4E7HA

Pfv intasome prior to 3'-processing, apo form (ui-apo)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7hA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7hA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7hA03
2X74A 3PY8A 4HUEA 4CGIA 3WNHA 4ELUA 4E1MA 1XWLA 1YTAA 3L8BA 3CFRA 3PMTA 4FJHA 4DQSA 3LGLA 3OYCA 3LX7A 3Q1JA 4FU6A 1B9FA 2P0KA 3LAMA 4H8KA 3TAMA 5T7BA 3EYZA 1EETA 1L5UA 2LVMA 1HNVA 2Z1HA 4Z4HA 4FJLA 2L8DA 3BGRA 2P5GA 4CFDA 3H08A 4NCBA 4MFBA 3VQ6A 4EZ6A 4M3WA 3C95A 2JZ2A 3KK1A 2QXFA 4DFKA 2E4LA 3V4IA 1ZBLA 1NK6A 4DF4A 5HLFA 3KTQA 3VQ8A 4E89A 4E7HA 4Y1DA 3SPYA 4BD3A 2LSNA 3NH0A 3P5JA 4FW1A 5HROA 3C6TA 3FFIA 2ETJA 1RT3A 1VSIA 1EKEA 1Z25A 4AH9A 1KCFA 2R7YA 4FJ7A 1HPZA 1VRUA 3CG7A 4C8NA 3HXMA 4C5GA 3LLRA 2VWKA 3OS0A 1HRHA 3TAGA 3THVA 2O4IA 3AO1A 4C5HA 1ASWA 1S9EA 4XIUA 4CESA 3QNOA 4KAZA 1WJRA 4UC4A 2VG7A 2YV0X 1WN7A 1WJQA 2Z1IA 2GBZA 3AA4A 4M41A 3SI6A 2G8FA 3F9KA 3L2RA 1RTIA 1TKTA 4IKFA 4Z0UA 3TR8A 3HL8A 3SV4A 4FVMA 1S1UA 4IUPA 3K59A 4Q0BA 2G8VA 4FYDA 1JXBA 4CEAA 4CEEA 3AVBA 4OJRA 5D3GA 2HQXA 3AVHA 4LH5A 3K57A 2KZZA 1JLBA 3IAYA 4CHPA 4DSJA 2JTFA 4KB1A 3DLMA 1RT2A 4B8CA 4CERA 4CHZA 3M8SA 3ZSOA 1MU2A 5E41A 1TAUA 1OYXA 1WSJA 2RF2A 2BKDN 5KCOA 4CGFA 3VQAA 5C42A 2F96A 3SD4A 3KK2A 2W42A 1UAXA 2OA8A 1HYSA 1NOZA 2IAJA 4B9NA 2P5OA 2PYLA 4CCHA 1HYVA 4LD0A 3RR7A 1S5JA 3VQQA 2DIQA 3KLHA 4N41A 3DLEA 2QKKA 2NLUA 2BGGA 3NH1A 1D5AA 3CM5A 3WNFA 1J5OA 1LV5A 1ZBHA 1KTQA 4O5BA 3M8QA 1RDCA 4W5OA 1LW0A 1L3VA 3KKRA 4IG3A 4RG2A 3NBPA 4IUVA 5KGWA 5KH6A 2RJCA 5KE3A 3FC3A 4QQGA 4EP4A 4DU4A 3UWNA 3DMJA 3ZSYA 3L2WA 4CJ3A 4KHYA 1VSHA 4CEQA 1RT7A 3VQCA 1C1AA 4CJTA 1RDAA 4JS4A 1TK5A 3V9UA 2L3RA 1RT1A 3M8PA 5C0MA 1VSDA 2Z1JA 4OGCA 1TKDA 1ITGA 3EAEA 4KHQA 4Q5VA 4W5NA 3NCIA 1GOCA 1CZ9A 3AA2A 3ZT3A 4QOZB 5J1EA 3PX0A 3I0SA 5K14A 5CZ2A 3ZCMA 1Q9YA 3M8RA 1KLMA 3DB3A 3IS9A 3RRGA 4CJWA 3V1QA 3D0PA 4KV8A 4B9XA 4LH4A 1NJYA 1NOYA 3QESA 3KLIA 4A4EA 3S6WA 1BGXT 4M3XA 4A4FA 2RKIA 4W5RA 1KSPA 4ZTFA 4DSIA 4E7KA 1JLQA 3ZSQA 3RMBA 1XI1A 2KW4A 3ZSZA 1TK0A 3MEDA 3META 3NTIA 3OYHA 1JL2A 5CYMA 4HUFA 4Z4EA 3OYEA 2AJQA 5HRNA 1X9WA 1WJSA 4QQDA 4C5EA 1Z26A 3AO2A 4W5QA 4FJXA 1X1PA 4LY7A 2XY6A 3FDRA 1QQCA 2X6SA 3VN5A 5KRTA 1SKWA 1SV5A 1FKOA 3KLGA 3OYMA 3V9SA 1IG9A 3NTKA 2KTQA 3AVFA 4F3TA 2QK9A 1TAQA 3QIOA 3HSTB 3AVJA 4A4GA 4KFBA 4FLTA 2HMIA 2HHSA 4CRIA 2LDMA 1RTDA 2M16A 3SQ2A 4E7JA 1JL1A 2HHXA 2R58A 5J26A 1K6YA 4FM1A 2BUDA 4HUGA 4Z4IA 1SKSA 4RW4A 2VWJA 4CK1A 4DQQA 4FLUA 4FJMA 2PQWA 4NYFA 1NJWA 1CXUA 2YNGA 1WGSA 4FJ9A 2XK0A 4B08A 3ZSWA 3QEXA 2VYTA 3LANA 5DMRA 4DF8A 5J2PA 3ZSRA 4I7FA 2DTUA 2EQMA 3OYFA 3NTHA 3ME9A 2X35A 2VG5A 3K5LA 3K58A 1U47A 4FZYA 4DSEA 4FK0A 3RWUA 5J2MA 3PV8A 4CGDA 4R5PA 4DLGA 4N56A 4DMNA 5JS2A 3SUQA 2OYQA 1BL3A 1T8EA 2L89A 3MP1A 4KI6A 1U45A 1XNIA 5CZ1A 1TK8A 1FKPA 2I5JA 4C8OA 1RDDA 3VQ9A 3RMDA 4O44A 4AHUA 3MXIA 2ATQA 2Y1JA 2OPSA 3MEEA 4PUOA 2HNZA 5FDLA 1WAFA 4C8KA 2HHWA 3C4SA 4LSLA 3AVMA 4IG0A 1XHZA 2B8AA 2DIGA 1FK9A 3NF8A 3OJSA 3K5OA 3JSMA 4G1QA 4CEZA 4FLXA 1NKBA 1N5YA 4O0JA 4O0IA 2GV9A 3TANA 4FLYA 3QEPA 4PLIA 3VQBA 3KK3A 3SV3A 1KRPA 2HHVA 3K5NA 1C1CA 3DI6A 4E0DA 4KHWA 3S9HA 2X6NA 3HYFA 2ZQBA 3LP0A 2RI2A 3KIOA 4CEOA 4OKJA 1UA0A 4CGGA 3H8ZA 2QQRA 2RN2A 5M9OA 2GFAA 4B9WA 2DY4A 4NS5A 3G0ZA 2M1HA 3NF7A 2PYJA 1DTQA 3DRSA 3PX6A 4KTQA 3B6PA 3O8VA 1KFSA 4F2SA 4AHSA 3QJ6A 2RHXA 1C0MA 1S6QA 1TL1A 3I0RA 2OPPA 4IFYA 4NCGA 3SQ4A 4DQIA 4DFMA 1IKWA 1J53A 1Y97A 3L2UA 1JLAA 1ASVA 1C6VA 2OPRA 2GUIA 3LALA 3TI0A 2G8HA 1D8YA 4BDPA 2RJDA 3BDLA 4CJVA 2IG0A 4FJ5A 2G3RA 2RHZA 5HRRA 3ZSVA 1WSFA 4CHYA 5J2NA 3E01A 4KB0A 4BACA 4CF1A 2EQKA 2E6LA 1CZBA 4GW6A 2RHUA 1A5VA 4CHOA 4ID1A 3V81A 4FK4A 5IAYA 3DOKA 1VSMA 3HO1A 4BWJA 5C24A 4CECA 4FLZA 4O4GA 2IS3A 4AHCA 1S6PA 3QEVA 1TV6A 2YHAA 1GOAA 4IURA 4WE1A 4EDUA 3MEVA 1A5XA 3F73A 1NK7A 1RTJA 3O4QA 3ULDA 2R5MA 3OQ5A 4N4GA 3GOXA 3TAEA 3G10A 2Z1GA 3P8DA 3LWLA 1OZ3A 2E5QA 1KVBA 1SSFA 3L42A 1SL2A 4B9VA 4DU1A 3LGFA 4CK3A 3LP2A 3AVKA 1TKXA 3SUNA 3SJJA 3LWMA 3DLHA 4FJIA 4PY5A 3DLRA 1KFDA 1WLJA 4HCBA 2Q3SA 4M3ZA 3ZSXA 4ZTJA 3CEYA 4KTWA 4DTPA 2YKMA 4LD6A 3QIPA 2OPQA 5D6XA 3RMCA 4QW2A 4GY5A 3BDPA 4N4IA 5IN1A 1G15A 3O4NA 4NCAA 4QVZA 3CFPA 2O4XA 5KE2A 1WAJA 4DTNA 3T3FA 4H4MA 4RG8A 4CJEA 1T03A 4FZZA 3MEGA 4CEBA 3QIIA 1N27A 4CGJA 4A4HA 4W5TA 4RW7A 3KLEA 1BCMA 1JLGA 3MP6A 3AVLA 2RPIA 2P1JA 2RO0A 3VQDA 2GF7A 1QE1A 4YNQA 3OY9A 1OI1A 2XY5A 1NKEA 3E9FA 1L3SA 2F8TA 4DSKA 1TL3A 4BE2A 2O4XB 2XDPA 3ZEHA 4I9LA 2KFNA 4J2DA 1J54A 4OGEA 2ITGA 2XY7A 2HNYA 4KKOA 3ALYA 1VK0A 3LAKA 3NHGA 1XC9A 3NGZA 1RI0A 1S1VA 3FEOA 1VSEA 2IOCA 2X4YA 1RDBA 4CJPA 1SL1A 2YNIA 4KTZA 2D5RA 4F4KA 4CF2A 3OYGA 1LWFA 5J39A 3OYAA 4BE1A 3AVAA 2DAQA 3L2VA 3I8DA 3SCXA 5CY4A 2RHYA 1NJZA 4CF0A 1T7PA 5KI6A 2YRVA 1YTUA 3PX4A 2LCCA 3PNWC 1NKCA 3MEWA 3AVGA 1YT3A 3LYIA 4X34A 2VG6A 4FLWA 1RBUA 1RCHA 3O3FA 4BWMA 5CYQA 1QHTA 2GFUA 3TABA 2R57A 1U48A 1IKVA 3OMGA 3F70A 1HQUA 3OS2A 1RNHA 2ZD1A 3QO9A 4AILC 2BDPA 4CEDA 3SZ2A 1DLOA 4KPYA 4CGHA 3KUFA 1RBVA 3VQ7A 