4E7HA

Pfv intasome prior to 3'-processing, apo form (ui-apo)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7hA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7hA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7hA03
2D9TA 3SPYA 1IH7A 3S6WA 1IKWA 1WJRA 2B8AA 3LH0A 3I0RA 3IG1A 5DMRA 3V1RA 4DU4A 3QEWA 3NF7A 4OVLA 3OMGA 4H8KA 5JS2A 1YTUA 3ZSOA 5CY4A 2RO0A 3V9SA 2QQSA 2RI5A 3LANA 3TAFA 1RDBA 3KD1E 1VSHA 4EP4A 4DQPA 3K5MA 1TL1A 1NJYA 4Q0BA 3B6OA 4RW4A 2XY6A 4O0JA 4Z0UA 3K5LA 1X9MA 3PMTA 2E6LA 4CEEA 4C5HA 1JLFA 4HVJA 4FJMA 1KLMA 4M3YA 3HP9A 4F3TA 2HHXA 1L3SA 4FJ7A 2JGUA 3NTKA 1LW0A 4IUTA 3LAKA 3LP1A 2VG6A 2YKNA 3ISNC 3KLIA 1JL2A 3OVNA 4IFYA 4DLGA 3T3FA 1HNVA 1T8EA 1RDAA 1J5OA 2RHXA 1XWLA 3AVBA 4CJFA 1WJSA 4DTRA 3SUPA 4FU6A 1RBRA 3I0SA 4Y1CA 1ZBLA 1XI1A 4CGFA 5E41A 2D0AA 5IN1A 4E19A 1HQEA 3HYFA 1U48A 3QBYA 2G8HA 3SQ1A 4LD0A 5C24A 3CFRA 2RHIA 2DIQA 3D0PA 4DTPA 1X1PA 3TR8A 2RI3A 5KCHA 1GOAA 3TWHA 3DLMA 3PO5A 2R5MA 2RHZA 2RHUA 3KUFA 1C0MA 1JLEA 4FLZA 4PA1A 3HXMA 2G8VA 4J2DA 1ZBUA 4DU3A 4IURA 1HYVA 1SUQA 5HRSA 2EX3A 3C94A 3VQ8A 4CGJA 5I3UA 2OPPA 3AV9A 4BDZA 2DFFA 4FJLA 4C5EA 1NK5A 1S5JA 4CJPA 4HUFA 4ZTJA 5C42A 5SWMA 3S3OA 3ZSWA 4FJXA 2HHTA 3LAMA 4UC4A 2RJEA 1KRPA 4FM2A 2YKMA 3IRXA 5CYQA 3P8DA 4CJ5A 1CZBA 3PNWC 3WNEA 5KRTA 4FJGA 4RG8A 3DI6A 3SQ2A 3LPUA 3HK2A 1IO2A 1C1AA 3AA4A 3VQ6A 4CJLA 5T7BA 4CCHA 2HHUA 2F5KA 4BE1A 1QSLA 4CEAA 4JS5A 1VSIA 5HLFA 4OKJA 3AO5A 1S1UA 3DRRA 4C8LA 3RR8A 4TSXA 3NHGA 3E9FA 3M8SA 1OZ3A 4DTUA 2RHYA 4AHSA 4CGGA 3AVKA 4YFUA 5J26A 4IBNA 1T03A 4C5GA 2LSNA 1VSLA 4ICLA 3RWUA 2D0CA 1QSSA 1EX4A 2HNZA 1SKWA 4PLLA 2XY8A 3LYIA 1VSDA 4FLVA 1WJQA 2IAJA 3AVFA 3VQ4A 4FJ8A 2EQMA 3RMAA 5CIUA 3GOXA 1CXUA 1O1WA 1VRTA 2FBVA 4PL6A 1GOBA 1A5XA 3NF8A 2YHAA 1TVRA 4Z4HA 3PV8A 2HW3A 3SUNA 2OPRA 3PFSA 4FZXC 2KW4A 4IKFA 1WAFA 4GMJB 1D5AA 4Q5VA 3D45A 5KTQA 4DLEA 3OYJA 4CJUA 1A5WA 1YTAA 3PX6A 3TAPA 1NK4A 5KH6A 2B4JA 1U47A 4M41A 2OZSA 1EETA 4FL6A 1RT6A 1RTHA 3AVNA 4CF1A 3O4NA 1VSKA 4E89A 5CZ1A 3K59A 1QSYA 4C8OA 3M8RA 1B9DA 4DTJA 1TAQA 3L2WA 4QVZA 2E4LA 1SKRA 3QNNA 4CEBA 2G8UA 4B9WA 1VSFA 2IDOA 3U6FA 5D6XA 1RBVA 3AO2A 4E3SA 1WSJA 1IG9A 4IG0A 3ZT1A 2K3XA 1TL3A 3EY1A 4ID5A 4I9LA 4CHOA 4OVAA 3QEXA 3OYEA 1TKTA 3HM9A 3ZSXA 2RPIA 3KTQA 4WE1A 4J2BA 2ETJA 4IG3A 3WNGA 1NOZA 3HL8A 5CYMA 4N76A 2Z1GA 4IUPA 1VSJA 2XRIA 3QIIA 4BD3A 5C0MA 3MEEA 3L2QA 1N6QA 3AVJA 3PUFA 2PYLA 3SQ4A 2KFNA 3KLHA 5HRRA 3MP1A 2QQRA 1NKCA 2RJCA 4B9SA 4Z4CA 1BIUA 3G10A 3NGIA 4DFKA 3QERA 1N27A 1SKSA 2E5QA 3LZIA 1RI0A 2EKOA 3LGLA 4QW2A 4KPYA 4M3RA 1QHTA 2DFHA 3H6ZA 3DLGA 4A4FA 4N4GA 2O4GA 3EZ5A 3OYMA 3VQCA 1RT7A 3SV3A 1KVAA 4B9NA 4FK4A 3L3UA 3RTVA 1JL1A 4CGDA 3ZT2A 2PY5A 4HCZA 4PUOA 3L2VA 3OYCA 3O4QA 3OYKA 3QEVA 1Q9YA 4DSJA 4CRIA 3K5OA 3DM2A 1ASUA 1EP4A 5CZ2A 4EZ9A 3P83D 3QESA 4W5NA 4NCBA 1KHCA 4DSKA 4B9TA 4Z4FA 2RJDA 3KKRA 3KLGA 2DIGA 2X35A 2HNYA 4CF9A 2MWOA 3UWNA 3VN5A 4BWJA 5DK5A 2JLEA 4C8NA 4CJ3A 4CJSA 1WSIA 3V9UA 4CJ4A 3PO4A 4DFPA 4B9MA 4IUUA 3OYBA 2IG0A 4FJ9A 4B9XA 3NH2A 3BDPA 1SL1A 1SL2A 4DTSA 4FXDA 4J2EA 3AVLA 4CIFA 3DLKA 1C1CA 5KGXA 4DS4A 2QK9A 3OYDA 4CEQA 1FKOA 4IDKA 2X4YA 4AHRA 1NK7A 2HQEA 1L3UA 3VQBA 3QIPA 3SCXA 4KTQA 3LP2A 2LCCA 4Y1DA 4FK0A 2D0BA 4DFMA 4CEZA 3KK2A 1OYXA 2EQUA 3JYTA 1I39A 1S9GA 4NZGA 1JXBA 4YNQA 4FJ5A 2KFZA 4PLIA 1IKYA 4Z4GA 4E1MA 5K14A 3VQ9A 3KK1A 3SUQA 2BDPA 1WSFA 1JLBA 4UQGA 3QEIA 4FLTA 4II1A 4G1QA 1DTTA 2HHVA 1CXQA 3P8HA 1DTQA 1TGOA 1KFDA 5J2PA 4CF2A 3KIOA 2VG7A 3V81A 2ATQA 3NAEA 3E9GA 4N4HA 1VSMA 4E7HA 2B5JA 1W0HA 4KO0A 4BE0A 3C95A 4OKEA 2YV0X 3MEWA 4CECA 4E7KA 4RG2A 4B9VA 1HNIA 5JS1A 3AA3A 4KHSA 2ITGA 4LSLA 1WLJA 4W5QA 4F8RA 3L3VA 4JS4A 5KCOA 2YRVA 2L8DA 4DQSA 3RR7A 4LD6A 3ALYA 2GFAA 3V9ZA 1NOYA 4JRQA 3TABA 2HMIA 4B3OA 2GF7A 2X4XA 4GVMA 4FM0A 1TK5A 1S1VA 2EQJA 2F8SA 3ZSQA 3SV4A 2HB5A 3SJJA 1JXEA 1KLNA 1C0UA 5D6YA 3ZT0A 4M3TA 2IC3A 3KJVA 1X9SA 3HJFA 4FZYA 4BACA 4X34A 3C6UA 4DU1A 1OZ2A 3E01A 3SUOA 4FJIA 1XHXA 5KI6A 4CJTA 3K58A 3SD4A 1VSEA 1EKEA 3ZSVA 1YVUA 3G0ZA 2R7YA 2ZD1A 2FHDA 1RT4A 3PMIA 3CFOA 1QS4A 4KB1A 2X78A 3RMBA 1NK6A 2HHQA 4JLHA 4M3WA 1RT3A 1ITGA 1JLQA 4FLXA 4CERA 3LX7A 5KE2A 2P1JA 2BIVA 4Z4IA 3TAQA 5I42A 4O4GA 3KD5E 4A4HA 1L3TA 3AO3A 4DF8A 2RI2A 4FJHA 4FJKA 2XK0A 4FZZA 1H3ZA 3TI0A 2F8TA 4QOZB 4DG1A 2IOCA 3OYLA 3A2FA 2OPQA 4LY7A 1CZ9A 2O4IA 5C6SA 4HUEA 4FLYA 1C0TA 3O3HA 1S1XA 1XHZA 4FJJA 4CEDA 4NYNA 4DMNA 1SL0A 3M9QA 4RW9A 4HCCA 1TAUA 4N5SA 2WOMA 1RILA 2VWKA 4CJWA 4CF8A 3NCIA 1NJZA 4M3UA 4BE2A 4DQRA 1RTJA 3O8VA 3ASMA 4KI4A 2BGGA 3LLRA 1RDCA 4AILC 3KLEA 1TKXA 1KCFA 1Q8IA 2OYQA 3M8QA 1HRHA 4CIEA 4KB0A 3HPOA 1BL3A 1WGSA 5D6WA 1HPZA 2HVHA 3OY9A 2YHBA 4QAGA 3OS1A 2IS3A 2RKIA 2WONA 4OKKA 3HPGA 3VQPA 3HVRA 4C8MA 3VA0A 2MWPA 2P51A 1ZBHA 1A5VA 1RBUA 1HJRA 1I3AA 1ZYQA 3P5JA 2G8KA 2HHWA 4RW6A 2P5OA 5FROA 2HNDA 2Z1JA 4CHZA 4FCYA 1RTDA 1FK9A 2E6MA 3F9KA 4GY5A 2LDMA 1WSHA 1LWEA 3CQ8A 3TAEA 3VQQA 2PZSA 1D9FA 3SYZA 4DQIA 4F2RA 4NCGA 2E6NA 3DYAA 4AHCA 2CKKA 3LP0A 4CFCA 1SSFA 3V6DA 3AVGA 3IAYA 4B9UA 