4E74A

Crystal structure of the rho gtpase binding domain of plexin a4a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
108
structure length
101
Chain Sequence
DYKTLVLSCVSPSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGARMILQDEDITTKIWKRLNTLAHYQVPDGSVVALVSKQVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plexin-A4
publication title Crystal structure of the RHO GTPASE BINDING DOMAIN of Plexin A4A
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 101
sequence length 108
ec nomenclature
pdb deposition date 2012-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4e74A00
1RLFA 2RSUA 3K9PB 3EECA 4II3B 4K7WA 4KIKA 4DDID 2DYOA 3SD5A 1ISNA 4WJNA 2EMTA 5C23A 2MCNB 2V3SA 4IUMB 3DBSA 3OLMD 4DDGD 1L7YA 2MBQA 3OJ4B 1IP9A 4GXBA 1V2YA 2N9EB 2XBBC 1V5OA 2ZCBA 4BKSD 3UQAA 3NZSA 4DHZB 4M8MA 1WX9A 1NBFC 2KD0A 4ANXA 3DBLI 2LI5A 1GNUA 2LXAA 1HE8A 3A1QA 4DXAB 2K6DB 3QA8A 3MTNB 4TUUA 4F1SA 4NPNA 1GUAB 4FLHA 3MJWA 4IM3A 2MP2A 3RZWC 2L8JA 2ZNVC 4IC7B 5KHQA 2LVOA 3ZO5B 4ASWC 4AJWA 4MM3A 3AXCA 1LQBA 2FCQA 2K39A 2LASA 2CS4A 3HHMA 2ZZPB 3UIOB 1UGMA 3WALA 4GIVA 2LXCA 2ZJDA 5D7GA 2Z0DB 3N3KB 2W9NA 3L16A 2C9WB 2LJ5A 2KO3A 1XT9B 3ZNHB 5J18A 2DX5B 2BYEA 2UYZB 4FULA 3VTVA 3KUDB 4GGQA 2KJRA 2JF5A 2LVPA 4KDLB 2JZZA 2RR9A 2AYOB 3DOWA 2FCNA 1WX8A 2CHXA 4E74A 2G4SA 3APCA 2KQSA 4FJVB 1C1YB 4DBGA 3L08A 1ZW7A 2D10A 3Q3JA 4LJPB 4ICVA 2KTFA 1UBQA 3PV1A 1P1AA 4HVBA 4NAWA 3BY4B 3DVNV 3CSFA 5JH5C 2MBHA 4KV2A 2C7HA 3KW5B 3WAOA 1WGYA 3Q3FA 2WX1A 4I6NB 2CU1A 3QIJA 2DYMA 3GZNI 2KVRA 3M95A 4ZDVA 3VH4B 1Z5SB 3KH0A 3V6EB 3UF8A 3ML8A 3L13A 1FXTB 4EZJA 2ZEQA 2JUOA 2PPHA 4MELA 3V61A 1EF1A 2HTHA 4HJKA 1WMHB 1YJ1A 3QJZA 4HXDA 1WGRA 4LDTB 4PYUA 4ICUA 5DPWA 2KWUB 2N1VA 2AL3A 2ZPNA 3BINA 2KDEB 5LLIA 3ECIA 2C7MB 3CMMB 1YX5B 2IY0B 2K25A 2O6VA 1TGZB 3NS8A 1GJZA 1RAXA 2ASQA 3JSVB 3K9OB 4MGKE 3N30A 5L95C 2N9XA 1VCBA 2XEWA 3DBHI 4TKNA 4P7IA 2LD9A 4KSKC 4A3OA 2N4FA 2REXA 3ENEA 2KK8A 2A5UA 4NQLB 4WAAA 3SDLC 1IYFA 3A9JA 3JYUA 3B0AA 3MHSD 3VUWA 3WIMA 4WJOA 3W1SA 4ANWA 3PHWB 4EEWA 2OJRA 4M8NA 1SE9A 1Q5WB 1Q0WB 1E8XA 4KVGB 1V80A 2KFKB 2LWPA 3TCAA 2NPTB 3PHXB 1YQBA 4EOYA 1WYWB 3DDCB 2L00B 3L0WB 4X57B 3UINB 4GN1A 5LXHA 3PS6A 4KZCA 3H7SA 2BKRB 2D11A 3GOEA 3P2BA 4TV3A 3TBLD 3S2AA 2KTRA 4K7SA 2JRHA 3D32A 1WGDA 4G0NB 2BKFA 4EFOA 4JIOU 2JY6A 2LGDA 4N9F4 2MQJA 2L0TA 1T0YA 4YL8A 2D07B 2KOXA 1BT0A 2MBEA 4ZRIA 1LFDA 1R4MI 2BWFA 2LVQA 2C60A 3A33B 3PGEA 2J7QB 2I1KA 5IAAC 1WF9A 1C3TA 1WXVA 3RZFA 3VUYA 2NBWB 2GBKA 3PLUA 3A4RA 4EZLA 3CF6E 4B9KA 2LRUA 2WWZA 3VQIA 3APDA 3ZRFA 2M8SA 4FADA 4LCDE 1D3ZA 3DVGX 4M0WB 2ZNVB 2YVCA 4WQOB 4BKSA 1YD8U 1WE6A 1V9JA 5E6NA 3NOBA 2L7RA 4CO7A 3PPAA 2GMIC 3PRZA 3QWZB 4MJSA 4W9HA 2NVUI 5AZHA 3W1SC 4A3PA 4RM8A 2K8BA 3RYTA 5J2RA 4BFRA 4GDKA 2G45B 2K1FA 2KC1A 1V81A 3QARA 3U8ZA 1XD3B 1CMXB 4KZ0A 3RCZA 4W9DA 2CHWA 4J6IA 1WXAA 2L3ZA 2MBOA 4FBJB 1P3QU 1WJ4A 4HPMB 4BKGA 1WFYA 4RM9A 3RULA 2GBRA 4GSWA 2PEAA 4F8CB 1WRDB 2MA9B 3HK0A 4K81A 5AZGA 2Z59B 2DZMA 5AZFA 3VUXA 2FUHB 1WXSA 1Q1OA 2K8CA 2KDBA 1R4NI 4IG7B 4AP4C 4B95A 1G6JA 2BPSA 4IW0A 3ZTDA 3KYCD 3QQ8B 4HCPB 5E6OA 3RUIB 3V60A 2QHOA 4ZYNA 1UZXB 3IFWB 2NBVB 3ONSA 2JXXA 3UQBA 3A1QB 1WZ0A 3WAPA 4TQ0A 2XK5B 3ZVVA 2M4NA 3PTFC 4W9FA 1WI0A 2K8HA 4GDLB 2MP2B 3U7DA 1I35A 5DPRA 4W9KA 1WIAA 1UELA 3VFKA 3ZNZB 2C7NB 3TMPB 3PRMB 2O2VB 2D2QA 4JLCA 2KDFB 5IA7A 4NY0A 1WH3A 2KXJA 4FJZA 4NNJB 5D6JB 3X23A 3IBEA 4GU2A 3VH3B 4DK5A 5AEKB 3KYDD 2R2QA 1UBIA 2DZKA 3ZRCA 3B1LX 1WJNA 4G3XB 4NQKE 2MW5A 3APFA 1WGHA 1YX6B 3I3TB 4LDTD 4GB9A 2JVCA 4JQWC 2BYFA 2D3GA 2J0JA 1V6EA 1OEYJ 2KKCA 3DPDA 2L0FA 2KLCA 3QK0A 3EHVA 2KZRA 3JW0X 3R7QA 2MBBB 4NAWB 2HE7A 3JSVA 3R66C 3ZNGC 3H1UA 3AU4A 3ZIMA 4W9CA 1TZ1A 2KN5A 5CHVC 1RRBA 1TBEA 2KWVB 1OGWA 2WDTB 3L54A 4HDOA 3CSTA 2NR2A 3VAWA 1V86A 4RMAA 4IWQA 2FCMA 4MGIE 4W9GA 3TL5A 1E5WA 3QX1A 1WGGA 2KANA 2FAZA 5JHBA 1IPGA 4GMVA 1P9DU 2DYBA 3PSEB 4I6LB 4ZRJA 3QC8B 5D94A 3A4SC 2AL6A 3A9KB 1WZ3A 3OAWA 3H6NA 2RPQA 3DVNU 2A4ZA 2KMAA 2KFKA 3LJ3A 1E8YA 2NPTA 4MEMA 1AARA 3PT2B 4IM2A 1Z2MA 2N7DA 3DVGY 3WAMA 1WM3A 1WJ6A 2KDIA 2KC2A 2PE6B 2JRIB 4LJOB 2ZVOA 2BF8B 2O6VB 3AI5A 2DHZA 2YLMA 4IM0A 4XC2A 5CHFA 3ZDMC 2IO2B 4KSLC 3AU5A 3PREA 1E8ZA 1EUVB 3QCAA 4BKTA 3PRPB 4HPLB 4W9IA 1GC7A 2N7EA 1Y8RC 4MGZE 1ZGUB 2JZ3B 4OVUA 4E3CA 3M3JA 2JT4B 3PLVA 4OVVA 1V5TA 2PJHA 3IG3A 5D2MB 2NBUA 2M1MA 3L17A 1UH6A 2PE9A 2KJHB 1OTRB 4B6WA 2K6QA 1V49A 2DZJA 2EMSA 2KFJA 2BWES 2C5LC 5BO4B 3HIZA 3DBRI 1WR1A 1WR6E 1SGHA 2DZIA 3DQVA 3N32A 1M94A 4FJYA 2IY1B 4G50A 2DAJA 4FHKA 4HDQA 3H7PB 2NCNA 5KHOA 4E71A 4IWOA 3KUCB 3RD2A 4WWNA 4W9EA 4AJYB 4PYZA 1E90A 2ZVNA 1QZEA 2FNJB 2R2OA 3JVZX 1GG3A 1E7UA 2KNBA 2MX2A 3RT3B 1NDDA 2RGFA 5LXIB 3ZW3A 2MLBA 1UD7A 4TQ1A 2LRWA 3H9DA 4PS7A 4KIKB 2L76A 4EKUA 2IO0B 4GOCA 3SHQA 1VD2A 1P98A 3ZDTA 4KDIC 2LZ6A 4MDKE 5DPSA 3UIPB 1L2NA 3VTUA 4FHJA 2Z0EB 1MG8A 3ZNID 5J17A 4NJ7A 1SIFA 3PZDA 4BVUC 2XK5A 4EUTA 1E8WA 2CR5A 4MJSB 4PS3A 1KLVA 3QAQA 5FR6A 4FN2A 4GDKB 3OJ3A 4WWOA 5JZEB 4GDLA 3ZUNA 1EO6A 1WX7A 2DENB 2HD5B 2JPHA 5CX3A 2O2VA 3EFUA 3T9LA 5L83A 2MRPA 4ZRKA 3VXWA 4K7UA 1JRUA 3NY5A 1OQYA 2RD0A 4HCNB 4K1RB 4IWPA 1F9JA 2EKEC 4BBNF 1S1QB 2CKHB 1ZKHA 2DAFA 3NZUA 4HLEA 3IVFA 2ZCCA 3ML9A 1J19A 1NI2A 3C0RB 3ZLZA 1KOTA 2MWSB 1TTNA 3U30A 1K8RB 5JHAA 1E7VA 4I6PA 2I1JA 2LUEA 2V1YA 2ZPYA 3O65B 4DHJD 4BOZB 2BYVE 3NHEB 1WMHA 2WX0A 1S3SG 1XQQA 3M63B 4MSMB 2GOWA 4WWPA 4XZ4A 4BOSC 4DHJB 3IHPC 3KUZA 4DWFA 1I42A 4XX5A 2LGYA 2KLGA 3HM6X 3LDZE 4MH0E 2GBJA 1WE7A 2G4DB 3V62A 3R3MA 2J0KA 1EF5A 2KX0A 2OOBB 4A20A 1P0RA 5G55A 3ZTCA 2AWTA 2BGFA 3VDZA 1A5RA 2IZVB 1KJTA 4CHKA 5DCNA 2KHWB 5C1ZA 1LM8B 2WYQA 5G2NA 3A9KA 2VRRB 3SU8X 2G3QB 2KWCA 2KQ7A 2FIDA 2N9PC 2KJ6A 2KMCA 4BBNC 4MSQB 3TIXA 1WXMA 1WY8A 2L05A 2KX3A 2M0XA 2CHZA 5EDSA 1H4RA 3PVLA 2J0MA 3AULA 3HM3A 5DPTA 3EC8A 3R7RA 2O6VD 1J0GA 4HK2A 5TR5A 4PS8A 4NJ6A 3ZKJC 2IYDB 3WA0A 3KVFB 3DCGA 2FCSA 1KM7A 4JGHB 4URKA 5GMVA 3UGBB 3V6CB 2N1WA 4MGYE 4F7ZA 3ALBA 5CTRC 4AUQC 2IBIB 2GBMA 2Y5BB 1U4AA 4FA6A 2NS5A 3WANA 4AOFA 1PQSA 2JWZA 4W9LA 1YIWA 3TJPA 4WJPA 4II2B 2V4LA 3QHTA 1WJUA 1WM2A 4AWJA 2GBNA 1H8CA 3M62B 3A9JB 2IO3B 3VTWA 2M17A 3VVWB 4G11A 1X1MA 4CYEA 1OEYA 3T8MA 2IO1B 4JL9A 3X0WA 3L10B 4EZKA 5E6PA 3H7PA 1RFAA 2HJ8A 2MSED 2UWQA 4HWIB 2KTRB 2FIFA 4W9JA 3VHTC 3B08A 1GC6A 1LXDA 4DHZE 5HKHA 1J8CA 2LGXA 3W1YA 5CHWA 4ANVA 4WJQA 2AEHA 4ANUA 2B3AA
chains in the Genus database with same CATH superfamily