2KQ2A 3DYAA 4H4OA 3WNEA 4B8AB 5SWMA 4CJQA 4DU3A 4B9UA 1HNIA 1HMVA 2DFFA 3OYBA 1SL0A 1J9AA 3S3NA 1IKYA 3QNNA 1ZBFA 1JLFA 1IO2A 1BI4B 1S1XA 2NUBA 4GVMA 3HP6A 1I39A 3CQ8A 4Z4FA 2BANA 4CJRA 1JKHA 1EP4A 4AHTA 1BHLA 2WACA 3QBYA 1RTHA 1WSGA 4C8MA 3V6DA 3S3MA 2B4JA 1QTMA 4E7LA 3KLFA 1T05A 3OA6A 1U4BA 3VA3A 1CXQA 3P1GA 3E9GA 1TVRA 1RT4A 5KRSA 4DTJA 4CF9A 3MEUA 4FW2A 3CM6A 2XO7A 3VQEA 4FLVA 3U3YA 4L8RB 2RJFA 4DS4A 4DQRA 5DK5A 1UWBA 4QQ6A 3MEAA 4HVJA 4Z02A 4PQUA 1RT5A 1R0AA 2A1SA 4FJGA 1S9GA 2EQUA 3NGYA 3PMIA 1LWEA 4CJUA 4HHTA 1D9DA 4C8LA 4HCCA 1KVAA 2P51A 4L59A 4Z4GA 1VRTA 5I3UA 4RW6A 3QETA 1LW2A 3MXJA 5KTQA 3ZT2A 2HHUA 3CYMA 1TKZA 4F8RA 2B5JA 3C94A 4NZGA 3RTVA 2RHIA 3AO5A 3NF6A 1IKXA 4M3TA 1O1WA 1TGOA 4LSNA 2G8UA 4J2BA 5D6YA 2RI5A 4MQ3A 3OYDA 3PFSA 3HK2A 4OKEA 3S3OA 1Q9XA 1ZBUA 3HVRA 4FJNA 4N4HA 1JXEA 4HCZA 4B9MA 3LP3A 4CHNA 4M42A 1BISA 3KKSA 1LAVA 3HP9A 1BI4A 3AA5X 3IRXA 4GMJB 4FXDA 4F3OA 4NYNA 3LZIA 4PA1A 2QQSA 2KZMA 1A5WA 4FL6A 4RW9A 3DRPA 3SQ1A 3HT3A 3TAQA 2X78A 1SKRA 4N5SA 1BIUA 3V9ZA 4FK2A 1U04A 3AO3A 4M3RA 4OPKA 1S1WA 2RJEA 3T1AA 3EZ5A 2R5AA 4CE9A 5KGXA 3OS1A 3MO8A 2YNHA 4DTSA 2EHGA 3MECA 4FJKA 3TAPA 3V9WA 3H6ZA 2LRQA 3HPHA 3VQ5A 2IC3A 3DOLA 3LPUA 3NGIA 2D0CA 3KD1E 1ZYQA 3VQPA 4FM2A 4DTRA 4KO0A 4RW8A 4FJ8A 3U6FA 1NK4A 3NH2A 4BE0A 3V9XA 4CIFA 2HVHA 2HVIA 1L3UA 4DLEA 2K3YA 4Q5WA 1BCOA 1QS4A 2EKOA 2BE2A 2FC0A 2HNDA 4I2QA 1NK9A 4OLBA 1BQMA 1REVA 3T19A 1RBSA 3VQ4A 1W0HA 3TAFA 1ZBIA 4FCYA 5EU7A 4B9TA 1VSFA 3LZJA 4OVAA 4ELVA 1YVUA 3LPTA 4M3YA 1RBRA 1CLQA 1B9DA 1HQEA 2IGIA 3A2FA 4CEFA 1RBTA 3DLBA 2B6AA 4F2RA 3DB4A 4CHQA 4OLAA 3NNQA 2D0BA 2FBYA 2RI3A 4CJKA 3ITHA 4DSFA 2HB5A 3SQ0A 1QSYA 4O55A 3MAQA 4DTMA 4J2AA 3K5MA 4PWDA 3B6OA 1BIZA 3RMAA 1KVCA 2D0AA 2OZMA 4YFUA 3ASKA 4BDYA 2HHQA 5J2QA 1B92A 2K3XA 4QAGA 1VSKA 2DFEA 4DTUA 4EZ9A 5JS1A 5SZTA 3IG1A 5FROA 4DWIA 1UOCA 1Q8IA 3TWHA 3LP1A 4E19A 3QINA 4M3UA 1H3ZA 5CIUA 1C1BA 3OYKA 1XHXA 4CJLA 3OMCA 2JGUA 4JRQA 2G8WA 4KHUA 3NDKA 2PZSA 4EP5A 3ZT0A 2E6NA 1GOBA 3AVNA 3OYIA 3NFAA 1MHNA 2MWOA 2JLEA 4M45A 4AHRA 3SYZA 3MXMA 3PO5A 1SUQA 3RR8A 1L3TA 4IUUA 2X4WA 2O4GA 4I2PA 2QKBA 2YHBA 4FJJA 3L3UA 1VSLA 1NK8A 1LWCA 4Y1CA 4DFPA 5I42A 3PO4A 2WOMA 2G8IA 4I9QA 2KFZA 5HBMA 3NAEA 3UT1A 4IUQA 3RRHA 3HJFA 2HW3A 3VA0A 4JS5A 1X9MA 3TARA 3HPGA 3HVTA 1G5VA 4JRPA 2HQEA 3P83D 4E3SA 3OYJA 5KCHA 1JLCA 4DSLA 1OZ2A 2E6MA 4CFCA 4ID5A 4CF8A 4KREA 3OYLA 2X4XA 3MP8A 1F21A 4FM0A 3QEIA 1I3AA 5FRMA 2EQJA 3FLGA 4TSXA 3AVCA 2Y1IA 2HHTA 3NE6A 3QERA 4HTUA 2OZSA 4CIEA 3UIQA 1JLEA 4IFVA 3OB9A 4CIGA 4J2EA 4DTXA 3AVIA 1HYZA 1QSSA 1QSLA 3D45A 3ISNC 4OPJA 1VSJA 4IBNA 4DS5A 3SUOA 1KHCA 4B9LA 4C5IA 1WNSA 4DFJA 1NK5A 1WSIA 3U3GA 3P8HA 1BQNA 3L3VA 2FBVA 2XY8A 4DG1A 5C25A 4ZHRA 3DRRA 3NF9A 3OJUA 3HM9A 2BIVA 2FBTA 5C6SA 1C0TA 4OVLA 4QCLA 1ASUA 3L2QA 5FRNA 4IDKA 3O3GA 3JYTA 3HPOA 2M0OA 1RT6A 3ASMA 3OVNA 4JLHA 3O3HA 2MWPA 1LAWA 3ZT4A 1HJRA 3DM2A 4AHVA 4Z4CA 2DFHA 4OKKA 1N6QA 1KLNA 3LH0A 3ZT1A 1NJXA 2EFIA 4N47A 3LDSA 3DLGA 3SNNA 4DQPA 3DLKA 1IH7A 3AO4A 3WNGA 5HRPA 2WONA 3SPZA 4FZXC 4E7IA 3SUPA 2CKKA 5HRSA 1D9FA 1W9HA 4ICLA 4K8XA 4N76A 2EX3A 4CK2A 4KI4A 1NK0A 2YNFA 1EX4A 4IUTA 3V1RA 1WSEA 1DTTA 4CFBA 1C0UA 2ZE2A 3OYNA 4K8ZA 1RILA 3QKJA 1EXQA 4PLLA 2IDOA 4KRFA 2F8SA 4CJSA 2XHBA 4B3OA 3CFOA 2LTOA 4CJFA 2FHDA 3K2PA 2XRIA 4BDZA 4II1A 4PL6A 4CFAA 2A1RA 3AA3A 1UA1A 1WSHA 4CJ4A 3M9QA 4KHNA 3V1OA 4KHSA 5D6WA 4ELTA 3KJVA 2FBXA 4B9SA 2YKNA 1FXXA 4CJ5A 1X9SA 2F5KA 1S1TA 4E1NA 3KD5E 2D9TA 3PUFA 3QLHA 3EY1A 3QEWA 1U49A 4UQGA 3AV9A 5HP1A 2PY5A 2G8KA 3C6UA 4DTOA
chains in the Genus database with same CATH superfamily
1VQMT 3PY8A 4E9GA 4E1MA 4HTLA 3H45C 1X1BA 1OQKA 2LX9A 3QXEB 5K7FA 2L8DA 2WWYA 1QKXA 2DBMA 1YLFA 4MNUA 4WQ4A 5FLXK 2HBJA 3SPYA 2LSNA 1B72B 4JUVA 3CG7A 2XAFA 3CC2Q 2O4IA 2HYGD 2XIDA 4KHWA 3QNOA 3WEEB 4G9ZA 1HW2A 2XF6A 3F9KA 3EFRA 1BBZA 1N78A 3CC2T 3CDHA 1T39A 3OYYA 4HYEA 4DSJA 4EA5A 1WXUA 4CERA 5CKEA 1AWOA 5HDNA 3CPWP 5HK3A 2P5OA 1RUOA 4FWPA 1J59A 2LNBA 1O3SA 1FTZA 5KYYB 3CM5A 1YHQA 1KTQA 3QPSA 2ZMEC 1EF4A 5ILSA 2DQLA 3ZX2A 2VXFA 2RDPA 5TISC 3HEFA 1TKDA 1TZLA 2QBYB 1VQ6Q 4M7DB 4K11A 3PX0A 1QRYA 4N4NB 1T0FA 1M3CA 2ZAEA 2A42A 3META 2NOEA 4CCKA 4ENKA 4X6AJ 3FDRA 1RL2A 4FLTA 5D8LB 2HHSA 2YHYA 2JWTA 1VQ6I 4RW4A 2VOPA 2YNGA 1ZLKA 5JVGL 2NRRA 5CQEA 4DF8A 1ZXOA 1W7AA 2QCOA 4U87A 1WQ7A 5J2MA 3SUQA 1F36A 5LL6Z 1NGFA 5FLXE 2RNAA 4OIQF 4BUGA 4LSLA 2PNIA 2RQUA 1NGDA 3ERED 2NVXJ 4PLIA 2XHKA 3UF4A 4CEOA 4DR4K 4CGGA 2QQRA 5CVUA 3D7EO 3I0RA 1JJ2M 4JKCA 4LFUA 2ABLA 2RJDA 2ZPIB 2LP0A 1T3VA 5J2NA 3CQYA 3BJOA 2E6LA 5FKOA 2FXUA 4RTWA 2IS3A 2G6FX 1HKTA 1S29A 1T33A 4B22A 5J3BA 2IGNA 5CJ9A 4HVUA 5DM7L 1MWMA 2QUFA 3CCEN 1ILYA 3HTSB 2YKMA 2P84A 1ZUYA 1P4AA 1MUDA 4H4MA 1GLAG 4JKGA 5F1JA 3HOWJ 5AQJA 3KP5A 2EFNA 3AVLA 1QVGM 3TOBA 3KX2A 1KHIA 4L5GA 2V1NA 3ZEHA 4QPQA 3JRBA 1BM9A 2JG6A 3LDQA 1VSEA 4RM2A 4U67L 2EV6A 5J39A 4I6MA 1ETWA 2RHYA 2Z16A 1YCSB 2QGUA 4BS9A 2UWMA 3VEXA 1BR2A 2LCCA 4E47A 3LYIA 3HZ6A 1LJ9A 3TSWA 4BJ6C 2DETA 3OS2A 