4E71A

Crystal structure of the rho gtpase binding domain of plexin b2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
90
Chain Sequence
EYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYRPDSVVLEWRPSTAQILSDLDLTSQRWKRVNTLMHYNVRDGATLILSKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the RHO GTPASE binding domain of Plexin B2
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Plexin-B2
total genus 20
structure length 90
sequence length 103
ec nomenclature
pdb deposition date 2012-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4e71A00
2EMSA 4IWQA 3ZDMC 2NPTA 4P7IA 2RGFA 1WF9A 1G6JA 1TBEA 3QHTA 4MGYE 4K7SA 1SE9A 1RAXA 2ZJDA 2M1MA 1P0RA 2ZVOA 3IVFA 5CHWA 3UIOB 1D3ZA 3RUIB 4IM2A 2CU1A 2FIFA 5D6JB 5HKHA 2KDFB 2R2QA 1KOTA 2KKCA 2V1YA 4WQOB 3HHMA 3R7QA 1U4AA 3L17A 1WJ4A 1I35A 4GSWA 3ZRFA 1J19A 3UF8A 2LRUA 3NZSA 2KLCA 3CSFA 4ASWC 4HCNB 5AZGA 1WE6A 2MWSB 3EFUA 1E7VA 3HIZA 3W1SA 1UELA 2LGXA 3CSTA 2N9PC 4W9CA 4FJZA 3ZNGC 3PHWB 2MX2A 4KIKA 1RFAA 1CMXB 3U8ZA 1UBQA 3DBLI 3PRMB 2BYEA 2KN5A 2JRIB 3DBRI 4EUTA 2FCQA 3BINA 1E8XA 2G45B 1GJZA 1WI0A 3C0RB 2C60A 2J0KA 2IO1B 2WWZA 2MRPA 2C7MB 2REXA 2ZPYA 4ZRJA 4BBNF 3KYDD 3NY5A 5KHOA 1BT0A 2M0XA 3H9DA 2RD0A 3M63B 2UWQA 3JYUA 2NBVB 4HPMB 4GGQA 2RR9A 5DPRA 4DDGD 2LI5A 2KFKA 2KMAA 4ZRIA 4DHZE 2V3SA 1SIFA 2KTFA 4NY0A 2LJ5A 4JIOU 4KZCA 1C3TA 4HCPB 4ZRKA 1WJUA 1YQBA 5JHBA 2DZKA 4GN1A 4WAAA 4DWFA 4G11A 3PHXB 3MJWA 2BKRB 2KTRA 3RULA 3V6CB 3VHTC 4I6PA 1GG3A 2K8BA 2CHXA 2ZCBA 3IHPC 4K7UA 3WA0A 4BOSC 2O2VB 4BKGA 2FCSA 3SD5A 2N9XA 3H6NA 4GIVA 4MGIE 4GOCA 3DQVA 4W9GA 4KDIC 2PE9A 2ZCCA 3JW0X 4WJNA 3W1YA 4AWJA 5CHVC 3S2AA 3WAMA 5LLIA 4IWOA 3IBEA 1WXSA 4FLHA 1E5WA 5JZEB 4WJPA 2KOXA 4W9KA 1WJNA 2EMTA 1IYFA 2KMCA 4HPLB 2K6QA 3AULA 3R7RA 3ZTDA 4EEWA 4MEMA 1KLVA 2MW5A 1R4NI 2DENB 4MDKE 2XK5A 1Q0WB 4ZDVA 1LXDA 2N9EB 3LDZE 5D2MB 2K8CA 3JVZX 4BKTA 3V62A 1E8ZA 5AZHA 4NPNA 4WWPA 5LXHA 2LRWA 2WX1A 4BFRA 1KJTA 2DZIA 1V49A 2MBEA 2L8JA 3PSEB 1TTNA 2UYZB 2ZVNA 2JPHA 1GC6A 1KM7A 3KH0A 3ZIMA 2GBKA 3SDLC 3TIXA 2O6VD 1PQSA 2KZRA 3PREA 4WWNA 1L7YA 3N32A 4PS7A 3V60A 3AU4A 1E7UA 1Q1OA 3ZNHB 4FADA 2JY6A 3B08A 3ZNID 4MELA 1YD8U 3L54A 5L83A 1OEYA 2DZMA 4HJKA 3VAWA 3VDZA 3ZO5B 2IY0B 2IZVB 1NDDA 1P3QU 4IWPA 1R4MI 1IP9A 5FR6A 1YX6B 4KV2A 3Q3FA 1WFYA 3Q3JA 2L05A 3NZUA 3EHVA 4GDKB 4WJQA 2O2VA 3DCGA 4KVGB 1WR1A 2KDBA 4HDOA 1T0YA 2K1FA 2OOBB 4LJOB 5DPSA 3L08A 3NS8A 2GBJA 1WGYA 1NBFC 1TGZB 1WIAA 1GC7A 2JVCA 3GOEA 3PPAA 4EFOA 3DVGY 2XEWA 4FA6A 3APCA 3A9JA 1NI2A 4B9KA 2KWVB 3VXWA 2KVRA 1S3SG 3O65B 5C23A 1A5RA 5J17A 5DPTA 2GOWA 2C5LC 4FHJA 4BKSA 2KFKB 3VH3B 4NJ7A 4F1SA 3MTNB 2FNJB 2DHZA 2FCMA 3IFWB 2K39A 2MBHA 2PEAA 4M8NA 1VD2A 3TMPB 3X23A 3A4SC 2KNBA 3B0AA 4NNJB 3DPDA 4GDLA 4W9DA 2V4LA 3HM3A 4XX5A 3ECIA 4W9FA 2LVPA 1JRUA 2J0JA 4IG7B 1LFDA 3CF6E 3N30A 1V81A 2KQSA 2G3QB 2CHZA 4GDKA 4ICUA 5D94A 4RM8A 2D10A 3A9KA 3QCAA 2KJ6A 3CMMB 1XD3B 4B6WA 2AEHA 1WMHA 1V86A 2FIDA 3A4RA 4W9IA 2GBRA 3QWZB 3RD2A 2D11A 4X57B 4A3OA 3SU8X 4JL9A 1OTRB 2DYMA 3KUCB 4PYZA 2D07B 1K8RB 3UQBA 3VQIA 2NVUI 3PLVA 1SGHA 2DYOA 5JHAA 5IA7A 2DZJA 1H8CA 2HJ8A 5E6NA 1E8WA 3V6EB 1WX9A 2ZPNA 4MGKE 1E90A 1GNUA 1V2YA 2M4NA 4GMVA 3DVNU 2KDIA 1WXAA 4LJPB 2CHWA 2AL6A 4BBNC 3ZKJC 4G0NB 4IW0A 3QA8A 1EO6A 2C7HA 2L0TA 1GUAB 1HE8A 3APFA 1V5OA 3H7SA 4MSQB 1L2NA 3KVFB 1S1QB 1WY8A 4EZJA 3UQAA 2QHOA 1XT9B 4YL8A 2XK5B 1WM3A 3HK0A 3UIPB 2JT4B 2NCNA 1I42A 3VTWA 2C7NB 4MJSA 3AI5A 4NQLB 2KHWB 2L7RA 3A1QB 1ZKHA 3DVGX 4NJ6A 3T8MA 4DHZB 5L95C 2K8HA 4F8CB 2BWFA 2WYQA 4MM3A 4AJWA 2LWPA 4N9F4 2YVCA 4PS3A 3L13A 4CO7A 4PS8A 1V80A 3PZDA 1WMHB 1YIWA 2Z0EB 2ASQA 3EECA 3PRPB 5CTRC 1UH6A 3QARA 4GU2A 1EF1A 2N1VA 3ENEA 2KWUB 1Z2MA 5BO4B 3JSVA 4II2B 3TJPA 1Q5WB 2JZZA 2KWCA 3ML9A 3HM6X 3IG3A 2O6VA 3TCAA 3RT3B 2G4SA 2D3GA 4FN2A 2GBMA 2I1KA 3PLUA 2JZ3B 2LZ6A 1RRBA 4W9JA 4AJYB 3WIMA 2RSUA 4DK5A 3KUDB 3AXCA 4XZ4A 2MBQA 2IO2B 5AZFA 4GXBA 3DDCB 4TKNA 2LVOA 4BVUC 2IO3B 5LXIB 3N3KB 1MG8A 3DBHI 3RZWC 4TUUA 4DHJB 4E3CA 1WGGA 2KD0A 2LD9A 4WWOA 3OAWA 2MLBA 3OJ3A 2JRHA 4DBGA 4TQ0A 1H4RA 4ANXA 2MBOA 4URKA 3QJZA 3L16A 2KJHB 1WX7A 3M3JA 1ZW7A 2MQJA 2MBBB 3I3TB 1UZXB 3QX1A 2YLMA 4ANVA 3K9PB 2FCNA 4HWIB 4CHKA 3R3MA 2ZEQA 1WXVA 2MCNB 3SHQA 3T9LA 3A9KB 2LUEA 3KYCD 4IM0A 1WZ0A 4FHKA 4I6NB 1WX8A 1WZ3A 4J6IA 1V6EA 3RZFA 2Y5BB 4AP4C 4K81A 1C1YB 2L76A 4G50A 1J0GA 2KLGA 5J2RA 5TR5A 4M8MA 3ZVVA 4MGZE 1OQYA 3KUZA 3VTVA 2IBIB 3PRZA 1OEYJ 4KZ0A 1QZEA 4FJVB 2GMIC 4ANWA 2KO3A 1X1MA 1IPGA 2L3ZA 2DYBA 2W9NA 3QQ8B 1ZGUB 4W9LA 4AUQC 3M62B 1F9JA 3L10B 3PTFC 3GZNI 2N1WA 2KC1A 2KDEB 2EKEC 3VTUA 2GBNA 3DOWA 2CKHB 2IYDB 1LM8B 2KX0A 5CHFA 2ZNVC 3A33B 2KTRB 3VH4B 4HK2A 3UGBB 2ZZPB 4RM9A 3WAOA 5KHQA 2KANA 3L0WB 4EOYA 3ALBA 3RYTA 2BKFA 3NOBA 2PPHA 2HD5B 2LXCA 1FXTB 4GB9A 3PT2B 4WJOA 2BF8B 1M94A 3H7PB 4HDQA 2KQ7A 4JLCA 1TZ1A 3QK0A 2L0FA 5G2NA 2BWES 1UGMA 3P2BA 2AL3A 4IM3A 2IO0B 1RLFA 3TBLD 4TV3A 4NQKE 4LDTB 4W9EA 4ICVA 4KDLB 1LQBA 4K1RB 2D2QA 3H1UA 3R66C 2MA9B 4FBJB 3QAQA 3W1SC 2IY1B 2KFJA 3V61A 4MJSB 2A4ZA 3WALA 3ZDTA 4OVVA 2R2OA 2JUOA 3WANA 2BYVE 4FULA 3KW5B 3VFKA 4ANUA 1P9DU 1WGHA 3H7PA 3ONSA 4TQ1A 4PYUA 4HVBA 2HE7A 2LGDA 2N4FA 4KSKC 4BOZB 5JH5C 3U7DA 2NBWB 1E8YA 2LXAA 5E6OA 3ZLZA 2JXXA 2L00B 3QIJA 4KIKB 1YX5B 2NBUA 3VUWA 3BY4B 1V9JA 5IAAC 3X0WA 5CX3A 2AYOB 2DAJA 1WXMA 4JQWC 3A1QA 1WJ6A 2DAFA 4HXDA 4EZKA 2C9WB 2N7EA 2MP2B 2WX0A 2MP2A 2KJRA 2ZNVB 3ZTCA 5D7GA 4MSMB 4E71A 1WH3A 2JWZA 1AARA 5G55A 4AOFA 2Z0DB 2WDTB 5DPWA 4MH0E 3OLMD 2Z59B 3TL5A 1WRDB 2B3AA 3MHSD 2BPSA 4K7WA 1WM2A 2BYFA 2NPTB 3VUXA 2CR5A 3JSVB 4IC7B 2FAZA 4A3PA 2LASA 3VVWB 1P98A 3AU5A 4LDTD 2DX5B 1P1AA 1EUVB 2HTHA 2J0MA 1Y8RC 2M8SA 2M17A 1ISNA 2LGYA 3QC8B 4GDLB 3VUYA 4DDID 2CS4A 2KK8A 4II3B 1WE7A 2NR2A 2K25A 3B1LX 4XC2A 4M0WB 4OVUA 1YJ1A 3ZW3A 3UINB 3D32A 2J7QB 2I1JA 4EKUA 3LJ3A 4KSLC 2RPQA 4DHJD 2KXJA 2XBBC 3PGEA 5C1ZA 4ZYNA 3U30A 5EDSA 2OJRA 3ZUNA 3OJ4B 3NHEB 2FUHB 4G3XB 3A9JB 4LCDE 5GMVA 2O6VB 1OGWA 2VRRB 4W9HA 3DBSA 3ML8A 2PE6B 3DVNV 4RMAA 4JGHB 3PVLA 2LVQA 1XQQA 3PV1A 3PS6A 4B95A 3RCZA 2MSED 3EC8A 2KC2A 3M95A 4EZLA 1UD7A 2PJHA 2A5UA 2KX3A 4E74A 1VCBA 5AEKB 3ZNZB 2JF5A 2NS5A 4DXAB 1WGRA 4NAWA 4NAWB 4A20A 1WR6E 3K9OB 5DCNA 2G4DB 4FJYA 3ZRCA 1UBIA 1WGDA 4I6LB 2K6DB 4BKSD 4CYEA 1V5TA 2AWTA 5J18A 3WAPA 1J8CA 5E6PA 1Z5SB 4HLEA 1WYWB 2BGFA 4IUMB 1EF5A 2N7DA 4F7ZA 3APDA
chains in the Genus database with same CATH superfamily