3DWGC 3SD5A 4WJNA 4RGOS 2EMTA 5C23A 3AH7A 4L23A 1R4MB 4ARCA 2V3SA 4IUMB 2MBQA 1NBFC 3DBLI 3CIRB 3BIID 3QA8A 1JMLA 4TUUA 1KTKA 1GUAB 2I2YA 4XYCA 2J53A 3UI3A 4IM3A 1RM6C 4P16A 4IC7B 3TEYA 2LVOA 2FCQA 3UIOB 3HHMA 2PMVA 4GIVA 1NVID 4MACA 3L16A 1XT9B 2DX5B 1QQRA 1V8CA 3ABVB 2VZKB 3EFCA 5E6JA 3DOWA 2FCNA 1WX8A 2CHXA 2G4SA 2WXGA 3Q3JA 4ICVA 4HVBA 2AQ2B 4NAWA 3AEDB 5JH5C 2JYEA 2MBHA 1HTQA 2WX1A 1JQ4A 1FNVA 2CU1A 3QIJA 1GB4A 1SBBB 1TKEA 3M95A 3VR8B 1WRIA 1C9FA 3L13A 3GZNB 1EF1A 4A8XC 3BK2A 4PYUA 2MH7A 5BYRA 3I57A 3ECIA 3P4SB 2IY0B 2O6VA 1GJZA 2ASQA 3K9OB 3Q8FA 1SE3A 2EELA 2N9XA 2XEWA 3DBHI 4MT5A 3AV8A 4P7IA 1I4HA 3A9JA 3MHSD 3VUWA 3WIMA 4ANWA 1SE9A 1Q5WB 2L52A 2KFKB 2LWPA 4AS1A 1FNWA 4L1BA 2NPTB 2WHIA 3PHXB 3L0WB 4X57B 2JX5A 1EU3A 4LNKA 3TBLD 2KTRA 4K7SA 2JRHA 3D32A 3T3NA 1QT9A 4YT0B 4RGTA 1T0YA 4HEA1 1VZ6A 1LFDA 1R4MI 3A33B 2D3BA 4EZLA 2QCZA 4KX6B 3APDA 3ZRFA 2M8SA 1E9MA 2QSDA 2YVCA 3URYA 5E6NA 3U4EG 3B9JA 5AZHA 2INPE 4MJSA 2NVUI 4A3PA 2K8BA 2KC1A 3U8ZA 1RFKA 1CMXB 2FBWB 4J6IA 2L3ZA 3AMZA 1I7HA 4HPMB 1I35A 4K81A 1WSPA 2FUHB 4AP4C 4IG7B 4IW0A 3KYCD 4HCPB 3N1ZC 3RUIB 4ZYNA 3IFWB 2NBVB 1OQQA 2WNMA 3WAPA 2M4NA 1YJIA 2MP2B 5DPRA 4S0RA 3MC8A 5D3DA 1UELA 3VFKA 1XLQA 5H8YE 2O2VB 2Y3AA 3ZQ4A 5IA7A 1D6EC 1WH3A 5IP4D 1RYJA 1I4RA 5AEKB 4DK5A 1MJDA 1UBIA 2PKOA 2D3CA 3AEGB 4LDTD 4GB9A 1GPXA 2JVCA 4LNFA 3I63C 2D3GA 2LMCA 2WXRA 2KLCA 3JW0X 2MBBB 1T0QC 3AU4A 4W9CA 1TZ1A 4YSYB 1TBEA 4M00A 3FILA 2BB5A 2TSSA 3CSTA 3H8HA 1K52A 2AX5A 4IWQA 1WGGA 2FAZA 2J52A 2KDMA 1P9DU 3QC8B 3VR9B 2BW2A 1ET9A 1WZ3A 3OAWA 2A4ZA 1E8YA 4JWSC 4MEMA 1FFVA 1M4VA 1Z2MA 2N7DA 2KDIA 4IOIE 4IM0A 1D5MC 3BVZA 3W5VB 1FIQA 3MFGA 3AB5A 3PRPB 4HPLB 1GC7A 4MGZE 1QKZA 1L6UA 3PLVA 1BXTA 1JW9D 2M19A 2EMSA 2WGSA 4MH8A 1WR6E 1L4ZB 3DQVA 3N32A 4G50A 2DAJA 3H7PB 4PYZA 2ZVNA 4XWTA 3RT3B 1E7UA 1JWAD 2RGFA 1I4PA 4TQ1A 3H9DA 2QILA 4EKUA 1P98A 5C3JB 3RI7C 4FHJA 3VTUA 2Z0EB 1MG8A 1XCTL 2H88B 5J17A 2FE8A 2XK5A 1E8WA 5FR6A 4GDKB 5G5HA 4WWOA 2B76B 2QMTA 4GDLA 4IDIA 5IOIA 1WX7A 2JPHA 4BZAA 3T9LA 1JRUA 1KFYB 1Y56A 2BT6A 1OQRA 2RD0A 4K1RB 1P7EA 1ENFA 4BBNF 3TEWA 3C0RB 2IGDA 2MWSB 1WGKA 3U30A 1K8RB 2ZPYA 3O65B 1TKYA 4BOZB 1AYFA 2BYVE 3M63B 1DGJA 4XZ4A 2INCC 4FXCA 4PT5A 3R3MA 1V1PA 2OOBB 1EF5A 3E9SA 3PZ7A 1BMLC 1SXTA 2AWTA 1VDVA 1K51A 1A5RA 1BUIC 4CHKA 5DCNA 1J7CA 1QILA 5G2NA 5BYSA 3SU8X 3RMKC 2PTLA 2N9PC 4BBNC 1FEHA 2KMCA 1QOBA 4JX1C 1NENB 1WXMA 2L05A 2M0XA 5DPTA 2IYDB 4XWWA 4REZA 4P6VF 3V6CB 3RNFC 4AUQC 2GBMA 1VJKA 3WANA 4AOFA 1PQSA 3TJPA 1KF6B 3GE8C 4II2B 1WJUA 2GBNA 4OHJA 3LYYA 3A9JB 4CYEA 2M17A 4G11A 3MP9A 2OHFA 2WU2B 3X0WA 4EZKA 3FKYA 4CQNA 2UWQA 4DXFA 2KTRB 2FIFA 3N1XC 4DHZE 1H4RA 3MJ5A 1MG4A 3K9PB 3EECA 4II3B 4WURA 2DYOA 4US9A 2CU3A 3DBSA 3OLMD 1L7YA 2HDEA 1AW7A 3UQAA 4BKSD 1TYGB 1I4QA 2LI5A 1GNUA 3MTNB 2KWDA 2V0GA 2MP2A 1JWMD 2Y5CA 2K3UA 1TKGA 4AJWA 4A6QA 1UGJA 2QEJC 2LASA 2CS4A 2ZZPB 3DHHC 1JROA 2LXCA 2Z0DB 4WAFA 2W9NA 2C9WB 5J18A 2UYZB 1B9RA 4GGQA 3L4PA 2KJRA 2JF5A 4KDLB 2RR9A 2AYOB 1SEBD 4E74A 2WXOA 2PVGC 1C1YB 3NG0A 1N63A 2D10A 1P1AA 3Q14C 3BY4B 2N0SB 3CSFA 3U52E 2C7HA 1HXYD 4XE0A 2DYMA 4ZDVA 3VH4B 1QF6A 1TS5A 1FFUA 1FD6A 2ZEQA 1WYGA 2PPHA 1E0ZA 1YJ1A 4YSZB 2KWUB 2N1VA 2AL3A 3BINA 2KDEB 2GI9A 4O1NA 5LLIA 2C7MB 1P7FA 1YX5B 3RNCC 4ARIA 4ZRQA 5H92C 5L95C 3HVZA 1VCBA 3FILB 1TY0A 3ENEA 4NQLB 2KK8A 2A5UA 1JRPA 2BS4B 1ESFA 4WJOA 2PIAA 3PHWB 3DBHB 4YTNB 1Q0WB 2JU6X 5LXHA 2MEKA 3PS6A 3GOEA 3P2BA 1WGDA 2MJEA 2MQJA 2JWUA 2L0TA 4YL8A 2D07B 2KOXA 2MJ3A 1D5ZC 2J7QB 1C77A 3R8BA 4C80A 1C3TA 1C4CA 3RZFA 3N1YC 2NBWB 3VUYA 1YQ3B 3PLUA 3RPFC 2DLBA 2QDFA 2WDRB 2LRUA 3OWEB 4FADA 4WQOB 1XEEA 1HZ6A 4ZHPA 3NOBA 2L7RA 4XDCA 2GMIC 4RM8A 3RYTA 1B1ZA 2G45B 4GDKA 3QARA 3VRAB 4W9DA 1KLUD 1TJEA 1P3QU 4BKGA 1YJJA 4RM9A 4YTMB 4GSWA 2PEAA 2WXLA 3ZJVA 3VUXA 2DZMA 1MPEA 1R4NI 1DOXA 2BPSA 3QQ8B 5E6OA 3V60A 2JXXA 3NUHB 3EGRA 1WZ0A 4TQ0A 2XK5B 3WCQA 3ZVVA 2KYWA 2K8HA 4GDLB 3IXSA 4MM3B 3ZNZB 2C7NB 2M56B 4FJZA 5D6JB 3E56A 4KGRA 3B1LX 1WJNA 2JYTA 4HROA 4AQ7A 4GLSC 1PGBA 1WGHA 3I3TB 3DWMA 2INDC 2WXQA 4USAA 1V6EA 1OEYJ 2JXTA 2KKCA 3NVVA 2L0FA 3QK0A 3JSVA 3R66C 1C79A 5CHVC 2KWVB 1YN5A 1V1PB 3I9V1 3L54A 2XN9C 4HDOA 3W2DA 2BB6A 3AE7B 1V86A 2QJLA 2I38A 3TL5A 2LGIA 3QX1A 2DYBA 4I6LB 3A4SC 3H6NA 4A9AA 3DVNU 2K0PA 1E6EB 3IAS1 2L1AA 3PT2B 3ETRA 1STEA 2INNE 3MC9A 2BF8B 4HKQA 3AI5A 1TT5B 3AE4B 1GB1A 5EE9A 3AU5A 3PREA 4N58A 1JCKB 1E8ZA 1EUVB 1HZ5A 3QCAA 1ZGUB 1UUPA 2PJHA 2BTEA 2KN4A 3IG3A 2NBUA 5D2MB 2WXPA 1UH6A 3R2TA 1OTRB 4B6WA 2KFJA 1N60A 5BO4B 4TMAB 3HIZA 3DBRI 4KGTA 1D5XC 2IY1B 3P4RB 4OZAA 4FHKA 4HDQA 2NCNA 1ZOYB 4AJYB 1QOAA 3MHZA 2FNJB 2IPKD 3JVZX 1F1HA 1GG3A 1MFWA 1NI3A 2ON8A 1TIFA 2LRWA 2LUMA 4BAXA 1MHHE 1XCQL 2IO0B 4GOCA 2D5GA 1VD2A 3ZDTA 4MDKE 2LZ6A 3UIPB 1PUTA 3GP7A 2N9KA 4NZLB 3AEBB 4EUTA 4PS3A 4QAYA 5T8IA 2V9HA 1YNTE 2V4IB 3EFUA 2MRPA 4K7UA 1OQYA 4A55A 4N6EB 1F9JA 2RPVA 1S1QB 2CKHB 4HLEA 3ML9A 2ZCCA 4M02A 5FR3A 1CK1A 1E7PB 2K9XA 5JHAA 2KT7A 2V1YA 1S3SG 4MSMB 4BOSC 3IHPC 3KUZA 4DWFA 1I42A 1GAQB 2KLGA 2BS3B 1FMAD 3HM6X 2GBJA 1WE7A 3LDZE 3V62A 2J0KA 2KACA 2ZW1A 2HJ1A 5G55A 3ZTCA 1ROEA 2V3NA 3BYTB 3VDZA 3BWUD 4JE3B 2KHWB 5C1ZA 1C78A 1ZDVA 3A9KA 3N9YC 4XDDA 2FIDA 3ZJTA 4WQMA 1WY8A 2KX3A 2ZW0A 5EDSA 3DHGC 1J0GA 2O6VD 4HK2A 5TR5A 3ZKJC 3KVFB 3DCGA 1KM7A 4JGHB 4URKA 5GMVA 3UGBB 4F7ZA 3NVWA 2IBIB 2Y5BB 4FA6A 1UF0A 3VRBB 1YIWA 3AN1A 2BYTA 3M62B 3SR6A 1NYRA 4JPSA 3VVWB 3T8MA 2IO1B 1N6ZA 4RH6A 4K3CA 3C8YA 1KLGD 1L0XB 1K50A 2HJ8A 2BS2B 2BBCA 3ZYYX 5HKHA 2LGXA 4W9GA 1RLFA 2QIEB 2N7JA 4KIKA 4DDID 3P63A 1UNSA 2MCNB 2YEPF 4ZOHC 4DDGD 3NRZA 1V2YA 2XBBC 2ZCBA 2H89B 3AE5B 4M8MA 4DHZB 1WX9A 2KD0A 1QOGA 2LXAA 2IDYA 2RDGA 4C4VA 4DXAB 2SAKA 4F1SA 4LNOA 3AE8B 2IGGA 1F2RI 3RZWC 2L8JA 2ZNVC 5KHQA 3ZO5B 4ASWC 4MM3A 3AXCA 3ZXRA 3AE6B 3P1MA 1UGMA 4ACFA 2ZJDA 5D7GA 3Q3OC 1WWTA 4EE2A 2LJ5A 3ZNHB 4FULA 4C56C 2LVPA 1UWMA 2KQSA 4FJVB 4DBGA 3L08A 1ZW7A 1R7SA 1UBQA 2OJWA 2WDVB 3KW5B 2X38A 3Q3FA 1GOZA 4DXGA 4I6NB 2KVRA 3SFDB 1FXTB 2JUOA 3Q2AC 4MELA 2HTHA 4HJKA 4HXDA 4LDTB 1WGRA 5C2TB 2RMMA 3CMMB 2K25A 1TGZB 3NS8A 3T3OA 4R3DA 1RAXA 3JSVB 4Q2JA 3N30A 2Y5PA 1F52A 5EE3A 1N61A 1CJEA 4TKNA 4KSKC 4A3OA 2N4FA 3P4QB 1DOYA 1FM0D 1ZPSA 3JYUA 2NTTA 2VH1A 5G5GA 2PW9A 2ONQA 1E8XA 3DHIC 1C4AA 1V80A 1SSNA 2R61A 4EOYA 2L00B 4GN1A 2G9HD 4KZCA 1VRAB 2BKRB 3S2AA 1VZ7A 4EFOA 2BKFA 2JY6A 5AUIA 1FRRA 1BT0A 4ZRIA 2BWFA 2LVQA 2C60A 3PGEA 2I1KA 1XLPA 1WF9A 1KRHA 4WWMA 3AEFB 1WXVA 2GBKA 3CF6E 2WWZA 4LCDE 4JWUC 1D3ZA 2ZNVB 1YD8U 1TS4A 1WE6A 1TY2A 3PRZA 5BMIA 3W1SC 1N62A 1N5WA 2Z8LA 5J2RA 4BFRA 2K1FA 1XD3B 4KZ0A 2CHWA 2MBOA 2YEPB 1V1OA 1WJ4A 3RULA 3HK0A 2EKIA 2Z59B 5AZFA 2PLPA 1WXSA 2KDBA 2K8CA 3RFZB 1G6JA 2W82A 2LGSA 2VZKD 2CJOA 2QHOA 1UZXB 2WLBA 4LLGM 3Q8AA 3UQBA 3A1QB 1R4NB 1FNUA 1LO5D 1LGRA 1CZPA 3TEZA 2MJDA 4YTPB 4W9KA 1WIAA 2WS3B 4HJGE 3P42A 1HA5A 1TS2A 2KDFB 2KXJA 3KLSX 4NNJB 3X23A 3CWIA 3IBEA 3KWLA 3VH3B 3KYDD 2R2QA 1T6BX 2DZKA 4PK1A 1HTOA 5LNK1 4G3XB 2G1EA 3APFA 3MC0B 1YX6B 4JQWC 2NMQA 3Q3MC 3DPDA 1ZE3D 3EHVA 1VR9A 2HE7A 3LXFA 1RRBA 2Q5WD 1YMHE 2NR2A 4L2YA 4RMAA 1NYQA 3TUOA 5BMGA 2FCMA 4H2AA 3FC4A 4GMVA 3HRDD 5D94A 3A9KB 2RPQA 2K5PA 4LNNA 1FCCC 1VLBA 4RFBA 1AARA 4IM2A 2PE6B 4XGAB 2KC2A 2DHZA 2YLMA 4XC2A 4ITKA 3NS1A 5I4DA 3SFEB 2WXMA 4BKTA 1XLOA 3M3JA 2JT4B 4OVVA 2XNAC 2PE9A 3AM9A 1IBXA 2KJHB 2K6QA 1V49A 2WXHA 2DZJA 1PYWD 4M0WA 2C5LC 2V3PA 1WR1A 3N20C 3PO0A 2ACZB 4HKZE 3J9CA 5KHOA 4IWOA 3KUCB 3RD2A 1JWSD 4WWNA 4W9EA 3DBRB 3KQ4A 3RNGC 3AEEB 4YSXB 3EA6A 1FCLA 1TZOA 2MX2A 3R2IA 3NJTA 1PGXA 3ZW3A 4PS7A 5IKCM 4KIKB 2L76A 2JQRB 1DOIA 2ICIA 3GB1A 1L2NA 1JALA 1MHXA 2M0AA 3ZNID 1SIFA 1T0RC 3QAQA 4C4VB 4FN2A 5JZEB 3NVYA 2LJIA 1EO6A 3AE3B 2HD5B 2SEBD 2DNFA 5L83A 4ZRKA 3VXWA 4HCNB 2EKEC 2DAFA 3NZUA 3RNBC 3IVFA 1NI2A 3ZLZA 1KOTA 5HG2A 3I5JC 4I6PA 1F2RC 1EWYC 3NHEB 2WX0A 4DHJB 3PZ8A 4XX5A 2LGYA 4MH0E 4N59A 1FRDA 1T0SC 2KX0A 4A20A 2WXJA 2BGFA 3Q3NC 1FXAA 1LM8B 