4E7HA

Pfv intasome prior to 3'-processing, apo form (ui-apo)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7hA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7hA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7hA03
4FXDA 2YHAA 4O4GA 2VG5A 4BWMA 1B9DA 1YVUA 3V1QA 4FW2A 3T1AA 3OS2A 3VQBA 3L8BA 4FZYA 3M8QA 2YNFA 4CHZA 3SI6A 3PMTA 4DQIA 1BI4A 2WOMA 2DY4A 4KREA 4DS4A 4Z4GA 4LSLA 3L2VA 3AVHA 2LSNA 4CJ4A 2XY7A 1NJXA 4F2SA 3UWNA 1JXBA 2E6NA 3RR7A 4N41A 4EP5A 2HHTA 5M9OA 3SJJA 1S1TA 2YNGA 3C4SA 1BQMA 2VG7A 1KSPA 3PY8A 3META 2KTQA 1KVAA 2PQWA 2RO0A 1VSJA 3C6UA 3CM5A 1NK5A 3K5LA 2OZSA 5C24A 5CZ1A 4DLEA 3LDSA 2G8HA 4F2RA 1HNVA 4JLHA 4OKKA 3V81A 1QSLA 4KI6A 3PV8A 3ME9A 4NYFA 3S9HA 3ISNC 3V1RA 3QEPA 4IUUA 4W5NA 1W9HA 1RT2A 3NGIA 3MEEA 4W5OA 1KFDA 1XI1A 1EKEA 4KHSA 2E4LA 1WN7A 3S3OA 2HQEA 4IFVA 4AHRA 2Y1IA 4B8CA 3NTKA 2E6LA 4CEFA 3AA4A 3SV4A 3QEWA 1XC9A 1WSFA 3KIOA 1JLGA 3HT3A 4ELUA 2D0BA 1TKXA 3OYCA 3L42A 4AHSA 5KGXA 4KI4A 2P51A 2HB5A 3MXMA 2L8DA 1UOCA 3FLGA 2XO7A 3HM9A 1NK4A 2B6AA 1KTQA 3OYGA 1NK8A 2W42A 3KUFA 2FBVA 3LALA 3KJVA 4HHTA 4B9NA 3KD5E 2R58A 3P8HA 3QKJA 1JXEA 1OZ2A 2OPPA 1XHZA 1U45A 1LV5A 4CF8A 4FLTA 1SUQA 1JKHA 1QE1A 1S1XA 4FLWA 4C8MA 2WONA 4J2EA 4H4MA 2KZZA 1REVA 4FJ9A 1S9GA 2JZ2A 4N5SA 3OYFA 2AJQA 2FBTA 2RI2A 1G15A 3CYMA 3AVFA 3PMIA 3LZJA 1SKRA 1LW0A 2RJFA 1JLEA 3AA3A 3OYMA 3LANA 3WNEA 3VA3A 1ZBUA 4I9LA 2FBXA 3G10A 4I7FA 3ZSQA 4DTMA 1HYZA 3PNWC 3K2PA 3HSTB 3T3FA 3NH1A 3VQDA 1BI4B 1J9AA 2JTFA 3QEIA 1C1AA 4FLZA 1IKXA 1BIZA 3OYKA 4DU1A 4ZHRA 2QKBA 3L3UA 1TVRA 5KRTA 3AA5X 3TWHA 3TI0A 2QXFA 1ZBFA 2OZMA 3KK2A 2QQSA 4GY5A 3O3GA 4G1QA 1NJWA 5KGWA 4CHNA 4E19A 3HK2A 4BE2A 3M8PA 2ATQA 3IRXA 3NH0A 2R7YA 1S1UA 3ZEHA 4M3WA 4WE1A 4H8KA 1KLMA 2XY5A 3SUNA 2L89A 4C8OA 3TAEA 4QCLA 3WNFA 2RHYA 4EZ9A 3RWUA 4A4HA 3MEWA 3DB3A 3F9KA 3WNHA 3MAQA 1TK8A 2BGGA 4OLAA 1FXXA 2HHWA 1EETA 2HW3A 4B9TA 5D6XA 3DOLA 3G0ZA 5EU7A 4CEBA 1HQUA 4CHOA 4CIFA 2E5QA 3DLHA 4B9VA 4AHCA 4GVMA 5DK5A 3LGFA 4EP4A 1RDBA 2G8IA 2RI5A 3PX4A 3O4QA 5C0MA 4IG0A 3PX6A 1J5OA 4HCCA 3RTVA 2K3YA 4CEZA 1X9WA 2HNYA 3SQ4A 1RI0A 3LP0A 3LP1A 4MFBA 3KKRA 3TARA 1KHCA 3V1OA 1ZYQA 1HMVA 4CGGA 2VYTA 3FEOA 4CGJA 