2IXSA 4RLFA 4LG3A 4E6KG 2D45A 3QB0A 4CEDA 4JN4A 2D5VA 4BEHB 1WNLA 4C0DB 3VEVA 1QVFS 1SD7A 4YELA 3R6NA 1HNIA 2BANA 2F8TA 3F72A 3OIQA 1YI2T 3VENA 1XGMA 4BB7A 2XAGA 4PJ0C 3MEUA 3JAMK 5IYDJ 1Y39A 3I55N 2ZFUA 5DLQE 4LNPA 1GLJO 1HSTA 2DDAA 4C8LA 3HKZN 1D9DA 2JUGA 1OH8A 2B5JA 2M4GA 1E7OA 1O1WA 1YIJA 2G8UA 5D6YA 1U2WA 5KN9A 3I33A 4CZGA 4X1EA 5AQFA 4BC3A 3DRPA 4MEXF 3TSQA 2FOWA 4HOBA 1JHHA 1M3HA 1DPRA 4L5IA 1GFDA 1P7MA 4AU7A 4LDVA 3W6VA 1QVFM 3T19A 4FCYA 9ATCB 4C92G 2WAFA 4RGSA 1FTTA 1YVUA 2DA2A 1QQMA 3A2FA 1VQNI 3A5MC 2MGQA 1L3LA 4GYGA 4X64K 3DJCA 3ITHA 5B8HA 2HHQA 1OV3A 2DFEA 1SSHA 5CLSA 1VQ8N 3UR3C 1UOCA 1HQCA 3VV0A 4KHUA 5LBQA 4EMKB 4YOXA 2GAUA 3TCJA 1VIFA 1VQMA 1VQ5Q 1LWVA 1SAUA 3L3UA 5GAN7 2LG4A 4IZZA 3THYA 3Q7BA 1XSVA 1VF9A 2GOXB 2RNGA 4Q48A 5GADJ 3O9TA 4KREA 4EW0A 1IN8A 2OTLI 3AVCA 4FVUA 1UGSB 3RKXA 1VQLN 4H0PA 1HYZA 3ISNC 3LQRA 4C5IA 1KC8R 1WSIA 3U3GA 2DNUA 3QU3A 2QSGX 2CP0A 3OJUA 5C6SA 3BP8A 3SB2A 3LH5A 5F0FA 4AHVA 1ZAOA 2XG8D 4M7DG 2E19A 4RTUA 1MJBA 2NRXA 4ICLA 4WFAL 4IX7A 2YNFA 2YUSA 3OYNA 3RKWA 1F5TA 4PJOE 5GMKm 3LDNA 3WXKA 2NS7A 5J40A 2PVDB 2UV1A 4KH1B 5IYBJ 4B9SA 1JKPC 4DR1K 1J6ZA 2DF6A 1YJ9Q 3V4GA 2GIZA 3J81O 2G8KA 3ZQLA 5HLHA 3JAMO 1ORNA 2HQRA 4YOVA 3CHWA 3H35A 1KYWA 4J9BA 4M77D 4OMMA 1LPLA 2QASA 4IVNA 3O8HA 3BGRA 1K78A 3WVDB 4XNFA 2C0OA 3P4IA 5DUIA 4ME7A 1RT3A 2HSEB 4BQOA 2E20A 3BJAA 2R7YA 4W1UA 2VGNA 1YNZA 4ESFA 2P6TA 5ADXH 2VJJA 2MYSA 3L2RA 3M4YA 3R2XC 3D5LA 4J6YA 1JXBA 5FD5A 2M8GX 4IPAA 1OYYA 3M8SA 4WFNL 1Z6TA 4IRHA 2YUQA 2ME6A 1HJDA 2LC2A 2IA1A 2XB0X 2H3JA 3BCBA 4HG2A 2QEXT 2RM4A 1LV5A 5AQLA 4XLCA 2HVQA 1NK2P 4QQGA 4LK1F 1OJLA 3UWNA 3DMJA 5FPNA 4CJ3A 1VSHA 3QFPA 5AN4A 1C1AA 1XMOK 1LVKA 2KT8A 3G6EA 3CJRB 3FM5A 2KDOA 2Z1JA 1ITGA 3EAEA 3DCFA 1ETOA 1Q81O 2OI3A 2K7LA 2K85A 2YT6A 3BT9A 2EQRA 1JEGA 1R1TA 3RBBB 3SBTA 4C1NK 4BROA 2FMLA 4AIKA 5KRTA 4PUSA 1YO5C 2X6SA 1GV2A 4H0TB 4U88A 1Y0UA 2DQRA 4CCJA 3E19A 2Y31A 2GM4A 2F4OB 4BGDA 3M54A 3PT9A 3FSPA 1BI3A 4CK1A 3V7RA 1VQOQ 4XM3A 2ZNYA 5E18F 4B08A 2DTUA 4M6XA 1IDYA 3LA7A 3K5LA 5JVGF 4AVPA 4F93B 4DSEA 5D5WB 4F04B 4BRFA 4JKBA 3KEOA 1I6XA 3DBRB 1IZ1A 4O44A 2HHWA 4C8KA 2DPDA 1VQLA 4CA0A 2CS7A 3GZ6A 1WHMA 4M9SA 2BY1A 3DKMA 1K83J 3OR2C 4AD9A 2D0NA 1KQ0A 4ABZA 4FX4A 4NCGA 1D8YA 1I8FA 4YRVA 1ZX6A 4FJ5A 5L8RE 1CZBA 3RNJA 2XIGA 1KQ2A 1ZH5A 3WT0A 2GIVA 4MGRA 1ZG3A 3WUHA 4DQ2A 2K5IA 2F4VK 1HKGA 2VKVA 3F8FA 3THKA 4UHTA 5CKTA 5FLVA 4KHPK 2RPIA 1NM7A 4K0KK 1TL3A 4BE2A 3M5RA 2O9LA 3IFRA 5J6XA 4FT2A 2FZCB 2X9HA 2PAVA 2D5RA 3K0SA 4BE1A 2DAQA 3VF6A 2NOIA 3I8DA 4FX0A 2YRVA 3C1DA 1OOTA 1N8RC 3AVGA 2BY2A 3SQNA 4DR2K 1RRJA 1NJIO 3K9TA 3FISA 3M56A 5A0DA 3HRUA 2HGCA 5J8FA 3VQ7A 2F5TX 5LRSA 1JLFA 3CFRA 3CC7T 4IDHA 2FBHA 1W7PA 1M1KO 4EMSA 5KRSA 5FGMA 3MHXA 4JI0K 1MD0A 3H0DA 4GO1A 4RGRA 4DS4A 3Q5FA 3NHNA 1T08B 2MAMA 1N39A 2VYPA 1KVAA 3CUOA 4F8RA 2LKPA 1KZHA 3FX3A 1U78A 5GAOq 5GAMj 4K42A 3KKSA 2RA2A 4J6WA 3IRXA 4C8QC 1ZRCA 2HBPA 2KBTA 1P7IA 5LJ5h 2R0QC 3BDDA 3WXMB 4YFNF 4M3RA 1S1WA 2FE3A 2V4JC 2GXGA 4HSRA 3HPHA 4OFHA 2P9SA 3OIPA 1ZYQA 2K7AA 5TKYA 1ZYRF 2HTJA 2HVIA 4JI4K 1BB9A 1ZBIA 2JN6A 3I3LA 3THXA 4P5NA 2ZJQL 2OZ6A 3DB4A 2D0BA 3DXMB 3C3WA 4EAHD 1PRLC 1C0GA 1MMGA 3O5ZA 2JGUA 2XI9A 3JCMg 4BG9A 4CZKA 1WPYA 2NVQJ 3AVNA 3NFAA 5M3FJ 4M3FA 1BC7C 2PJRB 1KSWA 4FJJA 3KFWX 4ESJA 2MSYA 2WUSA 4RAYA 1ZGAA 4NUBA 1PC0A 4E3SA 3OYJA 3JRAA 3JRGA 2V8IA 4M77B 2VBXA 2F5DA 3OYLA 5FRMA 1S1NA 4Z89A 5CPRB 2CW8A 3VRZA 4J9IA 1OPLA 4DS5A 2JSCA 4HPQA 2KKOA 2DL3A 3L3VA 2ETHA 2YRCA 2FBVA 1WB9A 3CQXA 2NOLA 4RS8A 4QCLA 5M1FA 3KYDB 3VPRA 3DPLC 2E60A 3ZT4A 2YSQA 2DBBA 2IS4A 2OJ2A 2STTA 1IH7A 2WONA 3SUPA 2CKKA 5HRSA 4A63B 3ELKA 1FP1D 2YUOA 1N8RR 2V1DA 4M9ZA 2LMJA 2PMHA 4NL3A 1S72N 4JZ3A 4PJJA 1WJ5A 2R7SA 3OBWA 4KHSA 3HBTA 2DMTA 3S2DJ 2F5KA 3GTLJ 3R6OA 4NO7A 2P8TA 5F04A 2MMPA 1H92A 2GTOA 3I56I 5J3LA 5C15A 3LAMA 3A5ZB 4EATA 3TAMA 1RAFB 2STWA 2JTVA 3H08A 4M7DC 5KYWB 2HEQA 3KTQA 3L6QA 2M2EA 4NC8A 4Y1DA 4M75E 3C6TA 1FYNA 2OV7A 1N32K 4S05A 5F6FA 1YHQQ 3OS0A 1U5TB 2EKHA 1OCRH 3ZLJA 3K1NA 2O8EA 2O01E 3HL8A 1M9SA 4M3EA 4CEEA 3AVBA 1PD1A 1XNRK 2X51A 4CHZA 3ZMZA 4ISEA 3IHUA 4AVZA 3F2KA 3TU4K 4XLEA 2IVMA 2PG4A 3TOAA 4ZYHA 2F4MB 1Q1VA 1RT7A 5GAHJ 2BE5F 1LCKA 4Q5VA 5EF6A 4GBQA 3QPLA 7AT1B 1QHAA 2HEOA 2COBA 3ZCMA 2JWKA 4KMUX 3D0PA 1SG5A 1UDLA 3MEDA 5CYMA 3CCRI 5EZHA 1Q86O 4XEIA 5D6EA 2FB7A 3HSTB 3SQ2A 2K3PA 1K6YA 3V8KA 1M1FA 1HDDC 5ILUA 4JI1K 1QA6A 2A7YA 3CMEQ 2P9NB 1FC3A 1U9NA 3IRRA 5BPIA 1S3JA 4XH5A 1Z6RA 3FRNA 5E1WA 3MP1A 2A3ZA 4PKCC 1DU6A 3TQ7P 3VQ9A 3PLAA 4NC7A 2ATQA 4PUOA 1H1VA 1QQIA 4BUPA 1RAAB 2CQKA 2HMAA 2KR3A 3LP0A 3FMQA 4AM3A 4J01A 2CH6A 3E66A 2IVOA 2M1HA 3LM2A 4B3TK 3PX6A 4PFPA 3ULEB 2OTJN 3LALA 2R5ZA 3ZSVA 1FNNA 4A0XA 1HK9A 3F9MA 4H0OA 3LAJA 4OB0B 5BPMA 4AHCA 5LGTA 4M6YA 4A2AA 4EDUA 1KONA 3A2KA 1TC3C 1NZ9A 2FEIA 3P8DA 3BY7A 1M1KU 3S41A 2NYXA 1B59A 3VW4A 4KBMB 1OPCA 4ZTJA 4BU2A 4NCAA 5CKBA 4M7AG 2D1KA 3DKWA 4G7OF 4RW7A 3OTOK 3M9AA 2DMOA 4ZYGA 4CJPA 1SL1A 2FQ3A 1DEJA 4JLIA 4YTLA 4HLXA 3U2RA 3E5XA 