4CFAA 4M3XA 4E7JA 4N47A 4CIGA 1T05A 2HVIA 5C25A 1NKEA 3B6PA 3IS9A 2XHBA 1WN7A 1DLOA 3AA2A 1N5YA 4KRFA 1LAVA 3K5NA 4LH4A 1MU2A 1LV5A 3T19A 3UIQA 1CLQA 5HBMA 4FW1A 2D5RA 4B8AB 4W5RA 4M3ZA 4FW2A 3FEOA 2BANA 1LW2A 4MFBA 1BGXT 2KQ2A 1IKVA 2X6SA 2G8IA 4KHYA 2FC0A 2ZE2A 1TKDA 1K6YA 2M1HA 4CJKA 3C6TA 4FM1A 4E7LA 4A4EA 3OA6A 2B6AA 4GW6A 1VK0A 5J1EA 2AJQA 3Q1JA 3VQAA 3DRSA 1RT1A 4I9QA 1S1TA 4MQ3A 3DLHA 3DOLA 1RTIA 3DLEA 1TK8A 2KZMA 1UOCA 4DTNA 4IFVA 4HHTA 1C6VA 4N56A 4KAZA 4FJNA 4KHQA 2KZZA 2M16A 3SQ0A 3AA5X 1ASWA 3DRPA 2A1SA 2L89A 3EAEA 2XY7A 3QETA 4DSIA 2DFEA 3LP3A 2YNIA 4L8RB 4OLBA 4DQQA 3SNNA 1J54A 3ITHA 3L2RA 1J9AA 5FRNA 4FK2A 4KHWA 2HHSA 5HROA 1ZBIA 4PWDA 4AHVA 4KHNA 4O55A 1BIZA 1VRUA 4NYFA 1UWBA 1XNIA 2JZ2A 3SZ2A 3TANA 2X74A 4A4GA 2DAQA 3S3NA 3AVMA 1NKBA 3UT1A 2QKKA 4KI6A 4E0DA 3NTIA 1D8YA 4CK2A 1JLAA 3HSTB 1J53A 3NF6A 3QIOA 4ZHRA 4DS5A 5J2NA 2Y1IA 3ZCMA 4EDUA 4RW8A 4CEOA 3HPHA 4QQDA 3DMJA 2WACA 1HMVA 1S6PA 4AHUA 4CFBA 2F96A 2OPSA 4B08A 4CHQA 3MXMA 2GBZA 3VQDA 3MAQA 1WAJA 4W5OA 3NH1A 3L8BA 2BE2A 1JLCA 2LVMA 1BISA 1RT2A 3LDSA 2ZQBA 3NGZA 2W42A 3ZT3A 1BI4B 3HP6A 4C5IA 5M9OA 1W9HA 3O3GA 3RMCA 2LRQA 5KGWA 3QEPA 3CEYA 4CJRA 2NLUA 4LH5A 4JRPA 4I2QA 4ELTA 4F4KA 3MEUA 1WSEA 3PX4A 4OLAA 2VG5A 1U04A 3S3MA 3NNQA 3OYGA 3VQEA 2Y1JA 1EXQA 2JTFA 3ULDA 1FKPA 1JLGA 1UAXA 2Z1IA 3ZEHA 3MEGA 1L3VA 3K2PA 3VQ7A 2OZMA 2P0KA 1GOCA 4LSNA 1KVBA 3BGRA 3MXIA 4Z4EA 1BCOA 4DTMA 3L2UA 1R0AA 1KFSA 2G8WA 3FFIA 2EQKA 3KKSA 3NDKA 2BUDA 5KE3A 2BKDN 1HQUA 1KTQA 3CM6A 3V9XA 1NK0A 4BDYA 3ASKA 1LWFA 2GV9A 4N41A 4ELVA 4QQGA 1TV6A 3LWLA 3MXJA 2Q3SA 2XDPA 4OGCA 2EHGA 4CJQA 1UA1A 5IAYA 2G8FA 2P5GA 2DTUA 2M0OA 3LZJA 3LPTA 4NS5A 1LAWA 2NUBA 4CHYA 3KK3A 2I5JA 2OA8A 4FLUA 1Q9XA 1B92A 3NFAA 4I2PA 4Q5WA 1MHNA 1BQNA 3DB4A 4CK3A 4ID1A 3CYMA 2XO7A 4F2SA 4CJEA 4KKOA 3AO4A 2PQWA 3BDLA 2HQXA 1S9EA 2YNGA 3M8PA 4KV8A 3RMDA 2EFIA 2FBYA 3MEDA 3QNOA 3TARA 4EZ6A 3V1QA 3HT3A 2YNFA 2RJFA 3MECA 3NTHA 3NF9A 4BWMA 3OYFA 5J39A 3KLFA 3OJUA 3JSMA 4B9LA 3T1AA 4DF4A 3LWMA 3EYZA 3AVHA 1NK9A 3F70A 1RCHA 1Z25A 4XIUA 1U45A 1NJXA 3OS0A 3MEAA 5J2MA 4O44A 4O0IA 4OPJA 3TAMA 4CEFA 4W5TA 3SPZA 2K3YA 4CGHA 3OYAA 3U3YA 2PYJA 4CJVA 4KREA 3DB3A 3WNHA 1NK8A 3AVAA 3L42A 3CM5A 3TAGA 1HYZA 4FLWA 1OI1A 4IUVA 3AVIA 2GUIA 3DLRA 3OYIA 5FRMA 4CFDA 3HVTA 2L3RA 3NE6A 3V4IA 1BI4A 4FVMA 3WNFA 2G3RA 1F21A 1UA0A 1T7PA 4DWIA 4K8XA 3NBPA 2RN2A 1L5UA 1D9DA 2R5AA 2QXFA 4FYDA 5J2QA 1FXXA 3RRGA 3OYNA 3ZSRA 3MP6A 1NJWA 3V9WA 3LALA 3OYHA 1X9WA 1G15A 2O4XA 3OB9A 2R58A 4IUQA 4Z02A 4B8CA 1RBTA 4CESA 1QTMA 3MO8A 1REVA 3C4SA 4QQ6A 3AVCA 3QINA 1RDDA 3META 3ZSYA 3LGFA 3ZSZA 4CE9A 1LWCA 4OPKA 5HP1A 1IKXA 4F3OA 4H4MA 1S1WA 1Z26A 2VYTA 3OS2A 3VQ5A 3U3GA 4KHUA 1JKHA 3DLBA 3OMCA 1TKZA 4CK1A 4DFJA 4CF0A 2R57A 5D3GA 4ELUA 3F73A 4HCBA 4R5PA 3HO1A 2A1RA 3H8ZA 1G5VA 2Z1HA 4BDPA 3K57A 1ZBFA 4AH9A 5KRSA 2X6NA 3FDRA 1C1BA 3PY8A 4NCAA 4L59A 4KFBA 4DSEA 3FC3A 4KTZA 4DTOA 3RRHA 3QKJA 1B9FA 3NGYA 3DOKA 4O5BA 1RBSA 5FDLA 1QQCA 3QJ6A 5HRNA 2KTQA 1WSGA 3SI6A 2X4WA 1WNSA 2O4XB 3FLGA 2FBXA 1ASVA 4H4OA 3V1OA 4DSLA 1QE1A 3NH0A 2GFUA 4J2AA 3H08A 4HUGA 1TK0A 4PQUA 4K8ZA 1SV5A 4OGEA 4ZTFA 3ZT4A 3O3FA 4QCLA 3CFPA 4AHTA 2XY5A 3CG7A 3ME9A 2VWJA 3THVA 1KVCA 3QO9A 4HTUA 3VA3A 3S9HA 1BHLA 1RNHA 3PX0A 1BQMA 2FBTA 5HRPA 2QKBA 1RT5A 4CGIA 4RW7A 5EU7A 1XC9A 4PY5A 4DTXA 4M42A 4E7IA 4I7FA 3OQ5A 3P1GA 4CHNA 2LTOA 2IGIA 1Y97A 4CHPA 1BCMA 3AO1A 3I8DA 3MP8A 4EP5A 3MEVA 5SZTA 3OJSA 1YT3A 1U49A 1HYSA 2RF2A 2YNHA 3QLHA 1KSPA 4E1NA 4DSFA 1S6QA 4M45A 4KTWA 1U4BA 2DY4A 4C8KA 4N4IA 4OJRA
chains in the Genus database with same CATH superfamily
1MNDA 3NF7A 4FETA 3X20B 4AFQC 2RO0A 2HDAA 4ENMA 4F7UG 3CP8A 1EV7A 3B6OA 2ID6A 1T3VA 1VQMQ 3MZHA 1SF9A 2FNPA 4JK8A 1YJ9N 1KQSA 1RESA 1JCFA 1SHFA 1WEGA 4DTRA 4BAYA 2V26A 3FXLA 3KP4A 5E41A 2D0AA 1KA8A 2G7UA 5JVGL 4RKUE 1VQ4I 3MAJA 3I8BA 4XRSA 1A0NB 1ZRFA 2R5MA 4DBRA 1JLEA 4A3MJ 1NM1A 1LQ1A 3EGDB 2EQRA 2KISA 1IXDA 2OPPA 2WUSA 2KMTA 2QA4T 2XF5A 1S72Q 2V4JC 1VQ9I 4UC4A 1BBYA 3D1NI 1VQ5T 3ULEA 3MJXA 1FOWA 3DI6A 3QYEA 2HDCA 1RKWA 3B73A 1PKTA 1Q82C 1GLLO 1PDNC 1I1SA 2EIFA 3QBXA 3CCVQ 5HLFA 1LE8B 3DRRA 2KIQA 4AG2C 3LH5A 3O1WA 2IPQX 3GP8A 3KVGA 3AVFA 2FBVA 4PL6A 2H8RA 1FOXA 4XU0A 3PX6A 3OYJA 2RD1A 1NK4A 4JNEA 1RT6A 2R7TA 1M1KU 2RVCA 1VQPT 3FBIB 4IOCL 1KC8U 3VEYA 3U6FA 1IGNA 4GVEA 4ILJA 2EH3A 1P8ZA 1TKTA 2YHXA 2QI2A 3PSIA 1S72I 5KAIC 2QTXA 5CYMA 1QVFM 1IO6A 5DLQE 1ATRA 2PYLA 5IT3A 2DXBA 3I0TA 3NRVA 2QF7A 4WQ4A 1RRSA 4Z4CA 2WAQN 3QERA 2LP0A 3LFKA 1BUPA 4M3RA 4FWSA 1IN6A 5ILVA 4N4GA 3EZ5A 1TWGJ 2FX0A 3K7AJ 3K4LA 1NYGA 2JJ9A 3EG1A 2LQNA 2A0FB 2VBYA 1K6OA 4M9ZA 1FPQA 1LE8A 1YFHA 4JD2A 3QESA 1VQ7Q 2BZ8A 4CF9A 1K79A 3PLAA 2O8KA 4FE7A 3HM8A 5I9EB 1EH8A 2OTJN 5LGNA 1FKOA 2ZPFB 2O9SA 5GPCA 1Q81R 2D6FA 3SAHA 3HFOA 4FJ5A 3NWSA 3GTOJ 4B1VA 3T8TA 2QG9B 2YT6A 3LFUA 2JM8A 2QQ9A 1UHSA 3GMEA 5DPKA 2YLCA 4IHSA 4HA8A 4Z94A 5JICA 4A3CJ 1S1VA 3FK7A 1D3BB 1TUYA 2DFUA 3KWGA 3S41A 3MN7A 1JXEA 3A4CA 5AQHA 4FJIA 1W4MA 4DIQA 4DOWA 5GAHP 