1JLBA 3C95A 1B92A 4C8NA 4CJTA 4E1MA 4W5RA 4DF8A 4CIEA 2X6SA 4DTNA 1NKEA 2Z1IA 3ZCMA 1FKOA 3CG7A 3M9QA 4BDPA 2O4XA 4ZTJA 3FFIA 1H3ZA 3DI6A 1VSDA 4FJ5A 3MP6A 3P1GA 3IAYA 5HRPA 4M41A 5FDLA 5C6SA 2LCCA 3QIPA 4IKFA 3AVMA 5FRNA 1KVCA 3HP9A 3DRSA 4CFBA 4CGHA 1WJRA 3DMJA 4CFDA 3CQ8A 1YT3A 4DTPA 3OYNA 1RDAA 2EHGA 4CK1A 4KTQA 3H6ZA 4KHNA 3QERA 4NCAA 2KFNA 3ZSWA 3AVNA 2GUIA 3CM6A 4CFAA 3LLRA 4YFUA 4PL6A 1OYXA 4CERA 3MECA 3K57A 4KHYA 2X4YA 2B8AA 2FBYA 1K6YA 4HUFA 4CJRA 3RMDA 4C5EA 2B4JA 4BWJA 3V9WA 3E9FA 4KFBA 3TANA 4ELVA 3VQPA 4RW8A 2PYJA 3NF6A 2JGUA 4KTWA 3MO8A 2LDMA 1KVBA 3TAQA 3H08A 1TKZA 4PUOA 2I5JA 1EP4A 1WSEA 1KRPA 1O1WA 4CJUA 4FLVA 4PQUA 3LAMA 2L3RA 1GOAA 3DLBA 4DTOA 3SYZA 4E3SA 5HBMA 3PX0A 4FCYA 2VG6A 3LWMA 3E9GA 3U3YA 2KQ2A 1FK9A 1OZ3A 4PY5A 5FROA 1CXUA 4DQSA 1U4BA 4DTRA 2DIQA 3VQ7A 4ICLA 1NOYA 4CJFA 1ZBIA 2D5RA 4KKOA 2QKKA 4C8KA 4CJ3A 3LYIA 4CHYA 2Y1JA 3SPYA 4M3ZA 2M16A 1XHXA 1BIUA 3ZSYA 4DTJA 3OYJA 2HNDA 3AVLA 1UAXA 3QIOA 3KLHA 1VRTA 3RRHA 3MEDA 2X6NA 4LD6A 3VQ5A 2RHIA 1HJRA 4OGCA 1NK6A 3ITHA 4Z4IA 1ASWA 2F8TA 1J54A 3Q1JA 3T19A 3DLMA 1S1WA 2IC3A 4JRPA 3AV9A 1NOZA 1SKSA 3HPHA 2PZSA 1XNIA 3L2WA 1RTDA 1YTAA 2O4XB 3ZT4A 3O8VA 3DLEA 4IDKA 3I0SA 2LTOA 2ITGA 1TKDA 4DSJA 4FJXA 3TAMA 3O4NA 4F3OA 1TL1A 2RJCA 1RT5A 2YV0X 3EYZA 1X1PA 2O4GA 3ZT3A 4XIUA 2BDPA 4DSIA 1VSKA 1S6QA 1LW2A 1RTIA 1RT6A 2XRIA 5CYMA 4OKJA 4ID1A 4DU3A 1VSMA 1MU2A 3BDLA 4ID5A 3D0PA 1T8EA 4RW7A 3QETA 1Q8IA 2DTUA 1S5JA 4CJKA 4FM0A 1Y97A 2OPRA 3ZT0A 4HCZA 1D9FA 1RDDA 4QVZA 2M0OA 4LH5A 4C5IA 4FJJA 1HYVA 3QBYA 3KTQA 3NF8A 4I2PA 3NNQA 1TKTA 1JL2A 2X74A 4Q0BA 4X34A 1C0UA 4KPYA 3K5NA 1NJYA 4FU6A 1IO2A 1LAVA 4CGDA 2R5MA 4A4EA 2YRVA 3RMAA 2P0KA 2WACA 1XWLA 3HVRA 3VA0A 2G8FA 2BUDA 4KB0A 1TL3A 4CK2A 4E0DA 5D6WA 1RBUA 5E41A 3QNNA 4HVJA 4EDUA 1RNHA 2RN2A 5HRNA 1U47A 1A5XA 1F21A 2D0AA 1L5UA 3K5MA 3K58A 4DMNA 1X9MA 3SQ2A 5DMRA 3KD1E 3C6TA 4E7IA 1TV6A 4DSFA 3HJFA 3RRGA 5I3UA 3D45A 1OI1A 1T05A 3OYEA 1I39A 3S3NA 3ZT1A 3OYDA 1JLFA 1Z25A 2Z1JA 3HYFA 1CXQA 1EX4A 5KI6A 3VQEA 4DFJA 1CLQA 3ZSRA 4E1NA 3DB4A 1NKBA 1NK9A 3OYHA 3VQ6A 5HRRA 1RTJA 1MHNA 3F73A 3MEVA 1BL3A 1UA1A 4KB1A 4KHUA 3OVNA 2X78A 1U48A 1J53A 4KHWA 4CEEA 1KCFA 