3QHTA 4MGYE 4C4VA 1FEHA 2AQ3B 1RAXA 3MC9A 1DOIA 2KWDA 3C8YA 2FIFA 1L0YB 2KDFB 3AH7A 4WQOB 3HHMA 4GSWA 5H92C 3NZSA 3TSSA 4HCNB 1WE6A 1E7VA 3HIZA 2LGXA 2N9PC 3V05A 3MFGA 2MX2A 1RFAA 3H8HA 3DBLI 4KX6B 3Q8EA 1EU4A 2KN5A 3P4SB 3RMKC 4K3CA 3BINA 2AQ2B 3GE8C 1ET9A 1F2RC 2IO1B 2G1EA 2C7MB 2ZPYA 4ZRJA 4RGNA 1FCLA 5KHOA 1BT0A 2M0XA 2LUMA 3M63B 2GB1A 2WS3B 4GGQA 5DPRA 1ZP0B 2LI5A 3DBHB 1SIFA 2KTFA 4JPSA 1D4BA 4JIOU 4HCPB 3MJ5A 4LNNA 4GN1A 2EELA 2LJIA 1YOVB 3V6CB 3AE7B 1UUPA 2K8BA 3IXSA 1C9FA 3FAHA 4BKGA 2WXQA 2N9XA 3H6NA 4W9GA 3JW0X 4IOIE 4WJNA 2Y3AA 3WAMA 3RNEC 3LXFA 5LLIA 3IBEA 1WXSA 4FLHA 1E5WA 2KOXA 1ENFA 2KMCA 3CWIA 2K6QA 3ZTDA 1KLVA 1HZ5A 4RH6A 4MDKE 2DENB 2XK5A 1Q0WB 3LDZE 5D2MB 2LGIA 5AZHA 3MP9A 2LRWA 4LK0M 2WX1A 3ZGZA 1V49A 2CU3A 2MBEA 4J3OD 1TTNA 2W54A 3ZIMA 1C76A 3RNCC 1YQ4B 1XEEA 3DWMA 3RPFC 1PQSA 3PREA 4TMAB 1L7YA 3N32A 4PS7A 3V60A 1Q1OA 4NAMA 1XXGA 4MELA 1YD8U 3AN1A 1OEYA 2BS2B 1JRPA 3VAWA 2IY0B 1NDDA 1P3QU 3GE3C 4IWPA 1V1PB 5FR6A 2UU7A 5C2TB 3Q3FA 2KDBA 2K1FA 1NBFC 1TGZB 1FO4A 1ZXIA 2XEWA 3ZJTA 3A9JA 4NJCA 3VXWA 3O65B 3MHZA 3VH3B 4F1SA 2DHZA 5G5HA 2QSDA 2K39A 2D5GA 2PEAA 3AEDB 1VD2A 3TMPB 3X23A 2KNBA 1EWCA 1CZPA 2WXNA 3B0AA 4NNJB 3HM3A 4XX5A 2CJOA 4OZBA 1JRUA 4IG7B 4P1BC 2L52A 3CF6E 2KQSA 4ICUA 4GDKA 4RM8A 2D10A 3QCAA 3CMMB 5HG2A 5H8YE 1V86A 3NS1A 4KGRA 3BYYB 1ZE3D 1TIFA 3FC4A 1OTRB 3KUCB 5JXVA 1B9RA 3VQIA 4M0WA 5IA7A 2HJ8A 5E6NA 4MGKE 2PIAA 4LNIA 1ZDVA 1WXAA 3DBLB 4M02A 2CHWA 2AL6A 4G0NB 4IW0A 1GUAB 1L2NA 1WY8A 4MACA 4RCOA 2JT4B 2IJ0A 1JWMD 2C7NB 3AI5A 1QT9A 1TYGB 2KHWB 2MHJA 3R8BA 4N9F4 5IN7A 2YVCA 4CO7A 1V80A 4B0EA 3PZDA 1SJED 3EECA 4FXCA 4GU2A 3N9YC 4PT5A 2JZZA 3TJPA 1FXAA 3TCAA 2D3GA 3PLUA 2LZ6A 4AJYB 3WIMA 3R2IA 3AXCA 4XZ4A 2IO2B 4GXBA 1YMHE 4DHJB 1WGGA 2LD9A 4TQ0A 2MBOA 3L16A 1WX7A 1ZW7A 4S17A 3U4EG 2MBBB 4ANVA 1RYJA 4HWIB 2MCNB 3V3XA 2X8XX 1VZ8A 3RZFA 4J6IA 4OVZA 1WX8A 1V6EA 4AP4C 1C4PA 3TEXA 2L76A 4L2YA 1I4HA 1OEYJ 2GMIC 2KO3A 1PDXA 1PYWD 1QQRA 1X1MA 2L3ZA 2DYBA 3Q8AA 3P42A 4AUQC 2BBCA 1F9JA 3L10B 1L6VA 2IGGA 1Y56A 1TJEA 2CKHB 1V1OA 2KX0A 2R61A 2DLBA 2KTRB 3VH4B 2LEKA 3LB8C 1N62A 3RYTA 2V3NA 2BKFA 2WXPA 3NOBA 1YJIA 1FXTB 3PT2B 2BF8B 3AB5A 4HKZE 2IGHA 2BTEA 4K1RB 3R66C 2MA9B 4HRSA 2KFJA 2RMMA 1NI3A 5BYSA 3I5JC 3ZDTA 4B0MA 2JUOA 4FULA 1XCTL 2RDHA 3SEBA 3H7PA 3AE5B 1Q10A 1TKYA 1A70A 4KSKC 4BOZB 3N1ZC 3U7DA 2D3AA 2VZKB 4C80A 4N6EB 3BZDB 3QIJA 1YX5B 5IKCM 3BY4B 4A6QA 4WQMA 3BVGA 2DAJA 1WXMA 1WJ6A 2DAFA 1M4VA 3VRBB 2N7EA 2VH2A 5D7GA 3BIID 1WH3A 1AARA 2WDVB 3AEEB 2WDTB 2B3AA 3MHSD 2M19A 2BYFA 2NPTB 3VVWB 4LDTD 1MHHE 2QEJC 2HTHA 2M8SA 2WXLA 4II3B 2K25A 4M0WB 1CQVA 4YT0B 4CQNA 3AE9B 1I7HA 3VR8B 3PGEA 3AECB 1MHXA 5GMVA 1KTKA 3PZ7A 4M00A 2K9XA 3DVNV 1J7CA 1T5XD 4RF1A 5FR3A 4OW0A 1SBBB 2V0GA 1NYQA 1ESFA 1UD7A 2PJHA 2KX3A 1L4ZB 1UF0A 2WDRB 4NAWA 3I63C 4A20A 1WR6E 3NVYA 2QCZA 3ZRCA 5J18A 1V5TA 1AN8A 2GI9A 2V9HA 1GAQB 1T3QA 2EMSA 3ZDMC 2LHEA 1WGKA 1SE9A 3IVFA 3UIOB 4IM2A 1OQRA 2WXRA 3R7QA 1U4AA 5IO9A 1FCCC 1I35A 3ZRFA 1J19A 1N60A 3EFUA 1UELA 3CSTA 3N1XC 3ZNGC 4KIKA 1CMXB 1F1HA 1LGRA 3DBRI 2JRIB 3DHGC 5E6JA 2BS4B 3C0RB 2Y5CA 2J0KA 2MRPA 2K3UA 2RD0A 3Q6BA 3EFCA 4HPMB 2K5PA 2V3SA 1GOZA 1DOYA 4OZCA 3FKYA 2LJ5A 2WDQB 1C3TA 5G5GA 5JHBA 4AQ7A 1NVID 4WAAA 2JYTA 3PHXB 1N63A 4I6PA 4US9A 4RNAA 3Q8FA 4AWJA 5CHVC 2BW2A 3S2AA 1GB1A 1WJNA 2EMTA 1IYFA 4HPLB 3R7RA 3E9SA 2MW5A 4RGTA 2K8CA 4HROA 3V62A 1ZOYB 4WWPA 2JYEA 2N9LA 1VDVA 4BFRA 2DZIA 4L1BA 2ZW0A 2L8JA 2UYZB 3P4RB 1KM7A 3KH0A 2GBKA 2O6VD 2KZRA 1FXIA 4YSZB 3ZJUA 3ZNHB 1QF6A 4FADA 2JY6A 4P1CC 3ZNID 1HTQA 3P4PB 3TEWA 1IP9A 1YX6B 4KV2A 2L05A 1FIQA 2WXKA 3NZUA 3EHVA 4WJQA 2MH7A 2XN9C 4KVGB 3Q2AC 2PMVA 4LJOB 5DPSA 3GOEA 4FA6A 2KVRA 3AV8A 3I9V1 5J17A 4WAFA 5DPTA 2GOWA 4FHJA 3O13A 3MTNB 5BMHA 1QLBB 4W9DA 3AMZA 2V4LA 4W9FA 2J0JA 2JQRB 1LFDA 2WXOA 2G3QB 2JZPA 1HQRD 4W9IA 3QWZB 3RD2A 1WYGA 2DYMA 1K8RB 1DYQA 1VR9A 3PLVA 2NTTA 1SGHA 2DYOA 2J4XA 2M4NA 4GMVA 3P1MA 2KDIA 2C7HA 2L0TA 2YEPB 1SIJA 3H7SA 4MSQB 1S1QB 1FRRA 4OHJA 4YTMB 1WM3A 1I42A 3VTWA 3ZJVA 4MJSA 2KN4A 4NQLB 2L7RA 3A1QB 3DVGX 1ZKHA 3CIRB 3T8MA 4F8CB 4AJWA 4MM3A 2LWPA 4PS3A 5C3JB 1WMHB 2ASQA 1JWAD 2WQYB 3AE4B 1PGXA 1ZUD2 3SR6A 1Q5WB 1IBXA 2TSSA 5IP4D 4D2KA 4FN2A 1AW7A 2RSUA 4ARCA 4ZRPA 1JROA 4TKNA 2LVOA 1QOAA 2CJNA 3DBHI 4DBGA 3OAWA 2MLBA 1H4RA 2ZW1A 3M3JA 1VLBA 1UZXB 2FBWB 2FCNA 3A9KB 3KYCD 4XDDA 4IM0A 1I4PA 2KQ4X 2PTLA 4RF0A 4FHKA 4I6NB 1CJEA 4JX1C 4Q2JA 3ZVVA 2RPVA 1IGDA 1ZGUB 3GP7A 3HVDA 3PTFC 2XNAC 4C00A 2EKEC 3Q3OC 1LM8B 3A33B 1AWDA 4A90A 3UGBB 3AEFB 3WAOA 2KANA 3ALBA 1XCQL 4GB9A 4WJOA 3OG5A 4HDQA 2KQ7A 1TZ1A 3KWVA 2L0FA 3ABVB 1UGMA 3P2BA 2AL3A 3C19A 4IM3A 2WU5B 4LLGM 4XYCA 4ICVA 4KDLB 3H1UA 3RI7C 3QAQA 2IY1B 3V61A 1MJDA 4MJSB 3AE8B 1RM6C 4EE2A 3U2SC 2BYVE 3KW5B 3VFKA 1WGHA 3IAS1 3ONSA 1STEA 1BMLC 1E8YA 4H2AA 2JSVX 1FNVA 2L00B 4JWUC 3VUWA 4KGSA 3ZQ4A 3NVWA 3X0WA 4JQWC 1EU3A 3A1QA 4HXDA 1DGJA 2C9WB 2MP2A 1XLPA 2JWZA 4AOFA 5G55A 2JX5A 1TS5A 4MH0E 3OLMD 3TL5A 1SB3C 4USAA 4K7WA 3NG0A 2CR5A 4IC7B 2FAZA 4A3PA 2J52A 4HKQA 4XDCA 1TKEA 3QC8B 1EUVB 2M17A 2LGYA 2H88B 1JWBD 1WE7A 2D3CA 1KRHA 1CK1A 2I2YA 1YJ1A 3ZW3A 1SE4A 2J7QB 2I1JA 3LJ3A 1KF6B 4KSLC 1D5MC 2KXJA 2XBBC 3AE3B 4BZAA 2OJRA 5FKAC 3ZUNA 1K51A 1OGWA 3DBSA 3ML8A 2PE6B 2OJWA 4MT5A 2LVQA 3PS6A 1L0VB 3EC8A 4E74A 1WGRA 2W3RA 2KYWA 5DCNA 2AWTA 1WYWB 1R7SA 4IUMB 4IDIA 1EF5A 1SXTA 3KWLA 4IWQA 2KAJA 3W2DA 4P7IA 1G6JA 2M1MA 2ZVOA 3NRZA 5CHWA 3RUIB 5D6JB 1AYFA 2KKCA 2V1YA 1WJ4A 4TSSA 2LRUA 4ZHPA 2KLCA 1F0ZA 1TS3A 5AZGA 2MWSB 2BQQA 1MI0A 1YNTE 4W9CA 4FJZA 4ZHOA 1UBQA 3PRMB 2E3TA 2FCQA 2MEKA 1E8XA 4WH4A 4C56C 2WXFA 1GJZA 1L4DB 1WI0A 2C60A 2WWZA 4BBNF 1E10A 3NY5A 4XWTA 1PGAA 4KGTA 5EE0A 2UWQA 3JYUA 2RR9A 3BK2A 2KFKA 3AEAB 4NY0A 1ZDXA 1ZXHA 4ZRKA 1JWSD 2N7JA 4DWFA 1TS4A 2WGSA 3MJWA 2BKRB 3RULA 3L4PA 4DQOC 1GG3A 2ZCBA 3IHPC 1VRAB 4K7UA 3RNAC 2FCSA 3SD5A 4GIVA 2ACZB 2ZCCA 3BYTB 1ROEA 3UI3A 4A8XC 2ICIA 2WLBA 4S0RA 4WJPA 4W9KA 3T3NA 3HRDD 3NUHB 4MEMA 1JQ4A 4LTUA 1VJKA 4BKTA 1E8ZA 4NPNA 5LXHA 1F77A 2QMTA 3PSEB 4XGAB 2ZVNA 1JW9D 3TIXA 1F52A 2I38A 4LNKA 4REZA 2N0SB 2V4IB 3U52E 3ZXRA 3B08A 3RN9C 3L54A 5L83A 4R3DA 2DZMA 2L32A 3VDZA 1SF0A 2KDMA 1R4MI 1BXTA 1V97A 1IGCA 1WFYA 3Q3NC 2BB6A 3DCGA 1JWUD 2E6XA 1T0YA 4WURA 4RFBA 1E7PB 4C4VB 1WGYA 1WIAA 4EFOA 3PPAA 3APCA 4B9KA 1HTOA 2SAKA 4LNOA 2C5LC 4BKSA 4QAYA 1VZ6A 5BMGA 4YTPB 4K3BA 2FNJB 3GZNB 1P7FA 2MJ3A 2FCMA 2MBHA 4XWWA 3AE6B 1WRIA 4GDLA 1ET6A 1WSPA 3ECIA 2LVPA 3N30A 4N59A 1V81A 3AEGB 4JE3B 3TEZA 3A9KA 2KJ6A 1EWYC 1XD3B 2GLSA 4B6WA 1L6UA 2GBRA 2D11A 4X57B 2WP9B 1K53A 3UQBA 2LHDA 3TUOA 1VZ7A 4N58A 1H8CA 2DZJA 1E8WA 3N1YC 3V6EB 2ZPNA 1E90A 1UWXA 1GB4A 2PVGC 3DVNU 2WXIA 4LJPB 3I57A 1FD6A 3QA8A 1L0XB 4L23A 3APFA 1V5OA 1XLOA 1KFYB 3UQAA 1XT9B 4YL8A 1T6BX 2NCNA 5BYRA 2IPKD 1QOBA 1C78A 2WNMA 4LNFA 1N5XA 2BWFA 3GS2A 3L13A 1R4MB 3URYA 2QDFA 5EE3A 1YIWA 2X38A 2Z0EB 5EE9A 5CTRC 1NYRA 1UH6A 2J42A 3QARA 1EF1A 2N1VA 4YTNB 3J9CA 2KWUB 5BO4B 5HHDG 1FNWA 4II2B 3HM6X 2O6VA 2VZKD 3BWUD 3BVZA 1RRBA 4W9JA 1FFUA 3EUB2 2MBQA 3NVZA 5AZFA 3DDCB 2H89B 5D3DA 4BVUC 3N3KB 1MG8A 5TSSA 3RZWC 2DWQA 4E3CA 3GB1A 3Q3MC 2JRHA 1I4QA 4M01A 4URKA 3QJZA 1IUEA 2MQJA 3I3TB 2JXTA 1B1ZA 2YLMA 4BAXA 1E0ZA 3K9PB 2ZEQA 1J7BA 3SHQA 3T9LA 3SFEB 1C4CA 1SE3A 1WZ0A 3W5UB 1WZ3A 1RFKA 2Y5BB 1PFDA 3IAM1 1C1YB 4C7ZA 2QIEB 5TR5A 2GRIA 4M8MA 2QC8A 4MGZE 1OQYA 1XLNA 3KUZA 3VTVA 2RDBC 2Z8LA 4KZ0A 4OZAA 4FJVB 4W9LA 1WWTA 2W9NA 3QQ8B 2N1WA 4RGMA 2KDEB 2SEBD 5CHFA 1K50A 1QKZA 4P16A 4RM9A 1C79A 3L0WB 2M56B 2PPHA 2HD5B 2LXCA 3H7PB 1M94A 1P7EA 4JLCA 5G2NA 2BWES 1XO3A 3TBLD 4TV3A 4NQKE 1T0QC 4W9EA 1D6EC 4WWMA 4FBJB 4OVVA 3VR9B 1IBXB 2OHFA 4ANUA 4PYUA 4ACFA 2LGDA 5JH5C 1LO5D 2LXAA 2PKOA 3ZLZA 2JXXA 4KIKB 4XE0A 5MPOA 2NBUA 1NEKB 1TKGA 1V9JA 2JWUA 1PUTA 5CX3A 1OFFA 2AYOB 1WXQA 3MC0B 4EZKA 2WX0A 3ZTCA 4MSMB 1MG4A 2N9KA 1WRDB 2WU2B 3ZXVA 3ZYYX 2LASA 1P98A 3B2FA 3AU5A 2DX5B 1P1AA 1Y8RC 1R4NB 1ISNA 4GDLB 3PZ8A 