3PMIA 1JEGA 5LFAA 2Y4YA 2HF4A 3KWIA 3D5LA 4A69C 2LCSA 8AT1B 5AONA 3E6BA 2SRCA 3NEUA 1JCEA 4BG8A 3FR0A 3CC2I 3TDUC 3FJPA 1HKCA 2X9DA 4RCBA 3I54A 4L9JA 3W6JB 1NJIU 2DW4A 2P51A 1A5VA 2HHWA 1FLIA 3F9KA 2HKQB 4P1WA 2XHIA 1QQJA 4EW0A 4PHTX 4LDXA 1Q1VA 1NKEA 4FWQA 5LJVA 5BN9A 2F7TA 4KGZB 1BGXT 1ZREA 3GIBA 3H0IA 3VRZA 2CUJA 2DI3A 1K9MR 4ZYGA 1NGJA 4FPBA 4F55A 4MZTA 2AKLA 4KAZA 1VQ6N 1YYVA 3JSOA 3AA5X 2PX9A 4GV3A 1YF5L 4H4KC 3RTRA 1Q82U 2KZVA 2HHSA 5HLTA 2KDZA 2ZF5O 5E84A 3UT1A 3FHNA 2ZXHA 5J2NA 3HSTB 3AFHA 3HPHA 2WACA 2VJJA 3FHFA 4HLYA 4JBAA 2KT0A 3JS6A 4C8QB 1RT2A 3Q9SA 3GBGA 2O31A 3ZX0A 3VU3C 3QEPA 1SSHA 4WXHA 2PMUA 2DA3A 4F4KA 2YG8A 2XAFA 3JCMc 1N8RO 3CC4I 1I3QJ 1N36K 1FKPA 1GLFO 3IHUA 4BR5A 3A0BC 2O8DA 2DT5A 2YUQA 2HMPA 4BGDA 2BUDA 1HQUA 2KDOA 1FBSA 3PVLA 2JPSA 2R93J 2LMDA 4EJYA 3A03A 1M90C 4X66K 5F1RA 3EUAA 5CO7A 2PQWA 2X6YA 4XAXB 3CC2N 2FSJA 2LBFA 5J39A 3MMVA 1H9GA 3T1AA 1VQ6T 4G6DA 3TEEA 5H1SQ 5TGTA 4FJGA 3TAMA 1NK3P 2DYSH 2NRVA 2FVUA 1TXQA 1LDDA 3CC4A 3HPWA 1ZHIA 3SHFA 2WTUA 3WNFA 3BG5A 3CDIA 2Q2RA 3M4OJ 3PQKA 5J2QA 4YIIA 1M1FA 1GLEG 1UJ8A 4Y3OA 2O8FA 2J5PA 3R8EA 1UG0A 1TC3C 1KGSA 1HBXG 1LWCA 3TW7A 4HV6A 1R9TJ 4UB8C 1Y0MA 3BEXA 1JKHA 1TKZA 3OW2S 2R7XA 3HO1A 3HUGA 5JLWA 4ISEA 3ASNH 3FRNA 3ZMSA 3DV8A 1T95A 1V4SA 1W2BS 2VJ4A 1FBQA 2KSSA 2M30A 3WXLA 5H20A 5E3LA 2OTJI 2GFUA 3H9NA 1W97L 3PX0A 2CZ7B 4VUBA 5HRPA 5FD6A 3OTOK 4E7IA 2LKPA 1ORKA 3FGUA 4AFUC 5GINA 1NLPC 2RF2A 1E3MA 2V9PA 4KN7X 4DSFA 3TEDA 3MFKA 4WF2A 1HJDA 4CEEA 3GLXA 4OIOF 2PTKA 4B23A 5HCKA 4CCLA 5A0LA 1SAXA 4FE4A 4FL9A 2K85A 3ABTA 2M3AA 4Z0UA 3K5LA 4OINF 2ZCWA 3G4SQ 3TP0A 3M4YA 2JPBA 3ISNC 2WA0A 4HRIA 1HQEA 3VS3A 4KITB 4PCQA 1FTZA 2QGFB 1RDWX 2Q31A 2Z9OA 3TR8A 4MGRA 1PHTA 1Y7XA 2D0PA 1W0TA 3VS5A 5HRSA 4A5BA 1U8RA 4LF5K 5EEAA 5I3UA 4HT9A 2HZYA 4ZTJA 5KNLA 3S3OA 3PVQA 4FM2A 3ATUA 1V5EA 5CYQA 1YW7A 5KRTA 5KVRA 3SQ2A 1IO2A 1YVNA 3KYCB 1IBLK 3E5XA 4CEAA 4EA5A 1M90U 1BYMA 3E9FA 3M8SA 3AVKA 3TKYA 3JSPA 4KH1B 2HNZA 2DZ9A 3HB9A 4HKEA 3RMAA 3PV8A 3QJYA 3I55T 4QSHA 4FZXC 2W82A 4RM3A 2YWWA 3CJCA 4FL6A 1T2KA 1RTHA 3F8FA 3K59A 1MNEA 1TAQA 4TVRA 5F1XA 3J7AP 1Y1WJ 3QO3A 4M77F 4AFSC 4HNUA 3A02A 3M0TA 4C2MJ 4RUGA 2KT8A 3O2PE 2VE9A 2JHNA 1Y56A 5BNGA 2H6BA 1VSJA 5J1YA 1W7PB 1OX8A 2VQHA 2YU3A 4BI3A 2P9KB 4NLCA 4C92A 2P9NB 4CD1A 5M5XJ 3J81K 4A4FA 5E1XA 1RT7A 2FJ1A 4XRMA 1M8MA 1X6GA 2XDVA 3ZT2A 2CG4A 4HCZA 5GANe 4AVPA 1SPKA 3U23A 1R0BG 3K5OA 3CETA 1UJYA 4XQFA 2AA4A 2CQQA 3K4NA 3LMMA 4B3RK 3BDPA 3D0SA 1SG5A 4CDGA 3LM9A 1UFMA 2V79A 3RIRA 3VQBA 3CPEA 2DTHA 3G6EQ 1VQOT 4EM1A 4NZGA 2ZPBB 2W84A 1N33K 4U0WA 4E1MA 1K73O 4BVPA 4FLTA 2JJ7A 4II1A 3GTLJ 1CXQA 1JKQC 3P8HA 4LE9A 3TSWA 1MBGA 5F08A 4CF2A 3FIFA 4UV8A 4KO0A 3ZQFA 3MCPA 4M78C 3K1MA 4JS4A 2VB6A 2DXIA 3I56Q 1J7KA 4GVMA 2XDBA 2K5IA 2HB5A 2JVHA 1HOMA 4BJ6C 5K5QA 3ZT0A 3VUBA 1QHAA 1QZYA 3E6CC 3SUOA 4CBUA 3RSNA 4E9FA 3I5RA 2FHDA 1IN8A 2J4RA 3CJBA 2FEIA 4OF1A 4EJVA 3A8HB 2KRCA 6PAXA 1N34K 2RI2A 2WBMA 2IOCA 3JTGA 1ETQA 3E9PA 3O3HA 2O9VA 3CCMA 2O8XA 4Y7NJ 3CD6I 1X1BA 1ARKA 1YITQ 4CF8A 2GWJA 2UXBK 2YHBA 3BG7A 1VQ6I 3CC4Q 1T33A 1SEUA 3BE3A 3VQQA 3CMAT 1SKUB 3I55A 2CKKA 4M7AC 4CIGA 3I35A 3B6PA 4I99C 1LAVA 3CBOA 4XKBA 1MV0B 4CZFA 2VBZA 1YI2T 3KTUA 4MDBA 3TSQA 2KJBA 2BHZA 1KXPA 2OPTA 3O9RA 3K4BA 1H92A 5IH2A 3N4QA 1ZR4A 1ZUKA 3E5QA 2OJED 1YJ9A 2QEXI 1QVFP 5L23A 2MPXC 2R7WA 2HPMA 3SNNA 1NTCA 4BRMA 2JZ2A 7AT1B 4Z89A 1BI3A 1UG1A 4KHPK 1S6PA 1ZQ1A 4H03B 3CCJN 2QGGA 3H3UA 2CP0A 2QSHX 2VQEK 4LIVA 2VJ5A 2IGMA 4JAXA 3OWTA 2NLUA 4B1RA 4H0YB 4MDXA 2VG5A 5CE3A 1VUBA 2C0OA 4FX4A 3H3VK 1X3MA 1UAXA 4JKFA 2UV1A 4BRFA 4XH1A 1Y8RB 3QDFA 3HOZJ 1KTQA 5ERIA 4LDVA 1OYWA 4CCOA 3DPTA 1U8BA 3H6EA 4M78D 2GBQA 3PE0A 1B92A 5LMNK 3J7AO 1MHNA 3SDGA 2M2EA 3AO4A 1MBJA 1FYKA 1IREB 3R60A 5AN4A 2M5WA 4BWMA 1WWXA 1VQOA 2Q0UA 4B09A 4G6QA 1Q95G 3M0PA 1XMAA 2K3YA 4WTOB 1K8AC 3W2VA 2VOPA 1S9HA 5FB2A 3QB0A 2K9NA 4MIMA 2PJPA 5HLIA 2X3XD 5DEQA 1BIAA 1W2BA 2WV1A 2R5AA 4KIBA 2V1XA 1CKAA 3RR6A 1T8IA 3CC2Q 4DR7K 4JEPA 3ZMTA 3V9WA 3CC7N 4O5VA 2F9WA 1RBTA 3ZSZA 2A6HF 3GPLA 1G3WA 4NBQA 2JUGA 5E1WA 3HKSA 3QODA 2XAQA 1XMQK 2MGQA 3K57A 4GKJK 3FZVA 4KRTA 1YI2I 1VQ7A 3PIPL 4KFBA 5EF6A 2A36A 1WHUA 1W0UA 4FISA 2XAUA 1WFWA 2PN6A 5EYRA 2XY5A 3K9TA 3THVA 4A53A 1BHLA 1MA9B 2QA4A 2DKGA 4DV5K 4M42A 1OKRA 1I6HJ 1IG8A 2B9SA 1KSPA 1ONVA 4E1NA 3TU5A 4KTWA 2YUSA 1VQ5Q 1U4BA 3D6RA 1SFUA 1YIOA 2B8AA 4H8KA 2E20A 2RI5A 4DQPA 1O9SA 2J6OA 1ZKGA 1LW0A 3JCMX 3LP1A 1N75A 3KNTA 2RB6A 2RQUA 3VS4A 5GMKm 3M59A 1VQNI 5IN1A 3WG7H 3IV5A 2DL4A 2X9HA 4JHDA 3BTCA 2HYJA 1NGIA 2W41A 2DK3A 2KYMA 4BY6B 4X9CA 1YOVB 4RGUA 1HYSA 4A2UA 3A0IX 2DMPA 3CCRI 2EX3A 3KZZA 3C94A 2O8EA 2QTVA 2DFFA 2DRMA 2ZPIB 1ZUUA 1ZH5A 1ZSZC 4RTFD 5D8LB 1VQPI 3GZ6A 1W6XA 1K1ZA 4M78A 2YJEA 4KT6A 3N0UA 2F5KA 1EWQA 1S3XA 3NHGA 4P5OA 3M57A 2GEMA 1V29B 4RB1A 2R7SA 2HBKA 4BXFA 2XY8A 4ZYDA 3CMAQ 3I8DA 1I6XA 2JTVA 2YHAA 4Q5VA 5FJ8J 1Y96B 1PVSA 2P9LB 4K25A 2E1ZA 4N0AC 4YDUA 2HQHA 4HF1A 3O4NA 1B9DA 3CMEI 5E3MA 3ZQHA 4BRCA 1N3CA 2EW3A 3PIOA 