRM B;  2DAF A;  3QX1 A;  3OAW A;  1EO6 A;  2MP2 A;  3APF A;  2LVP A;  2RSU A;  3PV1 A;  1ZGU B;  4WJN A;  2KJ6 A;  4F1S A;  4ICV A; 
#chains in the Genus database with same CATH topology
 1F52 A;  4B0E A;  2M0X A;  4M0W A;  5E6N A;  2L52 A;  2WXH A;  2KAJ A;  1D3Z A;  1WGH A;  2KTR A;  1E0Z A;  4OHJ A;  4PYZ A;  2C5L C;  3CWI A;  2FCQ A;  3BK2 A;  1MI0 A;  3HRD D;  2IGD A;  1ZDX A;  1V2Y A;  2HTH A;  1TS4 A;  1JQ4 A;  1WGK A;  1OQQ A;  4NNJ B;  2JU6 X;  4TSS A;  1FNU A;  4C56 C;  5JHB A;  3PGE A;  1KOT A;  3ZRC A;  4K7W A;  1KLV A;  1WGG A;  2WU2 B;  4FJY A;  2AL6 A;  2HD5 B;  1C9F A;  3H7S A;  2FCM A;  1QOG A;  3ZXR A;  4LDT B;  5JHA A;  4GOC A;  4JX1 C;  3Q8F A;  4ZRQ A;  3PPA A;  3IT6 B;  3PSE B;  4AQ7 A;  1WGD A;  4ZHO A;  5L83 A;  1IUE A;  5E6P A;  3KQ4 A;  1XD3 B;  1HZ5 A;  1C1Y B;  4TQ1 A;  3BVM A;  1V1O A;  4RCO A;  4ZRK A;  1K52 A;  3VFK A;  2K6D B;  4J3O D;  3GP7 A;  2XN9 C;  1I35 A;  1WE7 A;  3LJ3 A;  3AEB B;  1F77 A;  3KUD B;  2FUG 1;  4HEA 1;  2KXJ A;  2N1W A;  3DBH I;  2LJI A;  4AJY B;  1MG8 A;  3PVL A;  3Q8A A;  2GLS A;  4W9K A;  4KDL B;  4MJS B;  5HFY A;  3TEZ A;  3N30 A;  2WDT B;  3VVW B;  2RPV A;  3DOW A;  3JSV A;  4M00 A;  1HE8 A;  2PVG C;  2JVC A;  2A4Z A;  4RF1 A;  5CHF A;  3QIJ A;  4IG7 B;  4US9 A;  3OWE B;  3ZKJ C;  4GDL B;  1E7U A;  4YTN B;  3BK1 A;  1XLQ A;  3ZJU A;  4RF0 A;  2PIA A;  1T0R C;  2D11 A;  3P4Q B;  4XWW A;  1SE9 A;  1D5M C;  2O2V B;  5EE0 A;  3K9O B;  1FXT B;  1H4R A;  2DZK A;  2CU3 A;  2KLC A;  1T5X D;  4IWP A;  1AW7 A;  4IW0 A;  3U8Z A;  1I4X A;  3NVW A;  3NVV A;  4P7I A;  3IVF A;  5C1Z A;  4YTM B;  4A6Q A;  1VD2 A;  2EKE C;  5J17 A;  2XEW A;  3TJP A;  2PEA A;  2LRW A;  3RPF C;  4BOS C;  5D3I B;  4ZRI A;  1BUI C;  2ICI A;  2E3T A;  5AZF A;  4ANW A;  1VLB A;  5BMH A;  4GN1 A;  3BVG A;  4OW0 A;  2WX1 A;  2KMA A;  3URY A;  3I5J C;  2D3C A;  3UIO B;  4BOZ B;  3V62 A;  2NTS A;  2KT7 A;  4AOF A;  2AL3 A;  3R8B A;  3AE9 B;  4C7Z A;  5CX3 A;  2M17 A;  5IAA C;  3UQA A;  2R2O A;  4KVG B;  4JIO U;  4KX6 B;  4B9K A;  3V61 A;  2IY0 B;  1C76 A;  3ZNG C;  3CIR B;  4WQO B;  2ZEQ A;  5EE1 A;  2FIF A;  3Q3M C;  2KX3 A;  2VH2 A;  1MHH E;  1WXV A;  3M63 B;  1TKY A;  4WJO A;  2G1E A;  4MSQ B;  4GDK B;  3RZW C;  4HRS A;  1JAL A;  3EC8 A;  1EWC A;  4CYE A;  2KC2 A;  1MG4 A;  2INN E;  1EF1 A;  1ZP0 B;  3DVG X;  1UNS A;  3W5V B;  2ZW0 A;  4EZJ A;  4EOY A;  1WX8 A;  4W9D A;  4C4V B;  3AU5 A;  3VRA B;  3AE6 B;  1XLP A;  2L0T A;  3BYY B;  4HPM B;  4MJS A;  3SHQ A;  4BBN F;  3M62 B;  1GG3 A;  2LVO A;  2ZW1 A;  4WWM A;  3AEF B;  1R4M I;  5KHQ A;  1I4H A;  4P16 A;  4LNK A;  2C7M B;  2J53 A;  2MW5 A;  2IPK D;  4Q2J A;  1PFD A;  4PS3 A;  3BZD B;  4LCD E;  4M8N A;  2QDF A;  4GDL A;  2MCN B;  1OFF A;  1D5Z C;  2BS4 B;  2PE6 B;  5HHD G;  2BW2 A;  2K25 A;  2BPS A;  1D5X C;  4IM0 A;  1FM0 D;  2KMC A;  3DCG A;  4GSW A;  2V4L A;  3MHZ A;  4RGN A;  3JVZ X;  2O2V A;  1UEL A;  4FAD A;  5IA7 A;  3Q6B A;  2CU1 A;  3UF8 A;  4HCP B;  2MJ3 A;  1E8W A;  1I4R A;  1CQV A;  2KN4 A;  1SGH A;  1TZO A;  1UGM A;  1EM7 A;  1JWA D;  2YLM A;  4FHJ A;  4B0M A;  5AEK B;  3QAR A;  5C3J B;  4K7U A;  