3VUYA 4DDID 2CS4A 2KK8A 4GLSC 5HFYA 4YSXB 2PW9A 1TY0A 3D32A 5BMIA 2G9HD 2RPQA 2PVOD 4ZYNA 5EDSA 1HXYD 2EKIA 4IKGA 4G3XB 3A9JB 4LCDE 1YN5A 1J7AA 4RMAA 1FMAD 3T3OA 2D3BA 4B95A 4UDUC 3RCZA 2KC2A 2BYTA 4EZLA 2A5UA 2BS3B 1VCBA 3ZNZB 2HTME 2NS5A 4DXAB 4NAWB 1YN4A 2G4DB 1UBIA 4I6LB 2K6DB 4CYEA 1F2RI 3WAPA 1Z5SB 4YWGG 2BGFA 1JALA 3W5VB 3OJ3A 2NPTA 2BVCA 2RGFA 1WF9A 1TBEA 4K7SA 2ZJDA 1P0RA 2YEPF 1TY2A 1D3ZA 3HVZA 1OQQA 2CU1A 2FUG1 5HKHA 2R2QA 1KOTA 1D5ZC 1I4GA 3L17A 1K52A 3UF8A 3CSFA 4ASWC 4P6VF 3RNFC 3W1SA 3FILA 3DHHC 4O1NA 3PHWB 1ACCA 2IDYA 3U8ZA 4YXDB 2BYEA 4EUTA 2KACA 2G45B 4HEA1 2REXA 2LFIA 3KYDD 3VRAB 1I4RA 3H9DA 5GXGB 4A55A 2NBVB 4DDGD 2KMAA 4HPPA 4ZRIA 4DHZE 4KZCA 1DOXA 1WJUA 1SSNA 1YQBA 2KMMA 1HEZE 2DZKA 4G11A 2AQ1B 2M0AA 4PK1A 2KTRA 3SFDB 3VHTC 1TZOA 3WA0A 2W82A 2CHXA 4BOSC 4MH8A 2INCC 2O2VB 1QOGA 4MGIE 4GOCA 3DQVA 2HJ1A 4KDIC 2PE9A 3W1YA 4ZYSA 4IWOA 3E56A 5JZEB 2QJLA 3AULA 2ONQA 2K22A 4EEWA 4ITKA 2MJDA 1R4NI 4ZDVA 1LXDA 2N9EB 3JVZX 3ETRA 1KJTA 3DWGC 1JMLA 4ARIA 3BVMA 1HZ6A 2JPHA 1GC6A 3SDLC 3U7ZA 2W55A 5IOIA 4WWNA 3AU4A 1E7UA 3KQ4A 5FK9C 3Q8CA 1N5WA 1RWSA 2DNFA 4HJKA 3ZO5B 2IZVB 1N6ZA 5I4DA 4ZOHC 1ZPSA 3Q3JA 1YJJA 4GDKB 3HUIA 2O2VA 1WR1A 1FM0D 4HDOA 2OOBB 3L08A 1XLQA 2GBJA 3NS8A 4DXGA 2JVCA 1GC7A 2WXGA 3DVGY 1NI2A 2KWVB 5D3IB 5C23A 1S3SG 1E6EB 1A5RA 2INPE 2KFKB 1KLGD 3FILB 4NJ7A 4HJGE 3IFWB 4M8NA 1V8CA 1D5XC 3A4SC 1HA5A 3DPDA 3RNGC 2L83A 2CHZA 2J53A 3BK1A 5D94A 3Q14C 2AEHA 1WMHA 3A4RA 2FIDA 3DBRB 1QILA 3Q8BA 3NVVA 1N61A 4A3OA 3SU8X 4JL9A 4PYZA 2D07B 2INNE 4AS1A 2NVUI 4WIPA 5JHAA 3NJTA 1WX9A 1GNUA 1V2YA 1KH0A 1TS2A 4A9AA 4BBNC 3ZKJC 1SE2A 1GPXA 1EO6A 1HE8A 3RFZB 1UNSA 3KVFB 4EZJA 2QHOA 4YSYB 2XK5B 4JWSC 3HK0A 3UIPB 3P63A 1UGJA 2IGDA 3WCQA 4NJ6A 3N20C 4DHZB 5L95C 2K8HA 2WYQA 1QOFA 4MM3B 4ZRQA 4PS8A 2JU6X 3PRPB 1SJHD 3DHIC 3B9JA 3ENEA 1Z2MA 3JSVA 2KWCA 2Q5WD 3ML9A 3IG3A 3RT3B 2G4SA 2GBMA 2I1KA 2JZ3B 2WXMA 1V1PA 4DK5A 3RNBC 3KUDB 3PO0A 1FFVA 5LXIB 2IO3B 3IT6B 4TUUA 2WHIA 2RDGA 2KD0A 4WWOA 4ANXA 2KJHB 2WXHA 1YN3A 3QX1A 1MVKA 4CHKA 2OEDA 3R3MA 2FE8A 1WXVA 3P4QB 2LUEA 3W9CB 1XF5L 4DXFA 2L1AA 1JCKB 1E9MA 2B76B 2DBYA 4K81A 1J0GA 4G50A 2KLGA 5J2RA 2NMQA 3OWEB 2IBIB 3PRZA 2W3SA 1QZEA 4ANWA 3EA6A 2PLPA 1IPGA 3M62B 3GZNI 2KC1A 3VTUA 2GBNA 3DOWA 2MJEA 2IYDB 2NTSA 2ZNVC 4HK2A 2ZZPB 5KHQA 4EOYA 3AE2B 3NZ3A 2BB5A 3KLSX 3QK0A 3R2TA 2IO0B 1RLFA 3TEYA 3Q69A 4LDTB 1C77A 1LQBA 4RGOS 2D2QA 2LMCA 2BT6A 3W1SC 1T0RC 2A4ZA 3WALA 2Y5PA 2R2OA 5HI1A 2WXJA 5AUKA 3WANA 4KKIA 1TT5B 1P9DU 5AUIA 5LNK1 1FRDA 4TQ1A 4US8A 4HVBA 2HE7A 2N4FA 2NBWB 5E6OA 1T0SC 2KVZA 3IT4B 5IAAC 1NENB 4NZLB 1C4AA 1BUIC 2MP2B 3B2GA 2KJRA 2ZNVB 5T8IA 4E71A 1MPEA 2Z0DB 5DPWA 3AEBB 1YQ3B 2Z59B 1L5PA 2BPSA 1WM2A 3VUXA 3JSVB 2V3PA 1I4XA 2J0MA 2HDEA 2KT7A 2AX5A 2NR2A 3B1LX 4XC2A 4OVUA 2ON8A 2LGSA 1SEBD 1MFWA 2K0PA 2QILA 3UINB 1FPYA 4EKUA 4DHJD 1FNUA 5C1ZA 3U30A 3MC8A 3OJ4B 3NHEB 2FUHB 3AE1B 5EE1A 1EM7A 2O6VB 2VRRB 4W9HA 1KLUD 3LYYA 4JGHB 3PVLA 1PGBA 1XQQA 3EGRA 3PV1A 2MSED 2VH1A 4KKJA 3M95A 5AEKB 2JF5A 5BYQA 3K9OB 1UWMA 4FJYA 1WGDA 4BKSD 1J8CA 3AM9A 4C7YA 5E6PA 4HLEA 2INDC 2N7DA 4F7ZA 3APDA
chains in the Genus database with same CATH topology
2EMSA 4IWQA 3ZDMC 2NPTA 4P7IA 2RGFA 1WF9A 1G6JA 1TBEA 3QHTA 4MGYE 4K7SA 1SE9A 1RAXA 2ZJDA 2M1MA 1P0RA 2ZVOA 3IVFA 5CHWA 3UIOB 1D3ZA 3RUIB 4IM2A 2CU1A 2FIFA 5D6JB 5HKHA 2KDFB 2R2QA 1KOTA 2KKCA 2V1YA 4WQOB 3HHMA 3R7QA 1U4AA 3L17A 1WJ4A 1I35A 4GSWA 3ZRFA 1J19A 3UF8A 2LRUA 3NZSA 2KLCA 3CSFA 4ASWC 4HCNB 5AZGA 1WE6A 2MWSB 3EFUA 1E7VA 3HIZA 3W1SA 1UELA 2LGXA 3CSTA 2N9PC 4W9CA 4FJZA 3ZNGC 3PHWB 2MX2A 4KIKA 1RFAA 1CMXB 3U8ZA 1UBQA 3DBLI 3PRMB 2BYEA 2KN5A 2JRIB 3DBRI 4EUTA 2FCQA 3BINA 1E8XA 2G45B 1GJZA 1WI0A 3C0RB 2C60A 2J0KA 2IO1B 2WWZA 2MRPA 2C7MB 2REXA 2ZPYA 4ZRJA 4BBNF 3KYDD 3NY5A 5KHOA 1BT0A 2M0XA 3H9DA 2RD0A 3M63B 2UWQA 3JYUA 2NBVB 4HPMB 4GGQA 2RR9A 5DPRA 4DDGD 2LI5A 2KFKA 2KMAA 4ZRIA 4DHZE 2V3SA 1SIFA 2KTFA 4NY0A 2LJ5A 4JIOU 4KZCA 1C3TA 4HCPB 4ZRKA 1WJUA 1YQBA 5JHBA 2DZKA 4GN1A 4WAAA 4DWFA 4G11A 3PHXB 3MJWA 2BKRB 2KTRA 3RULA 3V6CB 3VHTC 4I6PA 1GG3A 2K8BA 2CHXA 2ZCBA 3IHPC 4K7UA 3WA0A 4BOSC 2O2VB 4BKGA 2FCSA 3SD5A 2N9XA 3H6NA 4GIVA 4MGIE 4GOCA 3DQVA 4W9GA 4KDIC 2PE9A 2ZCCA 3JW0X 4WJNA 3W1YA 4AWJA 5CHVC 3S2AA 3WAMA 5LLIA 4IWOA 3IBEA 1WXSA 4FLHA 1E5WA 5JZEB 4WJPA 2KOXA 4W9KA 1WJNA 2EMTA 1IYFA 2KMCA 4HPLB 2K6QA 3AULA 3R7RA 3ZTDA 4EEWA 4MEMA 1KLVA 2MW5A 1R4NI 2DENB 4MDKE 2XK5A 1Q0WB 4ZDVA 1LXDA 2N9EB 3LDZE 5D2MB 2K8CA 3JVZX 4BKTA 3V62A 1E8ZA 5AZHA 4NPNA 4WWPA 5LXHA 2LRWA 2WX1A 4BFRA 1KJTA 2DZIA 1V49A 2MBEA 2L8JA 3PSEB 1TTNA 2UYZB 2ZVNA 2JPHA 1GC6A 1KM7A 3KH0A 3ZIMA 2GBKA 3SDLC 3TIXA 2O6VD 1PQSA 2KZRA 3PREA 4WWNA 1L7YA 3N32A 4PS7A 3V60A 3AU4A 1E7UA 1Q1OA 3ZNHB 4FADA 2JY6A 3B08A 3ZNID 4MELA 1YD8U 3L54A 5L83A 1OEYA 2DZMA 4HJKA 3VAWA 3VDZA 3ZO5B 2IY0B 2IZVB 1NDDA 1P3QU 4IWPA 1R4MI 1IP9A 5FR6A 1YX6B 4KV2A 3Q3FA 1WFYA 3Q3JA 2L05A 3NZUA 3EHVA 4GDKB 4WJQA 2O2VA 3DCGA 4KVGB 1WR1A 2KDBA 4HDOA 1T0YA 2K1FA 2OOBB 4LJOB 5DPSA 3L08A 3NS8A 2GBJA 1WGYA 1NBFC 1TGZB 1WIAA 1GC7A 2JVCA 3GOEA 3PPAA 4EFOA 3DVGY 2XEWA 4FA6A 3APCA 3A9JA 1NI2A 4B9KA 2KWVB 3VXWA 2KVRA 1S3SG 3O65B 5C23A 1A5RA 5J17A 5DPTA 2GOWA 2C5LC 4FHJA 4BKSA 2KFKB 3VH3B 4NJ7A 4F1SA 3MTNB 2FNJB 2DHZA 2FCMA 3IFWB 2K39A 2MBHA 2PEAA 4M8NA 1VD2A 3TMPB 3X23A 3A4SC 2KNBA 3B0AA 4NNJB 3DPDA 4GDLA 4W9DA 2V4LA 3HM3A 4XX5A 3ECIA 4W9FA 2LVPA 1JRUA 2J0JA 4IG7B 1LFDA 3CF6E 3N30A 1V81A 2KQSA 2G3QB 2CHZA 4GDKA 4ICUA 5D94A 4RM8A 2D10A 3A9KA 3QCAA 2KJ6A 3CMMB 1XD3B 4B6WA 2AEHA 1WMHA 1V86A 2FIDA 3A4RA 4W9IA 2GBRA 3QWZB 3RD2A 2D11A 4X57B 4A3OA 3SU8X 4JL9A 1OTRB 2DYMA 3KUCB 4PYZA 2D07B 1K8RB 3UQBA 3VQIA 2NVUI 3PLVA 1SGHA 2DYOA 5JHAA 5IA7A 2DZJA 1H8CA 2HJ8A 5E6NA 1E8WA 3V6EB 1WX9A 2ZPNA 4MGKE 1E90A 1GNUA 1V2YA 2M4NA 4GMVA 3DVNU 2KDIA 1WXAA 4LJPB 2CHWA 2AL6A 4BBNC 3ZKJC 4G0NB 4IW0A 3QA8A 1EO6A 2C7HA 2L0TA 1GUAB 1HE8A 3APFA 1V5OA 3H7SA 4MSQB 1L2NA 3KVFB 1S1QB 1WY8A 4EZJA 3UQAA 2QHOA 1XT9B 4YL8A 2XK5B 1WM3A 3HK0A 3UIPB 2JT4B 2NCNA 1I42A 3VTWA 2C7NB 4MJSA 3AI5A 4NQLB 2KHWB 2L7RA 3A1QB 1ZKHA 3DVGX 4NJ6A 3T8MA 4DHZB 5L95C 2K8HA 4F8CB 2BWFA 2WYQA 4MM3A 4AJWA 2LWPA 4N9F4 2YVCA 4PS3A 3L13A 4CO7A 4PS8A 1V80A 3PZDA 1WMHB 1YIWA 2Z0EB 2ASQA 3EECA 3PRPB 5CTRC 1UH6A 3QARA 4GU2A 1EF1A 2N1VA 3ENEA 2KWUB 1Z2MA 5BO4B 3JSVA 4II2B 3TJPA 1Q5WB 2JZZA 2KWCA 3ML9A 3HM6X 3IG3A 2O6VA 3TCAA 3RT3B 2G4SA 2D3GA 4FN2A 2GBMA 2I1KA 3PLUA 2JZ3B 2LZ6A 1RRBA 4W9JA 4AJYB 3WIMA 2RSUA 4DK5A 3KUDB 3AXCA 4XZ4A 2MBQA 2IO2B 5AZFA 4GXBA 3DDCB 4TKNA 2LVOA 4BVUC 2IO3B 5LXIB 3N3KB 1MG8A 3DBHI 3RZWC 4TUUA 4DHJB 4E3CA 1WGGA 2KD0A 2LD9A 4WWOA 3OAWA 2MLBA 3OJ3A 2JRHA 4DBGA 4TQ0A 1H4RA 4ANXA 2MBOA 4URKA 3QJZA 3L16A 2KJHB 1WX7A 3M3JA 1ZW7A 2MQJA 2MBBB 3I3TB 1UZXB 3QX1A 2YLMA 4ANVA 3K9PB 2FCNA 4HWIB 4CHKA 3R3MA 2ZEQA 1WXVA 2MCNB 3SHQA 3T9LA 3A9KB 2LUEA 3KYCD 4IM0A 1WZ0A 4FHKA 4I6NB 1WX8A 1WZ3A 4J6IA 1V6EA 3RZFA 2Y5BB 4AP4C 4K81A 1C1YB 2L76A 4G50A 1J0GA 2KLGA 5J2RA 5TR5A 4M8MA 3ZVVA 4MGZE 1OQYA 3KUZA 3VTVA 2IBIB 3PRZA 1OEYJ 4KZ0A 1QZEA 4FJVB 2GMIC 4ANWA 2KO3A 1X1MA 1IPGA 2L3ZA 2DYBA 2W9NA 3QQ8B 1ZGUB 4W9LA 4AUQC 3M62B 1F9JA 3L10B 3PTFC 3GZNI 2N1WA 2KC1A 