1WSGA 4CEQA 1L3UA 5K14A 3SV3A 4DTXA 3S3MA 4J2DA 3HVTA 1C6VA 4MQ3A 2XDPA 1HNIA 3CFOA 1RT7A 4M45A 4CJEA 2VWKA 4CE9A 4CHQA 5JS1A 2DFEA 2ZE2A 4FJMA 1TAUA 4E7HA 4DFMA 5IN1A 2BE2A 3NCIA 4BE1A 4M3UA 1ZBHA 3HO1A 3NGYA 1FKPA 4B3OA 4B8AB 4YNQA 1WLJA 2RF2A 5D6YA 4A4GA 4W5TA 4HUEA 4F8RA 4FJ8A 2EQMA 5T7BA 4AHUA 4FLXA 5IAYA 1UWBA 1CZ9A 3P8DA 3PO5A 2IGIA 3MXJA 2RI3A 1DLOA 3ASMA 4KAZA 3S6WA 4N76A 3EZ5A 1UA0A 4UC4A 3SUPA 1RT4A 2YNHA 3MP8A 3SZ2A 3THVA 4HUGA 2FC0A 3AVGA 4K8XA 3NTHA 3NGZA 3WNGA 3OS1A 4DG1A 1GOCA 3RMCA 2GF7A 1IH7A 2E6MA 4FJNA 2O4IA 2DIGA 4DFKA 1RTHA 3OS0A 1CZBA 4N4IA 3V9SA 2BKDN 2HVIA 4M42A 4E7KA 3ULDA 2ZQBA 1TAQA 2BANA 3NDKA 4J2AA 1QS4A 3U3GA 4CEDA 3O3HA 2RHZA 3ASKA 3AO5A 3B6PA 4FW1A 3M8SA 4BE0A 4FL6A 4IFYA 3KLEA 5KCOA 2HHSA 4Z4FA 3LP3A 4M3TA 4DFPA 3AO4A 1R0AA 3IG1A 4M3XA 1RBSA 1BCMA 4CEAA 4EZ6A 2QQRA 2NLUA 3C94A 5CIUA 1VSEA 5FRMA 1VSHA 3QIIA 3A2FA 1VK0A 5KE3A 3UT1A 4CECA 3OMCA 3IS9A 3PO4A 2EQKA 2HNZA 2JLEA 4KV8A 3JYTA 1IG9A 3L2RA 4CRIA 4DSLA 1BHLA 4N56A 3OB9A 2IG0A 4DQQA 1N5YA 4Q5VA 1SL2A 3K59A 3NTIA 3ALYA 2HHXA 3OJUA 4N4GA 1S9EA 5KTQA 4DF4A 2NUBA 2F96A 1JLQA 2X35A 1VRUA 1B9FA 4QQDA 3P5JA 4NCGA 4OJRA 4PA1A 1KLNA 4LD0A 1C1CA 4FK2A 3TABA 4LY7A 5J26A 4OLBA 1W0HA 4H4OA 3L3VA 2HQXA 4B9XA 3QESA 4B9UA 2G8UA 4CIGA 2OPSA 1KFSA 1T7PA 1NKCA 4N4HA 4N47A 4Y1CA 1T03A 4QW2A 4Q5WA 3DM2A 2EQUA 3KLGA 3LP2A 3CFRA 1ITGA 4AHTA 4Z4HA 4FJLA 4LSNA 3QEVA 1BQNA 3TAGA 1L3VA 3P83D 1ASVA 4RW6A 4CJLA 4E89A 5JS2A 3MEGA 4O44A 3L2UA 3ZT2A 3ZSVA 4CEOA 4FM1A 1SL0A 3AVJA 3UIQA 3OY9A 2EX3A 2LVMA 1RCHA 2OYQA 4IBNA 2PY5A 4FJGA 1YTUA 4TSXA 3HP6A 3QEXA 4CGFA 1WAFA 1HRHA 3DOKA 2P1JA 1WGSA 3HPOA 3AVIA 2EQJA 4KRFA 3FDRA 3KLFA 2A1RA 1HYSA 4DWIA 4B9WA 3H8ZA 3NAEA 1WJSA 3PFSA 4ELTA 4KTZA 1DTQA 1GOBA 5CY4A 2GV9A 2RKIA 2XHBA 4E7LA 4PLIA 4JS4A 4OGEA 4IUTA 5KCHA 1RT3A 2KZMA 3GOXA 4R5PA 2BIVA 3U6FA 3OYAA 4DSKA 3QJ6A 1IKWA 1ZBLA 2HHVA 1S6PA 1Z26A 4OVLA 1NJZA 1WSJA 4FJHA 3E01A 4OPKA 1RBTA 4UQGA 3BGRA 4O0IA 4L8RB 2FHDA 2RJDA 2RHUA 4CJSA 4CK3A 5J1EA 2YKNA 3VQ4A 4CJWA 2ZD1A 4GW6A 4QQ6A 2GFUA 3NH2A 4L59A 1A5VA 2G8WA 3MXIA 4DQPA 4KHQA 4IG3A 1LWFA 1TK0A 4B9SA 2R57A 4BDZA 4FJ7A 3VQAA 4HTUA 3LZIA 4O55A 5I42A 5KE2A 