3COAC 3JTHA 2W48A 3UE5A 4E2FB 1T6CA 1KG7A 1SANA 1VQON 4KULA 2E5LK 4RB2C 3IL2A 3B6AA 1JO8A 3NWSA 4GVMA 4MZMA 2IVNA 1JI8A 4AHTA 2KRCA 1WSGA 1SEMA 5EOYA 1Z3XA 4AIHA 4DOZA 2SEMA 3VS6A 3EG0A 1X2NA 3EUKL 1Z21A 5HY6A 2LTPA 4C92B 5I3UA 2VOOA 4RTTA 4M3TA 4EJYA 4DV4K 2VODA 1IBKK 1IDZA 2VWBA 3ZEUB 3PFSA 2QW9A 4X65K 3ABTA 5GAMh 4XOTA 5CQXA 2I7NA 1E0EA 4BG8A 3L00A 3EE9A 4GMJB 4M7DD 1MDMB 2WY8Q 3I54A 3I5RA 2AIRB 2F5EA 5AQWA 2YNHA 5BN9A 3MECA 1B34B 3BPXA 2A05A 3V9WA 2FO0A 3VODA 1VQKA 4I09A 3QHSA 4CIFA 3TKYA 1JT0A 3BW1A 1BCOA 5DM6L 1UG0A 1VSFA 3ZETA 2DRMA 1AZEA 1EJ9A 5KPTA 1I5LA 4CHQA 3U1KA 1NK3P 5EXWA 4DSFA 3SQ0A 2M7BA 4V2GA 2MLGA 1Y0MA 1TU0B 4DTUA 4CC3A 3FZVA 5JS1A 1V5GA 2NS0A 1ACMB 2OC6A 5GAMg 1D1AA 3MXMA 2M45A 3F0ZA 3CMEN 2EPDA 1D5YA 1LWCA 4Y52J 2KFZA 2PBIA 1A31A 3FJ5A 4RUGA 1JLCA 3I0WA 4YFKF 2E6MA 1RZ4A 3G6EQ 1ATRA 1D4XA 2HBMA 3NE6A 3A1PA 3RUXA 3TEEA 3J7AF 3LWHA 1O3QA 2A6EF 4IBNA 2IW5A 5E17F 1WNSA 3KP3A 4BXUA 3NF9A 1FYMA 5FRNA 4B3SK 3LQQA 1HJRA 4ORZA 4M7AA 1UAAA 3CCLQ 3SNNA 2FG0A 3EZWA 1NGJA 1TP4A 3X24B 4LF7K 2YU3A 4GV9A 5CYVA 2V1QA 3G6EI 2NNNA 4JRKA 4XONA 2YX4A 1RILA 1XSXA 4OIPF 2L54A 3CF5F 3GTPJ 1GXQA 5LFAA 2RMOA 4YOWA 2AS5F 4PL6A 3URGA 2Q31A 2ZPBB 5D4SA 2YDLA 2FBXA 1PVEA 2OFKA 3PUFA 5A2QZ 1U49A 2CGHA 2J06A 4DTOA 1M3AA 5LJWA 4FE4A 1XQOA 4Y28E 4FJHA 1XMKA 4BQAA 2KT1A 1U6ZA 3OYCA 1UEBA 3TSPA 1EETA 1YITA 4XTZA 2HHXA 3IKVA 4XRSA 5IHKA 3V4IA 1K73U 3SAHA 3QPHA 3BY5A 4FOIA 2BUPA 4IHXA 1H641 2VWKA 3A8YA 2YXYA 1LFUP 1NPPA 3ERMA 4FYWB 5H20A 3VESA 2DZ9A 1YJWI 4LUEA 3EG9A 2G8VA 5DD4A 3OHRA 2CZ7B 3CTAA 2QTVA 3PQJA 2FLOA 4KB1A 4M78F 4GLMA 4C92C 2OPTA 1OYXA 2BKDN 3ABLH 3HUGB 4K2EA 1G99A 4RBOA 3VQAA 3KK2A 1IBLK 4JKAA 2VKNA 3VQQA 2R93J 4XKBA 5D8KB 2BXYA 4A69C 1YTYA 2C0TA 1VQ8I 3Q3SA 4JK9A 3TL4X 1T0HA 4UNOA 2R92J 1OVYA 1JJ8C 4XU3A 4A93J 1ETXA 4KHQA 3K2ZA 1A35A 2HSPA 3CCLT 1ZG5A 3FMSA 1QZ6A 3I0SA 1QZZA 2CSIA 3DXJF 3H5NA 1T0FC 2NOBA 2LRDA 3CMMA 5KYNA 4DB3A 1HKCA 4DSIA 2NUTB 1UGQB 3O1BA 2ZGZA 3HI0A 1TWBA 1VA7A 3BZKA 3HTUA 4M78A 3NTKA 5E8IA 4HNTA 4JJCA 4KFBA 5EGOA 5H6RA 4RB0A 4ZYAA 3BG5A 2XK0A 3QEXA 4B24A 3LANA 4HSTA 2R3SA 5C3EJ 5GAGJ 1WUAA 3THWB 3CETA 3L1PA 3CZ6A 3WQTA 4CGDA 4DLGA 1N3AA 2LY9A 3E3VA 4UB6C 1VOMA 2V79A 3FXLA 1WAFA 3LDOA 1P4WA 5DPKA 1ZN2A 2PN6A 2HMIA 4XLPF 4NQWA 2JUCA 1TK8A 2ZQBA 2V1XA 4ZN1A 4OKJA 3VF2A 3BZ6A 3EHQA 3O8VA 4F14A 2ZPFB 4DV5K 4RAGA 1ITYA 2DX1A 5EZGA 3KETA 4D8KA 1XUPO 3RZDJ 2Z1DA 3HO1A 3TTDA 2M5WA 3M59A 4P9FA 2P5LC 1JHFA 1Q7YR 4M7AF 2EBPA 3F73A 3T8RA 2H27A 1BOBA 4ZNXA 4DU1A 4CK3A 2WSFE 3DLRA 4DV6K 1DGRM 2Q3SA 4BKXA 3CEYA 3JRDA 2F69A 5D6XA 2COYA 1XDUA 4HKEA 1EH8A 4C8QE 2O4XA 1WAJA 1KU7A 5GAMe 3HGGA 3T1YK 2GF7A 1K0XA 3OY9A 4XLNF 4CZEA 2XASA 4C92D 3JB9F 5F1XA 2ITGA 2XY7A 4KKOA 4JPBW 1YIJT 1RI0A 2VCPA 1VQ8Q 5GIOA 3TPQA 2MW8A 1NJZA 3G0QA 4MTDA 3KZIC 1Q81C 1NKCA 1MUYA 2PQ8A 2FRWA 3OOPA 2VKEA 4MLEA 2A36A 3CCMA 1HQUA 3H46O 3ZMDA 4HNVA 3ZFJA 3OYBA 1D3BB 2DZCA 3EN9A 3CD6T 4LF9K 1BJZA 1BI4B 1S1XA 3CQ8A 4Z4FA 2A6HF 2WACA 2HBWA 4X9DA 1YE9A 1ZSZA 3LSMA 4JKHA 1W6XA 3G4SN 4AF1A 5L3DA 2P9PB 1VIEA 4FLVA 3U3YA 2CGJA 1M27C 3QG1A 5LJ3h 4DQRA 1RT5A 4I76A 5AT1B 4J6XA 3CDLA 3FKJA 4M7DA 3GBGA 2HVRA 1TKZA 1RAHB 2K9LA 1BI0A 3BG9A 4MMLA 4AUXA 2DMPA 4OP0A 1EWRA 2DOEA 2ISYA 4YOQA 3ZBDA 5GAN3 3BR1A 4YORA 4BVOA 2KZMA 4J83A 2O8XA 2YX7A 5AZJB 3SBGA 1MBGA 5ECAA 4B47A 1GLDG 3KD1E 3DPTA 4FJ8A 2OTJI 5BRHA 4PIIA 2QQ9A 3D1NI 4BBSJ 2DMNA 1HX1A 1YJ9A 3KCCA 1MJAA 4OVAA 4EPCA 1FOKA 1CLQA 2O8BA 2PVGB 2EYZA 3JSCA 3MAQA 3MN7A 3ZN0A 5SZTA 5DUKA 2DEUA 2Q97A 1VQ9A 4ZGJB 4AYBN 1LNWA 4I99C 3UKUB 3OYIA 2XHCA 1W2BP 2LYCA 4IO9F 1VSLA 3VGKA 3RRHA 1HKBA 2HF3A 3BUZB 2ZJRF 3I56A 3HPGA 2P9KA 3CWUA 1VQ7I 3MP8A 4U0VA 1MBFA 3BTLA 5DEQA 1WDXA 4CIEA 3K4LA 2E2QA 4RLQA 4OPJA 1A0NB 2XPUA 4H0YB 4LLNA 2CFOA 2VN2A 1QCOA 3BDUA 2DCEA 1ASUA 5GAGP 4AMCA 4B09A 1PD0A 2Y9ZA 3TTCA 2DFHA 1Z9ZA 2QG9B 3LH0A 5FU6C 4XBFA 1VQNA 5F08A 2XDVA 4B43A 4K8XA 4M78C 2QM1A 4CK2A 4XN3A 1VYTA 1T3SA 1LVAA 1ZSZB 1HUXA 3JV3A 2P9IB 3U21A 2LTOA 4CJFA 4D9JA 2LY1A 2IGMA 1N9RA 2A1RA 1QPIA 4CJ5A 1JUSA 2VV5A 1KD1C 1J2XA 1TL8A 5LMNK 3VJPA 4R1HA 4DV1K 3PMTA 4FU6A 1HNVA 2L7MP 4FISA 4DA4A 3KP2A 3JCMb 4DYRA 1XDSA 4CBXA 4DF4A 3Q0WA 2DJZA 2GQQA 2EWNA 3EGUA 5HROA 3W6JB 1VSIA 4CESA 2DYSH 3CC2A 1MIJA 2M7AA 4ZYDA 3OW2P 4CW7B 4ELZC 1KQSP 2B86A 2P5VA 3DLMA 5BN8A 3HFOA 4FYVB 2ED1A 4BRKA 2IIMA 3REOA 2O8BB 3GTMJ 1PRMC 3U4LA 1D5AA 1KYZA 1ZBHA 3SWNA 4YOUA 4O5BA 3GWZA 3M8QA 3RYPA 2RJCA 1O13A 4EJOA 5JLFA 1M90R 4LD5A 2LJ1A 3VQCA 1FJGK 3IQLA 5AFUH 2E64A 5M1KA 5J1EA 1VFCA 2E5KA 1FMWA 2XICA 4Z94A 4F7UA 3N0UA 4LH4A 2V75A 2PTKA 3KLIA 3S6WA 4BR5A 3GG4A 1IV8A 4E7KA 2LT4A 2KRNA 3OYHA 5GAOn 4WX9A 3SXYA 2XGXA 1X9WA 3TDZC 1YHQI 3G71N 1QP3A 2DK8A 4A0YA 1QQCA 2XY6A 1IG9A 2H8RA 5AQSA 1I07A 3C18A 2KTQA 4XH4A 2CUZA 3FXMA 1SKSA 4FJMA 1UTIA 2VYTA 4YIFA 2UUBK 2FBKA 1KG2A 2K2MA 1FEXA 1AWJA 2LNVA 4CI6A 4WFBL 1YJWA 2H1LA 3M0RA 2N8GA 3ZOBA 4A5AA 2NOGA 3A5OC 3O8MA 5KYXB 2LP5A 2ROLA 2YLCA 3WTVC 3WTUC 4RA2A 1C1CA 5GINA 3KIOA 3UKRB 