1N5XA 2WYQA 5JXVA 3GS2A 3NVZA 2KWCA 2KQ7A 3TIXA 3FAHA 2E6XA 3AEAB 5FK9C 3PVLA 3AULA 3HM3A 1KH0A 1MI0A 3B2FA 4OW0A 4PS8A 4ZRPA 3WA0A 1PGAA 5EE1A 2N1WA 4MGYE 3ALBA 5CTRC 1U4AA 1FPYA 2NS5A 2JWZA 4W9LA 3Q8EA 2RDHA 3C19A 3V05A 1YN4A 1HEZE 1DYQA 3NZ3A 2IO3B 1X1MA 2E3TA 1IGDA 1OEYA 1ET6A 1V97A 3OG5A 1NEKB 3BZDB 1RFAA 3SEBA 1YQ4B 3U2SC 4W9JA 1MVKA 1GC6A 1J8CA 4ANVA 2AEHA 4ANUA 3L10B 2RSUA 4K7WA 1ISNA 2NTSA 2JZPA 3OJ4B 1IP9A 1J7AA 4GXBA 3W9CB 2N9EB 1V5OA 4KKIA 5TSSA 1FO4A 3NZSA 1F0ZA 1ZXHA 4C7ZA 4ANXA 2WU5B 1HE8A 4S17A 3A1QA 2K6DB 4NPNA 5IO9A 4FLHA 3MJWA 1LQBA 4C7YA 2GRIA 2K39A 1T5XD 2AQ1B 3WALA 4RGMA 4B0EA 3N3KB 2KO3A 4J3OD 2BYEA 1SE2A 3VTVA 3KUDB 3GE3C 4KGSA 2JZZA 3ZXVA 3APCA 2LHDA 3BK1A 1L6VA 4LJPB 2KTFA 3PV1A 3DVNV 3Q69A 2J4XA 4YXDB 4KV2A 4B0MA 3WAOA 1WGYA 4UDUC 2D3AA 2WP9B 1QLBB 3AE9B 5HI1A 3GZNI 1Z5SB 3KH0A 3V6EB 3UF8A 3ML8A 4EZJA 3V61A 2IGHA 1WMHB 3QJZA 4RGNA 4OVZA 5DPWA 1FXIA 3B2GA 2AQ3B 4ICUA 2ZPNA 2JSVX 4MGKE 4P1BC 3IT4B 2IJ0A 1D4BA 2W3SA 2GB1A 2LD9A 2REXA 5AUKA 1WXQA 4WAAA 3SDLC 1QOFA 1IYFA 2WXNA 3B0AA 4K3BA 3W1SA 4EEWA 2OJRA 4M8NA 2J42A 1TS3A 4KVGB 3TCAA 3U7ZA 1YQBA 1WYWB 3DDCB 3UINB 3Q8BA 3H7SA 2D11A 1T3QA 4TV3A 4G0NB 4YWGG 4JIOU 3AE1B 3P4PB 1ZP0B 2LGDA 4N9F4 2W55A 2MBEA 2WDQB 1SB3C 5IAAC 4D2KA 3EUB2 3A4RA 1IBXB 4B9KA 3Q8CA 3VQIA 3RN9C 2CJNA 3DVGX 4M0WB 2UU7A 3Q6BA 2KMMA 4ZYSA 4IKGA 4BKSA 1V9JA 2W54A 4CO7A 3PPAA 3QWZB 4W9HA 1L5PA 1F77A 1JWBD 4LTUA 1XXGA 1V81A 3AECB 1SJHD 1XO3A 3RCZA 1WXAA 4FBJB 4F8CB 1WFYA 2FUG1 2GBRA 1WRDB 2MA9B 5AZGA 5BMHA 1Q1OA 4B95A 4C00A 3ZGZA 2WXKA 4LK0M 3ZTDA 2OEDA 3ONSA 1ZXIA 3PTFC 4W9FA 1WI0A 1PFDA 3U7DA 4US8A 4RF0A 2LHEA 3TMPB 3PRMB 2D2QA 4JLCA 3V3XA 1C4PA 3W5UB 4NY0A 2HTME 4GU2A 5FKAC 2DBYA 3BYYB 3ZRCA 1L4DB 4NQKE 2MW5A 2PVOD 5GXGB 1IGCA 2QC8A 2BYFA 1J7BA 2J0JA 1PDXA 2K22A 2KZRA 3R7QA 5BYQA 4NAWB 3ZNGC 3H1UA 3ZIMA 5MPOA 3TEXA 2KN5A 2N9LA 1OGWA 2WDTB 3HVDA 3VAWA 3RNAC 2MHJA 4MGIE 1EU4A 1E5WA 2KANA 5JHBA 1IPGA 1SJED 3PSEB 4ZRJA 4OZCA 2AL6A 1YN3A 2KMAA 2KFKA 3LJ3A 2NPTA 4DQOC 1EWCA 1EM7A 4RCOA 3DVGY 3WAMA 1WM3A 1WJ6A 2JRIB 4LJOB 2ZVOA 2O6VB 5CHFA 1JWUD 3ZJUA 3ZDMC 2IO2B 4KSLC 1K53A 4W9IA 4HPPA 2N7EA 1Y8RC 2JZ3B 4OVUA 4E3CA 1V5TA 3AE2B 3L17A 2M1MA 4LNIA 3KWVA 2BWES 1SGHA 2DZIA 1VZ8A 1M94A 4FJYA 1XLNA 5EE0A 4E71A 5HFYA 3IT6B 5IN7A 4RNAA 1E90A 1QZEA 2R2OA 2KNBA 2WQYB 1NDDA 5LXIB 4WH4A 2MLBA 1UD7A 1XF5L 3SHQA 3O13A 3BVMA 4KDIC 4OZBA 5DPSA 2L32A 5HHDG 4NJ7A 3PZDA 4BVUC 4WIPA 2L83A 2CR5A 4MJSB 1KLVA 4P1CC 3OJ3A 3DBLB 4ZHOA 3ZUNA 2VH2A 2DENB 5CX3A 2O2VA 3LB8C 3NY5A 3IAM1 4IWPA 1ZUD2 1ZKHA 3HUIA 1J19A 1TTNA 2DWQA 1E7VA 2LFIA 2I1JA 2LUEA 4DHJD 1OFFA 4TSSA 1WMHA 1HQRD 4HRSA 1XQQA 4WWPA 2GOWA 2LEKA 2G4DB 1P0RA 2KQ4X 3RNEC 4A90A 2IZVB 1KJTA 2RDBC 1SE4A 2W3RA 2VRRB 2WXIA 2G3QB 5D3IB 2KJ6A 1I4GA 4MSQB 2CHZA 2J0MA 4M01A 3EC8A 1UWXA 1L0VB 3R7RA 1ZDXA 1CQVA 4NJ6A 1E10A 1L0YB 1SIJA 2FCSA 2GLSA 1YOVB 4KKJA 4RF1A 2BVCA 2BQQA 1C76A 4WJPA 2V4LA 3QHTA 2KAJA 1WM2A 4AWJA 1AN8A 1H8CA 2X8XX 1SF0A 3TSSA 4NAMA 3VTWA 2KVZA 1I4XA 3BVGA 2WXFA 1AWDA 4JL9A 1Q10A 5E6PA 3H7PA 1IUEA 2MSED 4HWIB 1RWSA 3VHTC 3B08A 4NJCA 1A70A 1LXDA 3W1YA 5CHWA 4WJQA 2B3AA 1ACCA
chains in the Genus database with same CATH topology
1RLFA 2RSUA 3K9PB 3EECA 4II3B 4K7WA 4KIKA 4DDID 2DYOA 3SD5A 1ISNA 4WJNA 2EMTA 5C23A 2MCNB 2V3SA 4IUMB 3DBSA 3OLMD 4DDGD 1L7YA 2MBQA 3OJ4B 1IP9A 4GXBA 1V2YA 2N9EB 2XBBC 1V5OA 2ZCBA 4BKSD 3UQAA 3NZSA 4DHZB 4M8MA 1WX9A 1NBFC 2KD0A 4ANXA 3DBLI 2LI5A 1GNUA 2LXAA 1HE8A 3A1QA 4DXAB 2K6DB 3QA8A 3MTNB 4TUUA 4F1SA 4NPNA 1GUAB 4FLHA 3MJWA 4IM3A 2MP2A 3RZWC 2L8JA 2ZNVC 4IC7B 5KHQA 2LVOA 3ZO5B 4ASWC 4AJWA 4MM3A 3AXCA 1LQBA 2FCQA 2K39A 2LASA 2CS4A 3HHMA 2ZZPB 3UIOB 1UGMA 3WALA 4GIVA 2LXCA 2ZJDA 5D7GA 2Z0DB 3N3KB 2W9NA 3L16A 2C9WB 2LJ5A 2KO3A 1XT9B 3ZNHB 5J18A 2DX5B 2BYEA 2UYZB 4FULA 3VTVA 3KUDB 4GGQA 2KJRA 2JF5A 2LVPA 4KDLB 2JZZA 2RR9A 2AYOB 3DOWA 2FCNA 1WX8A 2CHXA 4E74A 2G4SA 3APCA 2KQSA 4FJVB 1C1YB 4DBGA 3L08A 1ZW7A 2D10A 3Q3JA 4LJPB 4ICVA 2KTFA 1UBQA 3PV1A 1P1AA 4HVBA 4NAWA 3BY4B 3DVNV 3CSFA 5JH5C 2MBHA 4KV2A 2C7HA 3KW5B 3WAOA 1WGYA 3Q3FA 2WX1A 4I6NB 2CU1A 3QIJA 2DYMA 3GZNI 2KVRA 3M95A 4ZDVA 3VH4B 1Z5SB 3KH0A 3V6EB 3UF8A 3ML8A 3L13A 1FXTB 4EZJA 2ZEQA 2JUOA 2PPHA 4MELA 3V61A 1EF1A 2HTHA 4HJKA 1WMHB 1YJ1A 3QJZA 4HXDA 1WGRA 4LDTB 4PYUA 4ICUA 5DPWA 2KWUB 2N1VA 2AL3A 2ZPNA 3BINA 2KDEB 5LLIA 3ECIA 2C7MB 3CMMB 1YX5B 2IY0B 2K25A 2O6VA 1TGZB 3NS8A 1GJZA 1RAXA 2ASQA 3JSVB 3K9OB 4MGKE 3N30A 5L95C 2N9XA 1VCBA 2XEWA 3DBHI 4TKNA 4P7IA 2LD9A 4KSKC 4A3OA 2N4FA 2REXA 3ENEA 2KK8A 2A5UA 4NQLB 4WAAA 3SDLC 1IYFA 3A9JA 3JYUA 3B0AA 3MHSD 3VUWA 3WIMA 4WJOA 3W1SA 4ANWA 3PHWB 4EEWA 2OJRA 4M8NA 1SE9A 1Q5WB 1Q0WB 1E8XA 4KVGB 1V80A 2KFKB 2LWPA 3TCAA 2NPTB 3PHXB 1YQBA 4EOYA 1WYWB 3DDCB 2L00B 3L0WB 4X57B 3UINB 4GN1A 5LXHA 3PS6A 4KZCA 3H7SA 2BKRB 2D11A 3GOEA 3P2BA 4TV3A 3TBLD 3S2AA 2KTRA 4K7SA 2JRHA 3D32A 1WGDA 4G0NB 2BKFA 4EFOA 4JIOU 2JY6A 2LGDA 4N9F4 2MQJA 2L0TA 1T0YA 4YL8A 2D07B 2KOXA 1BT0A 2MBEA 4ZRIA 1LFDA 1R4MI 2BWFA 2LVQA 2C60A 3A33B 3PGEA 2J7QB 2I1KA 5IAAC 1WF9A 1C3TA 1WXVA 3RZFA 3VUYA 2NBWB 2GBKA 3PLUA 3A4RA 4EZLA 3CF6E 4B9KA 2LRUA 2WWZA 3VQIA 3APDA 3ZRFA 2M8SA 4FADA 4LCDE 1D3ZA 3DVGX 4M0WB 2ZNVB 2YVCA 4WQOB 4BKSA 1YD8U 1WE6A 1V9JA 5E6NA 3NOBA 2L7RA 4CO7A 3PPAA 2GMIC 3PRZA 3QWZB 4MJSA 4W9HA 2NVUI 5AZHA 3W1SC 4A3PA 4RM8A 2K8BA 3RYTA 5J2RA 4BFRA 4GDKA 2G45B 2K1FA 2KC1A 1V81A 3QARA 3U8ZA 1XD3B 1CMXB 4KZ0A 3RCZA 4W9DA 2CHWA 4J6IA 1WXAA 2L3ZA 2MBOA 4FBJB 1P3QU 1WJ4A 4HPMB 4BKGA 1WFYA 4RM9A 3RULA 2GBRA 4GSWA 2PEAA 4F8CB 1WRDB 2MA9B 3HK0A 4K81A 5AZGA 2Z59B 2DZMA 5AZFA 3VUXA 2FUHB 1WXSA 1Q1OA 2K8CA 2KDBA 1R4NI 4IG7B 4AP4C 4B95A 1G6JA 2BPSA 4IW0A 3ZTDA 3KYCD 3QQ8B 4HCPB 5E6OA 3RUIB 3V60A 2QHOA 4ZYNA 1UZXB 3IFWB 2NBVB 3ONSA 2JXXA 3UQBA 3A1QB 1WZ0A 3WAPA 4TQ0A 2XK5B 3ZVVA 2M4NA 3PTFC 4W9FA 1WI0A 2K8HA 4GDLB 2MP2B 3U7DA 1I35A 5DPRA 4W9KA 1WIAA 1UELA 3VFKA 3ZNZB 2C7NB 3TMPB 3PRMB 2O2VB 2D2QA 4JLCA 2KDFB 5IA7A 4NY0A 1WH3A 2KXJA 4FJZA 4NNJB 5D6JB 3X23A 3IBEA 4GU2A 3VH3B 4DK5A 5AEKB 3KYDD 2R2QA 1UBIA 2DZKA 3ZRCA 3B1LX 1WJNA 4G3XB 4NQKE 2MW5A 3APFA 1WGHA 1YX6B 3I3TB 4LDTD 4GB9A 2JVCA 4JQWC 2BYFA 2D3GA 2J0JA 1V6EA 1OEYJ 2KKCA 3DPDA 2L0FA 2KLCA 3QK0A 3EHVA 2KZRA 3JW0X 3R7QA 2MBBB 4NAWB 2HE7A 3JSVA 3R66C 3ZNGC 3H1UA 3AU4A 3ZIMA 4W9CA 1TZ1A 2KN5A 5CHVC 1RRBA 1TBEA 2KWVB 1OGWA 2WDTB 3L54A 4HDOA 3CSTA 2NR2A 3VAWA 1V86A 4RMAA 4IWQA 2FCMA 4MGIE 4W9GA 3TL5A 1E5WA 3QX1A 1WGGA 2KANA 2FAZA 5JHBA 1IPGA 4GMVA 1P9DU 2DYBA 3PSEB 4I6LB 4ZRJA 3QC8B 5D94A 3A4SC 2AL6A 3A9KB 1WZ3A 3OAWA 3H6NA 2RPQA 3DVNU 2A4ZA 2KMAA 2KFKA 3LJ3A 1E8YA 2NPTA 4MEMA 1AARA 3PT2B 4IM2A 1Z2MA 2N7DA 3DVGY 3WAMA 1WM3A 1WJ6A 2KDIA 2KC2A 2PE6B 2JRIB 4LJOB 2ZVOA 2BF8B 2O6VB 3AI5A 2DHZA 2YLMA 4IM0A 4XC2A 5CHFA 3ZDMC 2IO2B 4KSLC 3AU5A 3PREA 1E8ZA 1EUVB 3QCAA 4BKTA 3PRPB 4HPLB 4W9IA 1GC7A 2N7EA 1Y8RC 4MGZE 1ZGUB 2JZ3B 4OVUA 4E3CA 3M3JA 2JT4B 3PLVA 4OVVA 1V5TA 2PJHA 3IG3A 5D2MB 2NBUA 2M1MA 3L17A 1UH6A 2PE9A 2KJHB 1OTRB 4B6WA 2K6QA 1V49A 2DZJA 2EMSA 2KFJA 2BWES 2C5LC 5BO4B 3HIZA 3DBRI 1WR1A 1WR6E 1SGHA 2DZIA 3DQVA 3N32A 1M94A 4FJYA 2IY1B 4G50A 2DAJA 4FHKA 4HDQA 3H7PB 2NCNA 5KHOA 4E71A 4IWOA 