4FK0A 3F70A 3OJSA 3ZSOA 2M1HA 2IDOA 4FM2A 2RJEA 2X4XA 3SPZA 4M3YA 4CF0A 3SCXA 1BCOA 4CHPA 3RMBA 4AHVA 3LX7A 3SD4A 4FZZA 1SSFA 4PWDA 3NFAA 4HCBA 5D3GA 4II1A 1RILA 2IOCA 1SKWA 2R5AA 3OMGA 1JL1A 1LAWA 1U04A 3ZSZA 2G8VA 1SV5A 2XY8A 2F5KA 1WSHA 5J2PA 4O0JA 4CJVA 3K5OA 4FVMA 4DS5A 4CJQA 2XY6A 3KK3A 3V9XA 2OA8A 4ZTFA 1VSFA 3I0RA 3V9ZA 4B9MA 2KW4A 3AVCA 3PUFA 3LPTA 4FLUA 2YHBA 2HHQA 4CF1A 3M8RA 4Z4EA 1BISA 1WSIA 4NZGA 1D5AA 1ASUA 1D8YA 2HMIA 4OVAA 1RT1A 4JS5A 4A4FA 4CGIA 1TK5A 4E7JA 3DYAA 3TAFA 3V4IA 2YKMA 4LH4A 2RHXA 4F3TA 5C42A 2IS3A 1NK7A 1C0MA 3AO1A 4B08A 4IUQA 1BGXT 3AO2A 4CFCA 5HLFA 2P5OA 1QQCA 1D9DA 4IURA 1VSLA 4FYDA 1LWCA 3MEUA 3EY1A 3HPGA 2DFHA 4NYNA 3OA6A 3LH0A 5HRSA 3NE6A 3AVKA 4CESA 3QLHA 2LRQA 5CYQA 1L3SA 1N6QA 3NHGA 2HVHA 5KH6A 4Z0UA 3VQCA 4BACA 1RDCA 3LWLA 1A5WA 3NF7A 4CF2A 1HQEA 2X4WA 3AA2A 4C8LA 4DTSA 2EKOA 4B9LA 3LPUA 3AVBA 1TGOA 3MP1A 1I3AA 1HPZA 4QQGA 1WNSA 5J2QA 4DSEA 4M3RA 3SUQA 3DLRA 1Q9XA 1U49A 4FK4A 3B6OA 3LAKA 2HHUA 2GFAA 5SZTA 4QOZB 1S1VA 2G8KA 2D0CA 3VN5A 4C5HA 1QTMA 1VSIA 1X9SA 2K3XA 1SL1A 2IAJA 3V9UA 2D9TA 1DTTA 3FC3A 1RBRA 1Q9YA 3HL8A 1QHTA 4I9QA 1QSSA 4BDYA 2A1SA 3KKSA 4IUVA 1RBVA 4RG8A 1C1BA 3SUOA 5HP1A 3EAEA 2GBZA 4NS5A 2KFZA 5J2NA 2RPIA 4Z4CA 3QINA 3TAPA 2Z1GA 3O3FA 3KK1A 3QNOA 4CJ5A 3V6DA 4DU4A 1C0TA 3NBPA 2YNIA 3TR8A 3SQ1A 2PYLA 1IKVA 3BDPA 4Y1DA 4CCHA 3AVAA 4I2QA 5KRSA 3RR8A 4KO0A 2QK9A 4AILC 2P5GA 1LWEA 2ETJA 4PLLA 4FLYA 1JLAA 2Q3SA 3OYBA 4IUPA 4W5QA 4DLGA 4FJKA 4NCBA 3OYIA 3SNNA 3VQ8A 5J39A 4QAGA 2VWJA 4DTUA 3JSMA 4C5GA 2XK0A 1WJQA 4O5BA 4AH9A 4F4KA 3SQ0A 4K8ZA 3CFPA 2Z1HA 4Z02A 2B5JA 3MEAA 3OYLA 3L2QA 2OPQA 2EFIA 3KLIA 3VQ9A 3ZSXA 5J2MA 1QSYA 4RW4A 3DLGA 1NK0A 2CKKA 4J2BA 4GMJB 3VQQA 1G5VA 3AO3A 5C25A 4JRQA 3QO9A 3OQ5A 4BD3A 3DRPA 3I8DA 5SWMA 4FJIA 3HXMA 2G3RA 3LGLA 4CJPA 4FZXC 2DFFA 1EXQA 4DQRA 4RG2A 2F8SA 4RW9A 5HROA 1N27A 3NF9A 5CZ2A 2DAQA 1WAJA 2MWOA 4CF9A 4OKEA 2MWPA 4OPJA 3DRRA 3DLKA 1JLCA 1L3TA 3CEYA 1IKYA
chains in the Genus database with same CATH superfamily