5GIPA 1APLC 5M9OA 2GFAA 3A8MB 5LY3A 2L01A 2ZBKA 3QJ6A 1J53A 1C6VA 4B8XA 4BRDA 3B73A 5JFRA 1M1KR 2WTUA 4AQYK 1NYGA 4BHPA 2F4IA 2OF7A 5EY4A 1B9NA 4BRAA 1J9IA 4WE1A 4IURA 1RDUA 1A5XA 1NK7A 2R7WA 3TAEA 1RR7A 3G10A 5FLXO 2DJNA 1T95A 1JCGA 2L9SA 1YJNN 2XUBA 3TEDA 3J80Z 2LQKA 1CF7A 3BR2A 3A8HB 3HOTA 4JEPA 3G73A 2VVKA 2Q2EA 2VBYA 4RG8A 4C30A 4A4HA 3CCUQ 5GMKh 4AI5A 3F5TA 4G94A 4BYYA 4Y4RA 2KFNA 1EZZB 4GCVA 1VHXA 4MO7A 2HXIA 1Y0NA 3TU5A 1RDBA 5C10A 1WVRA 1BI2A 4AM7A 3OYGA 4RB1A 4OB1B 4BQQA 1W36C 3ABUA 2ASMA 3ZP5A 1KFZA 5DYMA 1LEBA 3HFNA 4QKUA 4AI4A 2VG6A 3IUOA 3CCSQ 4PGGA 4A3EJ 1QHTA 1W1WE 1OH6A 2WBMA 3DV8A 4M71A 1YWOA 4CGHA 3DXKB 2D1VA 1SL0A 3S3NA 1WOQA 3DEEA 4CZJA 2Q2RA 4G7ZF 1QTMA 2CP2A 3OA6A 1CXQA 4M78G 3CC2N 2K5CA 3S1NJ 3CWAA 5GMKj 2AQFA 1P92A 1Z0XA 1WEFA 1HXDA 2DJQA 1OVQA 2CQNA 3NGYA 1VQPT 2NUZA 3KEYA 4DIQA 4EV0A 1RFQA 9ANTA 1LKXA 3NQOA 1TW2A 2DPNA 3HVRA 5GAHP 4M42A 4FIBA 2O8DB 1PP8F 2K86A 4YFXF 3K70C 2EVRA 4LFAK 1PJRA 3JCMX 2BXZA 2LX7A 2DMQA 3AO3A 2DDBA 1AA7A 2Y69H 1A04A 4DTSA 4HSBA 1O4XA 2CJJA 4HA8A 2VQLA 3LWIA 1IBMK 5LHGA 3DBLB 3MCPA 5B1BH 3V8JA 1REVA 3J7ZI 2YHWA 1UFFA 1WI9A 4OLAA 2E2NA 1SVLA 1I0CA 1QSYA 1T44A 3CCVQ 1J5YA 4OIOF 2EIFA 4KT5C 5K5RA 1SKUB 3LDLA 5FROA 2YHTA 1H3ZA 3ER0A 5CIUA 4RDUA 2FNAA 2R7QA 4U7DA 2E1CA 4EP5A 2PZSA 2CQ7A 3CCUI 1TH7A 3LW5E 2K9QA 3EO3A 4I2PA 2LCSA 1XMXA 4WXHA 1KAXA 4GGGA 1UGVA 3HJFA 4OMOA 1UELB 5FKMA 2QXLA 1XC3A 1OR7C 3OW2A 1UJYA 1MDMA 2CZ0B 3K1MA 1DQUA 3R3LA 1D0ZA 3QEIA 1AOYA 3HZJA 3K4BA 3UIQA 4IFVA 1P8ZA 5IT3A 4DFJA 2DD5A 3DRRA 3WTYC 1C0TA 3ZX3A 3VYSB 2XPVA 1WI3A 3D4VA 3TW7A 4CDGA 3CCYA 2EFIA 3THWA 1ABOA 1NG7A 1AHJB 1ZGWA 2VGMA 5H2FC 2WC9A 4PSWA 1VQNT 3AGRA 3LA3A 4EHTA 1DTTA 4F9OA 1W2BS 1ZHFA 1EXQA 2IA0A 2JA6J 3P9IA 3OGDA 2VE8A 5D6WA 3KJVA 2JPSA 2JPCA 2Z0WA 2Y4YA 3AV9A 3BROA 1DP7P 3IHOA 2E6ZA 3WNHA 4EMGA 1WHGA 1CGPA 1QCNA 3LX7A 5EEGA 4YY3K 1JCEA 1LE8A 3CCJN 2GNCA 2P5GA 2MIOA 5JMVA 2DI3A 4XU2A 1NK6A 5E1ZB 3S1RJ 5GMKi 2E4LA 5HLFA 3NH0A 1ZARA 4BY1J 2ACJA 5AQHA 4FWSA 1VRUA 3F10A 3TAGA 1ASWA 2VG7A 3FK6A 2YU9J 3L7WA 1K9MO 1TWGJ 5H6QA 1R8OB 4IUPA 3QYHB 3BTIA 3MCAB 4CHPA 3FDYA 3QYEA 4KGXB 1TAUA 2F96A 2JK3A 4BR9A 1HYVA 2A5YB 3KLHA 2O8CA 3KTUA 4V19K 2C0IA 2D8HA 3VWBA 4W5OA 2RQPA 1K4TA 1LW0A 3D2FB 3GX4X 5KE3A 1BA5A 1GV5A 1YHQT 1E3OC 2K40A 4E9EA 4CC4B 1RDAA 5C0MA 1VSDA 2QEXN 4F7UB 3W6KB 2D0PA 5K14A 1Q9YA 3M8RA 3M7GA 4ESBA 1SPKA 4OF1A 1ZRFA 4XL9A 3GTOJ 4H03B 2CQQA 3HC7A 4Z4EA 2HR3A 3CMET 2Y90A 2PUKB 4II2A 3WGGA 1W5TA 3VU3C 1SV5A 2L2PA 1YG2A 3AVFA 4F3TA 4H4KC 4LMYA 4CRIA 3D6RA 1YFHA 5CK9A 4FQGA 4IO8A 4WXDA 5GMKe 3CCLI 2JS2A 4Y3OA 4B48A 1TBXA 2COMA 1NEBA 5DMRA 4BREA 2O8FA 4HDUA 2OFIA 4RGXA 1SQKA 4FK0A 2YJEA 3HSFA 4PL7A 1LFBA 3CCRT 5FLXZ 1FKPA 4NB4A 2E1HA 5L3EA 2K4JA 3O9SA 1OCTC 4HRIA 2OPSA 3BY6A 3CMAN 2LKXA 2DIGA 3K5OA 2CUJA 1YJNT 1XN7A 1VQLQ 1EA3A 4P5OA 3JCMP 3K5NA 4B1WB 4E0DA 2O9VA 3CCMI 3HPWA 3NAUA 2DL5A 1K4US 1T56A 1U1TA 2DY4A 3NF7A 2KXDA 2RAEA 1ASVA 2VL8A 5BR9A 2IG0A 1ON1A 3O6BB 1G6NA 4TVRA 1M4ZA 4MDWA 4CF1A 1RACB 4CHOA 2FZGB 3V81A 3V42A 4BR7A 3MDQA 2NAZA 4HQMA 3PIPA 3AG2H 5F2RA 1H9GA 5KPRA 3RPUA 3J80O 3ULDA 3CC4N 1KVBA 4B9VA 3LGFA 1TKXA 4FJIA 3RPQA 5KPZA 2DXTA 3I5UA 4KTWA 4QW2A 4DEXA 1Q81R 2RKHA 1YX5A 3CQTA 1T2KA 2OAUA 1CQTA 2DVJA 3L4QA 4WQ5A 3TO7A 4MQVA 4B3RK 4L18B 3KBGA 1IV6A 3ZL7C 2FRYA 3HGYA 3HSCA 1QMCA 5M5XJ 2K79A 2FZKB 2X3XD 1WEGA 3CCUT 2F2EA 3BG7A 3NGZA 2HDDA 5L3GA 2GTJA 2ASPA 2UYTA 2E1NA 3VRYA 5CY4A 4BY6B 2MA3A 5GTHC 2QLZA 1YW7A 2ECZA 1QVGS 4QLCU 3O3FA 2Q1NA 2NS8A 1OR7A 4C3HJ 3F70A 3S14J 4A3DJ 1DLOA 5M1PA 1WKMA 3MKLA 5DM7F 4F3QA 4DU3A 1QQOA 2V6CA 3CXCP 1T8IA 5EX5A 2HL3A 3SHWA 1I5ZA 4K43A 3FXKA 1W2BM 1I39A 2LQ8A 1EP4A 1JE8A 2YRDA 3RVCA 1U5TC 1TQMA 2R7XA 3X2QH 4CZZA 3J81Z 3CJAA 3N4QA 1UWBA 4H5RA 1HCRA 2F2WA 1JKRC 4EGYA 4DQ8A 4LIUA 2BW3A 3BFMA 4RGUA 3CCSA 1IGUA 3TO9A 4OMNA 1U3EM 4MQ3A 3WGIA 2DK5A 4GV3A 3ZGKA 3A0HC 2LZ6B 4N4HA 4B9MA 2K5LA 2LMDA 2ZMEB 4C3JJ 2NUPB 2JVGA 4BY9C 4CD1A 3ZR8X 3LZIA 5GANg 1VYVA 3SQ1A 2X78A 3LWFA 1BIUA 4C92F 1TYQA 3OS1A 1AWWA 2WV0A 2HKXA 1NHAA 4IHYA 2QTDA 4OPAA 3K4KA 2ITMA 4A3JJ 4OLBA 4C2TA 3M07A 3TAFA 2Y30A 1P6RA 2MH9A 3Q0VA 2KIFA 4RM3A 3IWZA 1KO9A 1U1SA 2FBYA 4A3FJ 2QQAA 4ZZLA 1PYVA 2MD5A 1YOVB 4M7AD 4CZIA 3QOPA 1MNMC 2K3XA 5L3CA 1WJEA 3PIOL 3KP7A 2IS2A 1C6VX 3TWHA 3BG3A 1BUPA 4IFEA 3NDKA 2QQ8A 3P8BB 4HF1A 2CV0A 1MHNA 2Z99A 4IUUA 2BOLA 3VYTB 2HZYA 1LCUA 4EEFG 1SAZA 2G8IA 4IXAA 2KHOA 4IUQA 3KVGA 4CXFA 5IOYA 1KG6A 3WGHA 2E7XA 3F0CA 4ZDLA 2KNBB 2X4XA 1F21A 3GNFB 2OZSA 1PSEA 4HTUA 3AFHA 3I4MJ 5DS9A 1FYKA 1IGNA 4HEA2 2JWLA 4XU1A 3PE0A 2E71A 1IXRC 3INZA 3TW6A 3ASMA 1LAWA 3R6MA 1ONVA 1OCOH 1JU5C 1NEGA 3LDSA 2KQRA 3WNGA 5ELZA 1D9FA 5FKLA 4I6ZA 4IOCL 2KJCA 1AVZC 4FOEA 2O8CB 3K4JA 4PJLA 1WSEA 3BR3A 2OTLQ 1NMNA 2Q0OA 3D5RC 1YS6A 3QKJA 1W7PD 2I5WA 3RPUD 5A0LA 1IB8A 3CESA 3GDQA 2FOKA 4ESRA 3KXTA 1OQYA 1X3ZB 4CJ4A 1HSQA 4BY6C 1S1TA 3CCEQ 3QLHA 4OX9K 5DD8A 3C6UA 2JA7J 4DGWB 3PQKA 4ELUA 1DDNA 2DRKA 4MO4A 3HTVA 5ADXA 4M77C 2P0KA 1K61A 3S15J 