2KQ4 X;  2NCN A;  2WYQ A;  4EE2 A;  4HVB A;  2CHZ A;  3GB1 A;  3VAW A;  2H89 B;  1SJH D;  4HKZ E;  3APD A;  1HQR D;  1XQQ A;  2CKH B;  2K8H A;  4P1C C;  4M02 A;  2N9E B;  4A3O A;  2MWS B;  1P98 A;  1P7E A;  1J7A A;  3L54 A;  1YJJ A;  1D4B A;  3ECI A;  1NBF C;  4GXB A;  5FKA C;  2Z0E B;  1RRB A;  3N1Y C;  1IBX B;  3O13 A;  2W82 A;  1MVK A;  3MHS D;  3NHE B;  1UD7 A;  1VRA B;  1QOA A;  3MP9 A;  4FJV B;  2WXR A;  2WXJ A;  2IO3 B;  1V81 A;  4RGT A;  2RR9 A;  1XT9 B;  1GC6 A;  1YNT E;  3N9Y C;  3SFE B;  3H6N A;  2K0P A;  2DWQ A;  2KMM A;  4AJW A;  2PW9 A;  2KDE B;  2W9N A;  4GDK A;  3NZ3 A;  3PT2 B;  4WQM A;  5BYS A;  3RFZ B;  4LNF A;  1V97 A;  1JWB D;  1FFU A;  1WJ4 A;  3VXW A;  2NPT B;  3TIX A;  3GE3 C;  2GRI A;  2UYZ B;  2LGI A;  3LYY A;  3TBL D;  3T9L A;  1N61 A;  5AUK A;  3AEG B;  3SEB A;  3AE1 B;  3WAN A;  2MBO A;  4WH4 A;  4C4V A;  1ET6 A;  5DPR A;  3ML9 A;  1FO4 A;  4DQO C;  2ZZP B;  4DDI D;  2ZPN A;  2EKI A;  1S1Q B;  2D3G A;  4GIV A;  1E8Z A;  2Y5B B;  1WY8 A;  1NI2 A;  2L8J A;  3P42 A;  4H2A A;  1UH6 A;  1NYQ A;  3AUL A;  1QLB B;  1GOZ A;  3N20 C;  2N0S B;  2WDQ B;  1Y8R C;  4WJP A;  1OQY A;  2RPQ A;  2BKF A;  1A70 A;  4HWI B;  1WH3 A;  1WXM A;  4WUR A;  4L1B A;  3AE7 B;  1ISN A;  3PRM B;  4IOI E;  1EO6 A;  2DLB A;  1K50 A;  2LVP A;  5FK9 C;  3PV1 A;  1YQ4 B;  4F1S A;  2I38 A;  3VUY A;  1EUV B;  3DBH B;  1SE3 A;  4W9L A;  3IAS 1;  1E8Y A;  1NYR A;  3CSF A;  4M0W B;  4EKU A;  5BMI A;  2W3S A;  1FPY A;  1QOF A;  3IHP C;  1WWT A;  2WLB A;  2UU7 A;  1FXI A;  4MEM A;  5DPS A;  4S0R A;  1KM7 A;  2G45 B;  2GBM A;  2N7E A;  3AI5 A;  3P4S B;  3NS1 A;  1XLO A;  1UBQ A;  2L76 A;  4RMA A;  5LLI A;  1IBX A;  1TT5 B;  2IJ0 A;  1LM8 B;  2JXX A;  4BAX A;  2LXC A;  1YOV B;  1KJT A;  3DHH C;  3FC4 A;  5AZH A;  2Y5C A;  1V9J A;  1ZPS A;  4P6V F;  2BWE S;  4CQN A;  3EUB 2;  3PRP B;  2KDF B;  1HTQ A;  3SD5 A;  5IO9 A;  3W9C B;  4FJZ A;  2J0K A;  1E10 A;  2WGS A;  4LTU A;  3VTU A;  3PRE A;  3OG5 A;  1PGA A;  3WIM A;  3PHX B;  3KW5 B;  2GB1 A;  4ARI A;  5AUI A;  4W9H A;  1ZXH A;  1Q1O A;  1GJZ A;  4US8 A;  5TSS A;  4KIK A;  3OJ4 B;  2QHO A;  1WR1 A;  2KQS A;  1ACC A;  1I4Q A;  2IYD B;  3NRZ A;  2WXP A;  3L10 B;  2DBY A;  4A8X C;  4YSZ B;  1WGY A;  1KH0 A;  2MRP A;  4WAF A;  3ONS A;  3B2F A;  4HLE A;  4YT0 B;  2I1J A;  3KLS X;  4JPS A;  2LGS A;  3ZJT A;  2KTF A;  1QKZ A;  1N6Z A;  3N32 A;  3HUI A;  4RM9 A;  3V3X A;  1C79 A;  3M3J A;  1K53 A;  2DYO A;  1KF6 B;  3V6C B;  5IKC M;  2INP E;  4NJC A;  1FIQ A;  2JSV X;  2QC8 A;  4I6L B;  2LJ5 A;  2PVO D;  4IM3 A;  4WWN A;  1P0R A;  2IO0 B;  1A5R A;  2N9K A;  3B08 A;  4MGI E;  1I42 A;  2BS2 B;  2CS4 A;  1JWM D;  3RNG C;  2IGH A;  4RFB A;  4WWP A;  3A4S C;  1E9M A;  3HVD A;  2ZPY A;  2I2Y A;  4XYC A;  1HZ6 A;  4OVZ A;  1ZXI A;  2OED A;  4MEL A;  1TJE A;  1R4M B;  1FNW A;  3Q8C A;  2XBB C;  2MJE A;  2KDB A;  3ZNI D;  3KH0 A;  2WDR B;  2UWQ A;  3RT3 B;  2M19 A;  1JWU D;  3P4P B;  2Q5W D;  1E7V A;  2KQ7 A;  2CHX A;  5IOI A;  3ZQ4 A;  2RGF A;  5D6J B;  2VRR B;  1ESF A;  1V8C A;  2FBW B;  2NBV B;  2J7Q B;  3X23 A;  2HJ1 A;  4GGQ A;  1CK1 A;  3HM3 A;  1J19 A;  