4O4GA 1E0EA 1B9DA 3L8BA 1HOMA 3M8QA 3K70D 3CC7T 3M4GA 3NRVA 3RR7A 1U9OA 2K6DA 5AIQA 4ESRA 3JCMJ 4F2RA 3EUKL 4CJ7A 1VQ5A 1S1NA 5L3DA 1XNRK 2EFPA 4B24A 3IWFA 2E6LA 2BVLA 4RTUA 1KU7A 3OYCA 3GFIA 3CCQA 1JUPA 2ZKZA 2L8DA 1YOVB 3EFRA 3JCMb 3ABLH 3FJPA 2B6AA 1SFEA 2QF7A 4HYEA 4XU3A 3P39A 1N8RC 4J9BA 3SWNB 3CMAN 1HLUA 1WHGA 2OTJN 4ITVA 5ICCA 2KISA 2O8DB 1LW0A 4C9YA 1UAAA 2BGCA 2K7AA 3HFNA 3HSTB 1OJLA 3GWZA 4Y92A 1HSJA 1ZBXA 1Q7YC 2WBNA 2FD5A 1CGPA 3CUQA 2C0OA 2R7YA 2W85A 2XY5A 1RDUA 3RWUA 1U8BA 4RDUA 5B1AH 1BBYA 3N4QA 3PX4A 3PX6A 1J5OA 4HCCA 2E7WA 5GAMj 3LP0A 3TSWA 4KFCA 5AQWA 1R8OB 2IBDA 1VQ8I 1NKEA 3E9PA 3LW5E 4CIEA 1DU6A 2Z1IA 3FFIA 1X9JA 2J5OA 1LB2A 3IAYA 5ILVA 4XIDA 3K9TA 2LSOA 3CQ8A 4M75C 5AQGA 3LFUA 3E66A 3DCFA 2YHYA 1H641 2QWRA 4KHNA 3ZSWA 3CM6A 2HYGD 4UHTA 1MJBA 2UXBK 4JJDA 1B8IA 2O9LA 4ILGB 5LD2C 4KFBA 3MO8A 3KZYA 2I5JA 2VBWA 1EP4A 4DTOA 2KEAA 1WOQA 2FPFA 5CKEA 3BTJA 3WVEB 3QWLA 2KXDA 1XSVA 2E2JJ 5A0DA 4KGVB 1FN7A 4WTOB 4IVNA 3DLMA 1PVEA 3P4IA 3R6NA 3LDQA 1RTDA 4L18B 2BXYA 2VKHA 5FU6B 3GXOA 3B8AX 3VS5A 2UUBK 2E60A 2YG8A 1X3NA 1SS6A 1JE8A 2NRTA 1NJIC 1T8EA 3A01A 2JS0A 4RW7A 1WEFA 2DM1A 1M1KC 1Y97A 1RKTA 5JI6A 4ZN1A 1WPKA 2DLPA 4F52A 3KPHA 2JUFA 1XWLA 1QZYA 1M90C 5LGTA 3FZVA 1AWCA 2FNPA 2YU3A 4XR6A 3K58A 1JI8A 3CJQB 1OI1A 3QRFF 3M0RA 2RQVA 4M7DA 2XHIA 3CCMN 5KI6A 2HL5C 4F17A 3TREA 4BR2A 3T1YK 1GFCA 1QQJA 2OAZA 1LKXA 4YIFA 3G7ZA 4LXCA 1X4OA 2HTJA 1J09A 1FJLA 4PSXA 4JKHA 1W0UA 2OFKA 1X1AA 1G4DA 4CD3A 1TAQA 1QS4A 3BZ6A 4FW1A 3AO5A 4P96A 2DODA 4HVUA 2P9IA 4PIIA 2AK5A 3JRGA 4FWSA 2WSFE 1P4WA 4K25A 1YO5C 3OMCA 3IS9A 3VYRB 1N5YA 2L02A 1NGHA 3O1WA 4CI0C 1BK2A 3QYGB 2X35A 2D6FA 4F7UG 3QICA 1WHLA 2E20A 4Y1CA 1T6SA 2OQRA 1I07A 1ITGA 4AHTA 5BPIA 2MH9A 3IWZA 3C18A 4FM1A 5JS2A 3VYTB 2JSCA 3UIQA 3K0LA 3BT9A 4J8OA 2KLOA 1YJ9A 3LA3A 5KVRA 1JKRC 3FDRA 1LFUP 4B9WA 1NWKA 3RNJA 4IX7A 3SJMA 4KIFA 5KCHA 4CC2A 1JHHA 1IKWA 4XAXB 2B7EA 1M2VA 2LY2A 1VYVA 2X0LA 5C4JJ 2GFUA 5ADXA 2JWKA 2JM9A 1C0WA 3KETA 2ISZA 3F70A 5DYMA 2M1HA 2RJEA 1PU8A 1WJFA 4D5CA 3SCXA 3WG9A 2TDXA 1LAWA 3IH3A 2G8VA 2F5KA 2FEZA 4O3MA 4FVMA 4H5RA 1FOKA 3HSEA 2QLZA 3EETA 2NOZA 4CCKA 1HUXA 3TAFA 4KULA 2WV1A 2V75A 3JRBA 1PUEE 2FVUA 4PHTX 2LRQA 4JD2A 2MBFA 1YX5A 4C8LA 4WXHA 3VEWA 1S7EA 2LYCA 1T98A 5E1XA 1XC3A 1ABOA 1S1VA 2DDAA 2QEXQ 1D0ZA 2D9TA 5J6XA 2F4OB 2JZYA 1A5JA 3MFKA 