3KUCB 3RD2A 4WWNA 4W9EA 4AJYB 4PYZA 1E90A 2ZVNA 1QZEA 2FNJB 2R2OA 3JVZX 1GG3A 1E7UA 2KNBA 2MX2A 3RT3B 1NDDA 2RGFA 5LXIB 3ZW3A 2MLBA 1UD7A 4TQ1A 2LRWA 3H9DA 4PS7A 4KIKB 2L76A 4EKUA 2IO0B 4GOCA 3SHQA 1VD2A 1P98A 3ZDTA 4KDIC 2LZ6A 4MDKE 5DPSA 3UIPB 1L2NA 3VTUA 4FHJA 2Z0EB 1MG8A 3ZNID 5J17A 4NJ7A 1SIFA 3PZDA 4BVUC 2XK5A 4EUTA 1E8WA 2CR5A 4MJSB 4PS3A 1KLVA 3QAQA 5FR6A 4FN2A 4GDKB 3OJ3A 4WWOA 5JZEB 4GDLA 3ZUNA 1EO6A 1WX7A 2DENB 2HD5B 2JPHA 5CX3A 2O2VA 3EFUA 3T9LA 5L83A 2MRPA 4ZRKA 3VXWA 4K7UA 1JRUA 3NY5A 1OQYA 2RD0A 4HCNB 4K1RB 4IWPA 1F9JA 2EKEC 4BBNF 1S1QB 2CKHB 1ZKHA 2DAFA 3NZUA 4HLEA 3IVFA 2ZCCA 3ML9A 1J19A 1NI2A 3C0RB 3ZLZA 1KOTA 2MWSB 1TTNA 3U30A 1K8RB 5JHAA 1E7VA 4I6PA 2I1JA 2LUEA 2V1YA 2ZPYA 3O65B 4DHJD 4BOZB 2BYVE 3NHEB 1WMHA 2WX0A 1S3SG 1XQQA 3M63B 4MSMB 2GOWA 4WWPA 4XZ4A 4BOSC 4DHJB 3IHPC 3KUZA 4DWFA 1I42A 4XX5A 2LGYA 2KLGA 3HM6X 3LDZE 4MH0E 2GBJA 1WE7A 2G4DB 3V62A 3R3MA 2J0KA 1EF5A 2KX0A 2OOBB 4A20A 1P0RA 5G55A 3ZTCA 2AWTA 2BGFA 3VDZA 1A5RA 2IZVB 1KJTA 4CHKA 5DCNA 2KHWB 5C1ZA 1LM8B 2WYQA 5G2NA 3A9KA 2VRRB 3SU8X 2G3QB 2KWCA 2KQ7A 2FIDA 2N9PC 2KJ6A 2KMCA 4BBNC 4MSQB 3TIXA 1WXMA 1WY8A 2L05A 2KX3A 2M0XA 2CHZA 5EDSA 1H4RA 3PVLA 2J0MA 3AULA 3HM3A 5DPTA 3EC8A 3R7RA 2O6VD 1J0GA 4HK2A 5TR5A 4PS8A 4NJ6A 3ZKJC 2IYDB 3WA0A 3KVFB 3DCGA 2FCSA 1KM7A 4JGHB 4URKA 5GMVA 3UGBB 3V6CB 2N1WA 4MGYE 4F7ZA 3ALBA 5CTRC 4AUQC 2IBIB 2GBMA 2Y5BB 1U4AA 4FA6A 2NS5A 3WANA 4AOFA 1PQSA 2JWZA 4W9LA 1YIWA 3TJPA 4WJPA 4II2B 2V4LA 3QHTA 1WJUA 1WM2A 4AWJA 2GBNA 1H8CA 3M62B 3A9JB 2IO3B 3VTWA 2M17A 3VVWB 4G11A 1X1MA 4CYEA 1OEYA 3T8MA 2IO1B 4JL9A 3X0WA 3L10B 4EZKA 5E6PA 3H7PA 1RFAA 2HJ8A 2MSED 2UWQA 4HWIB 2KTRB 2FIFA 4W9JA 3VHTC 3B08A 1GC6A 1LXDA 4DHZE 5HKHA 1J8CA 2LGXA 3W1YA 5CHWA 4ANVA 4WJQA 2AEHA 4ANUA 2B3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLF A;  2RSU A;  3K9P B;  3EEC A;  4II3 B;  4K7W A;  4KIK A;  4DDI D;  2DYO A;  3SD5 A;  1ISN A;  4WJN A;  2EMT A;  5C23 A;  2MCN B;  2V3S A;  4IUM B;  3DBS A;  3OLM D;  4DDG D;  1L7Y A;  2MBQ A;  3OJ4 B;  1IP9 A;  4GXB A;  1V2Y A;  2N9E B;  2XBB C;  1V5O A;  2ZCB A;  4BKS D;  3UQA A;  3NZS A;  4DHZ B;  4M8M A;  1WX9 A;  1NBF C;  2KD0 A;  4ANX A;  3DBL I;  2LI5 A;  1GNU A;  2LXA A;  1HE8 A;  3A1Q A;  4DXA B;  2K6D B;  3QA8 A;  3MTN B;  4TUU A;  4F1S A;  4NPN A;  1GUA B;  4FLH A;  3MJW A;  4IM3 A;  2MP2 A;  3RZW C;  2L8J A;  2ZNV C;  4IC7 B;  5KHQ A;  2LVO A;  3ZO5 B;  4ASW C;  4AJW A;  4MM3 A;  3AXC A;  1LQB A;  2FCQ A;  2K39 A;  2LAS A;  2CS4 A;  3HHM A;  2ZZP B;  3UIO B;  1UGM A;  3WAL A;  4GIV A;  2LXC A;  2ZJD A;  5D7G A;  2Z0D B;  3N3K B;  2W9N A;  3L16 A;  2C9W B;  2LJ5 A;  2KO3 A;  1XT9 B;  3ZNH B;  5J18 A;  2DX5 B;  2BYE A;  2UYZ B;  4FUL A;  3VTV A;  3KUD B;  4GGQ A;  2KJR A;  2JF5 A;  2LVP A;  4KDL B;  2JZZ A;  2RR9 A;  2AYO B;  3DOW A;  2FCN A;  1WX8 A;  2CHX A;  4E74 A;  2G4S A;  3APC A;  2KQS A;  4FJV B;  1C1Y B;  4DBG A;  3L08 A;  1ZW7 A;  2D10 A;  3Q3J A;  4LJP B;  4ICV A;  2KTF A;  1UBQ A;  3PV1 A;  1P1A A;  4HVB A;  4NAW A;  3BY4 B;  3DVN V;  3CSF A;  5JH5 C;  2MBH A;  4KV2 A;  2C7H A;  3KW5 B;  3WAO A;  1WGY A;  3Q3F A;  2WX1 A;  4I6N B;  2CU1 A;  3QIJ A;  2DYM A;  3GZN I;  2KVR A;  3M95 A;  4ZDV A;  3VH4 B;  1Z5S B;  3KH0 A;  3V6E B;  3UF8 A;  3ML8 A;  3L13 A;  1FXT B;  4EZJ A;  2ZEQ A;  2JUO A;  2PPH A;  4MEL A;  3V61 A;  1EF1 A;  2HTH A;  4HJK A;  1WMH B;  1YJ1 A;  3QJZ A;  4HXD A;  1WGR A;  4LDT B;  4PYU A;  4ICU A;  5DPW A;  2KWU B;  2N1V A;  2AL3 A;  2ZPN A;  3BIN A;  2KDE B;  5LLI A;  3ECI A;  2C7M B;  3CMM B;  1YX5 B;  2IY0 B;  2K25 A;  2O6V A;  1TGZ B;  3NS8 A;  1GJZ A;  1RAX A;  2ASQ A;  3JSV B;  3K9O B;  4MGK E;  3N30 A;  5L95 C;  2N9X A;  1VCB A;  2XEW A;  3DBH I;  4TKN A;  4P7I A;  2LD9 A;  4KSK C;  4A3O A;  2N4F A;  2REX A;  3ENE A;  2KK8 A;  2A5U A;  4NQL B;  4WAA A;  3SDL C;  1IYF A;  3A9J A;  3JYU A;  3B0A A;  3MHS D;  3VUW A;  3WIM A;  4WJO A;  3W1S A;  4ANW A;  3PHW B;  4EEW A;  2OJR A;  4M8N A;  1SE9 A;  1Q5W B;  1Q0W B;  1E8X A;  4KVG B;  1V80 A;  2KFK B;  2LWP A;  3TCA A;  2NPT B;  3PHX B;  1YQB A;  4EOY A;  1WYW B;  3DDC B;  2L00 B;  3L0W B;  4X57 B;  3UIN B;  4GN1 A;  5LXH A;  3PS6 A;  4KZC A;  3H7S A;  2BKR B;  2D11 A;  3GOE A;  3P2B A;  4TV3 A;  3TBL D;  3S2A A;  2KTR A;  4K7S A;  2JRH A;  3D32 A;  1WGD A;  4G0N B;  2BKF A;  4EFO A;  4JIO U;  2JY6 A;  2LGD A;  4N9F 4;  2MQJ A;  2L0T A;  1T0Y A;  4YL8 A;  2D07 B;  2KOX A;  1BT0 A;  2MBE A;  4ZRI A;  1LFD A;  1R4M I;  2BWF A;  2LVQ A;  2C60 A;  3A33 B;  3PGE A;  2J7Q B;  2I1K A;  5IAA C;  1WF9 A;  1C3T A;  1WXV A;  3RZF A;  3VUY A;  2NBW B;  2GBK A;  3PLU A;  3A4R A;  4EZL A;  3CF6 E;  4B9K A;  2LRU A;  2WWZ A;  3VQI A;  3APD A;  3ZRF A;  2M8S A;  4FAD A;  4LCD E;  1D3Z A;  3DVG X;  4M0W B;  2ZNV B;  2YVC A;  4WQO B;  4BKS A;  1YD8 U;  1WE6 A;  1V9J A;  5E6N A;  3NOB A;  2L7R A;  4CO7 A;  3PPA A;  2GMI C;  3PRZ A;  3QWZ B;  4MJS A;  4W9H A;  2NVU I;  5AZH A;  3W1S C;  4A3P A;  4RM8 A;  2K8B A;  3RYT A;  5J2R A;  4BFR A;  4GDK A;  2G45 B;  2K1F A;  2KC1 A;  1V81 A;  3QAR A;  3U8Z A;  1XD3 B;  1CMX B;  4KZ0 A;  3RCZ A;  4W9D A;  2CHW A;  4J6I A;  1WXA A;  2L3Z A;  2MBO A;  4FBJ B;  1P3Q U;  1WJ4 A;  4HPM B;  4BKG A;  1WFY A;  4RM9 A;  3RUL A;  2GBR A;  4GSW A;  2PEA A;  4F8C B;  1WRD B;  2MA9 B;  3HK0 A;  4K81 A;  5AZG A;  2Z59 B;  2DZM A;  5AZF A;  3VUX A;  2FUH B;  1WXS A;  1Q1O A;  2K8C A;  2KDB A;  1R4N I;  4IG7 B;  4AP4 C;  4B95 A;  1G6J A;  2BPS A;  4IW0 A;  3ZTD A;  3KYC D;  3QQ8 B;  4HCP B;  5E6O A;  3RUI B;  3V60 A;  2QHO A;  4ZYN A;  1UZX B;  3IFW B;  2NBV B;  3ONS A;  2JXX A;  3UQB A;  3A1Q B;  1WZ0 A;  3WAP A;  4TQ0 A;  2XK5 B;  3ZVV A;  2M4N A;  3PTF C;  4W9F A;  1WI0 A;  2K8H A;  4GDL B;  2MP2 B;  3U7D A;  1I35 A;  5DPR A;  4W9K A;  1WIA A;  1UEL A;  3VFK A;  3ZNZ B;  2C7N B;  3TMP B;  3PRM B;  2O2V B;  2D2Q A;  4JLC A;  2KDF B;  5IA7 A;  4NY0 A;  1WH3 A;  2KXJ A;  4FJZ A;  4NNJ B;  5D6J B;  3X23 A;  3IBE A;  4GU2 A;  3VH3 B;  4DK5 A;  5AEK B;  3KYD D;  2R2Q A;  1UBI A;  2DZK A;  3ZRC A;  3B1L X;  1WJN A;  4G3X B;  4NQK E;  2MW5 A;  3APF A;  1WGH A;  1YX6 B;  3I3T B;  4LDT D;  4GB9 A;  2JVC A;  4JQW C;  2BYF A;  2D3G A;  2J0J A;  1V6E A;  1OEY J;  2KKC A;  3DPD A;  2L0F A;  2KLC A;  3QK0 A;  3EHV A;  2KZR A;  3JW0 X;  3R7Q A;  2MBB B;  4NAW B;  2HE7 A;  3JSV A;  3R66 C;  3ZNG C;  3H1U A;  3AU4 A;  3ZIM A;  4W9C A;  1TZ1 A;  2KN5 A;  5CHV C;  1RRB A;  1TBE A;  2KWV B;  1OGW A;  2WDT B;  3L54 A;  4HDO A;  3CST A;  2NR2 A;  3VAW A;  1V86 A;  4RMA A;  4IWQ A;  2FCM A;  4MGI E;  4W9G A;  3TL5 A;  1E5W A;  3QX1 A;  1WGG A;  2KAN A;  2FAZ A;  5JHB A;  1IPG A;  4GMV A;  1P9D U;  2DYB A;  3PSE B;  4I6L B;  4ZRJ A;  3QC8 B;  5D94 A;  3A4S C;  2AL6 A;  3A9K B;  1WZ3 A;  3OAW A;  3H6N A;  2RPQ A;  3DVN U;  2A4Z A;  2KMA A;  2KFK A;  3LJ3 A;  1E8Y A;  2NPT A;  4MEM A;  1AAR A;  3PT2 B;  4IM2 A;  1Z2M A;  2N7D A;  3DVG Y;  3WAM A;  1WM3 A;  1WJ6 A;  2KDI A;  2KC2 A;  2PE6 B;  2JRI B;  4LJO B;  2ZVO A;  2BF8 B;  2O6V B;  3AI5 A;  2DHZ A;  2YLM A;  4IM0 A;  4XC2 A;  5CHF A;  3ZDM