3AB5 A;  2YVC A;  1Q5W B;  2LHD A;  3P4R B;  4YWG G;  1SEB D;  4NPN A;  2KDI A;  5DCN A;  2DAJ A;  2IND C;  3CST A;  3IBE A;  3QK0 A;  2KWU B;  1NEK B;  2WHI A;  5LXI B;  3KUC B;  4E71 A;  3UGB B;  2X38 A;  5HG2 A;  4BVU C;  1J7B A;  1Y56 A;  1T6B X;  4F7Z A;  1WRI A;  3NG0 A;  5FR6 A;  3RNF C;  1TZ1 A;  3DBR I;  2AQ3 B;  1ZE3 D;  3SU8 X;  4DXF A;  2BVC A;  2SAK A;  5IN7 A;  1QQR A;  3AN1 A;  3B1L X;  2LMC A;  1KRH A;  3RI7 C;  3NVY A;  1L6V A;  4A20 A;  3R7R A;  3A1Q B;  2OJR A;  3AV8 A;  3DPD A;  2RDH A;  3W1S C;  2YEP B;  4ARC A;  3AM9 A;  1C4C A;  2HDE A;  5J2R A;  4BZA A;  2NTT A;  3ZYY X;  2PJH A;  2LAS A;  2RD0 A;  1IYF A;  3SR6 A;  3DVG Y;  2C7H A;  1C4P A;  4S17 A;  3VH4 B;  4F8C B;  3WAM A;  1V49 A;  3C8Y A;  3RZF A;  2K1F A;  2MBH A;  4JE3 B;  4II3 B;  4LNO A;  3ML8 A;  1OTR B;  2LEK A;  2D3B A;  2HTM E;  4N59 A;  3L4P A;  4AS1 A;  1P7F A;  1TS5 A;  1TY2 A;  5C2T B;  1XXG A;  4YTP B;  2MP2 B;  1F1H A;  1FRR A;  4NZL B;  2KOX A;  3VDZ A;  5E6O A;  2KAC A;  2V4I B;  4L23 A;  2Z8L A;  3TL5 A;  4MT5 A;  1TS3 A;  1EU3 A;  1XF5 L;  1PDX A;  2LUM A;  2MBB B;  3A33 B;  2FCS A;  3MJW A;  3MTN B;  1TY0 A;  2KD0 A;  3V60 A;  3DWG C;  2QJL A;  3W1Y A;  1WX9 A;  2N9L A;  3VRB B;  2D2Q A;  1FCL A;  2K39 A;  1V86 A;  1DOI A;  3R2T A;  4L2Y A;  3MC9 A;  3LXF A;  1SXT A;  1T3Q A;  1E6E B;  4KDI C;  1DYQ A;  5I4D A;  1GB4 A;  4AWJ A;  1YJI A;  4IC7 B;  2J42 A;  3B2G A;  1Z2M A;  2ZJD A;  1L5P A;  2GOW A;  3T3N A;  3KWV A;  4ITK A;  4W9J A;  3EHV A;  3TMP B;  1AYF A;  4NJ6 A;  4K3B A;  2YEP F;  3VR9 B;  2NBW B;  3VR8 B;  2LRU A;  1WE6 A;  1N5X A;  4NJ7 A;  3RD2 A;  2IBI B;  3DVN V;  2WXN A;  2XK5 B;  5JXV A;  2L83 A;  3A1Q A;  1WSP A;  4FA6 A;  1GC7 A;  1RAX A;  2KK8 A;  3SFD B;  3A9K B;  2MJD A;  1LFD A;  1RFA A;  2M1M A;  4IM2 A;  5CHW A;  3WAP A;  3NS8 A;  4IDI A;  3BVZ A;  4WIP A;  4B6W A;  2N4F A;  2WXM A;  3EFU A;  1ZDV A;  1L4Z B;  2C60 A;  4NQL B;  1L7Y A;  1OQR A;  3ZO5 B;  1CZP A;  4OZC A;  3ZTC A;  1C77 A;  2ZNV C;  2CHW A;  1LQB A;  1V80 A;  2AWT A;  3AH7 A;  1TBE A;  2N1V A;  3DVN U;  1LO5 D;  1I7H A;  5J18 A;  1N63 A;  1J7C A;  2KWD A;  2OJW A;  1STE A;  3QX1 A;  2MP2 A;  4A55 A;  2RSU A;  2SEB D;  2OHF A;  4KGR A;  2PMV A;  3AE4 B;  2DZJ A;  1FXA A;  1BT0 A;  4ZYS A;  3AE2 B;  4PYU A;  2KZR A;  4PS7 A;  1M94 A;  3VQI A;  1GNU A;  3SDL C;  3R66 C;  2K22 A;  1T0Q C;  5EE9 A;  2D07 B;  4EZL A;  2NBU A;  2KO3 A;  2WXI A;  1FRD A;  4A3P A;  4PS8 A;  3HIZ A;  1G6J A;  1K8R B;  4W9I A;  2ZVO A;  2MQJ A;  2CJN A;  5JZE B;  1PYW D;  4ASW C;  4YL8 A;  1WZ0 A;  2MX2 A;  3N1Z C;  3L0W B;  4FUL A;  4HPP A;  2J0M A;  2ONQ A;  2L32 A;  4HJG E;  3AU4 A;  1H8C A;  2LD9 A;  4EEW A;  1XEE A;  3IT4 B;  2FAZ A;  2DNF A;  4KKI A;  2QSD A;  3RCZ A;  4MDK E;  2L0F A;  3FIL A;  4ZDV A;  1JW9 D;  3AMZ A;  4MGK E;  4C00 A;  1YQ3 B;  4E3C A;  2EEL A;  4KIK B;  4YSY B;  3UIN B;  2NVU I;  3H8H A;  4OVV A;  3Q3N C;  2XK5 A;  3GE8 C;  4MAC A;  1KFY B;  4FN2 A;  1F0Z A;  1WGR A;  3A9K A;  3QHT A;  1PUT A;  1NEN B;  2Z0D B;  2WXO A;  2WU5 B;  2L3Z A;  2FCN A;  2N9P C;  3CF6 E;  4K81 A;  1JRU A;  5HKH A;  