2KDEB 2EKEC 3VTUA 2GBNA 3DOWA 2CKHB 2IYDB 1LM8B 2KX0A 5CHFA 2ZNVC 3A33B 2KTRB 3VH4B 4HK2A 3UGBB 2ZZPB 4RM9A 3WAOA 5KHQA 2KANA 3L0WB 4EOYA 3ALBA 3RYTA 2BKFA 3NOBA 2PPHA 2HD5B 2LXCA 1FXTB 4GB9A 3PT2B 4WJOA 2BF8B 1M94A 3H7PB 4HDQA 2KQ7A 4JLCA 1TZ1A 3QK0A 2L0FA 5G2NA 2BWES 1UGMA 3P2BA 2AL3A 4IM3A 2IO0B 1RLFA 3TBLD 4TV3A 4NQKE 4LDTB 4W9EA 4ICVA 4KDLB 1LQBA 4K1RB 2D2QA 3H1UA 3R66C 2MA9B 4FBJB 3QAQA 3W1SC 2IY1B 2KFJA 3V61A 4MJSB 2A4ZA 3WALA 3ZDTA 4OVVA 2R2OA 2JUOA 3WANA 2BYVE 4FULA 3KW5B 3VFKA 4ANUA 1P9DU 1WGHA 3H7PA 3ONSA 4TQ1A 4PYUA 4HVBA 2HE7A 2LGDA 2N4FA 4KSKC 4BOZB 5JH5C 3U7DA 2NBWB 1E8YA 2LXAA 5E6OA 3ZLZA 2JXXA 2L00B 3QIJA 4KIKB 1YX5B 2NBUA 3VUWA 3BY4B 1V9JA 5IAAC 3X0WA 5CX3A 2AYOB 2DAJA 1WXMA 4JQWC 3A1QA 1WJ6A 2DAFA 4HXDA 4EZKA 2C9WB 2N7EA 2MP2B 2WX0A 2MP2A 2KJRA 2ZNVB 3ZTCA 5D7GA 4MSMB 4E71A 1WH3A 2JWZA 1AARA 5G55A 4AOFA 2Z0DB 2WDTB 5DPWA 4MH0E 3OLMD 2Z59B 3TL5A 1WRDB 2B3AA 3MHSD 2BPSA 4K7WA 1WM2A 2BYFA 2NPTB 3VUXA 2CR5A 3JSVB 4IC7B 2FAZA 4A3PA 2LASA 3VVWB 1P98A 3AU5A 4LDTD 2DX5B 1P1AA 1EUVB 2HTHA 2J0MA 1Y8RC 2M8SA 2M17A 1ISNA 2LGYA 3QC8B 4GDLB 3VUYA 4DDID 2CS4A 2KK8A 4II3B 1WE7A 2NR2A 2K25A 3B1LX 4XC2A 4M0WB 4OVUA 1YJ1A 3ZW3A 3UINB 3D32A 2J7QB 2I1JA 4EKUA 3LJ3A 4KSLC 2RPQA 4DHJD 2KXJA 2XBBC 3PGEA 5C1ZA 4ZYNA 3U30A 5EDSA 2OJRA 3ZUNA 3OJ4B 3NHEB 2FUHB 4G3XB 3A9JB 4LCDE 5GMVA 2O6VB 1OGWA 2VRRB 4W9HA 3DBSA 3ML8A 2PE6B 3DVNV 4RMAA 4JGHB 3PVLA 2LVQA 1XQQA 3PV1A 3PS6A 4B95A 3RCZA 2MSED 3EC8A 2KC2A 3M95A 4EZLA 1UD7A 2PJHA 2A5UA 2KX3A 4E74A 1VCBA 5AEKB 3ZNZB 2JF5A 2NS5A 4DXAB 1WGRA 4NAWA 4NAWB 4A20A 1WR6E 3K9OB 5DCNA 2G4DB 4FJYA 3ZRCA 1UBIA 1WGDA 4I6LB 2K6DB 4BKSD 4CYEA 1V5TA 2AWTA 5J18A 3WAPA 1J8CA 5E6PA 1Z5SB 4HLEA 1WYWB 2BGFA 4IUMB 1EF5A 2N7DA 4F7ZA 3APDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EMS A;  4IWQ A;  3ZDM C;  2NPT A;  4P7I A;  2RGF A;  1WF9 A;  1G6J A;  1TBE A;  3QHT A;  4MGY E;  4K7S A;  1SE9 A;  1RAX A;  2ZJD A;  2M1M A;  1P0R A;  2ZVO A;  3IVF A;  5CHW A;  3UIO B;  1D3Z A;  3RUI B;  4IM2 A;  2CU1 A;  2FIF A;  5D6J B;  5HKH A;  2KDF B;  2R2Q A;  1KOT A;  2KKC A;  2V1Y A;  4WQO B;  3HHM A;  3R7Q A;  1U4A A;  3L17 A;  1WJ4 A;  1I35 A;  4GSW A;  3ZRF A;  1J19 A;  3UF8 A;  2LRU A;  3NZS A;  2KLC A;  3CSF A;  4ASW C;  4HCN B;  5AZG A;  1WE6 A;  2MWS B;  3EFU A;  1E7V A;  3HIZ A;  3W1S A;  1UEL A;  2LGX A;  3CST A;  2N9P C;  4W9C A;  4FJZ A;  3ZNG C;  3PHW B;  2MX2 A;  4KIK A;  1RFA A;  1CMX B;  3U8Z A;  1UBQ A;  3DBL I;  3PRM B;  2BYE A;  2KN5 A;  2JRI B;  3DBR I;  4EUT A;  2FCQ A;  3BIN A;  1E8X A;  2G45 B;  1GJZ A;  1WI0 A;  3C0R B;  2C60 A;  2J0K A;  2IO1 B;  2WWZ A;  2MRP A;  2C7M B;  2REX A;  2ZPY A;  4ZRJ A;  4BBN F;  3KYD D;  3NY5 A;  5KHO A;  1BT0 A;  2M0X A;  3H9D A;  2RD0 A;  3M63 B;  2UWQ A;  3JYU A;  2NBV B;  4HPM B;  4GGQ A;  2RR9 A;  5DPR A;  4DDG D;  2LI5 A;  2KFK A;  2KMA A;  4ZRI A;  4DHZ E;  2V3S A;  1SIF A;  2KTF A;  4NY0 A;  2LJ5 A;  4JIO U;  4KZC A;  1C3T A;  4HCP B;  4ZRK A;  1WJU A;  1YQB A;  5JHB A;  2DZK A;  4GN1 A;  4WAA A;  4DWF A;  4G11 A;  3PHX B;  3MJW A;  2BKR B;  2KTR A;  3RUL A;  3V6C B;  3VHT C;  4I6P A;  1GG3 A;  2K8B A;  2CHX A;  2ZCB A;  3IHP C;  4K7U A;  3WA0 A;  4BOS C;  2O2V B;  4BKG A;  2FCS A;  3SD5 A;  2N9X A;  3H6N A;  4GIV A;  4MGI E;  4GOC A;  3DQV A;  4W9G A;  4KDI C;  2PE9 A;  2ZCC A;  3JW0 X;  4WJN A;  3W1Y A;  4AWJ A;  5CHV C;  3S2A A;  3WAM A;  5LLI A;  4IWO A;  3IBE A;  1WXS A;  4FLH A;  1E5W A;  5JZE B;  4WJP A;  2KOX A;  4W9K A;  1WJN A;  2EMT A;  1IYF A;  2KMC A;  4HPL B;  2K6Q A;  3AUL A;  3R7R A;  3ZTD A;  4EEW A;  4MEM A;  1KLV A;  2MW5 A;  1R4N I;  2DEN B;  4MDK E;  2XK5 A;  1Q0W B;  4ZDV A;  1LXD A;  2N9E B;  3LDZ E;  5D2M B;  2K8C A;  3JVZ X;  4BKT A;  3V62 A;  1E8Z A;  5AZH A;  4NPN A;  4WWP A;  5LXH A;  2LRW A;  2WX1 A;  4BFR A;  1KJT A;  2DZI A;  1V49 A;  2MBE A;  2L8J A;  3PSE B;  1TTN A;  2UYZ B;  2ZVN A;  2JPH A;  1GC6 A;  1KM7 A;  3KH0 A;  3ZIM A;  2GBK A;  3SDL C;  3TIX A;  2O6V D;  1PQS A;  2KZR A;  3PRE A;  4WWN A;  1L7Y A;  3N32 A;  4PS7 A;  3V60 A;  3AU4 A;  1E7U A;  1Q1O A;  3ZNH B;  4FAD A;  2JY6 A;  3B08 A;  3ZNI D;  4MEL A;  1YD8 U;  3L54 A;  5L83 A;  1OEY A;  2DZM A;  4HJK A;  3VAW A;  3VDZ A;  3ZO5 B;  2IY0 B;  2IZV B;  1NDD A;  1P3Q U;  4IWP A;  1R4M I;  1IP9 A;  5FR6 A;  1YX6 B;  4KV2 A;  3Q3F A;  1WFY A;  3Q3J A;  2L05 A;  3NZU A;  3EHV A;  4GDK B;  4WJQ A;  2O2V A;  3DCG A;  4KVG B;  1WR1 A;  2KDB A;  4HDO A;  1T0Y A;  2K1F A;  2OOB B;  4LJO B;  5DPS A;  3L08 A;  3NS8 A;  2GBJ A;  1WGY A;  1NBF C;  1TGZ B;  1WIA A;  1GC7 A;  2JVC A;  3GOE A;  3PPA A;  4EFO A;  3DVG Y;  2XEW A;  4FA6 A;  3APC A;  3A9J A;  1NI2 A;  4B9K A;  2KWV B;  3VXW A;  2KVR A;  1S3S G;  3O65 B;  5C23 A;  1A5R A;  5J17 A;  5DPT A;  2GOW A;  2C5L C;  4FHJ A;  4BKS A;  2KFK B;  3VH3 B;  4NJ7 A;  4F1S A;  3MTN B;  2FNJ B;  2DHZ A;  2FCM A;  3IFW B;  2K39 A;  2MBH A;  2PEA A;  4M8N A;  1VD2 A;  3TMP B;  3X23 A;  3A4S C;  2KNB A;  3B0A A;  4NNJ B;  3DPD A;  4GDL A;  4W9D A;  2V4L A;  3HM3 A;  4XX5 A;  3ECI A;  4W9F A;  2LVP A;  1JRU A;  2J0J A;  4IG7 B;  1LFD A;  3CF6 E;  3N30 A;  1V81 A;  2KQS A;  2G3Q B;  2CHZ A;  4GDK A;  4ICU A;  5D94 A;  4RM8 A;  2D10 A;  3A9K A;  3QCA A;  2KJ6 A;  3CMM B;  1XD3 B;  4B6W A;  2AEH A;  1WMH A;  1V86 A;  2FID A;  3A4R A;  4W9I A;  2GBR A;  3QWZ B;  3RD2 A;  2D11 A;  4X57 B;  4A3O A;  3SU8 X;  4JL9 A;  1OTR B;  2DYM A;  3KUC B;  4PYZ A;  2D07 B;  1K8R B;  3UQB A;  3VQI A;  2NVU I;  3PLV A;  1SGH A;  2DYO A;  5JHA A;  5IA7 A;  2DZJ A;  1H8C A;  2HJ8 A;  5E6N A;  1E8W A;  3V6E B;  1WX9 A;  2ZPN A;  4MGK E;  1E90 A;  1GNU A;  1V2Y A;  2M4N A;  4GMV A;  3DVN U;  2KDI A;  1WXA A;  4LJP B;  2CHW A;  2AL6 A;  4BBN C;  3ZKJ C;  4G0N B;  4IW0 A;  3QA8 A;  1EO6 A;  2C7H A;  2L0T A;  1GUA B;  1HE8 A;  3APF A;  1V5O A;  3H7S A;  4MSQ B;  1L2N A;  3KVF B;  1S1Q B;  1WY8 A;  4EZJ A;  3UQA A;  2QHO A;  1XT9 B;  4YL8 A;  2XK5 B;  1WM3 A;  3HK0 A;  3UIP B;  2JT4 B;  2NCN A;  1I42 A;  3VTW A;  2C7N B;  4MJS A;  3AI5 A;  4NQL B;  2KHW B;  2L7R A;  3A1Q B;  1ZKH A;  3DVG X;  4NJ6 A;  3T8M A;  4DHZ B;  5L95 C;  2K8H A;  4F8C B;  2BWF A;  2WYQ A;  4MM3 A;  4AJW A;  2LWP A;  4N9F 4;  2YVC A;  4PS3 A;  3L13 A;  4CO7 A;  4PS8 A;  1V80 A;  3PZD A;  1WMH B;  1YIW A;  2Z0E B;  2ASQ A;  3EEC A;  3PRP B;  5CTR C;  1UH6 A;  3QAR A;  4GU2 A;  1EF1 A;  2N1V A;  3ENE A;  2KWU B;  1Z2M A;  5BO4 B;  3JSV A;  4II2 B;  3TJP A;  1Q5W B;  2JZZ A;  2KWC A;  3ML9 A;  3HM6 X;  3IG3 A;  2O6V A;  3TCA A;  3RT3 B;  2G4S A;  2D3G A;  4FN2 A;  2GBM A;  2I1K A;  3PLU A;  2JZ3 B;  2LZ6 A;  1RRB A;  4W9J A;  4AJY B;  3WIM A;  2RSU A;  4DK5 A;  3KUD B;  3AXC A;  4XZ4 A;  2MBQ A;  2IO2 B;  5AZF A;  4GXB A;  3DDC B;  4TKN A;  2LVO A;  4BVU C;  2IO3 B;  5LXI B;  3N3K B;  1MG8 A;  3DBH I;  3RZW C;  4TUU A;  4DHJ B;  4E3C A;  1WGG A;  2KD0 A;  2LD9 A;  4WWO A;  3OAW A;  2MLB A;  3OJ3 A;  2JRH A;  4DBG A;  4TQ0 A;  1H4R A;  4ANX A;  2MBO A;  4URK A;  3QJZ A;  3L16 A;  2KJH B;  1WX7 A;  3M3J A;  1ZW7 A;  2MQJ A;  2MBB B;  3I3T B;  1UZX B;  3QX1 