1B9MA 3GBTA 1VQ9T 5F0HA 4PJOD 1F5TA 4J5YA 4X6AJ 4M7AD 3K9KA 2LNBA 3DXKA 1SRLA 4BD3A 5C0MA 3FMSA 1XDUA 5HRRA 4JUVA 1NKCA 4EMSA 3NGIA 2ZNZA 2E5QA 5C4JJ 2FPDA 1RI0A 2EKOA 3BW1A 1RRJA 2LQWA 3H6ZA 4DKWA 2BVLA 3RTVA 4ASNA 1H88C 1KO9A 3LA2A 1X9JA 3G71N 4DSJA 3NQOA 3JRAA 5GAMh 2ZXIA 5E17F 3ZCOA 3WHBA 2ASOA 3RESA 1KG6A 1YN8A 3CQTA 4M63C 2FZGB 3GTGJ 4DS4A 3AGKA 3OYDA 2Z0WA 2D0BA 4CEZA 3KK2A 2GM4A 2EQUA 1WJCA 4PLIA 2QWPA 4RTUA 1LFPA 1HSQA 1H8KA 3EE9A 2W6LA 4GNIA 4BE0A 4KHSA 2EIKH 2PVOB 4W5QA 1IZ1A 4ILGB 5DCMA 2ZJRL 1NOYA 3IAS2 3Q7CA 3J7ZI 2ZJPL 4OMYA 2EFPA 4CZMA 2Q2EA 4FT2A 1QS4A 4HX8A 4F3QA 2MMPA 1SMTA 4F7UF 3U9ZA 2E8AA 3LX7A 4Z4IA 3EO3A 3FXOA 3M0UA 2D1VA 2L3QA 5GIOA 4FJKA 2K4JA 2QWWA 1U3OA 3OSGA 3VOEA 1LWVA 4HUEA 1BC8C 3CQZJ 2X4HA 4LK1F 4CJWA 3NCIA 3CMAA 4RB2C 1AEYA 1ETVA 5GAN7 3VESA 5CKBA 2NVTJ 2OA4A 3HSBA 1ZBHA 1KAYA 1MGQA 4BRGA 1S72N 3CQ8A 3SYZA 5TKYA 4J6XA 1E2XA 4M72A 2GNCA 2DT6A 5GAN4 5GAGP 3K5NA 2GZWA 4B8AB 4W5RA 2KQ2A 2IRFG 2J6FA 4UVAA 4GW6A 4KMUX 2L3SA 3DOLA 5E1ZB 2GCXA 5GAN8 2MF2A 1IJJA 4KIFA 2JVGA 3HHGA 4N56A 3E2UA 2D8HA 1Y0NA 3DRPA 4DSIA 3TREA 3ITHA 3J7YP 1AVZC 4BC5A 1XNIA 3S3NA 3MKDA 4CK2A 1JLAA 4DR3K 5IT9O 4EMHA 3U9GA 5E79C 3BR3A 5C0YA 1ZUYA 2ZMEC 4MO5A 3ID6A 4MLHA 1RR8C 3CEYA 3OHRA 2R4GA 3QHSA 2JN6A 2HHHK 4FYYB 2PFUA 2HKOA 1U04A 1M1KC 3G6EI 4J01A 5AQJA 2HBWA 1Y1VJ 5KYYA 1HKSA 1CQTA 5CQXA 2Q97A 1BJAA 4BU2A 2IBDA 2GXBA 5KE3A 4ELVA 1TV6A 4P9FA 1K9MU 3LZJA 1H641 3NFAA 2DILA 4A57A 2CU7A 1TH7A 1ZRDA 2Y0SA 3SZGA 1KQ8A 2BGCA 5HLHA 1YHQQ 3SBTA 2EZKA 4I6ZA 5KN8A 3AT1B 5HDGA 3OYAA 3PQJA 1W4SA 4QS7A 3KYLA 3TAGA 4JJNK 5CKEA 5D5WB 4DWIA 4K8XA 4C2TA 5FWCA 2KZGA 1BB9A 1B7TA 4F9OA 1X9WA 2IS4A 3OB9A 1W2BP 4CESA 3C4SA 5KQDA 4OPKA 1IKXA 2XRNA 1GL5A 1Z26A 2VYTA 3EUKL 5KYYB 1IV6A 4DFJA 2Q36A 3F73A 4LFUA 1OPLA 3OSFA 3REBB 2F2WA 3GXOA 2MIOA 2RQVA 3DOKA 3BR0A 3CJ7A 3VSLA 2UZKA 3VUZA 3RDIA 4KT0E 2HCKA 3EGXA 3ZT4A 4UVCA 4RW7A 3BWGA 1KU7A 1ERDA 3U4LA 1MBHA 2VBWA 2NVXJ 4L5IA 3BG9A 2K2VA 3SPYA 4M7DE 3CCQI 5FU7C 2CFXA 2C0TA 4Q0BA 3NGPA 4F92B 3I56T 3G4SI 2EFWA 1NPPA 1KLMA 1OU8A 2IP2A 2HHXA 2IPOB 1SD5A 4X1VA 1J9IA 4FJ7A 4ZN3A 1HKTA 3VDXA 2W40A 2CS7A 3HIFA 3P9CA 1BDGA 3LL7A 2MAMA 1UECA 2BE9B 1SRMA 5KK1A 1DGWY 4M78G 5C24A 4CZJA 3CFRA 4FYXB 3H3ZA 4JI7K 4M7DA 2RI3A 1GOAA 1QA6A 2M4KA 4DEYA 4IOAL 3NARA 1UG2A 5J4VA 2VPLA 4BHBA 2PAVA 1IRZA 1O75A 3PT9A 5M3MJ 5SWMA 1N5ZA 4C2UA 5FO5A 1X2NA 2VJIA 4CXFA 3VYSB 3PNWC 3FZHA 3FZKA 2HMAA 4L3QA 4XKVA 5T7BA 2H1KA 2FPEA 4IJNA 4CCHA 5DV5A 1QSLA 3IP4B 4IQJA 3SDZA 4WFNL 4FVUA 3WODF 1RAHB 1YIJN 4E9GA 2RHYA 4HNVA 3JRHA 2VWBA 4JQFA 1R58A 1SKWA 3M7GA 4AI5A 3H3OB 3KZIC 3A1YA 2O6GE 2OPRA 3HSRA 5HODA 2B4JA 2DFIA 1G3TA 1M4ZA 1GFCA 1IGUA 3MN2A 1LWWA 1QQIA 4BQQA 3I56N 3SDBA 4GRIA 3M58A 3CJ9A 5FLXO 3LSMA 2A42A 3RBBB 1ZSZB 4M7DB 4ENKA 4ZYEA 4N76A 2CP3A 3BDDA 3DWLA 3KLHA 2RJCA 3S1RJ 3F9MA 1SKSA 4AU7A 4C3HJ 1AKHA 3CD6Q 1YAGA 1Z67A 3OSVA 1BK2A 4BY9C 4C0ZA 4FK4A 2K5FA 3WEEA 4B22A 4PUOA 1V1CA 1GLNA 4CRIA 1LNWA 2NNNA 5FLXZ 1JUSA 4EZ9A 3VOVA 3O9SA 1XTDA 4F7UA 2VC0A 4GV6A 4U88A 3R61A 3LW5E 4OIQF 1NG2A 5GMKj 4IDKA 2X4YA 1NK7A 1R22A 5D5UB 2LCCA 4WK8F 3CLQA 3JYTA 4GDFA 4AF1A 2CV2A 3WE3A 4CUGA 1MBEA 2LTPA 3FMRA 4YEJA 3DU5A 2H3JA 3KIOA 2AXLA 1YO5C 1M8VA 3BG6A 3C2HA 1Q86O 3LAPA 4KMFA 2GF7A 2F8SA 3VTHA 1N6AA 3JR9A 4AI4A 2HNIA 2YPRA 4G9YA 1J5YA 1N8RR 5F27A 3VV0A 1WZOA 2F9TA 3A0HC 5I42A 1XQOA 4Z6YA 3OH9A 4CD3A 3G71Q 3VB2A 1TL8A 5GAEP 1D1BA 2V1RA 1VQ7N 1E6GA 4N5SA 1MMNA 3GBQA 4NDLA 2EJ9A 1ZC6A 1S3JA 1RTJA 3RCOA 2BGGA 3LLRA 1P9QC 4BRPA 2JRTA 1WGSA 3OY9A 1OCPA 1NM7A 2KVQG 4QAGA 4OKKA 2P5KA 2P6SA 2Z5UA 5FLVA 3E6DA 1D8KA 3CUQC 2XC7A 3TOBA 3SWNB 4E9EA 4HPQA 1EQYA 2E6NA 4FM4B 3QWLA 1SSFA 2E2QA 2F5CA 1M3AA 5C25A 4IEEA 1DLOA 1WYXA 2W48A 1TP4A 3QU6A 3CJ1A 5FD5A 3IDHA 1ZA2B 3CQXA 2RV8A 5J1EA 5FFZA 1RT1A 1TK8A 2XV4S 4ELZC 4R79A 1TZLA 4JRIA 2TRTA 4M7AE 2NUTA 2VCPA 5FKLA 3NPFA 3T8RA 5FRNA 4QWQA 5GAN5 4PZJA 1VRUA 1RI7A 3Q9VA 2YR2A 3AVMA 1RIOH 4ZHRA 3VS7A 2DM1A 4M75E 4H0XB 2MC3A 4HLXA 4EAHD 2F96A 3MXMA 2E35A 4B4CA 4DBQA 1HC8A 2KBTA 4QVCA 5CPRB 2GX9A 4JKCA 2JHJA 1YQAA 1FIPA 4LH5A 1C0FA 5GAOq 3NNQA 3VQEA 4EHTA 5FW9A 4YOUA 4IVNA 3S2HJ 3BUZB 4BQZA 3N5NX 3VRYA 2UUBK 4KJZA 2EQKA 3K0SA 2OCCH 5BR9A 1XG7A 1OLTA 3K70C 2ZB9A 4UV9A 1V4RA 4HEA2 2CSOA 4Q5WA 3CCVI 3UA6A 4AIAA 4M7AB 2RJFA 5AFUH 3CCET 1YNZA 3TP3A 4Y92A 2P9PB 1QWEA 4HQEA 5ECAA 3OL3A 2MLKA 3SXYA 4RM2A 5BR8K 4BQLA 3U3YA 3HRGA 4MO7A 4UUSA 4MTEA 3DLRA 1RI9A 4A5AA 2GWKA 5F2RA 5EGOA 1QVGA 3H5RA 3LSKA 3L7WA 4HCKA 1TU0B 4HVWA 4CE9A 4X0GA 4J9HA 3VQ5A 2E10A 3O4WA 4E9HA 3H8ZA 2Z1HA 3EETA 3GTQJ 3ER0A 1QHHD 1IHVA 3JCMf 4D6WA 1K9MO 1JJ2S 1S7OA 2X4WA 1FEXA 2EFQA 2L3DA 4PQUA 2YU9J 5KN9A 1J0RA 5FU6C 3FISA 5J4YA 1BQMA 3JAMO 4PY5A 4RAYA 1CF7B 4CHNA 2IGIA 3LAJA 4CHPA 1XSXA 3AO1A 3CCEN 3O80A 1WJBA 3M0RA 2E65A 2DA7A 4DHYA 3R0JA 1QVTA 3I0RA 2ASPA 5AQIA 2DETA 2F1LA 1BIBA 2RNAA 4ZDOA 1M2VB 1VSHA 1Z21A 3SAGA 1GLDG 4O0JA 4WX9A 2C6YA 2BXZA 2YLBA 4F3TA 4IRHA 3OVNA 3S1NJ 3AVBA 2CT4A 2F5DA 3BJAA 2D1KA 