1V6E A;  3KWL A;  4GB9 A;  1Q10 A;  4ZRJ A;  3ZRF A;  2LI5 A;  4XZ4 A;  2MBQ A;  2H88 B;  2WDV B;  4MGZ E;  3UI3 A;  4M01 A;  1IGC A;  1P1A A;  2KKC A;  2N7J A;  5G5H A;  3MC0 B;  5MPO A;  3DBR B;  5CHV C;  2K6Q A;  1I4P A;  3W1S A;  4B95 A;  2IY1 B;  1HXY D;  4II2 B;  1E8X A;  5AZG A;  3JW0 X;  4NAW B;  4IKG A;  4O1N A;  3IAM 1;  4MM3 B;  3A4R A;  2HJ8 A;  4J6I A;  2B76 B;  1EU4 A;  3R3M A;  1WFY A;  2LGD A;  4MH8 A;  4E74 A;  1I4G A;  4K3C A;  3PZD A;  1WMH A;  4GLS C;  2L7R A;  4W9G A;  2FID A;  4IWQ A;  1AAR A;  4QAY A;  2ZNV B;  2KJH B;  1HA5 A;  4JL9 A;  3EEC A;  1QF6 A;  1UBI A;  4XC2 A;  4DHJ D;  1SBB B;  4I6N B;  2K9X A;  2MA9 B;  2DZM A;  2EMT A;  1QIL A;  2G9H D;  3U7Z A;  4DXG A;  5T8I A;  3RN9 C;  2BT6 A;  2JUO A;  3QC8 B;  2DYB A;  2W55 A;  4KZ0 A;  4OZB A;  4RGO S;  4RGM A;  3U52 E;  2WXF A;  1RYJ A;  4D2K A;  4MGY E;  2MLB A;  2PKO A;  3DBS A;  4ACF A;  1RM6 C;  3H7P B;  1WYG A;  3CMM B;  3R2I A;  3ZGZ A;  4IUM B;  4TMA B;  3DHI C;  3APC A;  5L95 C;  1ENF A;  3RMK C;  3RNB C;  1YQB A;  4JWU C;  4DDG D;  2BYF A;  1L6U A;  4ZYN A;  5EDS A;  2PTL A;  1N60 A;  2RDB C;  3IXS A;  3ZNZ B;  1VZ7 A;  2ASQ A;  1L0Y B;  3WAO A;  3H9D A;  1WXA A;  1QOB A;  2M56 B;  2CR5 A;  4KGT A;  4WWO A;  2G4S A;  2NMQ A;  2GMI C;  3QQ8 B;  3NZU A;  1M4V A;  1CMX B;  3FAH A;  2G3Q B;  2DHZ A;  2JT4 B;  3U7D A;  2GBK A;  3P63 A;  2AQ1 B;  2R2Q A;  1JWS D;  3GZN I;  2L05 A;  4DWF A;  2AYO B;  2MH7 A;  5G5G A;  1C3T A;  5DPW A;  2FUH B;  1JRO A;  4NAW A;  3EA6 A;  1YN5 A;  2WNM A;  4MM3 A;  4XX5 A;  2QMT A;  4TV3 A;  1C78 A;  3S2A A;  1F2R C;  2NS5 A;  3DWM A;  4KGS A;  1WM3 A;  1HTO A;  4UDU C;  4AP4 C;  1SE4 A;  2K8C A;  1KLU D;  2JY6 A;  1PGX A;  4C7Y A;  1N5W A;  2V3S A;  4GMV A;  5FR3 A;  2Y5P A;  3QWZ B;  1KTK A;  4DBG A;  4OVU A;  3ZW3 A;  3GOE A;  1T0S C;  4GU2 A;  3AED B;  3J9C A;  4HXD A;  2KWV B;  5BMG A;  1SIF A;  3K9P B;  4M8M A;  4HK2 A;  1YX5 B;  4MH0 E;  2KYW A;  4KV2 A;  4EUT A;  4ICU A;  2BKR B;  3VTV A;  2L00 B;  4LNI A;  3NZS A;  2JRH A;  3H7P A;  2AX5 A;  1VDV A;  1P3Q U;  3RUL A;  3MJ5 A;  4P1B C;  4REZ A;  2JZ3 B;  1WRD B;  3LB8 C;  2V9H A;  5KHO A;  4YXD B;  4X57 B;  3TEY A;  1YN4 A;  4YSX B;  4N9F 4;  2M4N A;  4DHZ B;  3ALB A;  3VUX A;  3WCQ A;  1YN3 A;  2IO2 B;  5G55 A;  2JXT A;  5GXG B;  3BWU D;  1FMA D;  3NY5 A;  4K7S A;  2D10 A;  4A90 A;  3D32 A;  3MFG A;  4W9C A;  2JF5 A;  2KHW B;  2KFJ A;  3Q8E A;  5EE3 A;  1WJN A;  4XDD A;  3KVF B;  5D7G A;  1WR6 E;  2KVZ A;  3VH3 B;  2LGX A;  4G3X B;  1VZ8 A;  3W5U B;  1GUA B;  1TTN A;  1XCT L;  5H8Y E;  2JPH A;  3Q3F A;  3W2D A;  5LNK 1;  2J52 A;  3Q8B A;  4DHJ B;  4G50 A;  3TEX A;  1RLF A;  3NJT A;  1UUP A;  3Q3J A;  5JH5 C;  2TSS A;  4EFO A;  2BBC A;  2DYM A;  1WZ3 A;  2V3P A;  3DBL I;  3T3O A;  2KX0 A;  1MFW A;  2JRI B;  4KSL C;  4TQ0 A;  1RFK A;  1TKG A;  5TR5 A;  1P9D U;  2VZK D;  1WF9 A;  5BYQ A;  1ROE A;  2O6V B;  3TCA A;  3NOB A;  3KUZ A;  1OEY A;  4BKS A;  2DAF A;  3APF A;  1BXT A;  1ZGU B;  4WJN A;  4R3D A;  2WX0 A;  3HM6 X;  2QIE B;  2K5P A;  3ABV B;  2DZI A;  2C9W B;  1VJK A;  2KN5 A;  4XWT A;  3H1U A;  3AE5 B;  