C;  2IO2 B;  4KSL C;  3AU5 A;  3PRE A;  1E8Z A;  1EUV B;  3QCA A;  4BKT A;  3PRP B;  4HPL B;  4W9I A;  1GC7 A;  2N7E A;  1Y8R C;  4MGZ E;  1ZGU B;  2JZ3 B;  4OVU A;  4E3C A;  3M3J A;  2JT4 B;  3PLV A;  4OVV A;  1V5T A;  2PJH A;  3IG3 A;  5D2M B;  2NBU A;  2M1M A;  3L17 A;  1UH6 A;  2PE9 A;  2KJH B;  1OTR B;  4B6W A;  2K6Q A;  1V49 A;  2DZJ A;  2EMS A;  2KFJ A;  2BWE S;  2C5L C;  5BO4 B;  3HIZ A;  3DBR I;  1WR1 A;  1WR6 E;  1SGH A;  2DZI A;  3DQV A;  3N32 A;  1M94 A;  4FJY A;  2IY1 B;  4G50 A;  2DAJ A;  4FHK A;  4HDQ A;  3H7P B;  2NCN A;  5KHO A;  4E71 A;  4IWO A;  3KUC B;  3RD2 A;  4WWN A;  4W9E A;  4AJY B;  4PYZ A;  1E90 A;  2ZVN A;  1QZE A;  2FNJ B;  2R2O A;  3JVZ X;  1GG3 A;  1E7U A;  2KNB A;  2MX2 A;  3RT3 B;  1NDD A;  2RGF A;  5LXI B;  3ZW3 A;  2MLB A;  1UD7 A;  4TQ1 A;  2LRW A;  3H9D A;  4PS7 A;  4KIK B;  2L76 A;  4EKU A;  2IO0 B;  4GOC A;  3SHQ A;  1VD2 A;  1P98 A;  3ZDT A;  4KDI C;  2LZ6 A;  4MDK E;  5DPS A;  3UIP B;  1L2N A;  3VTU A;  4FHJ A;  2Z0E B;  1MG8 A;  3ZNI D;  5J17 A;  4NJ7 A;  1SIF A;  3PZD A;  4BVU C;  2XK5 A;  4EUT A;  1E8W A;  2CR5 A;  4MJS B;  4PS3 A;  1KLV A;  3QAQ A;  5FR6 A;  4FN2 A;  4GDK B;  3OJ3 A;  4WWO A;  5JZE B;  4GDL A;  3ZUN A;  1EO6 A;  1WX7 A;  2DEN B;  2HD5 B;  2JPH A;  5CX3 A;  2O2V A;  3EFU A;  3T9L A;  5L83 A;  2MRP A;  4ZRK A;  3VXW A;  4K7U A;  1JRU A;  3NY5 A;  1OQY A;  2RD0 A;  4HCN B;  4K1R B;  4IWP A;  1F9J A;  2EKE C;  4BBN F;  1S1Q B;  2CKH B;  1ZKH A;  2DAF A;  3NZU A;  4HLE A;  3IVF A;  2ZCC A;  3ML9 A;  1J19 A;  1NI2 A;  3C0R B;  3ZLZ A;  1KOT A;  2MWS B;  1TTN A;  3U30 A;  1K8R B;  5JHA A;  1E7V A;  4I6P A;  2I1J A;  2LUE A;  2V1Y A;  2ZPY A;  3O65 B;  4DHJ D;  4BOZ B;  2BYV E;  3NHE B;  1WMH A;  2WX0 A;  1S3S G;  1XQQ A;  3M63 B;  4MSM B;  2GOW A;  4WWP A;  4XZ4 A;  4BOS C;  4DHJ B;  3IHP C;  3KUZ A;  4DWF A;  1I42 A;  4XX5 A;  2LGY A;  2KLG A;  3HM6 X;  3LDZ E;  4MH0 E;  2GBJ A;  1WE7 A;  2G4D B;  3V62 A;  3R3M A;  2J0K A;  1EF5 A;  2KX0 A;  2OOB B;  4A20 A;  1P0R A;  5G55 A;  3ZTC A;  2AWT A;  2BGF A;  3VDZ A;  1A5R A;  2IZV B;  1KJT A;  4CHK A;  5DCN A;  2KHW B;  5C1Z A;  1LM8 B;  2WYQ A;  5G2N A;  3A9K A;  2VRR B;  3SU8 X;  2G3Q B;  2KWC A;  2KQ7 A;  2FID A;  2N9P C;  2KJ6 A;  2KMC A;  4BBN C;  4MSQ B;  3TIX A;  1WXM A;  1WY8 A;  2L05 A;  2KX3 A;  2M0X A;  2CHZ A;  5EDS A;  1H4R A;  3PVL A;  2J0M A;  3AUL A;  3HM3 A;  5DPT A;  3EC8 A;  3R7R A;  2O6V D;  1J0G A;  4HK2 A;  5TR5 A;  4PS8 A;  4NJ6 A;  3ZKJ C;  2IYD B;  3WA0 A;  3KVF B;  3DCG A;  2FCS A;  1KM7 A;  4JGH B;  4URK A;  5GMV A;  3UGB B;  3V6C B;  2N1W A;  4MGY E;  4F7Z A;  3ALB A;  5CTR C;  4AUQ C;  2IBI B;  2GBM A;  2Y5B B;  1U4A A;  4FA6 A;  2NS5 A;  3WAN A;  4AOF A;  1PQS A;  2JWZ A;  4W9L A;  1YIW A;  3TJP A;  4WJP A;  4II2 B;  2V4L A;  3QHT A;  1WJU A;  1WM2 A;  4AWJ A;  2GBN A;  1H8C A;  3M62 B;  3A9J B;  2IO3 B;  3VTW A;  2M17 A;  3VVW B;  4G11 A;  1X1M A;  4CYE A;  1OEY A;  3T8M A;  2IO1 B;  4JL9 A;  3X0W A;  3L10 B;  4EZK A;  5E6P A;  3H7P A;  1RFA A;  2HJ8 A;  2MSE D;  2UWQ A;  4HWI B;  2KTR B;  2FIF A;  4W9J A;  3VHT C;  3B08 A;  1GC6 A;  1LXD A;  4DHZ E;  5HKH A;  1J8C A;  2LGX A;  3W1Y A;  5CHW A;  4ANV A;  4WJQ A;  2AEH A;  4ANU A;  2B3A A; 
#chains in the Genus database with same CATH topology
 3DWG C;  3SD5 A;  4WJN A;  4RGO S;  2EMT A;  5C23 A;  3AH7 A;  4L23 A;  1R4M B;  4ARC A;  2V3S A;  4IUM B;  2MBQ A;  1NBF C;  3DBL I;  3CIR B;  3BII D;  3QA8 A;  1JML A;  4TUU A;  1KTK A;  1GUA B;  2I2Y A;  4XYC A;  2J53 A;  3UI3 A;  4IM3 A;  1RM6 C;  4P16 A;  4IC7 B;  3TEY A;  2LVO A;  2FCQ A;  3UIO B;  3HHM A;  2PMV A;  4GIV A;  1NVI D;  4MAC A;  3L16 A;  1XT9 B;  2DX5 B;  1QQR A;  1V8C A;  3ABV B;  2VZK B;  3EFC A;  5E6J A;  3DOW A;  2FCN A;  1WX8 A;  2CHX A;  2G4S A;  2WXG A;  3Q3J A;  4ICV A;  4HVB A;  2AQ2 B;  4NAW A;  3AED B;  5JH5 C;  2JYE A;  2MBH A;  1HTQ A;  2WX1 A;  1JQ4 A;  1FNV A;  2CU1 A;  3QIJ A;  1GB4 A;  1SBB B;  1TKE A;  3M95 A;  3VR8 B;  1WRI A;  1C9F A;  3L13 A;  3GZN B;  1EF1 A;  4A8X C;  3BK2 A;  4PYU A;  2MH7 A;  5BYR A;  3I57 A;  3ECI A;  3P4S B;  2IY0 B;  2O6V A;  1GJZ A;  2ASQ A;  3K9O B;  3Q8F A;  1SE3 A;  2EEL A;  2N9X A;  2XEW A;  3DBH I;  4MT5 A;  3AV8 A;  4P7I A;  1I4H A;  3A9J A;  3MHS D;  3VUW A;  3WIM A;  4ANW A;  1SE9 A;  1Q5W B;  2L52 A;  2KFK B;  2LWP A;  4AS1 A;  1FNW A;  4L1B A;  2NPT B;  2WHI A;  3PHX B;  3L0W B;  4X57 B;  2JX5 A;  1EU3 A;  4LNK A;  3TBL D;  2KTR A;  4K7S A;  2JRH A;  3D32 A;  3T3N A;  1QT9 A;  4YT0 B;  4RGT A;  1T0Y A;  4HEA 1;  1VZ6 A;  1LFD A;  1R4M I;  3A33 B;  2D3B A;  4EZL A;  2QCZ A;  4KX6 B;  3APD A;  3ZRF A;  2M8S A;  1E9M A;  2QSD A;  2YVC A;  3URY A;  5E6N A;  3U4E G;  3B9J A;  5AZH A;  2INP E;  4MJS A;  2NVU I;  4A3P A;  2K8B A;  2KC1 A;  3U8Z A;  1RFK A;  1CMX B;  2FBW B;  4J6I A;  2L3Z A;  3AMZ A;  1I7H A;  4HPM B;  1I35 A;  4K81 A;  1WSP A;  2FUH B;  4AP4 C;  4IG7 B;  4IW0 A;  3KYC D;  4HCP B;  3N1Z C;  3RUI B;  4ZYN A;  3IFW B;  2NBV B;  1OQQ A;  2WNM A;  3WAP A;  2M4N A;  1YJI A;  2MP2 B;  5DPR A;  4S0R A;  3MC8 A;  5D3D A;  1UEL A;  3VFK A;  1XLQ A;  5H8Y E;  2O2V B;  2Y3A A;  3ZQ4 A;  5IA7 A;  1D6E C;  1WH3 A;  5IP4 D;  1RYJ A;  1I4R A;  5AEK B;  4DK5 A;  1MJD A;  1UBI A;  2PKO A;  2D3C A;  3AEG B;  4LDT D;  4GB9 A;  1GPX A;  2JVC A;  4LNF A;  3I63 C;  2D3G A;  2LMC A;  2WXR A;  2KLC A;  3JW0 X;  2MBB B;  1T0Q C;  3AU4 A;  4W9C A;  1TZ1 A;  4YSY B;  1TBE A;  4M00 A;  3FIL A;  2BB5 A;  2TSS A;  3CST A;  3H8H A;  1K52 A;  2AX5 A;  4IWQ A;  1WGG A;  2FAZ A;  2J52 A;  2KDM A;  1P9D U;  3QC8 B;  3VR9 B;  2BW2 A;  1ET9 A;  1WZ3 A;  3OAW A;  2A4Z A;  1E8Y A;  4JWS C;  4MEM A;  1FFV A;  1M4V A;  1Z2M A;  2N7D A;  2KDI A;  4IOI E;  4IM0 A;  1D5M C;  3BVZ A;  3W5V B;  1FIQ A;  3MFG A;  3AB5 A;  3PRP B;  4HPL B;  1GC7 A;  4MGZ E;  1QKZ A;  1L6U A;  3PLV A;  1BXT A;  1JW9 D;  2M19 A;  2EMS A;  2WGS A;  4MH8 A;  1WR6 E;  1L4Z B;  3DQV A;  3N32 A;  4G50 A;  2DAJ A;  3H7P B;  4PYZ A;  2ZVN A;  4XWT A;  3RT3 B;  1E7U A;  1JWA D;  2RGF A;  1I4P A;  4TQ1 A;  3H9D A;  2QIL A;  4EKU A;  1P98 A;  5C3J B;  3RI7 C;  4FHJ A;  3VTU A;  2Z0E B;  1MG8 A;  1XCT L;  2H88 B;  5J17 A;  2FE8 A;  2XK5 A;  1E8W A;  5FR6 A;  4GDK B;  5G5H A;  4WWO A;  2B76 B;  2QMT A;  4GDL A;  4IDI A;  5IOI A;  1WX7 A;  2JPH A;  4BZA A;  3T9L A;  1JRU A;  1KFY B;  1Y56 A;  2BT6 A;  1OQR A;  2RD0 A;  4K1R B;  1P7E A;  1ENF A;  4BBN F;  3TEW A;  3C0R B;  2IGD A;  2MWS B;  1WGK A;  3U30 A;  1K8R B;  2ZPY A;  3O65 B;  1TKY A;  4BOZ B;  1AYF A;  2BYV E;  3M63 B;  1DGJ A;  4XZ4 A;  2INC C;  4FXC A;  4PT5 A;  3R3M A;  1V1P A;  2OOB B;  1EF5 A;  3E9S A;  3PZ7 A;  1BML C;  1SXT A;  2AWT A;  1VDV A;  1K51 A;  1A5R A;  1BUI C;  4CHK A;  5DCN A;  1J7C A;  1QIL A;  5G2N A;  5BYS A;  3SU8 X;  3RMK C;  2PTL A;  2N9P C;  4BBN C;  1FEH A;  2KMC A;  1QOB A;  4JX1 C;  1NEN B;  1WXM A;  2L05 A;  2M0X A;  5DPT A;  2IYD B;  4XWW A;  4REZ A;  4P6V F;  3V6C B;  3RNF C;  4AUQ C;  2GBM A;  1VJK A;  3WAN A;  4AOF A;  1PQS A;  3TJP A;  1KF6 B;  3GE8 C;  4II2 B;  1WJU A;  