A;  2YLM A;  4ANV A;  3K9P B;  2FCN A;  4HWI B;  4CHK A;  3R3M A;  2ZEQ A;  1WXV A;  2MCN B;  3SHQ A;  3T9L A;  3A9K B;  2LUE A;  3KYC D;  4IM0 A;  1WZ0 A;  4FHK A;  4I6N B;  1WX8 A;  1WZ3 A;  4J6I A;  1V6E A;  3RZF A;  2Y5B B;  4AP4 C;  4K81 A;  1C1Y B;  2L76 A;  4G50 A;  1J0G A;  2KLG A;  5J2R A;  5TR5 A;  4M8M A;  3ZVV A;  4MGZ E;  1OQY A;  3KUZ A;  3VTV A;  2IBI B;  3PRZ A;  1OEY J;  4KZ0 A;  1QZE A;  4FJV B;  2GMI C;  4ANW A;  2KO3 A;  1X1M A;  1IPG A;  2L3Z A;  2DYB A;  2W9N A;  3QQ8 B;  1ZGU B;  4W9L A;  4AUQ C;  3M62 B;  1F9J A;  3L10 B;  3PTF C;  3GZN I;  2N1W A;  2KC1 A;  2KDE B;  2EKE C;  3VTU A;  2GBN A;  3DOW A;  2CKH B;  2IYD B;  1LM8 B;  2KX0 A;  5CHF A;  2ZNV C;  3A33 B;  2KTR B;  3VH4 B;  4HK2 A;  3UGB B;  2ZZP B;  4RM9 A;  3WAO A;  5KHQ A;  2KAN A;  3L0W B;  4EOY A;  3ALB A;  3RYT A;  2BKF A;  3NOB A;  2PPH A;  2HD5 B;  2LXC A;  1FXT B;  4GB9 A;  3PT2 B;  4WJO A;  2BF8 B;  1M94 A;  3H7P B;  4HDQ A;  2KQ7 A;  4JLC A;  1TZ1 A;  3QK0 A;  2L0F A;  5G2N A;  2BWE S;  1UGM A;  3P2B A;  2AL3 A;  4IM3 A;  2IO0 B;  1RLF A;  3TBL D;  4TV3 A;  4NQK E;  4LDT B;  4W9E A;  4ICV A;  4KDL B;  1LQB A;  4K1R B;  2D2Q A;  3H1U A;  3R66 C;  2MA9 B;  4FBJ B;  3QAQ A;  3W1S C;  2IY1 B;  2KFJ A;  3V61 A;  4MJS B;  2A4Z A;  3WAL A;  3ZDT A;  4OVV A;  2R2O A;  2JUO A;  3WAN A;  2BYV E;  4FUL A;  3KW5 B;  3VFK A;  4ANU A;  1P9D U;  1WGH A;  3H7P A;  3ONS A;  4TQ1 A;  4PYU A;  4HVB A;  2HE7 A;  2LGD A;  2N4F A;  4KSK C;  4BOZ B;  5JH5 C;  3U7D A;  2NBW B;  1E8Y A;  2LXA A;  5E6O A;  3ZLZ A;  2JXX A;  2L00 B;  3QIJ A;  4KIK B;  1YX5 B;  2NBU A;  3VUW A;  3BY4 B;  1V9J A;  5IAA C;  3X0W A;  5CX3 A;  2AYO B;  2DAJ A;  1WXM A;  4JQW C;  3A1Q A;  1WJ6 A;  2DAF A;  4HXD A;  4EZK A;  2C9W B;  2N7E A;  2MP2 B;  2WX0 A;  2MP2 A;  2KJR A;  2ZNV B;  3ZTC A;  5D7G A;  4MSM B;  4E71 A;  1WH3 A;  2JWZ A;  1AAR A;  5G55 A;  4AOF A;  2Z0D B;  2WDT B;  5DPW A;  4MH0 E;  3OLM D;  2Z59 B;  3TL5 A;  1WRD B;  2B3A A;  3MHS D;  2BPS A;  4K7W A;  1WM2 A;  2BYF A;  2NPT B;  3VUX A;  2CR5 A;  3JSV B;  4IC7 B;  2FAZ A;  4A3P A;  2LAS A;  3VVW B;  1P98 A;  3AU5 A;  4LDT D;  2DX5 B;  1P1A A;  1EUV B;  2HTH A;  2J0M A;  1Y8R C;  2M8S A;  2M17 A;  1ISN A;  2LGY A;  3QC8 B;  4GDL B;  3VUY A;  4DDI D;  2CS4 A;  2KK8 A;  4II3 B;  1WE7 A;  2NR2 A;  2K25 A;  3B1L X;  4XC2 A;  4M0W B;  4OVU A;  1YJ1 A;  3ZW3 A;  3UIN B;  3D32 A;  2J7Q B;  2I1J A;  4EKU A;  3LJ3 A;  4KSL C;  2RPQ A;  4DHJ D;  2KXJ A;  2XBB C;  3PGE A;  5C1Z A;  4ZYN A;  3U30 A;  5EDS A;  2OJR A;  3ZUN A;  3OJ4 B;  3NHE B;  2FUH B;  4G3X B;  3A9J B;  4LCD E;  5GMV A;  2O6V B;  1OGW A;  2VRR B;  4W9H A;  3DBS A;  3ML8 A;  2PE6 B;  3DVN V;  4RMA A;  4JGH B;  3PVL A;  2LVQ A;  1XQQ A;  3PV1 A;  3PS6 A;  4B95 A;  3RCZ A;  2MSE D;  3EC8 A;  2KC2 A;  3M95 A;  4EZL A;  1UD7 A;  2PJH A;  2A5U A;  2KX3 A;  4E74 A;  1VCB A;  5AEK B;  3ZNZ B;  2JF5 A;  2NS5 A;  4DXA B;  1WGR A;  4NAW A;  4NAW B;  4A20 A;  1WR6 E;  3K9O B;  5DCN A;  2G4D B;  4FJY A;  3ZRC A;  1UBI A;  1WGD A;  4I6L B;  2K6D B;  4BKS D;  4CYE A;  1V5T A;  2AWT A;  5J18 A;  3WAP A;  1J8C A;  5E6P A;  1Z5S B;  4HLE A;  1WYW B;  2BGF A;  4IUM B;  1EF5 A;  2N7D A;  4F7Z A;  3APD A; 
#chains in the Genus database with same CATH topology
 3QHT A;  4MGY E;  4C4V A;  1FEH A;  2AQ3 B;  1RAX A;  3MC9 A;  1DOI A;  2KWD A;  3C8Y A;  2FIF A;  1L0Y B;  2KDF B;  3AH7 A;  4WQO B;  3HHM A;  4GSW A;  5H92 C;  3NZS A;  3TSS A;  4HCN B;  1WE6 A;  1E7V A;  3HIZ A;  2LGX A;  2N9P C;  3V05 A;  3MFG A;  2MX2 A;  1RFA A;  3H8H A;  3DBL I;  4KX6 B;  3Q8E A;  1EU4 A;  2KN5 A;  3P4S B;  3RMK C;  4K3C A;  3BIN A;  2AQ2 B;  3GE8 C;  1ET9 A;  1F2R C;  2IO1 B;  2G1E A;  2C7M B;  2ZPY A;  4ZRJ A;  4RGN A;  1FCL A;  5KHO A;  1BT0 A;  2M0X A;  2LUM A;  3M63 B;  2GB1 A;  2WS3 B;  4GGQ A;  5DPR A;  1ZP0 B;  2LI5 A;  3DBH B;  1SIF A;  2KTF A;  4JPS A;  1D4B A;  4JIO U;  4HCP B;  3MJ5 A;  4LNN A;  4GN1 A;  2EEL A;  2LJI A;  1YOV B;  3V6C B;  3AE7 B;  1UUP A;  2K8B A;  3IXS A;  1C9F A;  3FAH A;  4BKG A;  2WXQ A;  2N9X A;  3H6N A;  4W9G A;  3JW0 X;  4IOI E;  4WJN A;  2Y3A A;  3WAM A;  3RNE C;  3LXF A;  5LLI A;  3IBE A;  1WXS A;  4FLH A;  1E5W A;  2KOX A;  1ENF A;  2KMC A;  3CWI A;  2K6Q A;  3ZTD A;  1KLV A;  1HZ5 A;  4RH6 A;  4MDK E;  2DEN B;  2XK5 A;  1Q0W B;  3LDZ E;  5D2M B;  2LGI A;  5AZH A;  3MP9 A;  2LRW A;  4LK0 M;  2WX1 A;  3ZGZ A;  1V49 A;  2CU3 A;  2MBE A;  4J3O D;  1TTN A;  2W54 A;  3ZIM A;  1C76 A;  3RNC C;  1YQ4 B;  1XEE A;  3DWM A;  3RPF C;  1PQS A;  3PRE A;  4TMA B;  1L7Y A;  3N32 A;  4PS7 A;  3V60 A;  1Q1O A;  4NAM A;  1XXG A;  4MEL A;  1YD8 U;  3AN1 A;  1OEY A;  2BS2 B;  1JRP A;  3VAW A;  2IY0 B;  1NDD A;  1P3Q U;  3GE3 C;  4IWP A;  1V1P B;  5FR6 A;  2UU7 A;  5C2T B;  3Q3F A;  2KDB A;  2K1F A;  1NBF C;  1TGZ B;  1FO4 A;  1ZXI A;  2XEW A;  3ZJT A;  3A9J A;  4NJC A;  3VXW A;  3O65 B;  3MHZ A;  3VH3 B;  4F1S A;  2DHZ A;  5G5H A;  2QSD A;  2K39 A;  2D5G A;  2PEA A;  3AED B;  1VD2 A;  3TMP B;  3X23 A;  2KNB A;  1EWC A;  1CZP A;  2WXN A;  3B0A A;  4NNJ B;  3HM3 A;  4XX5 A;  2CJO A;  4OZB A;  1JRU A;  4IG7 B;  4P1B C;  2L52 A;  3CF6 E;  2KQS A;  4ICU A;  4GDK A;  4RM8 A;  2D10 A;  3QCA A;  3CMM B;  5HG2 A;  5H8Y E;  1V86 A;  3NS1 A;  4KGR A;  3BYY B;  1ZE3 D;  1TIF A;  3FC4 A;  1OTR B;  3KUC B;  5JXV A;  1B9R A;  3VQI A;  4M0W A;  5IA7 A;  2HJ8 A;  5E6N A;  4MGK E;  2PIA A;  4LNI A;  1ZDV A;  1WXA A;  3DBL B;  4M02 A;  2CHW A;  2AL6 A;  4G0N B;  4IW0 A;  1GUA B;  1L2N A;  1WY8 A;  4MAC A;  4RCO A;  2JT4 B;  2IJ0 A;  1JWM D;  2C7N B;  3AI5 A;  1QT9 A;  1TYG B;  2KHW B;  2MHJ A;  3R8B A;  4N9F 4;  5IN7 A;  2YVC A;  4CO7 A;  1V80 A;  4B0E A;  3PZD A;  1SJE D;  3EEC A;  4FXC A;  4GU2 A;  3N9Y C;  4PT5 A;  2JZZ A;  3TJP A;  1FXA A;  3TCA A;  2D3G A;  3PLU A;  2LZ6 A;  4AJY B;  3WIM A;  3R2I A;  3AXC A;  4XZ4 A;  2IO2 B;  4GXB A;  1YMH E;  4DHJ B;  1WGG A;  2LD9 A;  4TQ0 A;  2MBO A;  3L16 A;  1WX7 A;  1ZW7 A;  4S17 A;  3U4E G;  2MBB B;  4ANV A;  1RYJ A;  4HWI B;  2MCN B;  3V3X A;  2X8X X;  1VZ8 A;  3RZF A;  4J6I A;  4OVZ A;  1WX8 A;  1V6E A;  4AP4 C;  1C4P A;  3TEX A;  2L76 A;  4L2Y A;  1I4H A;  1OEY J;  2GMI C;  2KO3 A;  1PDX A;  1PYW D;  1QQR A;  1X1M A;  2L3Z A;  2DYB A;  3Q8A A;  3P42 A;  4AUQ C;  2BBC A;  1F9J A;  3L10 B;  1L6V A;  2IGG A;  1Y56 A;  1TJE A;  2CKH B;  1V1O A;  2KX0 A;  2R61 A;  2DLB A;  2KTR B;  3VH4 B;  2LEK A;  3LB8 C;  1N62 A;  3RYT A;  2V3N A;  2BKF A;  2WXP A;  3NOB A;  1YJI A;  1FXT B;  3PT2 B;  2BF8 B;  3AB5 A;  4HKZ E;  2IGH A;  2BTE A;  4K1R B;  3R66 C;  2MA9 B;  4HRS A;  2KFJ A;  2RMM A;  1NI3 A;  5BYS A;  3I5J C;  3ZDT A;  4B0M A;  2JUO A;  4FUL A;  1XCT L;  2RDH A;  3SEB A;  3H7P A;  3AE5 B;  1Q10 A;  1TKY A;  1A70 A;  4KSK C;  4BOZ B;  3N1Z C;  3U7D A;  2D3A A;  2VZK B;  4C80 A;  4N6E B;  3BZD B;  3QIJ A;  1YX5 B;  5IKC M;  3BY4 B;  4A6Q A;  4WQM A;  3BVG A;  2DAJ A;  1WXM A;  1WJ6 A;  2DAF A;  1M4V A;  3VRB B;  2N7E A;  2VH2 A;  5D7G A;  3BII D;  1WH3 A;  1AAR A;  2WDV B;  3AEE B;  2WDT B;  2B3A A;  3MHS D;  