2MBE A;  1UGJ A;  4W9F A;  4TKN A;  4CO7 A;  2OOB B;  4G11 A;  2IGG A;  2LZ6 A;  2W3R A;  1SB3 C;  4ZRP A;  3UIP B;  2BYT A;  3QCA A;  3L17 A;  2IDY A;  1IPG A;  3I57 A;  4KKJ A;  3N1X C;  4HRO A;  1HEZ E;  2LWP A;  3ZIM A;  3PZ7 A;  2AEH A;  3I3T B;  2BYV E;  5DPT A;  3VTW A;  1R4N I;  3KYC D;  2AQ2 B;  3C0R B;  4LJO B;  4OZA A;  4XDC A;  2KC1 A;  3RNE C;  2JZZ A;  4N6E B;  1TKE A;  3FIL B;  1L0V B;  2WWZ A;  3ZLZ A;  2ACZ B;  2JWZ A;  1WXQ A;  3GS2 A;  4PK1 A;  1Q0W B;  1XO3 A;  4N58 A;  1NI3 A;  2LXA A;  4G0N B;  1WJU A;  2FNJ B;  3QAQ A;  3AE8 B;  3BIN A;  2WXQ A;  3Q14 C;  1S3S G;  1B1Z A;  3V6E B;  1SE2 A;  4WAA A;  1VCB A;  2GBR A;  3ENE A;  2K8B A;  2IO1 B;  2N7D A;  3AXC A;  1YIW A;  3PLU A;  3N3K B;  4DHZ E;  2V1Y A;  3U2S C;  3WAL A;  4ANX A;  1VZ6 A;  2QIL A;  4HCN B;  3AEE B;  2BGF A;  1MHX A;  2LHE A;  4DXA B;  4IWO A;  1E5W A;  5CTR C;  4I6P A;  1ZUD 2;  2D5G A;  3IFW B;  2LVQ A;  3C19 A;  3I9V 1;  1V5O A;  1SJE D;  2A5U A;  1GB1 A;  2O6V A;  1DOX A;  1UWM A;  1DOY A;  1AN8 A;  1SIJ A;  3R7Q A;  4BFR A;  4HDO A;  4BKG A;  5BYR A;  4LNN A;  2EMS A;  3DQV A;  1N62 A;  1YJ1 A;  2WP9 B;  2MSE D;  2Z59 B;  3PHW B;  4NY0 A;  4TUU A;  1WMH B;  1SSN A;  2ZCC A;  1V1P B;  2REX A;  4JGH B;  4KZC A;  3U30 A;  4RM8 A;  1FFV A;  2BS3 B;  2PE9 A;  1D6E C;  5IP4 D;  2DX5 B;  1YD8 U;  1JCK B;  2KNB A;  4FLH A;  2HE7 A;  4W9E A;  2PPH A;  3WA0 A;  5GMV A;  2V3N A;  3GZN B;  3ZDM C;  1R7S A;  5E6J A;  3TEW A;  4BKT A;  4JLC A;  2Y3A A;  3A9J B;  1YMH E;  5D2M B;  4EZK A;  2BTE A;  4FHK A;  2RMM A;  3V05 A;  4PT5 A;  3B9J A;  1WM2 A;  3O65 B;  1ET9 A;  4NQK E;  2V0G A;  2INC C;  4XE0 A;  4BKS D;  1V5T A;  2G4D B;  1MPE A;  3PS6 A;  2WXL A;  2LGY A;  4A9A A;  3I63 C;  3X0W A;  1WX7 A;  2RDG A;  1IP9 A;  3ZTD A;  4WJQ A;  2ZVN A;  1K51 A;  3ZUN A;  3LDZ E;  4ANV A;  4MSM B;  2JQR B;  1FCC C;  4CHK A;  2ZCB A;  3PLV A;  2BF8 B;  3U4E G;  3PZ8 A;  3RNA C;  2KDM A;  2VZK B;  2BB6 A;  1SF0 A;  2MHJ A;  3BYT B;  2BWF A;  5HI1 A;  2W54 A;  3KYD D;  3P2B A;  2DEN B;  3TUO A;  1OEY J;  2LFI A;  2ON8 A;  4FXC A;  2NR2 A;  3VUW A;  4LJP B;  1RWS A;  3PRZ A;  2X8X X;  2JZP A;  3EFC A;  1NDD A;  2KFK B;  1ZOY B;  3AE3 B;  3ZDT A;  1EF5 A;  1L2N A;  1ZW7 A;  4LDT D;  3HVZ A;  1WI0 A;  3OJ3 A;  1F2R I;  1C4A A;  1TS2 A;  3TSS A;  5C23 A;  2R61 A;  1LGR A;  3PO0 A;  3T8M A;  2GI9 A;  4JQW C;  1IGD A;  3Q2A C;  4FBJ B;  2J0J A;  1TYG B;  1WYW B;  2BB5 A;  1TGZ B;  3Q69 A;  2FE8 A;  1E7P B;  2IZV B;  4AUQ C;  1VR9 A;  5D94 A;  4LLG M;  2B3A A;  1V1P A;  5LXH A;  1KLG D;  2GBJ A;  3P1M A;  1DGJ A;  3RNC C;  1X1M A;  3RUI B;  3HK0 A;  1YX6 B;  3JYU A;  2BQQ A;  1WJ6 A;  2KTR B;  3DBL B;  3FKY A;  4ZOH C;  2XNA C;  3A9J A;  4K1R B;  3B0A A;  2VH1 A;  1CJE A;  2WXG A;  2QCZ A;  3BY4 B;  4LK0 M;  4RNA A;  3ZJV A;  2O6V D;  1UWX A;  2KAN A;  2M8S A;  3AEA B;  1FD6 A;  3M95 A;  1AWD A;  4HKQ A;  2I1K A;  3QJZ A;  1OGW A;  2MEK A;  2D3A A;  2BYE A;  3DHG C;  1FEH A;  3L16 A;  3Q3O C;  3EGR A;  4URK A;  4HPL B;  2PLP A;  3IG3 A;  1NVI D;  1L0X B;  4ZHP A;  1TIF A;  2L1A A;  3HHM A;  4DK5 A;  3UQB A;  3MC8 A;  1E90 