2GBN A;  4OHJ A;  3LYY A;  3A9J B;  4CYE A;  2M17 A;  4G11 A;  3MP9 A;  2OHF A;  2WU2 B;  3X0W A;  4EZK A;  3FKY A;  4CQN A;  2UWQ A;  4DXF A;  2KTR B;  2FIF A;  3N1X C;  4DHZ E;  1H4R A;  3MJ5 A;  1MG4 A;  3K9P B;  3EEC A;  4II3 B;  4WUR A;  2DYO A;  4US9 A;  2CU3 A;  3DBS A;  3OLM D;  1L7Y A;  2HDE A;  1AW7 A;  3UQA A;  4BKS D;  1TYG B;  1I4Q A;  2LI5 A;  1GNU A;  3MTN B;  2KWD A;  2V0G A;  2MP2 A;  1JWM D;  2Y5C A;  2K3U A;  1TKG A;  4AJW A;  4A6Q A;  1UGJ A;  2QEJ C;  2LAS A;  2CS4 A;  2ZZP B;  3DHH C;  1JRO A;  2LXC A;  2Z0D B;  4WAF A;  2W9N A;  2C9W B;  5J18 A;  2UYZ B;  1B9R A;  4GGQ A;  3L4P A;  2KJR A;  2JF5 A;  4KDL B;  2RR9 A;  2AYO B;  1SEB D;  4E74 A;  2WXO A;  2PVG C;  1C1Y B;  3NG0 A;  1N63 A;  2D10 A;  1P1A A;  3Q14 C;  3BY4 B;  2N0S B;  3CSF A;  3U52 E;  2C7H A;  1HXY D;  4XE0 A;  2DYM A;  4ZDV A;  3VH4 B;  1QF6 A;  1TS5 A;  1FFU A;  1FD6 A;  2ZEQ A;  1WYG A;  2PPH A;  1E0Z A;  1YJ1 A;  4YSZ B;  2KWU B;  2N1V A;  2AL3 A;  3BIN A;  2KDE B;  2GI9 A;  4O1N A;  5LLI A;  2C7M B;  1P7F A;  1YX5 B;  3RNC C;  4ARI A;  4ZRQ A;  5H92 C;  5L95 C;  3HVZ A;  1VCB A;  3FIL B;  1TY0 A;  3ENE A;  4NQL B;  2KK8 A;  2A5U A;  1JRP A;  2BS4 B;  1ESF A;  4WJO A;  2PIA A;  3PHW B;  3DBH B;  4YTN B;  1Q0W B;  2JU6 X;  5LXH A;  2MEK A;  3PS6 A;  3GOE A;  3P2B A;  1WGD A;  2MJE A;  2MQJ A;  2JWU A;  2L0T A;  4YL8 A;  2D07 B;  2KOX A;  2MJ3 A;  1D5Z C;  2J7Q B;  1C77 A;  3R8B A;  4C80 A;  1C3T A;  1C4C A;  3RZF A;  3N1Y C;  2NBW B;  3VUY A;  1YQ3 B;  3PLU A;  3RPF C;  2DLB A;  2QDF A;  2WDR B;  2LRU A;  3OWE B;  4FAD A;  4WQO B;  1XEE A;  1HZ6 A;  4ZHP A;  3NOB A;  2L7R A;  4XDC A;  2GMI C;  4RM8 A;  3RYT A;  1B1Z A;  2G45 B;  4GDK A;  3QAR A;  3VRA B;  4W9D A;  1KLU D;  1TJE A;  1P3Q U;  4BKG A;  1YJJ A;  4RM9 A;  4YTM B;  4GSW A;  2PEA A;  2WXL A;  3ZJV A;  3VUX A;  2DZM A;  1MPE A;  1R4N I;  1DOX A;  2BPS A;  3QQ8 B;  5E6O A;  3V60 A;  2JXX A;  3NUH B;  3EGR A;  1WZ0 A;  4TQ0 A;  2XK5 B;  3WCQ A;  3ZVV A;  2KYW A;  2K8H A;  4GDL B;  3IXS A;  4MM3 B;  3ZNZ B;  2C7N B;  2M56 B;  4FJZ A;  5D6J B;  3E56 A;  4KGR A;  3B1L X;  1WJN A;  2JYT A;  4HRO A;  4AQ7 A;  4GLS C;  1PGB A;  1WGH A;  3I3T B;  3DWM A;  2IND C;  2WXQ A;  4USA A;  1V6E A;  1OEY J;  2JXT A;  2KKC A;  3NVV A;  2L0F A;  3QK0 A;  3JSV A;  3R66 C;  1C79 A;  5CHV C;  2KWV B;  1YN5 A;  1V1P B;  3I9V 1;  3L54 A;  2XN9 C;  4HDO A;  3W2D A;  2BB6 A;  3AE7 B;  1V86 A;  2QJL A;  2I38 A;  3TL5 A;  2LGI A;  3QX1 A;  2DYB A;  4I6L B;  3A4S C;  3H6N A;  4A9A A;  3DVN U;  2K0P A;  1E6E B;  3IAS 1;  2L1A A;  3PT2 B;  3ETR A;  1STE A;  2INN E;  3MC9 A;  2BF8 B;  4HKQ A;  3AI5 A;  1TT5 B;  3AE4 B;  1GB1 A;  5EE9 A;  3AU5 A;  3PRE A;  4N58 A;  1JCK B;  1E8Z A;  1EUV B;  1HZ5 A;  3QCA A;  1ZGU B;  1UUP A;  2PJH A;  2BTE A;  2KN4 A;  3IG3 A;  2NBU A;  5D2M B;  2WXP A;  1UH6 A;  3R2T A;  1OTR B;  4B6W A;  2KFJ A;  1N60 A;  5BO4 B;  4TMA B;  3HIZ A;  3DBR I;  4KGT A;  1D5X C;  2IY1 B;  3P4R B;  4OZA A;  4FHK A;  4HDQ A;  2NCN A;  1ZOY B;  4AJY B;  1QOA A;  3MHZ A;  2FNJ B;  2IPK D;  3JVZ X;  1F1H A;  1GG3 A;  1MFW A;  1NI3 A;  2ON8 A;  1TIF A;  2LRW A;  2LUM A;  4BAX A;  1MHH E;  1XCQ L;  2IO0 B;  4GOC A;  2D5G A;  1VD2 A;  3ZDT A;  4MDK E;  2LZ6 A;  3UIP B;  1PUT A;  3GP7 A;  2N9K A;  4NZL B;  3AEB B;  4EUT A;  4PS3 A;  4QAY A;  5T8I A;  2V9H A;  1YNT E;  2V4I B;  3EFU A;  2MRP A;  4K7U A;  1OQY A;  4A55 A;  4N6E B;  1F9J A;  2RPV A;  1S1Q B;  2CKH B;  4HLE A;  3ML9 A;  2ZCC A;  4M02 A;  5FR3 A;  1CK1 A;  1E7P B;  2K9X A;  5JHA A;  2KT7 A;  2V1Y A;  1S3S G;  4MSM B;  4BOS C;  3IHP C;  3KUZ A;  4DWF A;  1I42 A;  1GAQ B;  2KLG A;  2BS3 B;  1FMA D;  3HM6 X;  2GBJ A;  1WE7 A;  3LDZ E;  3V62 A;  2J0K A;  2KAC A;  2ZW1 A;  2HJ1 A;  5G55 A;  3ZTC A;  1ROE A;  2V3N A;  3BYT B;  3VDZ A;  3BWU D;  4JE3 B;  2KHW B;  5C1Z A;  1C78 A;  1ZDV A;  3A9K A;  3N9Y C;  4XDD A;  2FID A;  3ZJT A;  4WQM A;  1WY8 A;  2KX3 A;  2ZW0 A;  5EDS A;  3DHG C;  1J0G A;  2O6V D;  4HK2 A;  5TR5 A;  3ZKJ C;  3KVF B;  3DCG A;  1KM7 A;  4JGH B;  4URK A;  5GMV A;  3UGB B;  4F7Z A;  3NVW A;  2IBI B;  2Y5B B;  4FA6 A;  1UF0 A;  3VRB B;  1YIW A;  3AN1 A;  2BYT A;  3M62 B;  3SR6 A;  1NYR A;  4JPS A;  3VVW B;  3T8M A;  2IO1 B;  1N6Z A;  4RH6 A;  4K3C A;  3C8Y A;  1KLG D;  1L0X B;  1K50 A;  2HJ8 A;  2BS2 B;  2BBC A;  3ZYY X;  5HKH A;  2LGX A;  4W9G A;  1RLF A;  2QIE B;  2N7J A;  4KIK A;  4DDI D;  3P63 A;  1UNS A;  2MCN B;  2YEP F;  4ZOH C;  4DDG D;  3NRZ A;  1V2Y A;  2XBB C;  2ZCB A;  2H89 B;  3AE5 B;  4M8M A;  4DHZ B;  1WX9 A;  2KD0 A;  1QOG A;  2LXA A;  2IDY A;  2RDG A;  4C4V A;  4DXA B;  2SAK A;  4F1S A;  4LNO A;  3AE8 B;  2IGG A;  1F2R I;  3RZW C;  2L8J A;  2ZNV C;  5KHQ A;  3ZO5 B;  4ASW C;  4MM3 A;  3AXC A;  3ZXR A;  3AE6 B;  3P1M A;  1UGM A;  4ACF A;  2ZJD A;  5D7G A;  3Q3O C;  1WWT A;  4EE2 A;  2LJ5 A;  3ZNH B;  4FUL A;  4C56 C;  2LVP A;  1UWM A;  2KQS A;  4FJV B;  4DBG A;  3L08 A;  1ZW7 A;  1R7S A;  1UBQ A;  2OJW A;  2WDV B;  3KW5 B;  2X38 A;  3Q3F A;  1GOZ A;  4DXG A;  4I6N B;  2KVR A;  3SFD B;  1FXT B;  2JUO A;  3Q2A C;  4MEL A;  2HTH A;  4HJK A;  4HXD A;  4LDT B;  1WGR A;  5C2T B;  2RMM A;  3CMM B;  2K25 A;  1TGZ B;  3NS8 A;  3T3O A;  4R3D A;  1RAX A;  3JSV B;  4Q2J A;  3N30 A;  2Y5P A;  1F52 A;  5EE3 A;  1N61 A;  1CJE A;  4TKN A;  4KSK C;  4A3O A;  2N4F A;  3P4Q B;  1DOY A;  1FM0 D;  1ZPS A;  3JYU A;  2NTT A;  2VH1 A;  5G5G A;  2PW9 A;  2ONQ A;  1E8X A;  3DHI C;  1C4A A;  1V80 A;  1SSN A;  2R61 A;  4EOY A;  2L00 B;  4GN1 A;  2G9H D;  4KZC A;  1VRA B;  2BKR B;  3S2A A;  1VZ7 A;  4EFO A;  2BKF A;  2JY6 A;  5AUI A;  1FRR A;  1BT0 A;  4ZRI A;  2BWF A;  2LVQ A;  2C60 A;  3PGE A;  2I1K A;  1XLP A;  1WF9 A;  1KRH A;  4WWM A;  3AEF B;  1WXV A;  2GBK A;  3CF6 E;  2WWZ A;  4LCD E;  4JWU C;  1D3Z A;  2ZNV B;  1YD8 U;  1TS4 A;  1WE6 A;  1TY2 A;  3PRZ A;  5BMI A;  3W1S C;  1N62 A;  1N5W A;  2Z8L A;  5J2R A;  4BFR A;  2K1F A;  1XD3 B;  4KZ0 A;  2CHW A;  2MBO A;  2YEP B;  1V1O A;  1WJ4 A;  3RUL A;  3HK0 A;  2EKI A;  2Z59 B;  5AZF A;  2PLP A;  1WXS A;  2KDB A;  2K8C A;  3RFZ B;  1G6J A;  2W82 A;  2LGS A;  2VZK D;  2CJO A;  2QHO A;  1UZX B;  2WLB A;  4LLG M;  3Q8A A;  3UQB A;  3A1Q B;  1R4N B;  1FNU A;  1LO5 D;  1LGR A;  1CZP A;  3TEZ A;  2MJD A;  4YTP B;  4W9K A;  1WIA A;  2WS3 B;  4HJG E;  3P42 A;  1HA5 A;  1TS2 A;  2KDF B;  2KXJ A;  3KLS X;  4NNJ B;  3X23 A;  3CWI A;  3IBE A;  3KWL A;  3VH3 B;  3KYD D;  2R2Q A;  1T6B X;  2DZK A;  4PK1 A;  1HTO A;  5LNK 1;  4G3X B;  2G1E A;  3APF A;  3MC0 B;  1YX6 B;  4JQW C;  2NMQ A;  3Q3M C;  3DPD A;  1ZE3 D;  3EHV A;  1VR9 A;  2HE7 A;  3LXF A;  1RRB A;  2Q5W D;  1YMH E;  2NR2 A;  4L2Y A;  4RMA A;  1NYQ A;  3TUO A;  5BMG A;  2FCM A;  4H2A A;  3FC4 A;  4GMV A;  3HRD D;  5D94 A;  3A9K B;  2RPQ A;  2K5P A;  4LNN A;  1FCC C;  1VLB A;  4RFB A;  1AAR A;  4IM2 A;  2PE6 B;  4XGA B;  2KC2 A;  2DHZ A;  2YLM A;  4XC2 A;  4ITK A;  3NS1 A;  5I4D A;  3SFE B;  2WXM A;  4BKT A;  1XLO A;  3M3J A;  2JT4 B;  4OVV A;  2XNA C;  2PE9 A;  3AM9 A;  1IBX A;  2KJH B;  2K6Q A;  1V49 A;  