3URGA 1RBVA 1QPMA 3UA7A 4AMCA 3THWA 1YJWI 1QMCA 6AT1B 2X3WD 1U6ZA 2TCTA 5DLOA 4W97A 1B8IB 3RR8A 4WQ4A 2JWLA 3A02A 2L7ZA 1QSYA 1SAUA 1K9MR 3BY5A 4FE4A 4J2BA 2Q31A 4GKKK 1QZZA 1YCYA 3DRPA 3O80A 4CUGA 1H89C 2RA2A 2VC0A 1YQRA 3BLYA 1Q7YR 4JJNK 4Y17A 1KSPA 4A4KA 5KAIC 1IJJA 1O3SA 4FX0A 3ZEUB 5D6FA 1M8VA 1SPKA 2DOAA 3C4SA 5M3FJ 1BOBA 1I50J 3NMUA 4BQNA 4NC7A 3ISNC 3BTCA 3FZHA 1VQPT 4XOTA 3SV4A 3ECOA 3G71I 2YHTA 2QA4Q 3PO3J 4KIGA 1ACMB 2X1EA 2P51A 4M63C 4HHTA 5L3BA 1YIJQ 1KYZA 1JKHA 5IPAA 2A6TA 3QP5A 3CTAA 4GLKA 1J9AA 4H03B 2XAFA 2YX4A 5HLGA 1BIZA 2D0PA 1GV5A 2K9NA 3TWHA 3REAB 4QOZB 4C8QD 4E7SA 3CVSA 3BR2A 3IRXA 3NH0A 2IVMA 3TP3A 1X3ZB 3EFSA 4EFHA 1EWQA 2CGJA 2HHWA 1MGTA 5GAEJ 3MAQA 2BGGA 1V3FA 1FXXA 2IJLA 3BC8A 5D6XA 2LJ0A 4MLEA 4HF0A 2GX9A 3S1MJ 2LZ6B 4JN4A 4AI4A 5GAEP 3H0DA 1RI0A 1FYNA 3D5LA 1J5EK 4MLOA 3M56A 4CZJA 3KZIC 1VQ7N 3HHHA 3O8GA 1BC8C 2KPMA 5AR0A 4UY8O 5DM7L 4DTPA 2E1OA 3FHNA 1JJ2P 4O6JA 5KYYB 3FHZA 5CLSA 3K57A 1YUWA 1K6YA 2A3LA 4C5EA 3LAJA 2W7NA 3ABTA 2A61A 3MPUB 4GV6A 4B4CA 2JGUA 4EM0B 3V8KA 3TEEA 4BL0B 3MN5A 1IXCA 3DLBA 2F9TA 1Q82C 1S72A 3PX0A 3BFMA 5LMNK 3U3YA 1OZ3A 3WEEA 3VQ7A 2A6HF 1HDDC 1WFWA 4IEJA 3KLHA 2KSSA 5JICA 1F43A 4AD9A 2I5UA 3L2WA 4C30A 1XNIA 3S6IA 4KT5C 3H0FA 4ZGDB 3ZT4A 4OMYA 2LTOA 1V4SA 4JI4K 4LMYA 2RQWA 2KY9A 1RT6A 5GADJ 2F48A 2E8AA 3D0PA 1YIOA 1VQ5Q 3MMYB 1UHWA 2OAUA 2K02A 3TSUA 4YIIA 1JL2A 2X74A 4ORZA 4IO9F 3RMAA 2V4JC 2YWWA 1VQLT 5LLQA 4HVJA 3D1NI 1N77A 4EIAA 2RNGA 1CSKA 1BU1A 4M77E 2X48A 2VJIA 4LDWA 1NK9A 2KZGA 1MBHA 1WI9A 4BI3A 3S41A 2WC9A 1G6NA 1ATNA 3K9JA 1Z6RA 4CO8A 5JLWA 1X6GA 1NK3P 1VZ0A 1UWBA 5C44J 2GEMA 3MXJA 4RKUE 2O8FB 3THVA 2FC0A 4C3JJ 3EL2A 3OS1A 4M9SA 2WY7Q 2RQTA 4IPAA 2LCSA 1IV0A 5GANj 3CPEA 3CF5L 3ASKA 4CVNE 3GYHX 1LWWA 2QQRA 3PL8A 2QI2A 3D5SC 4FE7A 1OCTC 4Q47A 2QBYB 2HNZA 1RACB 1SFKA 1PHTA 2UXCK 1XB4A 2L3QA 1ORKA 1SL2A 3O6BB 3OJUA 4NCGA 1SKUB 3M0TA 4ZDPA 2D0NA 4W1UA 1KU3A 2OPSA 5DCFA 1PWTA 2CW0F 1T7PA 4XKVA 1KAZA 1VQ8N 1Z9CA 1EZZB 2F2VA 1AWJA 1XMAA 2QWQA 1KG5A 3K6GA 3IFRA 3MEGA 3ZT2A 2ZCFB 1E3PA 2UUAK 2NOGA 3QEXA 1UEBA 3CETA 1XDUA 1T08B 3WTZA 3GLXA 4U7DA 4KRFA 3PIPL 4PJOE 1W97L 4OFHA 4CBWA 4J6WA 4OFEA 3QDRB 5GMKl 