1P90A 3JCMh 1ZHIA 1EO1A 3MMYB 2FNPA 3TMOA 3KK1A 2NUTA 4HXJA 1BBYA 4E7HA 1YITT 2W6KA 3I4NJ 1EKEA 4F7UG 3CUQA 5DM6F 1NGIA 1Y71A 3THVA 1N34K 4C5HA 2A69F 4M41A 4AC0A 5B66C 5GAOr 2XDDA 3O8GA 2HHUA 1FSEA 1Z7UA 3GW2A 1MU2A 5E41A 4KMFA 2RF2A 4CCNA 3CJCA 2W42A 5AZIA 4FTHA 3SD4A 3M0UA 1NOZA 3CMAI 2A08A 4LD0A 3C7NB 2KY9A 3GFMA 2A61A 4DYCA 3RMQA 2G0EA 5K1YA 1K76A 1L3VA 1W7PB 2QWQA 1KG1A 3W0LA 1IUYA 5I2SA 3PO3J 4CEQA 4IZ9A 3GTGJ 1USTA 2R7VA 3A02A 1T3LA 5KAIC 4QOZB 2RQRA 2VXDA 1STZA 1NJIC 3CW7A 2J4RA 3S2HJ 3LAPA 2BTTA 2NRHA 2YS9A 2FPEA 1X58A 3EG1A 3IH2A 3CP2A 5LJ3d 4LY7A 2KRFA 1Y8QB 1ZBJA 1IN5A 3VN5A 2GWRA 1SKWA 5GANj 2EIMH 3VS1A 5E3OA 1QVFP 1OLTA 1ZK8A 1JL1A 2CWEA 1M1KC 1D8JA 2WV1A 1CXUA 1TWHJ 1WSUA 1WEIA 1X6OA 2JT4A 4FZYA 3ONQA 1IZ6A 1AD5A 2QQBA 2LD5A 4IIMA 2E1MC 1R0CB 2L89A 1U45A 4PCQA 3RMDA 3MN9A 5J4VA 3H0HA 1IHWA 3B02A 3ESWB 3S93A 2OTLA 2P9SB 2JRTA 3CCLA 1TL1A 1IXDA 4Y0WA 2OPPA 1LDDA 1JLAA 4OMYA 4M3WA 3BDLA 3A1YA 2LR8A 5GANh 3VS7A 2ZJ2A 4BL0B 4UY8I 3DOKA 2DA7A 2R5ZB 1RLPC 3VS2A 1B4AA 4A62A 1MMDA 4KUIA 5K5QA 3BPVA 4N4GA 3GOXA 1XG1A 3DKYA 4RKUE 2H6CA 4C0ZA 4KA4A 1LWYA 4YIRX 2EFQA 2DXUA 1EIFA 3M8JA 3QQAA 3CLQA 3FZKA 3WHCA 3CFPA 2O88A 2OUMA 3I59B 4DTNA 5EJCA 3KYCB 4MLOA 4WXCA 1YIJQ 4W5TA 3CCQN 3KLEA 1G3WA 4BC2A 4H5TA 1HD3A 1QVUA 1NJIU 3QYFA 3L9FA 4NXMK 2OCCH 5LJ5d 1RI7A 5FKNA 2X4YA 3A01A 4BHCA 1YW9A 3HRSA 3A0IX 2JT1A 3ZPLA 2X0LA 4FWQA 2DW4A 2WA0A 2W40A 5ICFA 1CZAN 2EZHA 5M5WJ 1LE8B 1RCHA 4LN2A 3HL2A 1YBYA 3QO9A 2W57A 3C2BA 3CF5L 1ZBXA 2WSEE 1OULA 2QDLA 1KQ9A 1HMVA 4EGZA 2RH2A 3GLLA 2GOMA 1WZOA 2GBYA 1W4MA 3I53A 3CPWA 1BHLA 1RTHA 3MZ8A 3RMSA 1FOWA 1Q82U 3AAQA 3J81E 3HG9A 1KK7A 1GLLO 4IXCA 1PKTA 3UA7A 1UCRA 2HPIA 5BQTA 5EG0A 3OIOA 3HHTB 4GLKA 3VQEA 1SMYF 4Z02A 2F2VA 5AQZA 4E1JA 1EWQA 3M53A 4BAYA 3PMIA 4RTVA 2P51A 3IAM2 1VRTA 3QETA 3I55T 2VONA 1VQPI 1LW2A 3CYMA 3C94A 1O75A 2GA1A 4J2BA 3E9OA 2JNGA 1HNWK 3GBQA 5CVIA 2P9KB 3J7AY 3U23A 3CC7Q 3JCMV 3VYRB 2E1ZA 4OU0A 3K10A 2E3HA 1FOXA 4C3IJ 4HVVA 3J8AA 2R5AA 3VF4A 3CCJQ 4BQNA 1N33K 1YUWA 4JHDA 2LRQA 3LPUA 1M90O 3V8LA 2O03A 4GY2B 4BE0A 2K4YA 3V9XA 3O4WA 4M72A 3ZYYX 2M8EA 1RR8C 5BS6A 4M7DE 3O6WA 1RBRA 5AQYA 5BREA 2KT0A 4F2RA 3SFMA 3G25A 1XX5A 2YR2A 1VQ7Q 3AY9A 3GLXA 2D0AA 2IA2A 1TWCJ 3RDVA 1JGSA 4JK1X 3S16J 1MBEA 1RETA 4XMYA 2ME0A 1G83A 1X6BA 4BRQA 1MNDA 3ZT0A 2E6NA 4IO9L 1YIJI 4P1WA 4ENNA 2O9SA 2QKBA 3PO4A 3DTKA 2VUMJ 4CD3A 2I0NA 3I5SA 2CUFA 4J19A 2O0YA 4EM1A 3FLGA 4TSXA 1M3BA 4FYXB 2P9UB 1VUBA 3D45A 1QKWA 5HNFA 2P9IA 4DG1A 6PAXA 1QLYA 1R1VA 1M3QA 3SJHA 1MPGA 3CCQQ 2M0OA 4ILHA 2P4RA 3AKZA 2FQ4A 2DYIA 1J5EK 3I64A 2Y4XA 3VEZA 1RRSA 3PIOF 3M1FA 1OU8A 3HYIA 3G1LA 2DPPB 2XHBA 1NJIR 1XMAA 3FZHA 2HQ5A 5MLCQ 4ELTA 3M0PA 5GAN5 2K3BA 2YKNA 4ZDOA 4LG0A 5HP1A 1FOYA 3GCMA 4DQSA 2W04A 4EJTA 2HDCA 2BVLA 2QEXI 3DEWA 4ZYEA 4OINF 4DW6A 1AT1B 3F23A 2KMUA 4GDFA 3M3YJ 2E1YA 1VQMI 4FW1A 1AOJA 4EM2A 2BE9B 1Z25A 4TV7A 3KZBA 2B63J 4WTOB 2CG4A 3GE1A 4A3IJ 4S0HB 2CSOA 4RTXA 4UNFA 3O5BA 4FVMA 3L09A 4M3DA 3CVTA 5D3GA 5BNGA 2IP2A 3PNYA 1N5ZA 4LF6K 2JMAA 2EGEA 2O2OA 4A5NA 3CCQA 5IPAA 4ILJA 4B9NA 2EW3A 2DIQA 3DLEA 2QKKA 1XCBA 3CCEI 1R4MB 3DTIA 4ZJZA 3CC7N 3UKGA 1GBRA 2L7ZA 2AKLA 2NUPA 1WRJA 1GVDA 2L3RA 2IIRA 3S1QJ 3M8PA 2R7TA 1KQSA 2BW3B 5IT9K 1GOCA 3WU2C 2VPRA 4LLLA 5CZ2A 2LKSA 2W25A 4A0ZA 3RRGA 2JRMA 4CJWA 3QESA 3BTJA 3HJEA 4M3XA 2RKIA 4BGBA 4W5RA 1KSPA 4IEIA 1MBHA 2EZIA 3UA6A 2E5NA 2VKDA 3H0GJ 5FWCA 3K6GA 2E10A 1ZGJA 3THYB 2KDSA 2V9KA 1WJSA 1Z26A 3CCVT 3CCLN 1X1PA 4AIJA 1Q18A 3Q9SA 2L3SA 4FL9A 1TT5B 2DXBA 3S8PA 3RERA 1Z9QA 4M7AC 2RB6A 3UKUA 2VWJA 4NYFA 3I58A 2EYWA 2EQMA 3H1VX 5JVTA 3NTHA 3RWUA 3M4OJ 5LJ3e 5CZ1A 1GBQA 1RDDA 2FX0A 3MXIA 3KP6A 2WAEA 4JX6A 2QWLA 1XHZA 1KC8C 3O9RA 1U5TA 5KYUA 2EGCA 2GV9A 4FLYA 3VQBA 1VQ7N 4ATOA 1SS6A 1ULYA 1TYQB 2GCXA 2X48A 4JX5A 1VQNQ 4LF8K 3VSLA 4JJNK 4BY7J 2NLXA 3MEXA 4N0BA 2K02A 1VQ4T 3ENHA 2A5WA 4DZJA 5HRRA 1IG7A 4CHYA 4XICA 1R49A 2R4GA 1V5FA 2LDUA 1OCZH 1RESA 4MO5A 1VQMQ 3PM1A 4XRSG 1WCMJ 2WAQN 2JM8A 2K27A 1BL0A 3SEZA 1OZ3A 4E70A 2E5QA 1SL2A 1C0FA 4XK4A 3PNVA 2P7VB 2P9LB 3GOIA 2HS5A 2E34A 4C23A 3N4PA 3PNTA 2XKOC 2X6OA 1S6LA 1NGEA 4JBAA 4YNQA 2L7KA 2ELHA 1FJLA 4BRHA 2GWKA 3AL0B 3OSVA 2KLOA 2IOCA 4Y13A 1Q95G 1ETVA 3ZQCA 4H5VA 2BHZA 8AT1B 1LWFA 4JJBA 3HKSA 2G9WA 3VS0A 3KEQA 3L2VA 4M75D 2ESWA 1YS7A 3QYGB 4M75C 3S17J 1JUPA 2YI1A 4Z88A 1QBJA 1NPRA 1BYMA 1GLNA 1RNHA 2O7OA 1YI2I 3OW2S 2J5OA 1H8KA 1Q86C 5FPMA 2SRCA 1IO2A 3HP6A 3EPZA 3O3KA 4JI6K 4HX8A 3S3MA 4R79A 3H1QA 4OWRB 2DO7A 3I71A 1TVRA 4DTJA 3EKSA 2XO7A 1JT6A 2O31A 1MKMA 2MCNA 2M9HA 3SLCA 1JJ2A 3CDIA 3KWGA 2L4MA 3I4PA 4L59A 2VXZA 1X2MA 2YSRA 1X3NA 3DKXA 2QA4T 1W2BA 3CVSA 2CUBA 3HK2A 1IREB 1ZBUA 1UECA 4M4ZA 4FJNA 4OIRF 5LJ5e 2HNIA 2YPRA 3VYHB 4M7YA 4Y33A 4OMZA 5IY5H 1KD1U 4I6MB 2ZPHB 3TAQA 4FK2A 1SKRA 3VS3A 1ARKA 4A3BJ 2E35A 2RJEA 3BTCA 2P9PA 1BI1A 4RAFA 3H6ZA 3DOLA 1TNTA 1BU6O 1ETKA 1NK4A 3NH2A 3CCJT 2D0QB 2HKQB 2HNDA 4PL8A 2RHKA 1BQMA 3ZQGA 2GGRA 5M1NA 4FPAA 4DV3K 4NXNK 3LPTA 4M3YA 2IGOA 3K69A 