1JXOA 4L5GA 4CGFA 3BLYA 3EHQA 2RE2A 1WQWA 1IG7A 2RDPA 1IRGA 1K83J 1X1PA 2RK2A 2QXLA 4U0YA 2P4WA 1MUYA 2EYZA 1UZCA 3ERMA 5DDGA 4FJLA 3MD2A 2X1CA 1IHWA 3TPQA 1WCMJ 5LEKA 1KRPA 2M51A 1W5CC 3I71A 1C1AA 3AA4A 1PWTA 1M9SA 2IJLA 1R8OB 1AWCA 2E2JJ 4TSXA 2XHCA 3QSUA 5LJ3f 4C5GA 1VSLA 1S5LC 3EH2A 1FC3A 4BC4A 2LKXA 3DJCA 1RLPC 3TAEA 3TO6A 4F2RA 4BS9A 3VYGA 3ZQGA 1JXMA 3D45A 3GTJJ 1E6HA 2VV5A 2E4LA 4CEBA 1IAWA 3L1AA 1QZZA 3JXUA 2OFIA 2Y9ZA 1T6SA 2WTEA 3QEXA 2MI6A 1BG3A 5EX5A 1RNLA 2ZSIB 4IUPA 2I10A 1YI2A 4XSZF 3QIIA 2NRXA 3ZMUA 2JNGA 3WTTC 1DP3A 2QQRA 2JSCA 1GHCA 4MQ9F 4DFKA 5CKFA 4DBHA 1EBMA 3CD6N 3UF4A 3RSEA 2PY5A 1FWZA 1Q9YA 2RQQA 2L3PA 3THXB 1ASUA 4RTTA 2HNYA 3PIPF 2JLEA 4CJSA 3O8GA 4CJ4A 3HC7A 2IG0A 2OF7A 1YCYA 2A07F 4XLCA 3QG1A 4CIFA 4RCHA 4CZHA 3CCMT 2M45A 2EPDA 4KTQA 2OANA 1OYXA 4FHTA 1JXBA 5LJ3g 3VQ9A 1EA3A 1JLBA 1AWXA 4PJOA 3DCFA 4HVVA 1QCFA 3H0DA 5E8IA 2E64A 4E7KA 2WADA 3CCUT 1V5FA 3L3VA 1HCRA 5E18F 2DU9A 3X25B 4I7HA 3DP7A 5F1JA 3CJAA 2HOAA 5EY4A 4E47A 2VASA 3C6UA 3SWNC 3CUQB 4L5EA 3CJQB 3QMLA 2R5YA 2UUAK 1POGA 1KD1O 2QK0A 4A4HA 4DOVA 3A2FA 2EV0A 2UXNA 5C6SA 4XORA 5GAOm 4DMNA 2KMUA 4J9IA 2A6TA 3C18A 2LOOA 4ZC3A 3H41A 4UUVA 2OYQA 4ESBA 3WG9A 1Q9XA 4C8MA 2QDLA 3Q0WA 5K7FA 5JHUA 2LDMA 4L0YB 2Z2SB 1ABOA 1SFXA 4FYVB 1K8AU 3ZQCA 4XLPF 1X3NA 1BI0A 3JAMZ 4N47A 1IV8A 3PSFA 3ZYYX 1T98A 3FJ5A 2DD4A 3UIQA 1CLQA 4YELA 5KAFC 3P9KA 4JI6K 4KHYA 2OFKA 1K6YA 2DPPB 1QQMA 2QQBA 2CGLA 4O8UA 1PRLC 1UGQB 3ZLJA 3FM3A 3EN9A 4CZCA 5I2SA 3DEEA 1LJ9A 2VT3A 4PJLA 3LDPA 3L4QA 2O3FA 3E9OA 2XY7A 2XMFA 3ASOH 5HROA 1ZBIA 1SFEA 2LKSA 2RPNA 5GAOp 4E0DA 1M3CA 1J53A 2MLGA 3NF6A 3QYBA 5L3GA 5KHDA 4DYCA 2JK3A 4C8QC 2KL4A 3H45C 3ID8A 3LDSA 2Y9YA 1W9HA 2HVQA 4XSXF 3R6SA 2WAFA 3X28B 1SEMA 3TVTA 1XCVA 2MH2A 2K79A 2Z1IA 3H5AA 1R0AA 3E7LA 1X2KA 2KP6A 4OIRF 5ELZA 3V7RA 3K4CA 4M7DC 1LWFA 3WVEB 2FSKA 3PIOL 4A3GJ 5FPDA 1VQLI 3KK3A 4OB0B 3IUOA 2IGOA 4MFEA 2FF3B 4QKUA 4FWRA 4KKOA 1X2QA 2FQ4A 3RUXA 3PGGA 3VMFB 2G8IA 3TARA 2WY8Q 1ZG3A 3L2ZA 3CVTA 2QQAA 4M78F 1VFCA 1BC7C 4D0PA 2JT4A 4B9QA 2ROTA 2A37A 3O5ZA 3AVHA 1Z6RA 3OS0A 1IRFA 3MEAA 1OR7A 1JRIA 2K27A 2ZJPF 3W2WA 1V76A 2PG4A 4KUMA 1R0CB 2QYOA 5EG0A 1VQOQ 2L3RA 3V4IA 2G3RA 2B63J 1D9DA 3R6MA 1P90A 2EV6A 1SZ2A 3L2CA 3VF6A 1WQ7A 3MN6A 3LALA 3OYHA 1REVA 1S1WA 4BC3A 1NPRA 3F72A 1VQKT 3GZNB 4BJ5C 1NGCA 4CK1A 2V9VA 4JJCA 2L9SA 2ZGZA 4R5PA 1WPKA 2A40A 3QPHA 5KRSA 3PY8A 4ESJA 2KRMA 4DSEA 5AZJB 4O5BA 4ORZA 2DA9A 2XD0A 4IHWA 1K78B 3H08A 1FTTA 4OGEA 1IXRC 3ME9A 3QO9A 4HTUA 1F1ZA 3S9HA 2ZFWA 5A2QK 5FU7B 3LOCA 1HU0A 2LTOA 1HKBA 2ZJQL 2A68F 3EG9A 4XLNF 3U1KA 4WXDA 1M3BA 4M6YA 5JS2A 3HEFA 2QQSA 9ANTA 2QWNA 1YI2N 4EP4A 5AJ3K 2OD5A 1SAZA 4PK4A 5AIPA 1I94K 4RDUA 4IFYA 2YKNA 4DLGA 3H1CA 4V19S 1MKMA 3ZMZA 3QP6A 2EVRA 1KAXA 3BY5A 1KQSP 3HUGB 3KE2A 4Q4ZF 2R0QC 3DLMA 3KUFA 1GV2A 4D7MA 4UY8I 2G8VA 4RAFA 4A5MA 1RADB 4BRQA 4ATOA 4IURA 2A41A 1FJGK 3VQ8A 2EKHA 1GDTA 2VVKA 2KFDA 3S1QJ 3WGIA 4G94A 2HHTA 1Y8QB 1IB8A 2GTOA 5J3LA 3CJNA 1ZTRA 4EPCA 3A5LC 4GCVA 4AQYK 1MZBA 3X24B 4M7DF 1VAZA 1WQ2A 4P5NA 1ZBXA 5CVIA 3EG9B 2OTLI 3I59B 1OZ3A 2F4IA 1BKBA 4LUEA 1ACMB 5EG2A 4EJOA 2R7VA 3FZFA 3ULRB 2F5VA 3ZN1A 5CIUA 3K2AA 1WKMA 1XNQK 3CPWP 4J2DA 1T6CA 1KQSM 2UXXA 3SUNA 5C44J 5KYNA 2EAYA 2E19A 3OGDA 3J7ZO 1EETA 5K1YA 2RNGA 3M8RA 4DTJA 3QNNA 2IDOA 2Q0OA 2L7FP 1MV3A 2HFHA 3PFYA 2W03A 5CCAA 3GFLA 1Q86R 4ZGEB 2DMTA 3SQ4A 5GJWB 1YITT 1XQHA 2ZM6K 4F7ZA 3M4GA 2DA5A 1N27A 1YJNQ 5HK0A 2W04A 2YHWA 2DFHA 3DLGA 1PD1A 2Q1ZB 5CHZA 5DCFA 2PMZN 5LL6Z 1BM9A 1K9AA 5AQMA 2KYBA 3DM2A 1W36D 1DDNA 4XICA 3CI5A 5C2FA 2DIGA 4MFDA 3V9UA 3DKWA 3QZ9B 1YJWT 1ZG1A 2K3BA 2JQ7A 4FWLA 1KG1A 5A2QE 5AFUA 4DTSA 1P4AA 1L3UA 1W7AA 3EL2A 2I8DA 5CR4A 4LB6B 1XSDA 4BQAA 5LD2C 3HBTA 4RGRA 2R7RA 2X51A 3QEIA 3L0QA 1NGHA 2BE7D 1YS6A 4J8FA 3UKRB 1VQ8Q 4NB4A 3CDHA 3BR6A 3C95A 4F16A 4RG2A 2JWLA 3PFIA 3CVSA 1QKWA 4I2OA 2HU9A 1JTYA 1W7PA 1XDSA 4BUPA 2EQJA 5AQPA 3SV4A 1PYVA 4LLLA 2CUZA 1GVJA 4ELYC 4M77B 5D6YA 1IDZA 5BPDA 2BV6A 5KI6A 1EKEA 4RGSA 1JKPC 4RBOA 2DDAA 3EFOB 4FLXA 4NL3A 2DA2A 3BZKA 4O4GA 2K86A 3TI0A 1W2BM 4NQWA 1WEFA 3VYHB 4IOAF 4FLYA 1XHZA 4CEDA 1MW7A 1TS9A 3BQZA 3W3DA 1R6RA 2OUMA 4DQRA 4DGWB 1BR2A 3TBIA 2FNAA 3M1FA 1KCFA 2MC4A 1B4AA 2HSTA 1QZEA 2E1CA 3AL0C 2KEAA 5AQWA 2D1XA 3MCAB 3CPFA 1I5LA 3UKRA 3ZFJA 2Z1JA 1J3TA 2YSQA 2EA4A 2PZSA 1OFCX 6AT1B 1MWKA 1U5TB 4OMLA 1AWJA 2NRRA 5I2MA 2E1HA 2D5RA 4XBFA 4FW2A 5GADJ 2K9MA 1IKVA 4WQ5C 3LM2A 5LL6S 2M1HA 1VQLQ 3AG1H 4A4EA 4M77A 1OR7C 4RTYA 3VQAA 3CF5L 3H3NO 3I0XA 3QDRB 5LY3A 4JKDA 1QGPA 3WTZA 3EFOA 3FBNB 3EFRA 2FYKA 2CH6A 2BXYA 1N32K 3JRBA 4FTHA 5JHFA 3QPSA 4LOCA 3VKIA 1B8IA 2X74A 3E5UA 5L3CA 1IDYA 2G7HA 3HKZA 4KBOA 2E1YA 4CFBA 1PC0A 1VQ9N 1A04A 3KEYA 3LSIA 1OCTC 2DQRA 1JLCA 1ATSA 1Y64A 4OX9K 3CC7I 1WX6A 3RMCA 1LDKB 3TSZA 4JRPA 4OLAA 1D5VA 1GV5A 3VYTB 1JLGA 1YQRA 2UXDK 3JCMQ 8ATCB 4H0VB 4UB6C 3V9XA 2Y48A 2OTLN 2FXAA 3MXJA 2BUPA 5GAOl 4CO8A 2OA8A 3ZMDA 4A2AA 1XPXA 3PUBA 1R00A 5KPZA 2ELKA 4BBRJ 2EFIA 3P4IA 5ILSA 4C0DC 5IHKA 