2WXH A;  2DZJ A;  1PYW D;  4M0W A;  2C5L C;  2V3P A;  1WR1 A;  3N20 C;  3PO0 A;  2ACZ B;  4HKZ E;  3J9C A;  5KHO A;  4IWO A;  3KUC B;  3RD2 A;  1JWS D;  4WWN A;  4W9E A;  3DBR B;  3KQ4 A;  3RNG C;  3AEE B;  4YSX B;  3EA6 A;  1FCL A;  1TZO A;  2MX2 A;  3R2I A;  3NJT A;  1PGX A;  3ZW3 A;  4PS7 A;  5IKC M;  4KIK B;  2L76 A;  2JQR B;  1DOI A;  2ICI A;  3GB1 A;  1L2N A;  1JAL A;  1MHX A;  2M0A A;  3ZNI D;  1SIF A;  1T0R C;  3QAQ A;  4C4V B;  4FN2 A;  5JZE B;  3NVY A;  2LJI A;  1EO6 A;  3AE3 B;  2HD5 B;  2SEB D;  2DNF A;  5L83 A;  4ZRK A;  3VXW A;  4HCN B;  2EKE C;  2DAF A;  3NZU A;  3RNB C;  3IVF A;  1NI2 A;  3ZLZ A;  1KOT A;  5HG2 A;  3I5J C;  4I6P A;  1F2R C;  1EWY C;  3NHE B;  2WX0 A;  4DHJ B;  3PZ8 A;  4XX5 A;  2LGY A;  4MH0 E;  4N59 A;  1FRD A;  1T0S C;  2KX0 A;  4A20 A;  2WXJ A;  2BGF A;  3Q3N C;  1FXA A;  1LM8 B;  1N5X A;  2WYQ A;  5JXV A;  3GS2 A;  3NVZ A;  2KWC A;  2KQ7 A;  3TIX A;  3FAH A;  2E6X A;  3AEA B;  5FK9 C;  3PVL A;  3AUL A;  3HM3 A;  1KH0 A;  1MI0 A;  3B2F A;  4OW0 A;  4PS8 A;  4ZRP A;  3WA0 A;  1PGA A;  5EE1 A;  2N1W A;  4MGY E;  3ALB A;  5CTR C;  1U4A A;  1FPY A;  2NS5 A;  2JWZ A;  4W9L A;  3Q8E A;  2RDH A;  3C19 A;  3V05 A;  1YN4 A;  1HEZ E;  1DYQ A;  3NZ3 A;  2IO3 B;  1X1M A;  2E3T A;  1IGD A;  1OEY A;  1ET6 A;  1V97 A;  3OG5 A;  1NEK B;  3BZD B;  1RFA A;  3SEB A;  1YQ4 B;  3U2S C;  4W9J A;  1MVK A;  1GC6 A;  1J8C A;  4ANV A;  2AEH A;  4ANU A;  3L10 B;  2RSU A;  4K7W A;  1ISN A;  2NTS A;  2JZP A;  3OJ4 B;  1IP9 A;  1J7A A;  4GXB A;  3W9C B;  2N9E B;  1V5O A;  4KKI A;  5TSS A;  1FO4 A;  3NZS A;  1F0Z A;  1ZXH A;  4C7Z A;  4ANX A;  2WU5 B;  1HE8 A;  4S17 A;  3A1Q A;  2K6D B;  4NPN A;  5IO9 A;  4FLH A;  3MJW A;  1LQB A;  4C7Y A;  2GRI A;  2K39 A;  1T5X D;  2AQ1 B;  3WAL A;  4RGM A;  4B0E A;  3N3K B;  2KO3 A;  4J3O D;  2BYE A;  1SE2 A;  3VTV A;  3KUD B;  3GE3 C;  4KGS A;  2JZZ A;  3ZXV A;  3APC A;  2LHD A;  3BK1 A;  1L6V A;  4LJP B;  2KTF A;  3PV1 A;  3DVN V;  3Q69 A;  2J4X A;  4YXD B;  4KV2 A;  4B0M A;  3WAO A;  1WGY A;  4UDU C;  2D3A A;  2WP9 B;  1QLB B;  3AE9 B;  5HI1 A;  3GZN I;  1Z5S B;  3KH0 A;  3V6E B;  3UF8 A;  3ML8 A;  4EZJ A;  3V61 A;  2IGH A;  1WMH B;  3QJZ A;  4RGN A;  4OVZ A;  5DPW A;  1FXI A;  3B2G A;  2AQ3 B;  4ICU A;  2ZPN A;  2JSV X;  4MGK E;  4P1B C;  3IT4 B;  2IJ0 A;  1D4B A;  2W3S A;  2GB1 A;  2LD9 A;  2REX A;  5AUK A;  1WXQ A;  4WAA A;  3SDL C;  1QOF A;  1IYF A;  2WXN A;  3B0A A;  4K3B A;  3W1S A;  4EEW A;  2OJR A;  4M8N A;  2J42 A;  1TS3 A;  4KVG B;  3TCA A;  3U7Z A;  1YQB A;  1WYW B;  3DDC B;  3UIN B;  3Q8B A;  3H7S A;  2D11 A;  1T3Q A;  4TV3 A;  4G0N B;  4YWG G;  4JIO U;  3AE1 B;  3P4P B;  1ZP0 B;  2LGD A;  4N9F 4;  2W55 A;  2MBE A;  2WDQ B;  1SB3 C;  5IAA C;  4D2K A;  3EUB 2;  3A4R A;  1IBX B;  4B9K A;  3Q8C A;  3VQI A;  3RN9 C;  2CJN A;  3DVG X;  4M0W B;  2UU7 A;  3Q6B A;  2KMM A;  4ZYS A;  4IKG A;  4BKS A;  1V9J A;  2W54 A;  4CO7 A;  3PPA A;  3QWZ B;  4W9H A;  1L5P A;  1F77 A;  1JWB D;  4LTU A;  1XXG A;  1V81 A;  3AEC B;  1SJH D;  1XO3 A;  3RCZ A;  1WXA A;  4FBJ B;  4F8C B;  1WFY A;  2FUG 1;  2GBR A;  1WRD B;  2MA9 B;  5AZG A;  5BMH A;  1Q1O A;  4B95 A;  4C00 A;  3ZGZ A;  2WXK A;  4LK0 M;  3ZTD A;  2OED A;  3ONS A;  1ZXI A;  3PTF C;  4W9F A;  1WI0 A;  1PFD A;  3U7D A;  4US8 A;  4RF0 A;  2LHE A;  3TMP B;  3PRM B;  2D2Q A;  4JLC A;  3V3X A;  1C4P A;  3W5U B;  4NY0 A;  2HTM E;  4GU2 A;  5FKA C;  2DBY A;  3BYY B;  3ZRC A;  1L4D B;  4NQK E;  2MW5 A;  2PVO D;  5GXG B;  1IGC A;  2QC8 A;  2BYF A;  1J7B A;  2J0J A;  1PDX A;  2K22 A;  2KZR A;  3R7Q A;  5BYQ A;  4NAW B;  3ZNG C;  3H1U A;  3ZIM A;  5MPO A;  3TEX A;  2KN5 A;  2N9L A;  1OGW A;  2WDT B;  3HVD A;  3VAW A;  3RNA C;  2MHJ A;  4MGI E;  1EU4 A;  1E5W A;  2KAN A;  5JHB A;  1IPG A;  1SJE D;  3PSE B;  4ZRJ A;  4OZC A;  2AL6 A;  1YN3 A;  2KMA A;  2KFK A;  3LJ3 A;  2NPT A;  4DQO C;  1EWC A;  1EM7 A;  4RCO A;  3DVG Y;  3WAM A;  1WM3 A;  1WJ6 A;  2JRI B;  4LJO B;  2ZVO A;  2O6V B;  5CHF A;  1JWU D;  3ZJU A;  3ZDM C;  2IO2 B;  4KSL C;  1K53 A;  4W9I A;  4HPP A;  2N7E A;  1Y8R C;  2JZ3 B;  4OVU A;  4E3C A;  1V5T A;  3AE2 B;  3L17 A;  2M1M A;  4LNI A;  3KWV A;  2BWE S;  1SGH A;  2DZI A;  1VZ8 A;  1M94 A;  4FJY A;  1XLN A;  5EE0 A;  4E71 A;  5HFY A;  3IT6 B;  5IN7 A;  4RNA A;  1E90 A;  1QZE A;  2R2O A;  2KNB A;  2WQY B;  1NDD A;  5LXI B;  4WH4 A;  2MLB A;  1UD7 A;  1XF5 L;  3SHQ A;  3O13 A;  3BVM A;  4KDI C;  4OZB A;  5DPS A;  2L32 A;  5HHD G;  4NJ7 A;  3PZD A;  4BVU C;  4WIP A;  2L83 A;  2CR5 A;  4MJS B;  1KLV A;  4P1C C;  3OJ3 A;  3DBL B;  4ZHO A;  3ZUN A;  2VH2 A;  2DEN B;  5CX3 A;  2O2V A;  3LB8 C;  3NY5 A;  3IAM 1;  4IWP A;  1ZUD 2;  1ZKH A;  3HUI A;  1J19 A;  1TTN A;  2DWQ A;  1E7V A;  2LFI A;  2I1J A;  2LUE A;  4DHJ D;  1OFF A;  4TSS A;  1WMH A;  1HQR D;  4HRS A;  1XQQ A;  4WWP A;  2GOW A;  2LEK A;  2G4D B;  1P0R A;  2KQ4 X;  3RNE C;  4A90 A;  2IZV B;  1KJT A;  2RDB C;  1SE4 A;  2W3R A;  2VRR B;  2WXI A;  2G3Q B;  5D3I B;  2KJ6 A;  1I4G A;  4MSQ B;  2CHZ A;  2J0M A;  4M01 A;  3EC8 A;  1UWX A;  1L0V B;  3R7R A;  1ZDX A;  1CQV A;  4NJ6 A;  1E10 A;  1L0Y B;  1SIJ A;  2FCS A;  2GLS A;  1YOV B;  4KKJ A;  4RF1 A;  2BVC A;  2BQQ A;  1C76 A;  4WJP A;  2V4L A;  3QHT A;  2KAJ A;  1WM2 A;  4AWJ A;  1AN8 A;  1H8C A;  2X8X X;  1SF0 A;  3TSS A;  4NAM A;  3VTW A;  2KVZ A;  1I4X A;  3BVG A;  2WXF A;  1AWD A;  4JL9 A;  1Q10 A;  5E6P A;  3H7P A;  1IUE A;  2MSE D;  4HWI B;  1RWS A;  3VHT C;  3B08 A;  4NJC A;  1A70 A;  1LXD A;  3W1Y A;  5CHW A;  4WJQ A;  2B3A A;  1ACC A; 
#chains in the Genus database with same CATH homology
 1RLF A;  2RSU A;  3K9P B;  3EEC A;  4II3 B;  4K7W A;  4KIK A;  4DDI D;  2DYO A;  3SD5 A;  1ISN A;  4WJN A;  2EMT A;  5C23 A;  2MCN B;  2V3S A;  4IUM B;  3DBS A;  3OLM D;  4DDG D;  1L7Y A;  2MBQ A;  3OJ4 B;  1IP9 A;  4GXB A;  1V2Y A;  2N9E B;  2XBB C;  1V5O A;  2ZCB A;  4BKS D;  3UQA A;  3NZS A;  4DHZ B;  4M8M A;  1WX9 A;  1NBF C;  2KD0 A;  4ANX A;  3DBL I;  2LI5 A;  1GNU A;  2LXA A;  1HE8 A;  3A1Q A;  4DXA B;  2K6D B;  3QA8 A;  3MTN B;  4TUU A;  4F1S A;  4NPN A;  1GUA B;  4FLH A;  3MJW A;  4IM3 A;  2MP2 A;  3RZW C;  2L8J A;  2ZNV C;  4IC7 B;  5KHQ A;  2LVO A;  3ZO5 B;  4ASW C;  4AJW A;  4MM3 A;  3AXC A;  1LQB A;  2FCQ A;  2K39 A;  2LAS A;  2CS4 A;  3HHM A;  2ZZP B;  3UIO B;  1UGM A;  3WAL A;  4GIV A;  2LXC A;  2ZJD A;  5D7G A;  2Z0D B;  3N3K B;  2W9N A;  3L16 A;  2C9W B;  2LJ5 A;  2KO3 A;  1XT9 B;  3ZNH B;  5J18 A;  2DX5 B;  2BYE A;  2UYZ B;  4FUL A;  3VTV A;  3KUD B;  4GGQ A;  2KJR A;  2JF5 A;  2LVP A;  4KDL B;  2JZZ A;  2RR9 A;  2AYO B;  3DOW A;  2FCN A;  1WX8 A;  2CHX A;  4E74 A;  2G4S A;  3APC A;  2KQS A;  4FJV B;  1C1Y B;  4DBG A;  3L08 A;  1ZW7 A;  2D10 A;  3Q3J A;  4LJP B;  4ICV A;  2KTF A;  1UBQ A;  3PV1 A;  1P1A A;  4HVB A;  4NAW A;  3BY4 B;  3DVN V;  3CSF A;  5JH5 C;  2MBH A;  4KV2 A;  2C7H A;  3KW5 B;  3WAO A;  1WGY A;  3Q3F A;  2WX1 A;  4I6N B;  2CU1 A;  3QIJ A;  2DYM A;  3GZN I;  2KVR A;  3M95 A;  4ZDV A;  3VH4 B;  1Z5S B;  3KH0 A;  3V6E B;  3UF8 A;  3ML8 A;  3L13 A;  1FXT B;  4EZJ A;  