2M19 A;  2BYF A;  2NPT B;  3VVW B;  4LDT D;  1MHH E;  2QEJ C;  2HTH A;  2M8S A;  2WXL A;  4II3 B;  2K25 A;  4M0W B;  1CQV A;  4YT0 B;  4CQN A;  3AE9 B;  1I7H A;  3VR8 B;  3PGE A;  3AEC B;  1MHX A;  5GMV A;  1KTK A;  3PZ7 A;  4M00 A;  2K9X A;  3DVN V;  1J7C A;  1T5X D;  4RF1 A;  5FR3 A;  4OW0 A;  1SBB B;  2V0G A;  1NYQ A;  1ESF A;  1UD7 A;  2PJH A;  2KX3 A;  1L4Z B;  1UF0 A;  2WDR B;  4NAW A;  3I63 C;  4A20 A;  1WR6 E;  3NVY A;  2QCZ A;  3ZRC A;  5J18 A;  1V5T A;  1AN8 A;  2GI9 A;  2V9H A;  1GAQ B;  1T3Q A;  2EMS A;  3ZDM C;  2LHE A;  1WGK A;  1SE9 A;  3IVF A;  3UIO B;  4IM2 A;  1OQR A;  2WXR A;  3R7Q A;  1U4A A;  5IO9 A;  1FCC C;  1I35 A;  3ZRF A;  1J19 A;  1N60 A;  3EFU A;  1UEL A;  3CST A;  3N1X C;  3ZNG C;  4KIK A;  1CMX B;  1F1H A;  1LGR A;  3DBR I;  2JRI B;  3DHG C;  5E6J A;  2BS4 B;  3C0R B;  2Y5C A;  2J0K A;  2MRP A;  2K3U A;  2RD0 A;  3Q6B A;  3EFC A;  4HPM B;  2K5P A;  2V3S A;  1GOZ A;  1DOY A;  4OZC A;  3FKY A;  2LJ5 A;  2WDQ B;  1C3T A;  5G5G A;  5JHB A;  4AQ7 A;  1NVI D;  4WAA A;  2JYT A;  3PHX B;  1N63 A;  4I6P A;  4US9 A;  4RNA A;  3Q8F A;  4AWJ A;  5CHV C;  2BW2 A;  3S2A A;  1GB1 A;  1WJN A;  2EMT A;  1IYF A;  4HPL B;  3R7R A;  3E9S A;  2MW5 A;  4RGT A;  2K8C A;  4HRO A;  3V62 A;  1ZOY B;  4WWP A;  2JYE A;  2N9L A;  1VDV A;  4BFR A;  2DZI A;  4L1B A;  2ZW0 A;  2L8J A;  2UYZ B;  3P4R B;  1KM7 A;  3KH0 A;  2GBK A;  2O6V D;  2KZR A;  1FXI A;  4YSZ B;  3ZJU A;  3ZNH B;  1QF6 A;  4FAD A;  2JY6 A;  4P1C C;  3ZNI D;  1HTQ A;  3P4P B;  3TEW A;  1IP9 A;  1YX6 B;  4KV2 A;  2L05 A;  1FIQ A;  2WXK A;  3NZU A;  3EHV A;  4WJQ A;  2MH7 A;  2XN9 C;  4KVG B;  3Q2A C;  2PMV A;  4LJO B;  5DPS A;  3GOE A;  4FA6 A;  2KVR A;  3AV8 A;  3I9V 1;  5J17 A;  4WAF A;  5DPT A;  2GOW A;  4FHJ A;  3O13 A;  3MTN B;  5BMH A;  1QLB B;  4W9D A;  3AMZ A;  2V4L A;  4W9F A;  2J0J A;  2JQR B;  1LFD A;  2WXO A;  2G3Q B;  2JZP A;  1HQR D;  4W9I A;  3QWZ B;  3RD2 A;  1WYG A;  2DYM A;  1K8R B;  1DYQ A;  1VR9 A;  3PLV A;  2NTT A;  1SGH A;  2DYO A;  2J4X A;  2M4N A;  4GMV A;  3P1M A;  2KDI A;  2C7H A;  2L0T A;  2YEP B;  1SIJ A;  3H7S A;  4MSQ B;  1S1Q B;  1FRR A;  4OHJ A;  4YTM B;  1WM3 A;  1I42 A;  3VTW A;  3ZJV A;  4MJS A;  2KN4 A;  4NQL B;  2L7R A;  3A1Q B;  3DVG X;  1ZKH A;  3CIR B;  3T8M A;  4F8C B;  4AJW A;  4MM3 A;  2LWP A;  4PS3 A;  5C3J B;  1WMH B;  2ASQ A;  1JWA D;  2WQY B;  3AE4 B;  1PGX A;  1ZUD 2;  3SR6 A;  1Q5W B;  1IBX A;  2TSS A;  5IP4 D;  4D2K A;  4FN2 A;  1AW7 A;  2RSU A;  4ARC A;  4ZRP A;  1JRO A;  4TKN A;  2LVO A;  1QOA A;  2CJN A;  3DBH I;  4DBG A;  3OAW A;  2MLB A;  1H4R A;  2ZW1 A;  3M3J A;  1VLB A;  1UZX B;  2FBW B;  2FCN A;  3A9K B;  3KYC D;  4XDD A;  4IM0 A;  1I4P A;  2KQ4 X;  2PTL A;  4RF0 A;  4FHK A;  4I6N B;  1CJE A;  4JX1 C;  4Q2J A;  3ZVV A;  2RPV A;  1IGD A;  1ZGU B;  3GP7 A;  3HVD A;  3PTF C;  2XNA C;  4C00 A;  2EKE C;  3Q3O C;  1LM8 B;  3A33 B;  1AWD A;  4A90 A;  3UGB B;  3AEF B;  3WAO A;  2KAN A;  3ALB A;  1XCQ L;  4GB9 A;  4WJO A;  3OG5 A;  4HDQ A;  2KQ7 A;  1TZ1 A;  3KWV A;  2L0F A;  3ABV B;  1UGM A;  3P2B A;  2AL3 A;  3C19 A;  4IM3 A;  2WU5 B;  4LLG M;  4XYC A;  4ICV A;  4KDL B;  3H1U A;  3RI7 C;  3QAQ A;  2IY1 B;  3V61 A;  1MJD A;  4MJS B;  3AE8 B;  1RM6 C;  4EE2 A;  3U2S C;  2BYV E;  3KW5 B;  3VFK A;  1WGH A;  3IAS 1;  3ONS A;  1STE A;  1BML C;  1E8Y A;  4H2A A;  2JSV X;  1FNV A;  2L00 B;  4JWU C;  3VUW A;  4KGS A;  3ZQ4 A;  3NVW A;  3X0W A;  4JQW C;  1EU3 A;  3A1Q A;  4HXD A;  1DGJ A;  2C9W B;  2MP2 A;  1XLP A;  2JWZ A;  4AOF A;  5G55 A;  2JX5 A;  1TS5 A;  4MH0 E;  3OLM D;  3TL5 A;  1SB3 C;  4USA A;  4K7W A;  3NG0 A;  2CR5 A;  4IC7 B;  2FAZ A;  4A3P A;  2J52 A;  4HKQ A;  4XDC A;  1TKE A;  3QC8 B;  1EUV B;  2M17 A;  2LGY A;  2H88 B;  1JWB D;  1WE7 A;  2D3C A;  1KRH A;  1CK1 A;  2I2Y A;  1YJ1 A;  3ZW3 A;  1SE4 A;  2J7Q B;  2I1J A;  3LJ3 A;  1KF6 B;  4KSL C;  1D5M C;  2KXJ A;  2XBB C;  3AE3 B;  4BZA A;  2OJR A;  5FKA C;  3ZUN A;  1K51 A;  1OGW A;  3DBS A;  3ML8 A;  2PE6 B;  2OJW A;  4MT5 A;  2LVQ A;  3PS6 A;  1L0V B;  3EC8 A;  4E74 A;  1WGR A;  2W3R A;  2KYW A;  5DCN A;  2AWT A;  1WYW B;  1R7S A;  4IUM B;  4IDI A;  1EF5 A;  1SXT A;  3KWL A;  4IWQ A;  2KAJ A;  3W2D A;  4P7I A;  1G6J A;  2M1M A;  2ZVO A;  3NRZ A;  5CHW A;  3RUI B;  5D6J B;  1AYF A;  2KKC A;  2V1Y A;  1WJ4 A;  4TSS A;  2LRU A;  4ZHP A;  2KLC A;  1F0Z A;  1TS3 A;  5AZG A;  2MWS B;  2BQQ A;  1MI0 A;  1YNT E;  4W9C A;  4FJZ A;  4ZHO A;  1UBQ A;  3PRM B;  2E3T A;  2FCQ A;  2MEK A;  1E8X A;  4WH4 A;  4C56 C;  2WXF A;  1GJZ A;  1L4D B;  1WI0 A;  2C60 A;  2WWZ A;  4BBN F;  1E10 A;  3NY5 A;  4XWT A;  1PGA A;  4KGT A;  5EE0 A;  2UWQ A;  3JYU A;  2RR9 A;  3BK2 A;  2KFK A;  3AEA B;  4NY0 A;  1ZDX A;  1ZXH A;  4ZRK A;  1JWS D;  2N7J A;  4DWF A;  1TS4 A;  2WGS A;  3MJW A;  2BKR B;  3RUL A;  3L4P A;  4DQO C;  1GG3 A;  2ZCB A;  3IHP C;  1VRA B;  4K7U A;  3RNA C;  2FCS A;  3SD5 A;  4GIV A;  2ACZ B;  2ZCC A;  3BYT B;  1ROE A;  3UI3 A;  4A8X C;  2ICI A;  2WLB A;  4S0R A;  4WJP A;  4W9K A;  3T3N A;  3HRD D;  3NUH B;  4MEM A;  1JQ4 A;  4LTU A;  1VJK A;  4BKT A;  1E8Z A;  4NPN A;  5LXH A;  1F77 A;  2QMT A;  3PSE B;  4XGA B;  2ZVN A;  1JW9 D;  3TIX A;  1F52 A;  2I38 A;  4LNK A;  4REZ A;  2N0S B;  2V4I B;  3U52 E;  3ZXR A;  3B08 A;  3RN9 C;  3L54 A;  5L83 A;  4R3D A;  2DZM A;  2L32 A;  3VDZ A;  1SF0 A;  2KDM A;  1R4M I;  1BXT A;  1V97 A;  1IGC A;  1WFY A;  3Q3N C;  2BB6 A;  3DCG A;  1JWU D;  2E6X A;  1T0Y A;  4WUR A;  4RFB A;  1E7P B;  4C4V B;  1WGY A;  1WIA A;  4EFO A;  3PPA A;  3APC A;  4B9K A;  1HTO A;  2SAK A;  4LNO A;  2C5L C;  4BKS A;  4QAY A;  1VZ6 A;  5BMG A;  4YTP B;  4K3B A;  2FNJ B;  3GZN B;  1P7F A;  2MJ3 A;  2FCM A;  2MBH A;  4XWW A;  3AE6 B;  1WRI A;  4GDL A;  1ET6 A;  1WSP A;  3ECI A;  2LVP A;  3N30 A;  4N59 A;  1V81 A;  3AEG B;  4JE3 B;  3TEZ A;  3A9K A;  2KJ6 A;  1EWY C;  1XD3 B;  2GLS A;  4B6W A;  1L6U A;  2GBR A;  2D11 A;  4X57 B;  2WP9 B;  1K53 A;  3UQB A;  2LHD A;  3TUO A;  1VZ7 A;  4N58 A;  1H8C A;  2DZJ A;  1E8W A;  3N1Y C;  3V6E B;  2ZPN A;  1E90 A;  1UWX A;  1GB4 A;  2PVG C;  3DVN U;  2WXI A;  4LJP B;  3I57 A;  1FD6 A;  3QA8 A;  1L0X B;  4L23 A;  3APF A;  1V5O A;  1XLO A;  1KFY B;  3UQA A;  1XT9 B;  4YL8 A;  1T6B X;  2NCN A;  5BYR A;  2IPK D;  1QOB A;  1C78 A;  2WNM A;  4LNF A;  1N5X A;  2BWF A;  3GS2 A;  3L13 A;  1R4M B;  3URY A;  2QDF A;  5EE3 A;  1YIW A;  2X38 A;  2Z0E B;  5EE9 A;  5CTR C;  1NYR A;  1UH6 A;  2J42 A;  3QAR A;  1EF1 A;  2N1V A;  4YTN B;  3J9C A;  2KWU B;  5BO4 B;  5HHD G;  1FNW A;  4II2 B;  3HM6 X;  2O6V A;  2VZK D;  3BWU D;  3BVZ A;  1RRB A;  4W9J A;  1FFU A;  3EUB 2;  2MBQ A;  3NVZ A;  5AZF A;  3DDC B;  2H89 B;  5D3D A;  4BVU C;  3N3K B;  1MG8 A;  5TSS A;  3RZW C;  2DWQ A;  4E3C A;  3GB1 A;  3Q3M C;  2JRH A;  1I4Q A;  4M01 A;  4URK A;  3QJZ A;  1IUE A;  2MQJ A;  3I3T B;  2JXT A;  1B1Z A;  2YLM A;  4BAX A;  1E0Z A;  3K9P B;  2ZEQ A;  1J7B A;  3SHQ A;  3T9L A;  3SFE B;  1C4C A;  1SE3 A;  1WZ0 A;  3W5U B;  1WZ3 A;  1RFK A;  2Y5B B;  1PFD A;  3IAM 1;  1C1Y B;  4C7Z A;  2QIE B;  5TR5 A;  2GRI A;  