1JGSA 3VGLA 1TWBA 3CCRN 4LF6K 3R9PA 3T5XA 3U1DA 2NUZA 1U45A 4O44A 1WHGA 4OPJA 1E17A 3AVAA 2UUCK 2LH9A 4FLWA 5AQSA 5ILUA 3HVTA 5LJ5j 3I0WA 4FVMA 3CCJA 2Y69H 1Z0XA 1T7PA 3CCST 3B6CA 4U67L 4CGZA 1PSEA 2LBFB 5IT9Z 4IUQA 1NG7A 3MO8A 2NNYA 4A54A 2LF7A 3HRUA 1GLBG 4FQGA 4J9BA 3I4NJ 3CZ6A 1TTHB 1YJNN 1JUPA 1NGAA 3P31A 2J06A 3OMCA 3MMYB 3AAPA 4A6EA 4HSBA 2VGNA 2P5VA 5CQEA 4BY6C 1RUWA 5M1NA 3KCCA 2DDBA 2VKDA 4KTZA 2P4RA 4Y17A 4WFBL 1AWWA 5AT1B 1Q82R 4GFBA 1H3HA 2FBXA 4H4OA 1TK0A 3CFPA 1TOVA 4NC7A 4M9XA 3CCQQ 5H6QA 4G6TB 2Z16A 2XG8D 3LSPA 5LJ5h 3MZ8A 4A0ZA 1IH7A 5JVTA 1WJRA 4NHJA 4KB1A 4NXMK 3HTUA 1NK2P 1DQUA 4OIPF 3TAFA 4HSRA 2FUG2 4XOTA 3BG3A 4V2SA 2BY0A 2DLPA 5JS1A 4LFBK 1T8EA 4ZH4F 4RLQA 1HNVA 1HD3A 2O61A 2ZSHB 3ZXSA 3HYFA 1JO8A 4C92G 3SQ1A 1S7EA 4JI5K 4DTPA 3RPUA 2XKOC 1OCOH 2JUCA 4J19A 3GOIA 2JA8J 1DP7P 3QDKA 2OAUA 3AV9A 2DEQA 4AM3A 2AQEA 3G71T 3H9QA 2RJEA 2E5NA 1XJWB 4ISGA 4CJ5A 3C7JA 3LPUA 4LFCK 1C0WA 1R59O 3F10A 3O9QA 5GADP 2ELHA 4HWIA 1K7AA 4NNJA 2AIRB 4DTUA 4AHSA 3CCMQ 1ZBJA 2FMYA 4J9FA 4H0TB 2BY1A 2DL3A 4JK7A 1EX4A 4J7FA 3VQ4A 2CQXA 2JW4A 4D7NA 1TVRA 4LLNA 2UU9K 1D5AA 2A5WA 1V5GA 2L5QA 2WB1N 2KQWA 4CF1A 5CZ1A 1G3SA 3HSCA 1SKRA 5BS6A 3ZPLA 2V75A 1HNXK 5L8RE 3HGYA 2Y31A 4YDUC 1NMDA 2LT4A 4M75G 4BH9A 2XPVA 3LSTA 2L4AA 3MP1A 2UYTA 3SBGA 4G7ZF 1E3HA 2E2NA 1NJIC 2DPNA 1OPCA 3WHCA 3VQCA 3L3UA 1O4XA 1T3SA 5HDNA 1JBMA 3IH3A 3G6EA 1PU6A 2R7OA 1YS7A 3UWNA 4AIHA 2XHKA 1YWPA 2FRHA 4CJ3A 2IVPA 4G7HF 4DFPA 1EFNA 4QS9A 1SL2A 3UKGA 2X0LA 1TT5B 2CP5A 4XEIA 4B8XA 4DFMA 2DJIA 2ECBA 4Z4GA 4XLFA 2BDPA 2XGXA 1KC8R 2X6OA 1AZGB 2J7IA 1BO5O 2HSPA 1R7JA 5IPAA 2ATQA 1SVOA 5EZHA 3F8MA 3MEWA 4B9VA 5GANj 2QEXQ 5HY6A 3FDYA 4C92F 3I3LA 2CP2A 3CJTB 3ALYA 3V9ZA 2X1DA 3SEZA 1TK5A 1GLCG 1YW8A 5KQ8A 3FK6A 3IHOA 3N5BB 5CJ9A 4AUXA 2BYVE 1O57A 2XGCA 3UE5A 5IOZA 1ITGA 4LJZF 1HW2A 2NVQJ 4KT5C 4FJHA 3SQNA 1W1FA 2XUBA 3HDDA 4FWPA 2IGNA 1FT9A 4N9IA 4ZZDA 1FYLA 4FJJA 5LMUK 5M3FJ 1WHKA 2KKZA 3QZ5B 2EZHA 4PJJA 4MEXF 2JOYA 3M8QA 3IUCA 1BL3A 5D6WA 2QW9A 3L6QA 1X43A 4XK8E 3HVRA 2EYXA 1RBUA 1HJRA 3WU0A 1G8XA 1UFFA 2E6MA 4PJOG 1P4XA 4DQIA 2E60A 2M7BA 5ICCA 3GYHX 3F8BA 4WQ5A 1LV5A 3SJMA 3U2RA 4IHVA 1IBMK 1VYUA 2X6SA 2EQIA 2DTZA 1TKDA 5EJCA 2R7QA 3VF4A 1WFXA 1S1TA 2Q2EB 2L7MP 3DLEA 3CJRB 3MN5A 4ANJA 5CYVA 3G4SA 4HHTA 1C6VA 3HM5A 2XI9A 5FGMA 5HS8A 5AQLA 4ON0A 3GFIA 3QETA 4L8RB 3VETA 2K7LA 3NWTA 4NYFA 5BRFA 3TANA 4AD9A 2R7FA 5DYMA 4DS5A 1R49A 1NHAA 3CCLI 5CR2A 3BT9A 4XM3A 4CC2A 2FSWA 2D45A 2LVMA 1GXQA 1B3QA 3DFGA 3RQIA 2V51B 2NVUB 3D5RC 3K4KA 3HP6A 5M9OA 2LRQA 4CC3A 2FBKA 1K4US 4BHPA 1WSEA 2HQAA 3PX4A 2CUBA 1KU2A 2R92J 2BZXA 4LG3A 4XH5A 3D7SB 4EIAA 3OYGA 3ECOA 2RKHA 2XDDA 3K2PA 2P7CB 1KJWA 2OZMA 3MXIA 4LMYA 5K7ZA 4KBMB 4Z4EA 1KFSA 2DA4A 3HZJA 5BMZA 3DKMA 5D6EA 2JS0A 2EHGA 2DTUA 4NS5A 4FLUA 2PFBA 4JP0A 3K4JA 2W57A 1QHGA 1D0ZA 1BQNA 3IH2A 3TMOA 4KH6A 3FX3A 3MECA 3FSPA 2D0QB 2OX7A 2DCEA 2KE9A 4C0DB 5DY9A 2QKMB 2PBIA 1F36A 1Z3YA 4ENJA 4FO0A 2X85A 5LRSA 2LF8A 1OH5A 4CFDA 2M8EA 1N39A 3CCVA 3CF5F 4DR5K 2HVRA 2HDWA 2ZPHB 1H9TA 2O4XA 1QTMA 2ETHA 1UELB 1SHGA 2FZCB 3VEZA 4BJTA 2RA2A 1P92A 1I5OB 2CH4A 4GY2B 2RM4A 3RI4A 4HCBA 2NAZA 4CZEA 4NCAA 2H8HA 3H0GJ 4OMPA 1VQ6Q 1WNSA 3V1OA 4KH5A 2VXZA 3R3LA 3ENHA 3CG7A 2VWJA 1ITYA 4C9YA 2LREA 4HTLA 2FMLA 4I7FA 5D7UA 1XSVA 3MKYB 4IF4A 2WB1A 3MEVA 2DZCA 1OH7A 1WB9A 4DW6A 4C8KA 1IKWA 3N05A 1NKUA 4JLGA 1YTUA 4MQVA 4B47A 1LNXA 3ZSOA 1QO0D 3CW7A 2RQTA 3LANA 4DA4A 3LQRA 5E3OA 2VUBA 1TL1A 4JX6A 1X9MA 3I9QA 3EGDA 5TKWA 2JMAA 1MJBA 3IWFA 2CREA 1YJ9Q 1L3SA 2E2PA 4DSLA 2VG6A 3KLIA 1U5TC 4E4HA 5BQTA 1QU3A 3GFJA 2COMA 5JI6A 2ESNA 2K02A 4FU6A 4Y1CA 1QVGS 4Y4RA 1PG5B 1G6NA 2GWRA 5E8GA 3TWHA 3HK2A 1VQ8A 1SUQA 4BY1J 2IW5A 2K9QA 1VQMT 3EGXB 5C42A 5J47A 4C0GA 4B6MA 4JI4K 2DYBA 3P8DA 2VXFA 4PNOA 2NVYJ 3JW4A 1IF1A 4JHDB 4CJLA 1F9NA 4OKJA 3X2QH 1VA7A 3HTSB 4JDSA 3M54A 3CLOA 3U8XA 4C0FA 4M77C 4PFPA 1KG5A 2VIXA 3BPVA 4FLVA 3FXJA 1M3HA 3H0HA 4M74A 4QT7A 1AWOA 3HKZN 2KW4A 5GANf 2EBIA 3RKYA 2CQKA 1I81A 4M78E 4ABZA 4C8OA 2YX7A 5LGTA 1I27A 1OEBA 1VSFA 3JCMJ 2JA5J 2OTJQ 5AQXA 1MMSA 1IG9A 1TL3A 4CHOA 5C2DA 1TT0A 3I55Q 1I1GA 4PGHA 2OBPA 1OYIA 1LEBA 3CCLA 4BRLA 3V8LA 1I07A 4KPYA 2I5WA 1RZ4A 3UPUA 1ACIA 1KYWA 3BTLA 1XCBA 5ED4A 1AT1B 4Y28E 5AYFA 4ZYAA 5FLXE 3DXKB 4C8NA 2V1DA 2OTLA 4IEIA 5AQNA 2GQQA 3ZGKA 3JCMe 4AHRA 3I58A 3SYTA 1D3YA 5IY5H 2M7AA 3RERA 3DKYA 3MVPA 4C30A 2F4VK 3COAC 1IKYA 1HLUA 2ATCB 2KT1A 1KFDA 2GA2A 1XC3A 3ULQB 1Z9ZA 1QNTA 3F23A 3E9GA 2Q1NA 5K7HA 4E7HA 2IA0A 1FP2A 3EKSA 2L0KA 4LD6A 2HMIA 5L3EA 2CZ6B 2EIJH 1WIEA 1IC8A 1RT3A 1NZ9A 5CHIA 3QYGB 3FZMA 1KC8C 2JMWA 4ZZLA 3W0LA 4DF8A 3D2FA 4QOZB 4DG1A 3TU4K 2JM9A 1VQ4N 3QU3A 1DU6A 1S1XA 4MTDA 2UWMA 1YHQA 4M3UA 2RF0A 2PUOB 4ILHA 4UOBA 4A3BJ 1LB2A 3RPUD 4CIEA 2UXCK 1YJWI 1HPZA 3QWYA 4E7SA 2IS3A 2QBYB 4YG2F 4JI0K 1USTA 1T0JA 4YOVA 5FROA 2NYSA 2W0ZA 2AK5A 1FK9A 3CC7A 3HL2A 4GY5A 4QPQA 3S93A 3A01A 2OTJA 1MWMA 1FMWA 4M3XA 2CV0A 1LVKA 3PNVA 4MFBA 3EUHC 3K2ZA 3F21A 2B7EA 4FM1A 4PJMA 1VI0A 