2ZEQ A;  2JUO A;  2PPH A;  4MEL A;  3V61 A;  1EF1 A;  2HTH A;  4HJK A;  1WMH B;  1YJ1 A;  3QJZ A;  4HXD A;  1WGR A;  4LDT B;  4PYU A;  4ICU A;  5DPW A;  2KWU B;  2N1V A;  2AL3 A;  2ZPN A;  3BIN A;  2KDE B;  5LLI A;  3ECI A;  2C7M B;  3CMM B;  1YX5 B;  2IY0 B;  2K25 A;  2O6V A;  1TGZ B;  3NS8 A;  1GJZ A;  1RAX A;  2ASQ A;  3JSV B;  3K9O B;  4MGK E;  3N30 A;  5L95 C;  2N9X A;  1VCB A;  2XEW A;  3DBH I;  4TKN A;  4P7I A;  2LD9 A;  4KSK C;  4A3O A;  2N4F A;  2REX A;  3ENE A;  2KK8 A;  2A5U A;  4NQL B;  4WAA A;  3SDL C;  1IYF A;  3A9J A;  3JYU A;  3B0A A;  3MHS D;  3VUW A;  3WIM A;  4WJO A;  3W1S A;  4ANW A;  3PHW B;  4EEW A;  2OJR A;  4M8N A;  1SE9 A;  1Q5W B;  1Q0W B;  1E8X A;  4KVG B;  1V80 A;  2KFK B;  2LWP A;  3TCA A;  2NPT B;  3PHX B;  1YQB A;  4EOY A;  1WYW B;  3DDC B;  2L00 B;  3L0W B;  4X57 B;  3UIN B;  4GN1 A;  5LXH A;  3PS6 A;  4KZC A;  3H7S A;  2BKR B;  2D11 A;  3GOE A;  3P2B A;  4TV3 A;  3TBL D;  3S2A A;  2KTR A;  4K7S A;  2JRH A;  3D32 A;  1WGD A;  4G0N B;  2BKF A;  4EFO A;  4JIO U;  2JY6 A;  2LGD A;  4N9F 4;  2MQJ A;  2L0T A;  1T0Y A;  4YL8 A;  2D07 B;  2KOX A;  1BT0 A;  2MBE A;  4ZRI A;  1LFD A;  1R4M I;  2BWF A;  2LVQ A;  2C60 A;  3A33 B;  3PGE A;  2J7Q B;  2I1K A;  5IAA C;  1WF9 A;  1C3T A;  1WXV A;  3RZF A;  3VUY A;  2NBW B;  2GBK A;  3PLU A;  3A4R A;  4EZL A;  3CF6 E;  4B9K A;  2LRU A;  2WWZ A;  3VQI A;  3APD A;  3ZRF A;  2M8S A;  4FAD A;  4LCD E;  1D3Z A;  3DVG X;  4M0W B;  2ZNV B;  2YVC A;  4WQO B;  4BKS A;  1YD8 U;  1WE6 A;  1V9J A;  5E6N A;  3NOB A;  2L7R A;  4CO7 A;  3PPA A;  2GMI C;  3PRZ A;  3QWZ B;  4MJS A;  4W9H A;  2NVU I;  5AZH A;  3W1S C;  4A3P A;  4RM8 A;  2K8B A;  3RYT A;  5J2R A;  4BFR A;  4GDK A;  2G45 B;  2K1F A;  2KC1 A;  1V81 A;  3QAR A;  3U8Z A;  1XD3 B;  1CMX B;  4KZ0 A;  3RCZ A;  4W9D A;  2CHW A;  4J6I A;  1WXA A;  2L3Z A;  2MBO A;  4FBJ B;  1P3Q U;  1WJ4 A;  4HPM B;  4BKG A;  1WFY A;  4RM9 A;  3RUL A;  2GBR A;  4GSW A;  2PEA A;  4F8C B;  1WRD B;  2MA9 B;  3HK0 A;  4K81 A;  5AZG A;  2Z59 B;  2DZM A;  5AZF A;  3VUX A;  2FUH B;  1WXS A;  1Q1O A;  2K8C A;  2KDB A;  1R4N I;  4IG7 B;  4AP4 C;  4B95 A;  1G6J A;  2BPS A;  4IW0 A;  3ZTD A;  3KYC D;  3QQ8 B;  4HCP B;  5E6O A;  3RUI B;  3V60 A;  2QHO A;  4ZYN A;  1UZX B;  3IFW B;  2NBV B;  3ONS A;  2JXX A;  3UQB A;  3A1Q B;  1WZ0 A;  3WAP A;  4TQ0 A;  2XK5 B;  3ZVV A;  2M4N A;  3PTF C;  4W9F A;  1WI0 A;  2K8H A;  4GDL B;  2MP2 B;  3U7D A;  1I35 A;  5DPR A;  4W9K A;  1WIA A;  1UEL A;  3VFK A;  3ZNZ B;  2C7N B;  3TMP B;  3PRM B;  2O2V B;  2D2Q A;  4JLC A;  2KDF B;  5IA7 A;  4NY0 A;  1WH3 A;  2KXJ A;  4FJZ A;  4NNJ B;  5D6J B;  3X23 A;  3IBE A;  4GU2 A;  3VH3 B;  4DK5 A;  5AEK B;  3KYD D;  2R2Q A;  1UBI A;  2DZK A;  3ZRC A;  3B1L X;  1WJN A;  4G3X B;  4NQK E;  2MW5 A;  3APF A;  1WGH A;  1YX6 B;  3I3T B;  4LDT D;  4GB9 A;  2JVC A;  4JQW C;  2BYF A;  2D3G A;  2J0J A;  1V6E A;  1OEY J;  2KKC A;  3DPD A;  2L0F A;  2KLC A;  3QK0 A;  3EHV A;  2KZR A;  3JW0 X;  3R7Q A;  2MBB B;  4NAW B;  2HE7 A;  3JSV A;  3R66 C;  3ZNG C;  3H1U A;  3AU4 A;  3ZIM A;  4W9C A;  1TZ1 A;  2KN5 A;  5CHV C;  1RRB A;  1TBE A;  2KWV B;  1OGW A;  2WDT B;  3L54 A;  4HDO A;  3CST A;  2NR2 A;  3VAW A;  1V86 A;  4RMA A;  4IWQ A;  2FCM A;  4MGI E;  4W9G A;  3TL5 A;  1E5W A;  3QX1 A;  1WGG A;  2KAN A;  2FAZ A;  5JHB A;  1IPG A;  4GMV A;  1P9D U;  2DYB A;  3PSE B;  4I6L B;  4ZRJ A;  3QC8 B;  5D94 A;  3A4S C;  2AL6 A;  3A9K B;  1WZ3 A;  3OAW A;  3H6N A;  2RPQ A;  3DVN U;  2A4Z A;  2KMA A;  2KFK A;  3LJ3 A;  1E8Y A;  2NPT A;  4MEM A;  1AAR A;  3PT2 B;  4IM2 A;  1Z2M A;  2N7D A;  3DVG Y;  3WAM A;  1WM3 A;  1WJ6 A;  2KDI A;  2KC2 A;  2PE6 B;  2JRI B;  4LJO B;  2ZVO A;  2BF8 B;  2O6V B;  3AI5 A;  2DHZ A;  2YLM A;  4IM0 A;  4XC2 A;  5CHF A;  3ZDM C;  2IO2 B;  4KSL C;  3AU5 A;  3PRE A;  1E8Z A;  1EUV B;  3QCA A;  4BKT A;  3PRP B;  4HPL B;  4W9I A;  1GC7 A;  2N7E A;  1Y8R C;  4MGZ E;  1ZGU B;  2JZ3 B;  4OVU A;  4E3C A;  3M3J A;  2JT4 B;  3PLV A;  4OVV A;  1V5T A;  2PJH A;  3IG3 A;  5D2M B;  2NBU A;  2M1M A;  3L17 A;  1UH6 A;  2PE9 A;  2KJH B;  1OTR B;  4B6W A;  2K6Q A;  1V49 A;  2DZJ A;  2EMS A;  2KFJ A;  2BWE S;  2C5L C;  5BO4 B;  3HIZ A;  3DBR I;  1WR1 A;  1WR6 E;  1SGH A;  2DZI A;  3DQV A;  3N32 A;  1M94 A;  4FJY A;  2IY1 B;  4G50 A;  2DAJ A;  4FHK A;  4HDQ A;  3H7P B;  2NCN A;  5KHO A;  4E71 A;  4IWO A;  3KUC B;  3RD2 A;  4WWN A;  4W9E A;  4AJY B;  4PYZ A;  1E90 A;  2ZVN A;  1QZE A;  2FNJ B;  2R2O A;  3JVZ X;  1GG3 A;  1E7U A;  2KNB A;  2MX2 A;  3RT3 B;  1NDD A;  2RGF A;  5LXI B;  3ZW3 A;  2MLB A;  1UD7 A;  4TQ1 A;  2LRW A;  3H9D A;  4PS7 A;  4KIK B;  2L76 A;  4EKU A;  2IO0 B;  4GOC A;  3SHQ A;  1VD2 A;  1P98 A;  3ZDT A;  4KDI C;  2LZ6 A;  4MDK E;  5DPS A;  3UIP B;  1L2N A;  3VTU A;  4FHJ A;  2Z0E B;  1MG8 A;  3ZNI D;  5J17 A;  4NJ7 A;  1SIF A;  3PZD A;  4BVU C;  2XK5 A;  4EUT A;  1E8W A;  2CR5 A;  4MJS B;  4PS3 A;  1KLV A;  3QAQ A;  5FR6 A;  4FN2 A;  4GDK B;  3OJ3 A;  4WWO A;  5JZE B;  4GDL A;  3ZUN A;  1EO6 A;  1WX7 A;  2DEN B;  2HD5 B;  2JPH A;  5CX3 A;  2O2V A;  3EFU A;  3T9L A;  5L83 A;  2MRP A;  4ZRK A;  3VXW A;  4K7U A;  1JRU A;  3NY5 A;  1OQY A;  2RD0 A;  4HCN B;  4K1R B;  4IWP A;  1F9J A;  2EKE C;  4BBN F;  1S1Q B;  2CKH B;  1ZKH A;  2DAF A;  3NZU A;  4HLE A;  3IVF A;  2ZCC A;  3ML9 A;  1J19 A;  1NI2 A;  3C0R B;  3ZLZ A;  1KOT A;  2MWS B;  1TTN A;  3U30 A;  1K8R B;  5JHA A;  1E7V A;  4I6P A;  2I1J A;  2LUE A;  2V1Y A;  2ZPY A;  3O65 B;  4DHJ D;  4BOZ B;  2BYV E;  3NHE B;  1WMH A;  2WX0 A;  1S3S G;  1XQQ A;  3M63 B;  4MSM B;  2GOW A;  4WWP A;  4XZ4 A;  4BOS C;  4DHJ B;  3IHP C;  3KUZ A;  4DWF A;  1I42 A;  4XX5 A;  2LGY A;  2KLG A;  3HM6 X;  3LDZ E;  4MH0 E;  2GBJ A;  1WE7 A;  2G4D B;  3V62 A;  3R3M A;  2J0K A;  1EF5 A;  2KX0 A;  2OOB B;  4A20 A;  1P0R A;  5G55 A;  3ZTC A;  2AWT A;  2BGF A;  3VDZ A;  1A5R A;  2IZV B;  1KJT A;  4CHK A;  5DCN A;  2KHW B;  5C1Z A;  1LM8 B;  2WYQ A;  5G2N A;  3A9K A;  2VRR B;  3SU8 X;  2G3Q B;  2KWC A;  2KQ7 A;  2FID A;  2N9P C;  2KJ6 A;  2KMC A;  4BBN C;  4MSQ B;  3TIX A;  1WXM A;  1WY8 A;  2L05 A;  2KX3 A;  2M0X A;  2CHZ A;  5EDS A;  1H4R A;  3PVL A;  2J0M A;  3AUL A;  3HM3 A;  5DPT A;  3EC8 A;  3R7R A;  2O6V D;  1J0G A;  4HK2 A;  5TR5 A;  4PS8 A;  4NJ6 A;  3ZKJ C;  2IYD B;  3WA0 A;  3KVF B;  3DCG A;  2FCS A;  1KM7 A;  4JGH B;  4URK A;  5GMV A;  3UGB B;  3V6C B;  2N1W A;  4MGY E;  4F7Z A;  3ALB A;  5CTR C;  4AUQ C;  2IBI B;  2GBM A;  2Y5B B;  1U4A A;  4FA6 A;  2NS5 A;  3WAN A;  4AOF A;  1PQS A;  2JWZ A;  4W9L A;  1YIW A;  3TJP A;  4WJP A;  4II2 B;  2V4L A;  3QHT A;  1WJU A;  1WM2 A;  4AWJ A;  2GBN A;  1H8C A;  3M62 B;  3A9J B;  2IO3 B;  3VTW A;  2M17 A;  3VVW B;  4G11 A;  1X1M A;  4CYE A;  1OEY A;  3T8M A;  2IO1 B;  4JL9 A;  3X0W A;  3L10 B;  4EZK A;  5E6P A;  3H7P A;  1RFA A;  2HJ8 A;  2MSE D;  2UWQ A;  4HWI B;  2KTR B;  2FIF A;  4W9J A;  3VHT C;  3B08 A;  1GC6 A;  1LXD A;  4DHZ E;  5HKH A;  1J8C A;  2LGX A;  3W1Y A;  5CHW A;  4ANV A;  4WJQ A;  2AEH A;  4ANU A;  2B3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...