4M8M A;  2QC8 A;  4MGZ E;  1OQY A;  1XLN A;  3KUZ A;  3VTV A;  2RDB C;  2Z8L A;  4KZ0 A;  4OZA A;  4FJV B;  4W9L A;  1WWT A;  2W9N A;  3QQ8 B;  2N1W A;  4RGM A;  2KDE B;  2SEB D;  5CHF A;  1K50 A;  1QKZ A;  4P16 A;  4RM9 A;  1C79 A;  3L0W B;  2M56 B;  2PPH A;  2HD5 B;  2LXC A;  3H7P B;  1M94 A;  1P7E A;  4JLC A;  5G2N A;  2BWE S;  1XO3 A;  3TBL D;  4TV3 A;  4NQK E;  1T0Q C;  4W9E A;  1D6E C;  4WWM A;  4FBJ B;  4OVV A;  3VR9 B;  1IBX B;  2OHF A;  4ANU A;  4PYU A;  4ACF A;  2LGD A;  5JH5 C;  1LO5 D;  2LXA A;  2PKO A;  3ZLZ A;  2JXX A;  4KIK B;  4XE0 A;  5MPO A;  2NBU A;  1NEK B;  1TKG A;  1V9J A;  2JWU A;  1PUT A;  5CX3 A;  1OFF A;  2AYO B;  1WXQ A;  3MC0 B;  4EZK A;  2WX0 A;  3ZTC A;  4MSM B;  1MG4 A;  2N9K A;  1WRD B;  2WU2 B;  3ZXV A;  3ZYY X;  2LAS A;  1P98 A;  3B2F A;  3AU5 A;  2DX5 B;  1P1A A;  1Y8R C;  1R4N B;  1ISN A;  4GDL B;  3PZ8 A;  3VUY A;  4DDI D;  2CS4 A;  2KK8 A;  4GLS C;  5HFY A;  4YSX B;  2PW9 A;  1TY0 A;  3D32 A;  5BMI A;  2G9H D;  2RPQ A;  2PVO D;  4ZYN A;  5EDS A;  1HXY D;  2EKI A;  4IKG A;  4G3X B;  3A9J B;  4LCD E;  1YN5 A;  1J7A A;  4RMA A;  1FMA D;  3T3O A;  2D3B A;  4B95 A;  4UDU C;  3RCZ A;  2KC2 A;  2BYT A;  4EZL A;  2A5U A;  2BS3 B;  1VCB A;  3ZNZ B;  2HTM E;  2NS5 A;  4DXA B;  4NAW B;  1YN4 A;  2G4D B;  1UBI A;  4I6L B;  2K6D B;  4CYE A;  1F2R I;  3WAP A;  1Z5S B;  4YWG G;  2BGF A;  1JAL A;  3W5V B;  3OJ3 A;  2NPT A;  2BVC A;  2RGF A;  1WF9 A;  1TBE A;  4K7S A;  2ZJD A;  1P0R A;  2YEP F;  1TY2 A;  1D3Z A;  3HVZ A;  1OQQ A;  2CU1 A;  2FUG 1;  5HKH A;  2R2Q A;  1KOT A;  1D5Z C;  1I4G A;  3L17 A;  1K52 A;  3UF8 A;  3CSF A;  4ASW C;  4P6V F;  3RNF C;  3W1S A;  3FIL A;  3DHH C;  4O1N A;  3PHW B;  1ACC A;  2IDY A;  3U8Z A;  4YXD B;  2BYE A;  4EUT A;  2KAC A;  2G45 B;  4HEA 1;  2REX A;  2LFI A;  3KYD D;  3VRA B;  1I4R A;  3H9D A;  5GXG B;  4A55 A;  2NBV B;  4DDG D;  2KMA A;  4HPP A;  4ZRI A;  4DHZ E;  4KZC A;  1DOX A;  1WJU A;  1SSN A;  1YQB A;  2KMM A;  1HEZ E;  2DZK A;  4G11 A;  2AQ1 B;  2M0A A;  4PK1 A;  2KTR A;  3SFD B;  3VHT C;  1TZO A;  3WA0 A;  2W82 A;  2CHX A;  4BOS C;  4MH8 A;  2INC C;  2O2V B;  1QOG A;  4MGI E;  4GOC A;  3DQV A;  2HJ1 A;  4KDI C;  2PE9 A;  3W1Y A;  4ZYS A;  4IWO A;  3E56 A;  5JZE B;  2QJL A;  3AUL A;  2ONQ A;  2K22 A;  4EEW A;  4ITK A;  2MJD A;  1R4N I;  4ZDV A;  1LXD A;  2N9E B;  3JVZ X;  3ETR A;  1KJT A;  3DWG C;  1JML A;  4ARI A;  3BVM A;  1HZ6 A;  2JPH A;  1GC6 A;  3SDL C;  3U7Z A;  2W55 A;  5IOI A;  4WWN A;  3AU4 A;  1E7U A;  3KQ4 A;  5FK9 C;  3Q8C A;  1N5W A;  1RWS A;  2DNF A;  4HJK A;  3ZO5 B;  2IZV B;  1N6Z A;  5I4D A;  4ZOH C;  1ZPS A;  3Q3J A;  1YJJ A;  4GDK B;  3HUI A;  2O2V A;  1WR1 A;  1FM0 D;  4HDO A;  2OOB B;  3L08 A;  1XLQ A;  2GBJ A;  3NS8 A;  4DXG A;  2JVC A;  1GC7 A;  2WXG A;  3DVG Y;  1NI2 A;  2KWV B;  5D3I B;  5C23 A;  1S3S G;  1E6E B;  1A5R A;  2INP E;  2KFK B;  1KLG D;  3FIL B;  4NJ7 A;  4HJG E;  3IFW B;  4M8N A;  1V8C A;  1D5X C;  3A4S C;  1HA5 A;  3DPD A;  3RNG C;  2L83 A;  2CHZ A;  2J53 A;  3BK1 A;  5D94 A;  3Q14 C;  2AEH A;  1WMH A;  3A4R A;  2FID A;  3DBR B;  1QIL A;  3Q8B A;  3NVV A;  1N61 A;  4A3O A;  3SU8 X;  4JL9 A;  4PYZ A;  2D07 B;  2INN E;  4AS1 A;  2NVU I;  4WIP A;  5JHA A;  3NJT A;  1WX9 A;  1GNU A;  1V2Y A;  1KH0 A;  1TS2 A;  4A9A A;  4BBN C;  3ZKJ C;  1SE2 A;  1GPX A;  1EO6 A;  1HE8 A;  3RFZ B;  1UNS A;  3KVF B;  4EZJ A;  2QHO A;  4YSY B;  2XK5 B;  4JWS C;  3HK0 A;  3UIP B;  3P63 A;  1UGJ A;  2IGD A;  3WCQ A;  4NJ6 A;  3N20 C;  4DHZ B;  5L95 C;  2K8H A;  2WYQ A;  1QOF A;  4MM3 B;  4ZRQ A;  4PS8 A;  2JU6 X;  3PRP B;  1SJH D;  3DHI C;  3B9J A;  3ENE A;  1Z2M A;  3JSV A;  2KWC A;  2Q5W D;  3ML9 A;  3IG3 A;  3RT3 B;  2G4S A;  2GBM A;  2I1K A;  2JZ3 B;  2WXM A;  1V1P A;  4DK5 A;  3RNB C;  3KUD B;  3PO0 A;  1FFV A;  5LXI B;  2IO3 B;  3IT6 B;  4TUU A;  2WHI A;  2RDG A;  2KD0 A;  4WWO A;  4ANX A;  2KJH B;  2WXH A;  1YN3 A;  3QX1 A;  1MVK A;  4CHK A;  2OED A;  3R3M A;  2FE8 A;  1WXV A;  3P4Q B;  2LUE A;  3W9C B;  1XF5 L;  4DXF A;  2L1A A;  1JCK B;  1E9M A;  2B76 B;  2DBY A;  4K81 A;  1J0G A;  4G50 A;  2KLG A;  5J2R A;  2NMQ A;  3OWE B;  2IBI B;  3PRZ A;  2W3S A;  1QZE A;  4ANW A;  3EA6 A;  2PLP A;  1IPG A;  3M62 B;  3GZN I;  2KC1 A;  3VTU A;  2GBN A;  3DOW A;  2MJE A;  2IYD B;  2NTS A;  2ZNV C;  4HK2 A;  2ZZP B;  5KHQ A;  4EOY A;  3AE2 B;  3NZ3 A;  2BB5 A;  3KLS X;  3QK0 A;  3R2T A;  2IO0 B;  1RLF A;  3TEY A;  3Q69 A;  4LDT B;  1C77 A;  1LQB A;  4RGO S;  2D2Q A;  2LMC A;  2BT6 A;  3W1S C;  1T0R C;  2A4Z A;  3WAL A;  2Y5P A;  2R2O A;  5HI1 A;  2WXJ A;  5AUK A;  3WAN A;  4KKI A;  1TT5 B;  1P9D U;  5AUI A;  5LNK 1;  1FRD A;  4TQ1 A;  4US8 A;  4HVB A;  2HE7 A;  2N4F A;  2NBW B;  5E6O A;  1T0S C;  2KVZ A;  3IT4 B;  5IAA C;  1NEN B;  4NZL B;  1C4A A;  1BUI C;  2MP2 B;  3B2G A;  2KJR A;  2ZNV B;  5T8I A;  4E71 A;  1MPE A;  2Z0D B;  5DPW A;  3AEB B;  1YQ3 B;  2Z59 B;  1L5P A;  2BPS A;  1WM2 A;  3VUX A;  3JSV B;  2V3P A;  1I4X A;  2J0M A;  2HDE A;  2KT7 A;  2AX5 A;  2NR2 A;  3B1L X;  4XC2 A;  4OVU A;  2ON8 A;  2LGS A;  1SEB D;  1MFW A;  2K0P A;  2QIL A;  3UIN B;  1FPY A;  4EKU A;  4DHJ D;  1FNU A;  5C1Z A;  3U30 A;  3MC8 A;  3OJ4 B;  3NHE B;  2FUH B;  3AE1 B;  5EE1 A;  1EM7 A;  2O6V B;  2VRR B;  4W9H A;  1KLU D;  3LYY A;  4JGH B;  3PVL A;  1PGB A;  1XQQ A;  3EGR A;  3PV1 A;  2MSE D;  2VH1 A;  4KKJ A;  3M95 A;  5AEK B;  2JF5 A;  5BYQ A;  3K9O B;  1UWM A;  4FJY A;  1WGD A;  4BKS D;  1J8C A;  3AM9 A;  4C7Y A;  5E6P A;  4HLE A;  2IND C;  2N7D A;  4F7Z A;  3APD A; 
#chains in the Genus database with same CATH homology
 2EMS A;  4IWQ A;  3ZDM C;  2NPT A;  4P7I A;  2RGF A;  1WF9 A;  1G6J A;  1TBE A;  3QHT A;  4MGY E;  4K7S A;  1SE9 A;  1RAX A;  2ZJD A;  2M1M A;  1P0R A;  2ZVO A;  3IVF A;  5CHW A;  3UIO B;  1D3Z A;  3RUI B;  4IM2 A;  2CU1 A;  2FIF A;  5D6J B;  5HKH A;  2KDF B;  2R2Q A;  1KOT A;  2KKC A;  2V1Y A;  4WQO B;  3HHM A;  3R7Q A;  1U4A A;  3L17 A;  1WJ4 A;  1I35 A;  4GSW A;  3ZRF A;  1J19 A;  3UF8 A;  2LRU A;  3NZS A;  2KLC A;  3CSF A;  4ASW C;  4HCN B;  5AZG A;  1WE6 A;  2MWS B;  3EFU A;  1E7V A;  3HIZ A;  3W1S A;  1UEL A;  2LGX A;  3CST A;  2N9P C;  4W9C A;  4FJZ A;  3ZNG C;  3PHW B;  2MX2 A;  4KIK A;  1RFA A;  1CMX B;  3U8Z A;  1UBQ A;  3DBL I;  3PRM B;  2BYE A;  2KN5 A;  2JRI B;  3DBR I;  4EUT A;  2FCQ A;  3BIN A;  1E8X A;  2G45 B;  1GJZ A;  1WI0 A;  3C0R B;  2C60 A;  2J0K A;  2IO1 B;  2WWZ A;  2MRP A;  2C7M B;  2REX A;  2ZPY A;  4ZRJ A;  4BBN F;  3KYD D;  3NY5 A;  5KHO A;  1BT0 A;  2M0X A;  3H9D A;  2RD0 A;  3M63 B;  2UWQ A;  3JYU A;  2NBV B;  4HPM B;  4GGQ A;  2RR9 A;  5DPR A;  4DDG D;  2LI5 A;  2KFK A;  2KMA A;  4ZRI A;  4DHZ E;  2V3S A;  1SIF A;  2KTF A;  4NY0 A;  2LJ5 A;  4JIO U;  4KZC A;  1C3T A;  4HCP B;  4ZRK A;  1WJU A;  1YQB A;  5JHB A;  2DZK A;  4GN1 A;  4WAA A;  4DWF A;  4G11 A;  3PHX B;  3MJW A;  2BKR B;  2KTR A;  3RUL A;  3V6C B;  3VHT C;  4I6P A;  1GG3 A;  2K8B A;  2CHX A;  2ZCB A;  3IHP C;  4K7U A;  3WA0 A;  4BOS C;  2O2V B;  4BKG A;  2FCS A;  3SD5 A;  2N9X A;  3H6N A;  4GIV A;  4MGI E;  4GOC A;  