1IREB 4E7LA 3WXLA 1Z91A 1HW2A 1I5ZA 4V2SA 4AU7A 2HZTA 9ANTA 4DSKA 1QZEA 1X69A 5BMZA 3QMLA 2NVYJ 2VXEA 2PU9B 5DM6L 4YOUA 4DB3A 1TBXA 4FM2A 1GXIE 2HDAA 5EYRA 1D8JA 3BPVA 1ZQ3P 1U1SA 1HNZK 2B9SA 1W0TA 1QHGA 4EHTA 4CJVA 2XY6A 1TYQB 1YQLA 2LBFA 3G1JA 3TO7A 2EV5A 3TGNA 5JVGF 1VQ4T 3I0RA 1Z7UA 1WBDA 1WB9A 4K0KK 3M57A 1MJ9A 1D8YA 2F2XA 4A4FA 3ZBDA 5B8HA 1IN8A 3K4KA 1C0MA 1YJ9T 1ZR2A 4JEPA 4RGXA 3QBWA 4PCQA 4M77F 1JCEA 3NE6A 1NEGA 1FOXA 2LF8A 4Z0UA 5CQGA 5AQRA 4E7ZA 3CPWA 1E3MA 3JCMc 2EQRA 2PMZA 2Y31A 3ZCOA 4EW0A 1I3AA 3VODA 3TO9A 3VEVA 4JKEA 5KYYA 2FSNA 2MC4A 2L54A 2GA2A 3NVKA 1HR0K 5HVQC 2GBZA 4J19A 1VF9A 4A59A 5BPLA 5J1UA 2MLKA 3EN9A 4JKCA 4NBQA 2W82A 2K2MA 2AXTC 2EFOA 1ZSZA 2NZTA 5FKOA 2HS5A 4B44A 4HLYA 3SLCA 1MBKA 2HF4A 3EYYA 1ZGWA 3QFUA 2OPQA 3RDVA 1VQLI 1N75A 2PMZN 2Z2SB 2A40A 5J47A 3PFYA 3OQ5A 4BD3A 4JKAA 4C0DC 2G3RA 3EEQA 2ABKA 4H5WA 4CZKA 2JVVA 4DQRA 1PNJA 2LG4A 1S29A 3BR5A 5FO5A 3I71A 1NLPC 3OW2S 2WTEA 1BKBA 2HHSA 4F04B 2HFHA 2P7VB 5EG0A 4KREA 3X26B 1IG7A 4EP5A 5IT9Z 2CH4A 2YNGA 4A3GJ 2OZSA 4ELVA 4B1VA 1LEAA 3ZMDA 5HS7A 3TOAA 1ILYA 3M8FA 2LLKA 3E19A 3VUBA 3S3OA 1M1FA 1K73C 3AA4A 1VIEA 3RZOJ 3DFGA 4ELUA 2BW3B 4JQFA 4A3FJ 2LC2A 1VQMQ 4J5YA 3F8CA 3ABKH 3RQ4A 1NK8A 3LALA 2FBVA 4B9NA 1IJWC 4J9GA 3JV3A 1S1XA 2FA5A 3SAHA 3MCPA 4H4MA 2O8BB 1WRJA 4FJ9A 1G15A 2E5KA 1WUAA 1FEXA 4I7FA 4OP0A 2DZCA 1IKXA 3U9DA 3HGYA 2XHKA 1VQ5T 2KI7A 1JU5C 3UDCA 3ZEHA 4J6YA 1K8AO 3WNFA 1OV3A 4EZ9A 3I5SA 3T0YA 3A5NC 1NJIO 3JW4A 1D3BB 3K4CA 4RLFA 2Q0RA 2Q36A 3BQZA 3GTMJ 1U9NA 4XBFA 4X1VA 4IXCA 3CZ6A 3TARA 3MKZA 3UKRB 2VYTA 4XN0A 4W5RA 3IUCA 1R77A 3H1QA 3CLOA 3BG6A 2HQRA 1QPIA 5CYVA 4XLPF 4M75E 2CSIA 3I58A 1NGIA 4EA5A 3OYNA 4DA4A 3QOPA 2ZBKA 1VTNC 3UATA 2H3EB 2HBPA 4KHYA 5CVRA 2B4JA 2P5KA 2DFUA 2E2NA 3LL7A 5ADXH 3H08A 1Y0NA 1E3OC 2MABA 3T8RA 2ENMA 3QUIA 3E1SA 4GLMA 3M9AA 1T0FA 1FK9A 4PY5A 5J4VA 1ZKGA 2VQEK 2VWBA 3E5UA 2OX7A 3OW2P 1ZN2A 1D1BA 4BR5A 4OGCA 4Y4RA 2ZGWA 4IHVA 3RMQA 1J54A 1BR1A 2FMLA 5B66C 3O8VA 5KPRA 1P92A 2DTRA 2IGKA 5F1RA 5GAN5 4LN2A 2H09A 4F3OA 1LW2A 3VFZA 3JTGA 3GBTA 3CPWP 3FMSA 2IS4A 1J5YA 2BZ8A 3VEPA 4IHTA 4G7HF 5KYWA 4BR9A 1RKWA 5GAOr 3CF2A 5CVIA 1EWRA 4EJVA 1LCKA 1TQMA 