A;  1WIA A;  4C80 A;  4XGA B;  3ZNH B;  5H92 C;  4HDQ A;  2E6X A;  2KWC A;  2M0A A;  3E56 A;  3E9S A;  1B9R A;  1T0Y A;  2GBN A;  2NPT A;  4NAM A;  2JYE A;  3RYT A;  2K3U A;  2QEJ C;  1XCQ L;  1JML A;  1QZE A;  5BO4 B;  4JWS C;  2WQY B;  2N9X A;  4USA A;  2J4X A;  1UZX B;  2KJR A;  1EWY C;  3AEC B;  4KSK C;  2JWU A;  1J0G A;  1FNV A;  1GPX A;  3L13 A;  2KFK A;  3DDC B;  3QA8 A;  3PTF C;  4BBN C;  1U4A A;  2KVR A;  1MJD A;  1R4N B;  1UF0 A;  2KLG A;  4HJK A;  1L4D B;  3ZXV A;  3OLM D;  2JYT A;  1PGB A;  1PQS A;  3BII D;  1ZKH A;  2C7N B;  3ZVV A;  4RH6 A;  1J8C A;  1WXS A;  2CJO A;  3JSV B;  3L08 A;  5G2N A;  1XLN A;  3NVZ A;  5D3D A;  1Z5S B;  1LXD A;  4ANU A;  2WXK A;  3ETR A;  1GAQ B;  1QT9 A;  3VHT C;  2WS3 B;  1F9J A;  1JRP A;  2LUE A;  3NUH B;  3OAW A;  2JX5 A;  1BML C;  2KJ6 A;  4ICV A; 
#chains in the Genus database with same CATH homology
 3VUY A;  1EUV B;  3HM6 X;  2DZJ A;  2M0X A;  4W9L A;  1BT0 A;  1E8Y A;  3CSF A;  4M0W B;  4EKU A;  4PYU A;  2KZR A;  4PS7 A;  1M94 A;  2DZI A;  5E6N A;  1GNU A;  2C9W B;  3SDL C;  3VQI A;  3R66 C;  1D3Z A;  2KN5 A;  1WGH A;  3IHP C;  2KTR A;  3H1U A;  2D07 B;  2MBE A;  4EZL A;  2NBU A;  4MEM A;  2KO3 A;  4PYZ A;  4W9F A;  5DPS A;  2C5L C;  1KM7 A;  4TKN A;  4A3P A;  4DDI D;  4CO7 A;  2G45 B;  2FCQ A;  2GBM A;  2OOB B;  2N7E A;  3AI5 A;  1V2Y A;  2HTH A;  3HIZ A;  4G11 A;  4PS8 A;  2L76 A;  1UBQ A;  1G6J A;  1K8R B;  4W9I A;  2LZ6 A;  4RMA A;  2ZVO A;  2MQJ A;  3UIP B;  5LLI A;  5JZE B;  3QCA A;  4NNJ B;  4ASW C;  1LM8 B;  2JXX A;  3L17 A;  2LXC A;  4YL8 A;  1WZ0 A;  1IPG A;  1KJT A;  2MX2 A;  3L0W B;  5JHB A;  3PGE A;  1KOT A;  3ZRC A;  4FUL A;  5AZH A;  2LWP A;  3ZIM A;  1V9J A;  2AEH A;  3I3T B;  4K7W A;  1KLV A;  2J0M A;  1WGG A;  4FJY A;  2BYV E;  2AL6 A;  1H8C A;  3AU4 A;  2BWE S;  5DPT A;  3VTW A;  1R4N I;  3PRP B;  2HD5 B;  2LD9 A;  4EEW A;  3H7S A;  2FCM A;  2KDF B;  3KYC D;  3SD5 A;  3C0R B;  4LDT B;  4LJO B;  4FJZ A;  2J0K A;  2KC1 A;  2FAZ A;  5JHA A;  2JZZ A;  3RCZ A;  4MDK E;  2L0F A;  3VTU A;  3PRE A;  4GOC A;  4ZDV A;  2WWZ A;  3ZLZ A;  3PPA A;  2JWZ A;  3PSE B;  3WIM A;  1WGD A;  4MGK E;  5L83 A;  3PHX B;  3KW5 B;  1Q0W B;  5E6P A;  2LXA A;  1XD3 B;  4G0N B;  1WJU A;  1C1Y B;  2FNJ B;  3QAQ A;  4W9H A;  4E3C A;  1Q1O A;  3BIN A;  4TQ1 A;  1GJZ A;  4KIK B;  3UIN B;  4KIK A;  2NVU I;  4OVV A;  1S3S G;  4ZRK A;  2XK5 A;  3V6E B;  3OJ4 B;  2QHO A;  3VFK A;  1WR1 A;  2KQS A;  2IYD B;  2K6D B;  4FN2 A;  4WAA A;  1I35 A;  1VCB A;  1WE7 A;  2GBR A;  3LJ3 A;  3L10 B;  1WGR A;  3KUD B;  3A9K A;  3QHT A;  3ENE A;  1WGY A;  2K8B A;  2IO1 B;  2MRP A;  2KXJ A;  2Z0D B;  2N7D A;  3AXC A;  3ONS A;  1YIW A;  3PLU A;  2N1W A;  3N3K B;  3DBH I;  4DHZ E;  4HLE A;  4AJY B;  2L3Z A;  2FCN A;  1MG8 A;  2N9P C;  2V1Y A;  3CF6 E;  4K81 A;  3PVL A;  2I1J A;  1JRU A;  5HKH A;  3WAL A;  4W9K A;  4ANX A;  1V6E A;  2KTF A;  4GB9 A;  4ZRJ A;  4KDL B;  4HCN B;  4MJS B;  3N32 A;  3N30 A;  2WDT B;  4RM9 A;  2BGF A;  3VVW B;  3M3J A;  3ZRF A;  3DOW A;  2LI5 A;  3JSV A;  4XZ4 A;  2DYO A;  2MBQ A;  1HE8 A;  3V6C B;  2JVC A;  4DXA B;  4IWO A;  1E5W A;  