3DQV A;  4W9G A;  4KDI C;  2PE9 A;  2ZCC A;  3JW0 X;  4WJN A;  3W1Y A;  4AWJ A;  5CHV C;  3S2A A;  3WAM A;  5LLI A;  4IWO A;  3IBE A;  1WXS A;  4FLH A;  1E5W A;  5JZE B;  4WJP A;  2KOX A;  4W9K A;  1WJN A;  2EMT A;  1IYF A;  2KMC A;  4HPL B;  2K6Q A;  3AUL A;  3R7R A;  3ZTD A;  4EEW A;  4MEM A;  1KLV A;  2MW5 A;  1R4N I;  2DEN B;  4MDK E;  2XK5 A;  1Q0W B;  4ZDV A;  1LXD A;  2N9E B;  3LDZ E;  5D2M B;  2K8C A;  3JVZ X;  4BKT A;  3V62 A;  1E8Z A;  5AZH A;  4NPN A;  4WWP A;  5LXH A;  2LRW A;  2WX1 A;  4BFR A;  1KJT A;  2DZI A;  1V49 A;  2MBE A;  2L8J A;  3PSE B;  1TTN A;  2UYZ B;  2ZVN A;  2JPH A;  1GC6 A;  1KM7 A;  3KH0 A;  3ZIM A;  2GBK A;  3SDL C;  3TIX A;  2O6V D;  1PQS A;  2KZR A;  3PRE A;  4WWN A;  1L7Y A;  3N32 A;  4PS7 A;  3V60 A;  3AU4 A;  1E7U A;  1Q1O A;  3ZNH B;  4FAD A;  2JY6 A;  3B08 A;  3ZNI D;  4MEL A;  1YD8 U;  3L54 A;  5L83 A;  1OEY A;  2DZM A;  4HJK A;  3VAW A;  3VDZ A;  3ZO5 B;  2IY0 B;  2IZV B;  1NDD A;  1P3Q U;  4IWP A;  1R4M I;  1IP9 A;  5FR6 A;  1YX6 B;  4KV2 A;  3Q3F A;  1WFY A;  3Q3J A;  2L05 A;  3NZU A;  3EHV A;  4GDK B;  4WJQ A;  2O2V A;  3DCG A;  4KVG B;  1WR1 A;  2KDB A;  4HDO A;  1T0Y A;  2K1F A;  2OOB B;  4LJO B;  5DPS A;  3L08 A;  3NS8 A;  2GBJ A;  1WGY A;  1NBF C;  1TGZ B;  1WIA A;  1GC7 A;  2JVC A;  3GOE A;  3PPA A;  4EFO A;  3DVG Y;  2XEW A;  4FA6 A;  3APC A;  3A9J A;  1NI2 A;  4B9K A;  2KWV B;  3VXW A;  2KVR A;  1S3S G;  3O65 B;  5C23 A;  1A5R A;  5J17 A;  5DPT A;  2GOW A;  2C5L C;  4FHJ A;  4BKS A;  2KFK B;  3VH3 B;  4NJ7 A;  4F1S A;  3MTN B;  2FNJ B;  2DHZ A;  2FCM A;  3IFW B;  2K39 A;  2MBH A;  2PEA A;  4M8N A;  1VD2 A;  3TMP B;  3X23 A;  3A4S C;  2KNB A;  3B0A A;  4NNJ B;  3DPD A;  4GDL A;  4W9D A;  2V4L A;  3HM3 A;  4XX5 A;  3ECI A;  4W9F A;  2LVP A;  1JRU A;  2J0J A;  4IG7 B;  1LFD A;  3CF6 E;  3N30 A;  1V81 A;  2KQS A;  2G3Q B;  2CHZ A;  4GDK A;  4ICU A;  5D94 A;  4RM8 A;  2D10 A;  3A9K A;  3QCA A;  2KJ6 A;  3CMM B;  1XD3 B;  4B6W A;  2AEH A;  1WMH A;  1V86 A;  2FID A;  3A4R A;  4W9I A;  2GBR A;  3QWZ B;  3RD2 A;  2D11 A;  4X57 B;  4A3O A;  3SU8 X;  4JL9 A;  1OTR B;  2DYM A;  3KUC B;  4PYZ A;  2D07 B;  1K8R B;  3UQB A;  3VQI A;  2NVU I;  3PLV A;  1SGH A;  2DYO A;  5JHA A;  5IA7 A;  2DZJ A;  1H8C A;  2HJ8 A;  5E6N A;  1E8W A;  3V6E B;  1WX9 A;  2ZPN A;  4MGK E;  1E90 A;  1GNU A;  1V2Y A;  2M4N A;  4GMV A;  3DVN U;  2KDI A;  1WXA A;  4LJP B;  2CHW A;  2AL6 A;  4BBN C;  3ZKJ C;  4G0N B;  4IW0 A;  3QA8 A;  1EO6 A;  2C7H A;  2L0T A;  1GUA B;  1HE8 A;  3APF A;  1V5O A;  3H7S A;  4MSQ B;  1L2N A;  3KVF B;  1S1Q B;  1WY8 A;  4EZJ A;  3UQA A;  2QHO A;  1XT9 B;  4YL8 A;  2XK5 B;  1WM3 A;  3HK0 A;  3UIP B;  2JT4 B;  2NCN A;  1I42 A;  3VTW A;  2C7N B;  4MJS A;  3AI5 A;  4NQL B;  2KHW B;  2L7R A;  3A1Q B;  1ZKH A;  3DVG X;  4NJ6 A;  3T8M A;  4DHZ B;  5L95 C;  2K8H A;  4F8C B;  2BWF A;  2WYQ A;  4MM3 A;  4AJW A;  2LWP A;  4N9F 4;  2YVC A;  4PS3 A;  3L13 A;  4CO7 A;  4PS8 A;  1V80 A;  3PZD A;  1WMH B;  1YIW A;  2Z0E B;  2ASQ A;  3EEC A;  3PRP B;  5CTR C;  1UH6 A;  3QAR A;  4GU2 A;  1EF1 A;  2N1V A;  3ENE A;  2KWU B;  1Z2M A;  5BO4 B;  3JSV A;  4II2 B;  3TJP A;  1Q5W B;  2JZZ A;  2KWC A;  3ML9 A;  3HM6 X;  3IG3 A;  2O6V A;  3TCA A;  3RT3 B;  2G4S A;  2D3G A;  4FN2 A;  2GBM A;  2I1K A;  3PLU A;  2JZ3 B;  2LZ6 A;  1RRB A;  4W9J A;  4AJY B;  3WIM A;  2RSU A;  4DK5 A;  3KUD B;  3AXC A;  4XZ4 A;  2MBQ A;  2IO2 B;  5AZF A;  4GXB A;  3DDC B;  4TKN A;  2LVO A;  4BVU C;  2IO3 B;  5LXI B;  3N3K B;  1MG8 A;  3DBH I;  3RZW C;  4TUU A;  4DHJ B;  4E3C A;  1WGG A;  2KD0 A;  2LD9 A;  4WWO A;  3OAW A;  2MLB A;  3OJ3 A;  2JRH A;  4DBG A;  4TQ0 A;  1H4R A;  4ANX A;  2MBO A;  4URK A;  3QJZ A;  3L16 A;  2KJH B;  1WX7 A;  3M3J A;  1ZW7 A;  2MQJ A;  2MBB B;  3I3T B;  1UZX B;  3QX1 A;  2YLM A;  4ANV A;  3K9P B;  2FCN A;  4HWI B;  4CHK A;  3R3M A;  2ZEQ A;  1WXV A;  2MCN B;  3SHQ A;  3T9L A;  3A9K B;  2LUE A;  3KYC D;  4IM0 A;  1WZ0 A;  4FHK A;  4I6N B;  1WX8 A;  1WZ3 A;  4J6I A;  1V6E A;  3RZF A;  2Y5B B;  4AP4 C;  4K81 A;  1C1Y B;  2L76 A;  4G50 A;  1J0G A;  2KLG A;  5J2R A;  5TR5 A;  4M8M A;  3ZVV A;  4MGZ E;  1OQY A;  3KUZ A;  3VTV A;  2IBI B;  3PRZ A;  1OEY J;  4KZ0 A;  1QZE A;  4FJV B;  2GMI C;  4ANW A;  2KO3 A;  1X1M A;  1IPG A;  2L3Z A;  2DYB A;  2W9N A;  3QQ8 B;  1ZGU B;  4W9L A;  4AUQ C;  3M62 B;  1F9J A;  3L10 B;  3PTF C;  3GZN I;  2N1W A;  2KC1 A;  2KDE B;  2EKE C;  3VTU A;  2GBN A;  3DOW A;  2CKH B;  2IYD B;  1LM8 B;  2KX0 A;  5CHF A;  2ZNV C;  3A33 B;  2KTR B;  3VH4 B;  4HK2 A;  3UGB B;  2ZZP B;  4RM9 A;  3WAO A;  5KHQ A;  2KAN A;  3L0W B;  4EOY A;  3ALB A;  3RYT A;  2BKF A;  3NOB A;  2PPH A;  2HD5 B;  2LXC A;  1FXT B;  4GB9 A;  3PT2 B;  4WJO A;  2BF8 B;  1M94 A;  3H7P B;  4HDQ A;  2KQ7 A;  4JLC A;  1TZ1 A;  3QK0 A;  2L0F A;  5G2N A;  2BWE S;  1UGM A;  3P2B A;  2AL3 A;  4IM3 A;  2IO0 B;  1RLF A;  3TBL D;  4TV3 A;  4NQK E;  4LDT B;  4W9E A;  4ICV A;  4KDL B;  1LQB A;  4K1R B;  2D2Q A;  3H1U A;  3R66 C;  2MA9 B;  4FBJ B;  3QAQ A;  3W1S C;  2IY1 B;  2KFJ A;  3V61 A;  4MJS B;  2A4Z A;  3WAL A;  3ZDT A;  4OVV A;  2R2O A;  2JUO A;  3WAN A;  2BYV E;  4FUL A;  3KW5 B;  3VFK A;  4ANU A;  1P9D U;  1WGH A;  3H7P A;  3ONS A;  4TQ1 A;  4PYU A;  4HVB A;  2HE7 A;  2LGD A;  2N4F A;  4KSK C;  4BOZ B;  5JH5 C;  3U7D A;  2NBW B;  1E8Y A;  2LXA A;  5E6O A;  3ZLZ A;  2JXX A;  2L00 B;  3QIJ A;  4KIK B;  1YX5 B;  2NBU A;  3VUW A;  3BY4 B;  1V9J A;  5IAA C;  3X0W A;  5CX3 A;  2AYO B;  2DAJ A;  1WXM A;  4JQW C;  3A1Q A;  1WJ6 A;  2DAF A;  4HXD A;  4EZK A;  2C9W B;  2N7E A;  2MP2 B;  2WX0 A;  2MP2 A;  2KJR A;  2ZNV B;  3ZTC A;  5D7G A;  4MSM B;  4E71 A;  1WH3 A;  2JWZ A;  1AAR A;  5G55 A;  4AOF A;  2Z0D B;  2WDT B;  5DPW A;  4MH0 E;  3OLM D;  2Z59 B;  3TL5 A;  1WRD B;  2B3A A;  3MHS D;  2BPS A;  4K7W A;  1WM2 A;  2BYF A;  2NPT B;  3VUX A;  2CR5 A;  3JSV B;  4IC7 B;  2FAZ A;  4A3P A;  2LAS A;  3VVW B;  1P98 A;  3AU5 A;  4LDT D;  2DX5 B;  1P1A A;  1EUV B;  2HTH A;  2J0M A;  1Y8R C;  2M8S A;  2M17 A;  1ISN A;  2LGY A;  3QC8 B;  4GDL B;  3VUY A;  4DDI D;  2CS4 A;  2KK8 A;  4II3 B;  1WE7 A;  2NR2 A;  2K25 A;  3B1L X;  4XC2 A;  4M0W B;  4OVU A;  1YJ1 A;  3ZW3 A;  3UIN B;  3D32 A;  2J7Q B;  2I1J A;  4EKU A;  3LJ3 A;  4KSL C;  2RPQ A;  4DHJ D;  2KXJ A;  2XBB C;  3PGE A;  5C1Z A;  4ZYN A;  3U30 A;  5EDS A;  2OJR A;  3ZUN A;  3OJ4 B;  3NHE B;  2FUH B;  4G3X B;  3A9J B;  4LCD E;  5GMV A;  2O6V B;  1OGW A;  2VRR B;  4W9H A;  3DBS A;  3ML8 A;  2PE6 B;  3DVN V;  4RMA A;  4JGH B;  3PVL A;  2LVQ A;  1XQQ A;  3PV1 A;  3PS6 A;  4B95 A;  3RCZ A;  2MSE D;  3EC8 A;  2KC2 A;  3M95 A;  4EZL A;  1UD7 A;  2PJH A;  2A5U A;  2KX3 A;  4E74 A;  1VCB A;  5AEK B;  3ZNZ B;  2JF5 A;  2NS5 A;  4DXA B;  1WGR A;  4NAW A;  4NAW B;  4A20 A;  1WR6 E;  3K9O B;  5DCN A;  2G4D B;  4FJY A;  3ZRC A;  1UBI A;  1WGD A;  4I6L B;  2K6D B;  4BKS D;  4CYE A;  1V5T A;  2AWT A;  5J18 A;  3WAP A;  1J8C A;  5E6P A;  1Z5S B;  4HLE A;  1WYW B;  2BGF A;  4IUM B;  1EF5 A;  2N7D A;  4F7Z A;  3APD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...