2KYMA 2AZSA 4JJDA 3SEQA 4MHGA 4AFQC 2DA9A 3B6OA 3RMAA 3VEPA 1R9TJ 3GZ5A 2B9SA 1V29B 2CP3A 5D5XB 2UXXA 1YQAA 3CI5A 3SHFA 5C2FA 2G8WA 3EGXA 1BA0A 1WFWA 3RR8A 1F1ZA 4UY8O 4YPHA 2HQNA 1SD6A 2EYQA 4DFPA 1WFXA 1YF5L 2WOMA 1ZQ3P 5HBMA 2GZWA 1VQPN 2LVSA 5TJJA 1O3TA 2PMZA 1N3CA 2F1LA 4JI7K 1VQMN 1BU1A 3MPUB 2VXEA 2M51A 1Q82C 1NG6A 1JXMA 4H5WA 2RD1A 1KXPA 4EIKA 1CSKA 4DTXA 3TTFA 1VSJA 3CCRQ 4E9FA 4J8OA 4WK8F 3ZRGA 1SHFA 3VETA 1SFXA 2DODA 4ZHRA 5M3MJ 2ED0A 2CMPA 1EBMA 2IPQX 3O3GA 3JYTA 5KK1A 3PSFA 1JTXA 2ZJRL 4OKKA 4Y91A 1ZG1A 4LIVA 3DLLF 1O3RA 3CWTA 4K8ZA 3RIRA 3FBNB 3JREA 4U0WA 4CJSA 3E1SA 3K2PA 2XRIA 4CBUA 1PG5B 1PU6A 3RR6A 1LUJB 2DL8A 2EIJH 2H3GX 1IJWC 3SFIA 4J5YA 2ZZDA 1YIJN 2K9GA 2LVMA 2Z1HA 1QHGA 4BRIA 4NCBA 3VQ6A 5HL7L 2ESNA 3FFIA 2Z9OA 4OMPA 4JYAK 1HPZA 2QZ8A 4FWOA 3M0SA 4XIUA 2F5FA 4KT0E 2YV0X 2Z1IA 5AQQA 1VQ9Q 3RI4A 3TP3A 2JZYA 2JJ9A 1WH7A 4KBOA 1TWFJ 2E70A 3P9KA 2LT1A 4ISFA 4EHUA 1JLBA 1K8AO 2FSJA 1MZBA 1IRFA 2D4WA 4HZFA 2QEXA 1D3BA 3RDIA 1HYSA 3LSGA 3GFIA 4HT8A 3MK6A 3T1HK 4OO1J 2ZSHB 1PKSA 2O8DA 5FO5A 3CC4T 3O08A 4EP4A 1DT9A 3JRFA 5IT9O 3C12A 3CC4A 4XLHA 2PMUA 4OB3B 1WYXA 4CZHA 3A98A 4W5NA 3T8TA 3NCIA 5BPNA 4I98B 2W82A 1XB4A 5TGTA 4GXOA 1IXCA 4RTYA 2BV6A 2VPLA 1W1FA 3IS9A 4CJ7A 1VQKI 4XTVA 2J7IA 1SEUA 3VMFB 4B3XA 3DWLA 5AZIB 1UHFA 1K9MU 1AU7A 4HUFA 1WA7A 4QQDA 1XJWB 5M1OA 5EC7A 1FKOA 3V9SA 4M6VA 4DK9A 1QVGA 1TAQA 1WI7A 2LDMA 4BR2A 4E7JA 1U3OA 5C44J 1NJWA 1WGSA 1WJBA 5J2PA 4MLHA 2XAUA 2Q8KA 2VG5A 3DP7A 4YDUC 2H6BA 3I0TA 1BL3A 2I5JA 5KCMA 3ATUA 4B1XB 2BY3A 5DTDA 4B1UB 3GTQJ 4BRCA 1YCYA 3WXLA 2EFOA 2H1KA 3FKIJ 2FA5A 2FXAA 1HC8A 5F27A 2Z33A 3H8ZA 3SK3A 2IPOB 1Q7YU 4AHSA 2H56A 5AYFA 3FXUA 2HOSA 2DTIA 3TI0A 4BDPA 2RK1A 1WLPB 2G3RA 3PFYA 2NNYA 3G1JA 2E2IJ 3ULEA 1UFMA 1Y7XA 2MPXC 2L9VA 1QPMA 2YHAA 4KITB 1RTJA 1LNXA 1NU0A 3LWLA 1JJ6C 3L42A 4LUDA 1BR4A 3AVKA 4O5VA 1VQ5I 3DLHA 2E1OA 2BYVE 5HOOA 4M3ZA 2MD0A 2QK0A 5IP6A 4A3KJ 1VQ4N 3GXOA 4GY5A 3BDPA 1BJAA 2DTZA 1YX3A 1MJ9A 1QCFA 3F8MA 2NXNB 4B9QA 4CJEA 1BCMA 3MP6A 3OR1C 2O6GE 2P0QA 3DXKA 1HOMA 1JXOA 2HNYA 1VTNC 2IEKA 1H88C 3ALYA 4R56A 2EYXA 3FEOA 3QDFA 2ROTA 4MZPA 4A3MJ 4ZGDB 2OTLT 1MH4A 4VUBA 4N0AA 1P9QC 3CBPA 4IHVA 3K7AJ 2DA1A 4LFBK 4I2OA 1VQPQ 3TABA 5L23A 1LPQA 2HDAA 3SZ2A 2EFPA 1HYOA 2KSSA 5SWMA 1VQOA 2EV5A 1V54H 3CIPA 2DFFA 2FD5A 2CZ1B 2GQVA 2COWA 2E2JJ 3QFUA 1ORPA 1VQOT 5DM7R 2IVPA 3CD6A 4E7LA 1SFKA 1U4BA 1IJJA 3CC7A 2NWMA 3BEXA 1TUYA 2XGEA 3CM6A 2E2HJ 2JW4A 2WAQA 1ETYA 3P9CA 1I1JA 3P38A 3CJ9A 4HVJA 4Q5SF 1R0AA 2DILA 3LFKA 3PO2J 2O8EB 3CCST 5AR0A 5H1SQ 2LREA 1XGNA 5HLGA 3BWGA 4D0PA 4HCZA 4PJOA 1BISA 3GO5A 2UUAK 4NYNA 3CJ7A 3ZEUA 1BDGA 3HT3A 4N5SA 1VQ7A 3HIFA 1WQWA 4OPKA 4IQJA 4CE9A 3FHGA 4C0DC 3FFKB 2EHGA 5AJ3K 2GWJA 1KQSS 1K73R 3M0TA 2KLAA 2L5QA 2W41A 2ZO4A 1SFEA 3TVTA 4KO0A 3U6FA 2XPWA 1J0RA 4DLEA 4MDXA 3IUCA 2HQHA 3AAPA 2VJIA 2LF8A 4AIDA 1SVMA 1RAEB 3CMAQ 1Q1HA 3CCET 3DLBA 1ETQA 1RBTA 2B6AA 5EYRA 3FZMA 4CJKA 2HB5A 4DTMA 5F1RA 1KVCA 2V1RA 4QAGA 3FHNA 1B8IA 3EG9B 4CI0C 3WHBA 2PVOB 3LP1A 2GLOA 3HRGA 1K9MR 2W03A 1VYUA 4F52A 1MV0B 1FMVA 2MWOA 4M45A 1R1UA 4IL6C 2DM1A 4ZH4F 4JKFA 3NAEA 2HW3A 1B72A 4NBQA 3JCMW 4FM0A 4PKGA 1WJDA 4A6DA 1R5ID 1SHGA 3C7JA 4M75A 2NVTJ 4LF5K 1XGOA 1VQ6N 3SUOA 2NRVA 2NNWA 1YFNA 1I1GA 2OJED 2B7EA 5C25A 3HM9A 2Q36A 2BIVA 2ZKZA 1X1DA 1IXSB 3V7SA 1R4NB 3DM2A 5DCMB 1IO6A 3PGGA 2GX9A 3EE8A 4V2SA 3E97A 4NC6A 3G7ZA 3G1OA 2CFXA 1UGPB 4IUTA 4CFBA 2L3PA 3J80E 4PLLA 2JHNA 3K70D 1ZREA 3RKQA 2NRZA 2AHQA 3AA3A 1WSHA 4RMOA 3FJPA 1FXXA 3H5RA 1ZRDA 2CREA 2HYFA 1BIBA 4M75F 1YW8A 1E2XA 4UUSB 2A28A 4FHTA 2JMCA 2LQNA 3HM8A 1YQRA 4R55A 1ZUKA 5LL6S 5LGNA 5GAEP 3GVAA 4LOCA 2PJRA 2JPBA 2GXAA 2QSFX 3QU6A 4BD3A 3GF2A 4FWKA 4YPRA 1NTCA 3HXMA 2PUOB 2R7DA 4AWXB 4KAZA 1O7FA 2DK3A 1WN7A 2GBZA 1E3PA 4C8QD 4WCEL 3A4CA 3MVPA 5FKKA 2X85A 1S72I 3K59A 1UB4A 4M78D 3GEZA 3MZYA 2HQXA 2VC0A 3EQLF 5IXFA 2F5VA 1G59A 1FIAA 4OMLA 2DT6A 2A6AA 2M9UA 4WQ4C 4F7UE 1OMIA 1GCPA 1S5JA 3FLCO 1PM3A 3ZQHA 3H3VK 3NH1A 1MDUB 5GAMf 2K5FA 2CW7A 2DA3A 5DLOA 4IG3A 2VBWA 3CQZJ 3NGPA 4G8XA 2EBIA 3L2WA 3ROUA 4KHYA 1TNSA 1YJNA 1R00A 4JS4A 1NM1A 4IRIA 1NGBA 4DHYA 1X3MA 1K9AA 1YITI 1EH7A 2IT0A 1D09B 1N8RO 1CF7B 4FETA 2IVWA 3DB3A 3ECOA 1M1GA 1HLUA 5LRRA 4KDPA 1Y57A 2ZPGB 4ZTFA 3ZSQA 2KW4A 3NTIA 4EJZA 4PJOC 3ML6A 4C5EA 4L5JA 4AFUC 4R0KA 2FRHA 3CJNA 3QSUA 2QK9A 3LSRA 3IRQA 3GFJA 5LHIA 5J26A 4I01A 5AQVA 3F3XA 3SZTA 4I7FA 4ISGA 4LG0B 2FU4A 4WYBA 1X27A 3K58A 5E1XA 2YG8A 4OPHA 3T1BA 5JS2A 3JRIA 4PZJA 3A01B 1VQKQ 1D8KA 3MEEA 4IG0A 1FK9A 3QZ9B 2YWWA 1PDNC 3QEPA 3KK3A 3CCRN 3E6CC 3E6MA 4XORA 4KTQA 4F2SA 1S6QA 2BEOA 2QDYB 3G71A 3U8XA 1IKWA 1ZBSA 2OCEA 1KC8U 3DF8A 2G8HA 4YDUA 2FF4A 5B3SH 5AIQA 1XC5A 4ID1A 2NVUB 3VYUB 3CXCS 4B1ZA 5TKWA 2Y2ZA 4EJUA 4MFDA 2OTLN 2YUPA 3R60A 3DXMA 1M5Q1 1NGNA 2C6YA 3QAHA 3OMYA 3MN6A 3LP2A 1LOJA 1MNEA 2EYYA 2QWMA 5KAFC 3SDZA 3MJXA 2MOXA 3H92A 5HVQC 3QRFF 4U7BA 2E5ZA 1EV7A 2HZDA 1ERDA 1N27A 4CGJA 3MN5A 5GJWB 2MH2A 2I10A 3QDRB 3A03A 2Y48A 4AYBA 5CE3A 5KVRA 1QVTA 3K2AA 1K73O 2HCKA 1MMSA 3DLAA 1XC9A 3RSEA 2M1BA 2HPMA 2RV8A 1S1VA 4H5NA 2EINH 1P7JA 2YNIA 3I55I 4F4KA 1GCQA 2EILH 4B4CA 1NE8A 4OB2B 1YXQA 1GVJA 2ATCB 4HWIA 1VQ5A 3BG6A 4EMHA 3M0QA 2K9MA 4FT8A 1YJ9N 5K7HA 4FLWA 3H1CA 2A3LA 5ICEA 4M74A 5GP9A 2E3IA 4M78E 2BDPA 1YQLA 4RCCA 2UXDK 5E26A 2GEMA 3KUFA 4HCCA 1IV0A 3VGLA 3S1MJ 2E8AA 2DYRH 2M0YA 2ZGWA 3VGMA 4BH9A 3SDGA 1DJ7B 1MSFC 4JKEA 3CD6N 4CGZA 3I35A 1QW1A 3ASOH 4FW2A 1YJNI 3F8BA 2LBFA 1WHKA 4ENMA 1S72T 3CCJI 1S9GA 5CR2A 1SAXA 1WIEA 2DD4A 3I56Q 3AHUA 3ZT2A 1VQNN 5GAEJ 2X4JA 2Q2EB 3K0LA 3RTVA 1WXBA 2QYZA 3NF6A 1I4K1 4A4KA 4KT6A 1TGOA 1OH7A 4M3BA 1EH6A 4JRIA 4OKEA 1G3TA 4KYWA 4A53A 1JXEA 3AA5X 1H9TA 2YLBA 2K3FA 4ZN3A 4PJOF 3V9ZA 1B3QA 1K7AA 4HAMA 3EZ5A 1KAZA 2XB5A 3MO8A 2MC3A 1VRLA 3TAPA 2KZGA 2DAOA 5GADP 4FM2A 2ZJPL 5AIPA 4Q5WA 2K9NA 4I2QA 3J80K 3W2AA 4ANJA 2ZXIA 2XHIA 3IWFA 2YX6A 1HQEA 5AQNA 3NNQA 1VQ9N 4BQZA 1VQ6T 2ZMEA 1KG4A 4M78B 1PCXA 2XKPA 3UPUA 1SZ2A 1LJOA 4JI3K 1FN7A 2GELA 4JQFA 1NGCA 4RAZA 3HHGA 3BZCA 2YJFA 2WFBA 4F7ZA 1SUQA 3E9PA 3SYZA 1ON2A 3PO5A 1YP5A 3S32A 3VS4A 3I56T 1AKHB 3I59A 3IH3A 2KHMA 2TRTA 4JS5A 3TARA 1NG9A 4M7AE 3E5QA 4U0YA 2O8KA 4CFCA 2CSQA 1XSDA 2Y1IA 2KFDA 4RCHA 2VQGA 1JLEA 3LSIA 4EW4A 1QP2A 4IJNA 5IWAK 3WXIA 4EQQA 1K8KB 4QS7A 1BQNA 3KWIA 2GA2A 4FE7A 1XS9A 5K7ZA 4KUMA 1PU8A 4CZFA 2DU9A 1RT6A 1N6QA 3QP5A 4DJAA 1WWXA 5FU7C 3DLKA 4FZXC 2F2XA 4E7IA 1Y1WJ 3C0CA 4N76A 1W9HA 3CCMQ 1HA8A 4LC9B 4C9YA 2J6FA 2PZ1A 1RPWA 3K9JA 5ICGA 4DR7K 1N75A 2ZE2A 4CSWA 2J6OA 1Y8RB 2XKOA 4KRFA 5FFXA 4IOXA 3CFOA 3QWLA 1EQYA 3RSEB 4CFAA 2LBFB 4WCGA 3MZHA 2HYJA 2JMWA 1M2OA 2V8KA 5IH2A 1YTAA 3OBYA 4RWTA 3CCUN 2QKLB 2Q0RA 1B9MA 3C95A 1WBBA 2LY2A 3NWTA 2ETJA 4M63C 3CF2A 4FJ7A 2TCTA 2V1UA 3AO1A 1TWAJ 4MFEA 2K6DA 1WJRA 1TK5A 1A6QA 3ABKH 1WPKA 1JB0E 2ADUA 1Z1DA 1X1CA 2XF7A 1S7AA 3KHYA 1JQQA 1T0JA 4B8CA 1ESVA 4NB5A 4CCOA 5KQ8A 3JW4A 1U0JA 4B1VA 3GTJJ 1H0MA 4M7DF 2PYLA 3GPLA 1FW6A 2BGGA 5IHIA 3JB9H 2X6WA 3QZ5B 2D1HA 3KKRA 2ENMA 2Y9YA 5E20A 2A40A 3SMPA 3AG1H 1I5OB 1OX8A 1OISA 2ZWHA 1WJCA 2IJLA 2HOEA 1QWFA 1RAGB 1FX7A 2OAWA 3CPEA 4H0VB 3HOXJ 1GDTA 1YRNA 1IAWA 2CV1A 1KAYA 2P9LA 4PFOA 2VIXA 4KRTA 3R0JA 2CYYA 5GANe 3FB9A 2COZA 4ENJA 2EAYA 3JB9G 1QQJA 4M77G 5AQUA 4BJ5C 2MI6A 4DYQA 4YG2F 3J7YP 1RRQA 4A4GA 1WHLA 5CKHA 3H5AA 2M16A 2JXBA 4FM1A 2BUDA 4DQQA 3WG9A 1ZELA 1P2FA 2Z2SB 2UZKA 3PTAA 1F9NA 3PVLA 1UHWA 3O80A 4R8HA 3N97A 2CP7A 4CZLA 3M1CA 1IHVA 1UHSA 3VEOA 1Z7LA 1U8BA 2UUZA 1HPMA 2HHVA 5AQMA 1ACIA 3DLLL 4DV0K 3HYFA 2RI2A 1HSJA 3HM5A 3CMYA 3CUQC 3JRZA 4A54A 2RHXA 4IFYA 4ZZDA 4DQIA 4NNJA 2GUIA 2A6TA 3M1EA 1ATSA 1A36A 1N25A 3BJ6A 3J7AO 5FU6B 1VSMA 2ELKA 3T5XA 4FLZA 2DLPA 4ITVA 1S6PA 1VQOI 1JRIA 5AQTA 1VQ4I 3O9UA 2AXLA 2OQRA 3EL2A 1Y07A 3PL8A 3JSPA 2VC1A 3LWMA 2W84A 2KIMA 1A5JA 5HKCA 3ZSXA 4I0AA 5TRDA 4N4IA 3O4NA 1QZYA 4GV6A 3H9GA 2RPNA 2VUBA 4LJZF 4WQ5C 5GAMd 1MGQA 3P39A 4BXXJ 2PEXA 4QTRA 2QAZA 4GFBA 4WCIA 1J54A 2ID6A 1PNJA 1KG3A 5JI6A 2NVYJ 1QGPA 3U9ZA 1XQHA 2PLYA 3LL3A 3R9PA 1YTUA 3FZFA 1VQ7T 4BWMA 4Q47A 1X75C 1XQPA 1POGA 3OSSC 2KK4A 2ZD1A 4AILC 3PSIA 3VERA 3KE2A 1TQIA 1X69A 1YITN 1W70A 2KQ2A 3G71I 2ECCA 4UV8A 2HQAA 4KN4X 3J7AP 8ATCB 3V6DA 3KLFA 3MX5A 3E9GA 2DPUA 3CPWM 4N0AC 2A1SA 1U2VA 1R23A 2W6LA 4J9FA 1QWEA 1ZSGA 3O2PE 3H3OB 3AO5A 4DV7K 1WXTA 3RKYA 2RI5A 3EYIA 1DGWY 3CMEI 2QYOA 2ZCWA 5LHHA 3WEEA 4D1QA 4LDUA 2OANA 5GAN6 2AHJB 3AG3H 1S7EA 2H94A 2XC7A 4FL6A 2K4BA 5LJ5j 2VQEK 3DTEA 2XGCA 1YQMA 2D0OA 3X20B 3AGKA 1J7KA 3CCJA 1USSA 2EH3A 3IAS2 3N5BB 2D0CA 3VQPA 2E2OA 2A3SA 1R0BG 3H0IA 2K3YA 2YG9A 2FC0A 1RBSA 2DXIA 2B0LA 2UXCK 1OCCH 3DU6A 4JP0A 5HNHA 5KYUB 3E1YA 2FUG2 5FWBA 3RSNA 3IG1A 1U2VB 4E19A 3QINA 4M3UA 2W10A 3OYKA 4JRQA 2HWVA 4G12A 2P81A 5JR3A 2EV0A 4Y1CA 5AQKA 2L7FP 3IC7A 3ZQ7A 4CVNE 2IBDA 4WF9L 1YAGA 4AG2C 3NVMA 4XTXA 4J2EA 1IRXA 3J81K 1QZ5A 2QEXQ 3M8FA 5FPDA 1NLOC 4G7HF 2QGGA 4B9LA 2W7NA 5L3BA 1TTHB 3ZQFA 1OEBA 4UUVA 3GFLA 4JLHA 5CVJA 3PIOA 3OH9A 4N47A 4DQPA 2KMTA 3AO4A 2QA4Q 2EX3A 2VC8A 2CS3A 3Q7CA 4C0GA 3V1RA 2BZTA 2C06A 1NMDA 1BOTO 2CH4A 2ZCFB 1LMZA 1EFNA 3EFOA 2FHDA 3NRVA 2L0AA 3TSUA 4II1A 1UA1A 2J05A 2QVOA 1TUCA 1W4SA 3GIBA 3TGNA 1RAIB 2WSCE 2I2LA 2EJ9A 1S7OA 4UQGA 3M55A 1U5SA 5I42A 5BMZA 5DCFA 2JA2A 4FASD 2RQTA 1FSHA 4NDLA 4FJLA 3KPHA 3E6DA 4MFBA 2CO5A 3AL0C 1RUWA 3MKYB 2P7CB 1TOVA 4C8NA 1P4XA 1N9SA 3W2WA 5KYYA 4V2FA 4C2MJ 4Z8AA 5BRDA 3AG4H 3SI6A 4HBLA 1BWFO 4MEYF 2LJ0A 3SV4A 4BGAA 1A6IA 2KZZA 2KE9A 4LH5A 2DFIA 1KGSA 4XSXF 5E3NA 4A2BA 5C42A 1VQ5N 2NLUA 2QSHX 3FIWA 4OOIA 4D6WA 5KGWA 4PJMA 2BTFA 3ZSYA 1GXIE 3QWYA 2EQIA 2CUDA 2CGPA 4LDYA 2DE0X 2JVVA 1MV3A 2KKZA 4QSHA 3TP0A 2V51B 2E12A 4B9XA 1WH5A 4A4EA 3MD2A 1BOAA 4HW0A 1OCPA 1XI1A 2FPFA 1TK0A 3HXLA 2OQGA 3AO2A 4W5QA 4FJXA 1XGSA 2CZ6B 4X9CA 4GYIA 4II3A 1X1AA 1MBJA 1RTDA 3WTXC 1VQ8T 2R58A 4M3GA 3A8LB 4ILGB 4XTYA 4FJ9A 1F43A 1ZA2B 1TUDA 4FYYB 2X35A 1WJAA 1FPQA 1K1ZA 4N56A 4ZGEB 5JLWA 1GLEG 3NMZC 2NOJB 1G3YA 1HW1A 4DUYK 3CCRA 3G4SQ 1R7JA 1FBSA 2B8AA 1B1BA 4A61A 4G1QA 1N5YA 1KQ8A 3TANA 1UG2A 3SWNB 3NARA