5CTR C;  4I6P A;  3IFW B;  4MGZ E;  2A4Z A;  5CHF A;  2LVQ A;  3QIJ A;  1V5O A;  1P1A A;  2A5U A;  2O6V A;  4I6L B;  4IG7 B;  2KKC A;  2LJ5 A;  3ZKJ C;  4IM3 A;  4GDL B;  5CHV C;  1E7U A;  2K6Q A;  4WWN A;  3W1S A;  4B95 A;  2IY1 B;  3R7Q A;  4BFR A;  4HDO A;  4BKG A;  1P0R A;  2IO0 B;  1E8X A;  4II2 B;  3UQA A;  1A5R A;  5AZG A;  3JW0 X;  3B08 A;  4NAW B;  2D11 A;  2EMS A;  4MGI E;  1I42 A;  1SE9 A;  2CS4 A;  3DQV A;  3A4R A;  2HJ8 A;  1YJ1 A;  2O2V B;  2MSE D;  2Z59 B;  1FXT B;  3K9O B;  1H4R A;  4J6I A;  4WWP A;  2DZK A;  2KLC A;  4IWP A;  3A4S C;  3PHW B;  3R3M A;  1WFY A;  2LGD A;  4IW0 A;  4NY0 A;  3U8Z A;  2ZPY A;  4TUU A;  4E74 A;  1WMH B;  3PZD A;  1WMH A;  2L7R A;  2ZCC A;  4W9G A;  4P7I A;  2FID A;  3IVF A;  5C1Z A;  4IWQ A;  2REX A;  4MEL A;  1AAR A;  2ZNV B;  4JGH B;  2KJH B;  4KZC A;  3U30 A;  4RM8 A;  1VD2 A;  2XBB C;  2EKE C;  2PE9 A;  2KDB A;  3ZNI D;  2XEW A;  5J17 A;  4JL9 A;  3EEC A;  3TJP A;  2DX5 B;  1UBI A;  2PEA A;  1YD8 U;  2LRW A;  2UWQ A;  3KH0 A;  3RT3 B;  4BOS C;  4XC2 A;  2KNB A;  4DHJ D;  4FLH A;  2HE7 A;  4W9E A;  2PPH A;  3WA0 A;  4ZRI A;  4I6N B;  5GMV A;  5AZF A;  4ANW A;  2MA9 B;  3ZDM C;  2DZM A;  2EMT A;  1E7V A;  4GN1 A;  2KQ7 A;  4BKT A;  2CHX A;  2WX1 A;  2KMA A;  4JLC A;  3A9J B;  2RGF A;  5D6J B;  2JUO A;  5D2M B;  3UIO B;  2VRR B;  4BOZ B;  2NBV B;  3V62 A;  4EZK A;  3QC8 B;  2J7Q B;  4FHK A;  3X23 A;  4AOF A;  2DYB A;  2AL3 A;  4GGQ A;  3HM3 A;  1J19 A;  1WM2 A;  2YVC A;  4KZ0 A;  3O65 B;  1Q5W B;  4NQK E;  4NPN A;  5CX3 A;  2M17 A;  2KDI A;  5IAA C;  4BKS D;  2R2O A;  1V5T A;  4KVG B;  2G4D B;  4JIO U;  2MLB A;  4MGY E;  5DCN A;  3PS6 A;  2DAJ A;  4B9K A;  2LGY A;  3V61 A;  3CST A;  3IBE A;  3DBS A;  3QK0 A;  3H7P B;  3X0W A;  2KWU B;  2IY0 B;  1WX7 A;  3CMM B;  1IP9 A;  4IUM B;  3ZTD A;  4WJQ A;  3ZNG C;  4WQO B;  2ZEQ A;  2FIF A;  2ZVN A;  3KUC B;  2KX3 A;  3APC A;  4E71 A;  3UGB B;  5L95 C;  5LXI B;  3ZUN A;  4BVU C;  3LDZ E;  4ANV A;  4MSM B;  1WXV A;  3M63 B;  1YQB A;  4WJO A;  4CHK A;  4DDG D;  2ZCB A;  4GDK B;  4MSQ B;  3RZW C;  3PLV A;  2BYF A;  4F7Z A;  2BF8 B;  3EC8 A;  5FR6 A;  1TZ1 A;  3DBR I;  4CYE A;  4ZYN A;  5EDS A;  2KC2 A;  3SU8 X;  2BWF A;  1EF1 A;  3DVG X;  4EZJ A;  3B1L X;  3ZNZ B;  4EOY A;  1WX8 A;  3KYD D;  3P2B A;  2ASQ A;  3WAO A;  2DEN B;  4W9D A;  3AU5 A;  3H9D A;  1OEY J;  1WXA A;  2CR5 A;  2NR2 A;  4A20 A;  3VUW A;  2L0T A;  4LJP B;  2G4S A;  3PRZ A;  4WWO A;  4HPM B;  2GMI C;  3R7R A;  4MJS A;  3A1Q B;  3SHQ A;  3M62 B;  4BBN F;  1GG3 A;  2LVO A;  1NDD A;  2OJR A;  3QQ8 B;  1R4M I;  5KHQ A;  2KFK B;  3DPD A;  3NZU A;  3W1S C;  1CMX B;  3ZDT A;  1EF5 A;  1L2N A;  2G3Q B;  2C7M B;  2DHZ A;  1ZW7 A;  2JT4 B;  2MW5 A;  4LDT D;  1WI0 A;  3U7D A;  3OJ3 A;  5J2R A;  2GBK A;  4PS3 A;  4LCD E;  4M8N A;  2PJH A;  2LAS A;  2R2Q A;  2RD0 A;  5C23 A;  3GZN I;  2L05 A;  4DWF A;  1IYF A;  4GDL A;  2MCN B;  3DVG Y;  2C7H A;  4F8C B;  2PE6 B;  3VH4 B;  2AYO B;  3WAM A;  1V49 A;  1C3T A;  2K25 A;  3T8M A;  2BPS A;  3RZF A;  2K1F A;  4JQW C;  2MBH A;  5DPW A;  2FUH B;  4IM0 A;  2KMC A;  4GSW A;  3DCG A;  4II3 B;  4NAW A;  4FBJ B;  2V4L A;  2J0J A;  3JVZ X;  4MM3 A;  1WYW B;  4XX5 A;  2O2V A;  1UEL A;  4FAD A;  5IA7 A;  3ML8 A;  1OTR B;  1TGZ B;  4TV3 A;  3S2A A;  2IZV B;  2NS5 A;  2CU1 A;  3UF8 A;  4HCP B;  4AUQ C;  1E8W A;  1WM3 A;  5D94 A;  1SGH A;  4AP4 C;  2B3A A;  1UGM A;  2K8C A;  2YLM A;  2MP2 B;  4FHJ A;  5AEK B;  3QAR A;  4K7U A;  5LXH A;  2JY6 A;  2KOX A;  2GBJ A;  2NCN A;  5E6O A;  3VDZ A;  2WYQ A;  2V3S A;  1X1M A;  3RUI B;  2CHZ A;  4HVB A;  4GMV A;  3VAW A;  3QWZ B;  4DBG A;  3TL5 A;  3HK0 A;  1YX6 B;  4OVU A;  3ZW3 A;  3GOE A;  4GU2 A;  3JYU A;  1WJ6 A;  1XQQ A;  3APD A;  4HXD A;  2CKH B;  2KWV B;  2KTR B;  2K8H A;  3A33 B;  2MBB B;  3A9J A;  1SIF A;  3K9P B;  4K1R B;  3B0A A;  2N9E B;  2FCS A;  3BY4 B;  4M8M A;  3MJW A;  4HK2 A;  1YX5 B;  3MTN B;  4A3O A;  2KD0 A;  2MWS B;  1P98 A;  2O6V D;  2KAN A;  2M8S A;  3V60 A;  4MH0 E;  3L54 A;  3M95 A;  4KV2 A;  4EUT A;  3W1Y A;  3ECI A;  1WX9 A;  1NBF C;  4GXB A;  2Z0E B;  2I1K A;  3QJZ A;  4ICU A;  1RRB A;  1OGW A;  3MHS D;  2BKR B;  3NHE B;  3VTV A;  1UD7 A;  2D2Q A;  2L00 B;  2BYE A;  2K39 A;  4URK A;  3L16 A;  4FJV B;  3NZS A;  4HPL B;  2JRH A;  1V86 A;  3H7P A;  3IG3 A;  2IO3 B;  1P3Q U;  1V81 A;  2RR9 A;  3RUL A;  1XT9 B;  1GC6 A;  3HHM A;  4DK5 A;  3H6N A;  2JZ3 B;  1WRD B;  3UQB A;  4KDI C;  4AJW A;  2KDE B;  1E90 A;  1WIA A;  5KHO A;  4X57 B;  3ZNH B;  4AWJ A;  2W9N A;  4GDK A;  4IC7 B;  4HDQ A;  3PT2 B;  4N9F 4;  2M4N A;  2KWC A;  4DHZ B;  3ALB A;  3VUX A;  1Z2M A;  2ZJD A;  5G55 A;  2IO2 B;  1T0Y A;  1WJ4 A;  3VXW A;  2GOW A;  2NPT B;  3NY5 A;  2GBN A;  2NPT A;  4W9J A;  3TIX A;  3RYT A;  3EHV A;  3TMP B;  4K7S A;  2D10 A;  4NJ6 A;  2UYZ B;  2WX0 A;  1QZE A;  5BO4 B;  3TBL D;  3T9L A;  2NBW B;  3WAN A;  3D32 A;  2LRU A;  1WE6 A;  4W9C A;  2JF5 A;  2KHW B;  2MBO A;  4NJ7 A;  2KFJ A;  2N9X A;  3RD2 A;  2IBI B;  1UZX B;  1WJN A;  2KJR A;  3DVN V;  5DPR A;  4KSK C;  3ML9 A;  1J0G A;  2XK5 B;  3KVF B;  5D7G A;  1WR6 E;  3A1Q A;  3VH3 B;  4FA6 A;  2LGX A;  1GC7 A;  4G3X B;  3L13 A;  2ZZP B;  2KFK A;  1RAX A;  2KK8 A;  3DDC B;  1GUA B;  1TTN A;  2ZPN A;  3A9K B;  3PTF C;  3QA8 A;  2JPH A;  4BBN C;  1U4A A;  1LFD A;  1RFA A;  1S1Q B;  2D3G A;  2M1M A;  2KVR A;  3Q3F A;  4GIV A;  4IM2 A;  5CHW A;  3WAP A;  1E8Z A;  3NS8 A;  2Y5B B;  1WY8 A;  2KLG A;  4HJK A;  3OLM D;  1NI2 A;  2L8J A;  1PQS A;  4DHJ B;  4B6W A;  2N4F A;  4G50 A;  3EFU A;  1RLF A;  1ZKH A;  2C7N B;  1UH6 A;  2C60 A;  3Q3J A;  3ZVV A;  4EFO A;  5JH5 C;  2DYM A;  1WZ3 A;  4NQL B;  3AUL A;  1J8C A;  3DBL I;  1L7Y A;  2KX0 A;  2JRI B;  4KSL C;  3ZO5 B;  3ZTC A;  1WXS A;  3JSV B;  4TQ0 A;  2ZNV C;  1Y8R C;  3L08 A;  4WJP A;  5G2N A;  2CHW A;  1OQY A;  2RPQ A;  5TR5 A;  2BKF A;  1P9D U;  1Z5S B;  1LQB A;  1LXD A;  1WF9 A;  4ANU A;  1V80 A;  2AWT A;  4HWI B;  1WH3 A;  1TBE A;  2N1V A;  2O6V B;  3DVN U;  3TCA A;  1WXM A;  3VHT C;  5J18 A;  3NOB A;  1F9J A;  2LUE A;  3KUZ A;  1ISN A;  1OEY A;  4BKS A;  3PRM B;  2DAF A;  3QX1 A;  3OAW A;  1EO6 A;  2MP2 A;  3APF A;  2LVP A;  2RSU A;  3PV1 A;  1ZGU B;  4WJN A;  2KJ6 A;  4F1S A;  4ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...