2AJQA 5AQYA 4C23A 4K11A 3PNYA 1M30A 2BZYA 1CSKA 4E70A 4E2FB 3D2FB 3WU1B 1UWBA 3ZQQA 2O9LA 1GRIA 2RREA 1PJRA 4CEOA 1HMVA 2OPSA 3MAQA 2QWMA 1WAJA 3CCRA 4ZNXA 3KETA 2W42A 2QBYA 3O3GA 4CJRA 3DAWA 2V6EA 4JI1K 1VQ8I 2K7AA 3CO6C 3A01B 3MQ0A 1M27C 3ELKA 2K4BA 1JT0A 1FZPB 4IRGA 1DKGD 4LSNA 1KVBA 3TGNA 3VEXA 1FYNA 3HG9A 2KNBB 3N4MA 2HQ5A 1NMNA 2O8BB 1NK0A 2JS2A 1X4OA 1OQKA 4C8QD 1R1UA 4CK3A 3G1LA 5ADXH 1S9EA 1HSJA 2YHYA 3RMDA 1O13A 2NUTB 3GWZA 4HZFA 1FBUA 5CK9A 5GAGJ 2GOMA 3F0CA 4A6DA 4DF4A 1LOTB 2ZPEB 1YWOA 3UB5A 3CXCM 2FPFA 4QVDA 3WNHA 4JKHA 1HYZA 1OI1A 4IUVA 2AO9A 5FKMA 3WTUC 2PJRB 2G9WA 3JB9J 1FXXA 2EA2A 3RRGA 3A8MB 2VPRA 3ZSRA 3CWAA 3MP6A 3CCEA 1NJWA 2IAIA 5FWBA 1OJLA 2BY2A 4LB5A 1X6BA 4MO4A 3QINA 3META 4OO1J 2K9LA 2YDLA 5D3GA 5L3BA 2DMQA 3ECHA 2DK8A 2A1RA 1T6DA 1V3FA 3CTAA 4M75C 4NO7A 2X48A 5JMVA 1K73R 3FC3A 5GMKe 2E41A 2P5LC 1IBKK 3HYIA 4CSWA 2NOLA 3NH0A 1SV5A 3S14J 3C0BA 3SAFA 4FSXA 3WXMB 2P9PA 5D5XB 1M1KR 2JPCA 4EM2A 3O8MA 3A5ZB 2ED0A 3CCSI 1QVFA 4GV9A 1I8FA 2HYFA 4OJRA 3QEWA 1S29A 4XLAA 3LH0A 1GT0C 1K0SA 3OMGA 1X3WB 2EYYA 1YI2Q 1QZ6A 2I7PA 1IXCA 3MHXA 1FX7A 5AQGA 4RW4A 1MMAA 4IXAA 3PTAA 4HVJA 3GW2A 3GL1A 3TQ7P 1JTXA 3LAKA 1XC9A 1IUYA 1XWLA 3I0SA 4WYBA 4QTRA 1PNJA 3ZQIA 3CBMA 4LD0A 4Z2YA 2LMJA 2WSCE 3D0PA 5LJ5g 1EWRA 4XR6A 1ODDA 2RHZA 4HXJA 1A35A 3FKIJ 5KYUB 4HOBA 1YCSB 5E20A 1X69A 5J1UA 2QWLA 4JRKA 5C3EJ 1UGVA 2ZPGB 4CJPA 4HUFA 2O88A 4KH4A 4RTZA 3ZN0A 1KD1C 4PKGA 3WNEA 3QBWA 3DLLL 3JRDA 2HHUA 3OMYA 3IKTA 2ZGWA 3RVCA 4XTVA 3OR2C 2E34A 5KYWB 4RTXA 5J26A 1T03A 2DL8A 2NYXA 1Q7YU 3AY9A 3BQYA 4JK1X 3RPQA 1KFZA 1EF4A 2P0PA 2H56A 4L0ZB 2HW3A 2GLOA 4IKFA 4C92B 3TAPA 3F22A 5KH6A 4WXCA 5F0XA 3CHWA 4R8HA 4PJOC 1RAGB 1TQIA 2LLKA 1WSJA 3P38A 3T1BA 3C12A 4BR9A 2VQGA 2ETJA 4OMFB 3SMSA 2DOAA 4FT4A 5KYUA 1N6QA 3PUFA 4B3AA 2CUDA 3QPTA 4Y0WA 2ZWHA 3EQLF 1BIUA 5LJ3j 1KQ2A 1O7FA 2CWEA 4JK9A 2JZYA 1LPLA 2ISZA 4MHGA 3V7CA 4D1QA 1BU1A 1NGBA 3OYCA 2IEKA 1RFQA 3KLGA 3NHNA 5DUIA 2K9SA 3W2AA 5GAMe 4XRFA 2KXCA 1VQKN 4EFHA 3G73A 1UJ0A 1ESVA 3SCXA 1W5SA 4Y1DA 2VBXA 2O7OA 4DZJA 2JA7J 4Y13A 2DL7A 4EEFG 2DEUA 1PM3A 2NRZA 1AHDP 2RK1A 5CVUA 2F69A 3QFUA 3WUHA 1X58A 4HBLA 3G0QA 1QWFA 2B5JA 3NAEA 1VSMA 5L3FA 2YJFA 4LD5A 1WLJA 2QQ8A 2LJ3A 3TABA 2RQRA 3UDCA 5M1OA 3NMZC 3OIOA 3TO7A 2L0AA 3TTCA 3TDZC 2IC3A 4M3TA 2HBPA 2Y2ZA 5K5OA 4MDAA 3ZSVA 4LC9B 2X1EA 2X6XA 1NWKA 2EGEA 2PVDB 3JRZA 4M3WA 5LJ5e 1V4TA 4J7IA 5J8FA 4FZZA 5CKHA 3S2DJ 2GGRA 4LY7A 4L9TA 2OU2A 2O8CA 1MDMB 2DTRA 4NYNA 5F6FA 3M9QA 1VYTA 1VIEA 3HGGA 3A5OC 5TJJA 2LY1A 2PQ8A 3ASMA 1OULA 5M1PA 2JRMA 3FXUA 5KCMA 3QOPA 4B24A 1ZBSA 3UKUA 4J83A 1SS6A 4S04A 1VF9A 4PJOB 3LSGA 2DYRH 1B6AA 3P5JA 1GCQC 4C92C 2HNDA 2WSEE 3TSPA 1X1AA 2NOIA 4KI4A 4XTXA 1K73U 5EDNA 1SMYF 1QMCA 1U2VA 2XHBA 1N5YA 4KRFA 4G12A 4J9EA 1LW2A 1U9OA 5B66C 1YJWA 4XTWA 4DK9A 2GQVA 3LSHA 1A5JA 1PU7A 5GAMd 4IEJA 3A8YA 1ZHFA 4MNUA 2WC2A 3WT0A 3I5UA 2QUFA 2R5YB 1JU5C 1F1BB 1EO1A 1Q18A 5GJVB 2A1SA 1TWAJ 3L2RA 4KHWA 1O7LA 1VQ6A 1ETXA 2O8CB 3SZ2A 3HOXJ 2DY4A 2DAQA 4PL8A 3NTIA 2XAGA 3CCLQ 2CSQA 1VQ9Q 4AHUA 3KLOA 5HK3A 3SJHA 3KEOA 4AMCA 4E6KG 2NOGA 3PIPA 1VQ5N 1WXUA 3ZEUA 4H0OA 1MJ9A 2YUNA 3ZMVA 2KJCA 4A93J 1WHJA 3WXJA 5IOYA 5AQRA 4M75D 2YX6A 5M5WJ 1YIJQ 1BOAA 1GOCA 1YITI 4CI0C 3JB9I 3GCMA 3EG2A 3NDKA 1UGPB 3CM6A 2EGAA 2JN0A 3LPTA 1N25A 2BTTA 1E4FT 1JKOC 4K43A 2KGTA 4C1NI 2VGMA 1VQPN 2XO7A 5M1FA 3G71A 3BDLA 2HQXA 3E9LA 2YNGA 1OH8A 3MEDA 2NOEA 2A28A 4BEHA 1A6IA 1RLQC 1BW5A 3QWXX 1NK9A 4XIUA 4P9UA 1TW3A 3M0SA 4M75B 3ZQ7A 4LG0A 3ABUA 3L42A 4OMMA 2GUIA 2H09A 3OYIA 2FXUA 1TUGB 1L5UA 3KFWX 2QXFA 4M7AA 2ED1A 1E3OC 3DBLB 1S8NA 1TUDA 2OQRA 2NUPA 1YRNA 4Z02A 1SAUA 1Z3XA 4EA4A 4DV0K 1Z05A 3SB2A 4F3OA 3I56A 3DLBA 4A2BA 1ZG5A 2OTJT 4UUSB 1G5VA 1M90R 1B72B 2R3SA 1QQCA 3ABLH 2COYA 3FLGA 1ASVA 4IXCA 1VQKI 1VQ8N 1OCCH 1XN7A 1KVCA 3VA3A 4CZKA 4BEHB 5HL7L 1VIFA 4XTYA 4IQ4A 2EYQA 1NU0A 2FBTA 3P9IA 3EZWA 4YY3K 2CW8A 2CUEA 2MG4A 3OQ5A 5D5VB 1OU9A 1Y97A 3JRGA 3MP8A 3MX5A 3CMAN 1OVYA 4K41A 3LA3A 5CY4A 1MUNA 3SK3A 1YRNB 4K0KK 3PMTA 4M73A 3A5MC 1JLFA 2O8EB 1ETOA 2NOFA 4S0HB 3SZTA 1STZA 2LC4A 1QZ5A 4ISFA 1RBRA 4IZZA 2GIZA 4CI6A 3BDUA 1SD4A 1YITN 1UMQA 4A63B 5KCHA 3PO5A 5AZJA 1JJ8C 1A6QA 4PA1A 3HXMA 5FKOA 4DV2K 4OAYA 3S8PA 5GMKl 1K4SA 1J5EK 5ICFA 1ZR2A 2GUPA 4BDZA 2XAJA 4I02A 1APLC 2EWSA 3CCJT 2VC8A 2YKMA 2O03A 3OW2P 5F0CA 3GO5A 4RG8A 3CMET 4AM6A 2HSEB 4V19K 1VQ8T 4U0VA 4BE1A 3KFVA 4KH0B 1VZ0A 4B3SK 5J40A 4C8LA 1QVGM 3K1NA 2KHMA 1G59A 4D9JA 1BI1A 1KG3A 1ATNA 3M8FA 3JRFA 2HS5A 3BR5A 2VLAA 2PMZA 2YSRA 5IHIA 2K5LA 3A98A 4RCCA 3KK7A 2ZJQF 1WAFA 4L9NA 5KTQA 3AKZA 3HFNA 4E89A 4AG1C 1OH6A 4Q47A 3AARA 3P8BB 3JCMb 1NJIR 4PKHA 3CCJI 5FFXA 2QYZA 4WE1A 4UVBA 3WNGA 1F43A 3CCRT 1ZXOA 1RL2A 4LK0F 1U3EM 3J81E 4DEXA 5AQZA 3LZIA 2DT7B 3VEVA 3DTEA 2CQNA 4CCKA 1VQNT 4J6YA 2O4GA 4OMQA 5KPRA 5JLXA 4HX4A 3FFKB 4DQ8A 3CC7T 2RJDA 3CMEN 5DD8A 1WSIA 1BW6A 1D4XA 4DBFA 3CWSA 4J2EA 5GAN2 3LDNA 2A61A 4AYBA 5LJ3h 2QK9A 3G6EN 4A12A 4PFOA 2FE3A 3TQNA 1HKQA 1WJDA 4J9GA 2Z1DA 2BBYA 5CVRA 3H1VX 2NOJB 3RSEB 3SUQA 3KK1A 4NC8A 4JD2B 2NNWA 2PUKB 1KK7A 1TTYA 4IIMA 2P4TA 4KGVB 2AHJB 1VQPQ 4OPAA 1WJAA 1Y71A 4RGXA 3OS5A 1KZHA 3HOYJ 3RR7A 4IZ9A 2BW3A 5A2QO 2W1OA 1WJFA 1IV0A 4ZGDB 1KQSS 1C0GA 3HJFA 4JI2K 3THYA 3CMAI 2NRHA 2R7YA 2ZD1A 5DM6L 3D7EO 4YOQA 2XROA 4IL6C 4M3GA 3G4ST 4BI8B 2KIFA 1VQNN 1ZGWA 2HQNA 4JKGA 2FBHA 2QA4Q 3DWLE 2V6CA 2W7NA 1DPRA 1G2HA 4F17A 1WSUA 2K5CA 1NJZA 4BE2A 3C65A 3J80O 2XSJC 2CGHA 3CO7C 4KB0A 1HRHA 1HX1A 2RKIA 4G8XA 1SD6A 5DTDA 4B48A 4F7UE 1FNNA 2HZTA 1WXBA 1GVDA 4NCGA 3LP0A 3V7SA 2VQFK 2DA6A 1M1KO 1R77A 5CKTA 4A3JJ 2FU4A 4LH4A 3T19A 4PJNA 3T1YK 5HKCA 3KHYA 2XIGA 2B6AA 4XU2A 3THYB 2VE8A 1Z9CA 5AZIA 1RTIA 3GZ5A 4DV3K 1ZAOA 1R5GA 2RN7A 1XUPO 3MWPA 3F5TA 4EVIA 1LCUA 2E1NA 2KZZA 2D0OA 3ISPA 3F3XA 4DV7K 3CDLA 4CZLA 4FK2A 1J9AA 4M77G 4CA0A 4J00A 3WGHA 3G4SN 2G6FX 2WFBA 3QIOA 2GELA 4BRIA 2HWVA 4CHQA 2XSDC 3VF2A 1NG6A 1AA7A 2WAEA 1M3QA 2H3GX 5IYCJ 1KEAA 1BA5A 1X1CA 4BXXJ 2A6EF 4C3JJ 5BPIA 2A5YB 2QEXT 3ULDA 3MEGA 3TOAA 1BCOA 5I11A 1WPYA 2G8WA 3KKSA 4K2EA 4NC6A 3M0QA 4KIGA 4MEYF 1RRQA 1HK9A 3KXTA 2ACJA 4RS8A 4CHYA 2GAUA 2IIRA 2DA1A 2ENMA 1USSA 3DB4A 4ID1A 1W36C 3M8PA 2PBDA 3MKWB 3DKXA 4B43A 3HRSA 1QPIA 2LY9A 2KR3A 2J05A 2PMHA 3OJUA 1DUXC 4B9LA 4H5VA 3I56I 3EYZA 1WNLA 3OIQA 2VI6A 3A8LB 2PYJA 3K4MA 4MLOA 1H1VA 2RH2A 1RR7A 3ZX3A 5D6FA 5LBQA 3W6VA 1YQMA 5C4XJ 2AT1B 2LT1A 2EPFA 4JX5A 4GGGA 2LSOA 2KLAA 5BRDA 5D4SA 3FM5A 5HP1A 3OS2A 4BREA 2JVVA 1ETKA 4LIUA 2B86A 4ELUA 1HW1A 2LP5A 4CH7A 3AGRA 4B1ZA 2QEXN 1ZBFA 3FDRA 4O3MA 5GAHJ 2CT3A 3V8KA 1ORNA 3V4GA 4J9DA 4BKXA 3CIPA 1RAAB 5LHIA 2HKXA 3IC7A 3KZBA 1S6LA 5LJ5d 3DBRB 4OMNA 2DBKA 2COZA 2QZ8A 4YFXF 3REAB 5BOXA 5LHHA 1Q82O 5SZTA 2HYGD 3G3ZA 2OAZA 4JI3K 3UA7A 4M45A 2EIMH 4N4IA 1UEBA 1XD7A 3O3KA 1Z77A 3V9SA 1MGTA 4I98B 2GQIA 1NJYA 1WI7A 4FYWB 2CFOA 2E6LA 4EVVA 4C5HA 2XIDA 1UHWA 3HP9A 4M3YA 1OV3A 5AQQA 2P9SA 2Z3YA 4BRAA 4XTUA 1WJSA 3SUPA 5GANh 2O0YA 4E19A 1MPGA 2G8HA 3FKJA 5FPMA 3DTIA 2RHIA 2MBFA 1D0XA 2DIQA 2WBNA 1FMVA 4II3A 1KIKA 4CGJA 2CMPA 1NEGA 1J6ZA 3KLNA 2LX7A 4OAZA 1CZBA 1X19A 3GX4X 1OKJA 1WOQA 2V7ZA 4OOIA 3WTYC 3VQ6A 5ICEA 4PJOE 4KFCA 1S1UA 4EMKC 4JX4A 3RR8A 4CHUA 2KQRA 1FSEA 1AHJB 2NOZA 2X3WD 3K10A 2I5UA 2D0CA 1YHQT 4W97A 2E70A 4YPRA 2Y0MA 1NGFA 1VRTA 1NE8A 3J7YJ 3LQQA 2BVMA 3IH4A 2E88A 3H5NA 1OX9A 2P9SB 1AKHB 1QW1A 2XKPA 2ZXJA 4QVZA 4FASD 1N3AA 1B34B 3A8GB 4LF4K 5D6XA 3AAQA 4YTLA 1QVGP 1PCXA 4ID5A 4HT8A 4I9LA 2VN2A 1TLHB 4ZDLA 3MEEA 4M3BA 3LDLA 5LGUA 4LF9K 2RQWA 1W70A 3VSKA 2K4YA 4BR4A 3OYKA 2FOKA 2NXNB 4N4NB 3RMSA 2MK5A 3ZX2A 3K70D 4BWJA 1RAEB 1VQKQ 2JSPA 1X01A 2QASA 4OMZA 1W5TA 4KGXB 3VJPA 2HVHA 2VL8A 2HQEA 4C92E 2O5RA 2JA6J 2GXAA 2CZ1B 1FSHA 2ZJRF 1QQOA 2HOSA 4GYGA 1I39A 2GTDA 2KFZA 1R5ID 4M9SA 5K14A 3VEWA 4N0AA 3O5BA 4BL0B 3IRRA 1WH5A 2BE5F 4ESFA 2WSFE 4DYRA 4BR7A 4CECA 4AT1B 4LSLA 1D1CA 4JRQA 1M1GA 3C7NB 2V7FA 4JZ4A 4H5NA 5JR3A 3JAME 1KLNA 1FY7A 4BACA 2LCLA 5FLXK 4CJTA 3HBLA 2XVCA 3G0ZA 1RABB 4XTZA 5J6XA 5JVGF 2AP1A 3OA9A 2CZ0B 2CGKA 1R1VA 3M6GA 4X64K 2CH5A 2R7ZJ 4OB2B 1I4K1 2QDYB 5CQYA 1HF0A 4OU0A 3WTXC 4RW9A 1TAUA 1X27A 3H92A 3WVDB 4ITVA 1K73C 2FRWA 5JFRA 1H8AC 1M1EB 3RYRA 1VQMN 3BTJA 3HOSA 2HBMA 4NQWB 2X6WA 1LPQA 5EOYA 4N9HA 1TQMA 2EZLA 2P9IB 3V6DA 3AVGA 3R6OA 2CGPA 2OTLQ 4CFAA 3VS0A 3CESA 3AA2A 4KICA 2IS1A 2L2OA 3BY6A 4CJKA 4EM0B 2X4JA 1DIZA 2LYCA 1K61A 2RAEA 2KKOA 3M3YJ 4I9QA 3DLLA 3JSCA 1K76A 1UOCA 2N8GA 3AHUA 2P9UB 1HUXA 3DEUA 4FIBA 2L89A 4BXUA 1IUFA 1YLFA 2E1MC 3C0CA 4XN0A 3G1MA 5JVHL 5AQTA 4EJUA 3CPWS 5K5RA 4LDWA 3VENA 1V55H 4CYCB 2D5VA 1M2OA 4NB5A 2FF4A 1I50J 1FYMA 2A6AA 2WWYA 3FZLA 2M1BA 1WVRA 3HJEA 3WTWC 1N78A 3CC7Q 1BI4B 5DM6F 4BGBA 5A0DA 3IFRA 3HHTB 1HW5A 1S22A 2E1MB 3S3MA 3D2EB 2YCHA 3GFMA 4LF8K 3EG3A 4XLEA 3VTIA 4G7OF 3I4MJ 4HAMA 3RMQA 4HQMA 3MPUB 4KYWA 3GVAA 1GBRA 1LAWA 2NUBA 3M8EA 1PRMC 2P9UA 1G99A 1AZEA 2FBYA 1WRJA 3OV8A 1RUNA 3OYFA 3L4IA 2KAFA 3LWMA 2O01E 3CPWA 2PEXA 1ETYA 2MD5A 3EDPA 3GLLA 3MN9A 2K6DA 3NE6A 1BI4A 1F21A 3NBPA 4BRHA 1N77A 3JCMh 4M7DD 4FWKA 5I22A 3D2EA 5H6RA 1RETA 5BRHA 3TW6A 1QVPA 3IQLA 3JRCA 2C0IA 4CF0A 2R57A 4EJTA 4IO9L 2Y30A 1JUMA 1CF7A 1IN7A 3EKUA 1VQ4T 2PU9B 2DE0X 2ZBKA 3QKJA 5ADXA 3EYYA 1WHHA 3QJ6A 2KRFA 1WSGA 1NJIO 2HF3A 3ZRGA 3BOQA 4ZTFA 1NBEB 1TG0A 4AHTA 4LDYA 4MDWA 4KN4X 4ZGJB 1KQJA 4DV1K 4NXNK 1KSWA 4PL7A 2M0CA 1YBYA 3H9JA 1YT3A 1ZQ3P 4PSWA 1QP2A 4BHCA 5EXWA 2WY7Q 1Q86U 4DU4A 1YQKA 1GXIE 1T44A 2F5EA 1Z6TA 3DBHB 4OVLA 4MMLA 1R5HA 1FMKA 1RDBA 2KY9A 3R4KA 3S16J 3CCVN 2JTMA 4KUDK 2XY6A 5CAIA 1HKGA 1HSTA 2QVOA 2JGUA 2YXYA 4WWCA 2KZMA 4CJFA 1YQLA 4M7XA 3ULEB 4XK4A 3BP8A 2L02A 3AG2H 2HEQA 2ZAEA 1SFKA 4IX7A 1IRXA 4M7AF 1C0MA 2PI0A 1X3UA 1U78A 2H3EB 4DU3A 1W1WE 1KHIA 4H5TA 1S72T 1E4GT 5IT9K 3LWIA 4FWNA 1LWYA 2JXBA 3CCSQ 2CS3A 1A31A 1FP1D 4TV7A 1REPC 3I33A 3C6AA 4YIFA 4KUIA 4DR2K 4JS5A 1VSIA 2RMOA 3CCLN 1UHCA 1CKBA 3EHRA 3CCMI 1VQNQ 4CGGA 4IBNA 2LSNA 3RWUA 1QSSA 2FA5A 4DV6K 4R55A 2KIUA 1WJQA 4ZN1A 2EQMA 4I76A 4Z4HA 2NZTA 3BJ6A 5AQOA 4M78B 2KRSA 2DK5A 3PO2J 3ZBDA