3LSPA 1U06A 2FF6A 4BQLA 3SFZA 1ZELA 3WGGA 4ZGEB 4C92D 2EJGA 1PC0A 3DXJF 3MCZA 3VF2A 4DTXA 3DBHB 4JPBW 1IZ1A 4GVEA 1Z0XA 3ZQLA 4YORA 3WXIA 4DFMA 5GPCA 5D6YA 4KJZA 4I09A 4N76A 5FLXK 4XKWA 3WTUC 3AVGA 2DILA 2OI3A 3H6EA 1PVSA 2GF7A 2Y9YA 4NQWB 2BKDN 2HF3A 2ZQBA 3NDKA 2RKHA 5A2QO 1QVGM 4CEDA 4AFQC 4IFYA 4I98B 1RL2A 4BRHA 4DFPA 3C94A 1BA1A 3CI5A 5CK9A 1VK0A 1EO1A 4J9HA 2IW5A 4ESJA 2PVOB 2DT7B 4C0GA 1ORNA 2FF3B 2JXBA 2HHXA 4ELTA 2MG4A 3M58A 2VBYA 3C1DA 2EZLA 4L0ZB 2O6GE 1KQSP 4AF1A 4B9XA 4KN4X 1NKCA 5LJ5f 4N4HA 1T03A 1R00A 3DM2A 1ERDA 2NNNA 4RW6A 2Y0SN 4IOAL 2DL5A 2MFZA 1VQNI 2P1JA 3OH9A 1VQKQ 2RE2A 5FD5A 1NM7A 2KKOA 1VQKN 3K1PA 4E9EA 4PFZA 3LA7A 1OCRH 2M2EA 1RGIA 2DA4A 2AT1B 3BGRA 5CO7A 5J1EA 4B09A 3NH2A 4GW6A 1HXDA 4L59A 1MMGA 1BN5A 4B9SA 2CT3A 4EVIA 4LITA 3CC4I 3I35A 4G94A 3SD4A 3CMEQ 3N4PA 2V52B 1IN6A 1PU6A 4EMHA 1BW6A 4BH9A 5F0CA 2OA8A 2CW8A 3VV0A 2FZGB 2VT2A 2XAUA 2L4AA 1WSUA 1IGQA 4EIKA 3UKGA 1VQKT 5A2QZ 1N8RU 1YFHA 5DDGA 5JLHA 1MNDA 3QAHA 1I27A 1QKWA 1T0HA 3AO1A 3AO2A 1UGSB 3MEUA 5CR2A 4ON0A 2GGRA 3QWYA 2XD0A 1A5WA 4I6MB 2I8DA 4IQ4A 2VXFA 4B9LA 4EJTA 4PJOF 2JVHA 3MKLA 3JRCA 3CUQC 5DD4A 3H41A 4JHDB 2DMUA 2GFAA 2G8KA 4IHYA 1W2BM 3ERED 4YFNF 1QSSA 5F0FA 1XQSC 4X62K 5GAOm 3QINA 2LJ1A 2H6CA 3VRYA 1XD7A 3HKZN 3TTFA 1VQLN 4CCHA 2ETJA 4FLYA 5M5XJ 1NLVA 1QHAA 2VONA 4BJTA 4OMNA 1YJWQ 3ZSXA 4RMOA 4GMJB 4FOEA 5FU7C 3GNFB 4G9ZA 2DFFA 4BY6C 3QU6A 3FZLA 1KQSM 3GFMA 4MO7A 1L3TA 4E4HA 2F4MB 1RR8C 1M3CA 3BPXA 1GHCA 4EEFG 1ON2A 4EJOA 1JRIA 2WOMA 4AI5A 4EM2A 4DS4A 4B1RA 1F1ZA 2R5ZB 2LSNA 1IZ6A 3OOUA 3UWNA 1PRLC 2E6NA 3Q9SA 2J6OA 2EV6A 1S1TA 3CCRA 3META 3CCLI 3KXTA 2GELA 4KI6A 1HA8A 2LQ8A 3J80E 1B9NA 1BWFO 1KFDA 3L2ZA 1TT5B 2NVXJ 3L42A 2XIGA 3CCUI 2YLBA 5KGXA 1P90A 3QU3A 1KQ2A 4C92F 3NQOA 3M8EA 3MAJA 4ISEA 2QQBA 4FLTA 1K0XA 2AHQA 1QGPA 4N5SA 2JZ2A 1N5ZA 4M78C 3A03A 1CF7A 3LZJA 1H9TA 2FZKB 1YJ9N 3PO2J 2X1DA 3LANA 2GBQA 2FQ4A 3MQ0A 2MPXC 4I9LA 4DTMA 2DNUA 1W2BS 1VQ5I 2JTFA 5E18F 3PM1A 1YJNT 5ELZA 1NJWA 4QLCU 3VW4A 4M3WA 1XQOA 1ZREA 4IJNA 2RHYA 4AUXA 1VQ6Q 1HQCA 3DOLA 4B9VA 3OL3A 1WA7A 2QWPA 3HK2A 1RDBA 2RI5A 2X9HA 2HNYA 4BQZA 3Q0WA 4PSWA 4M3BA 4C8NA 1HKBA 3CCMQ 1FMWA 2A69F 1NMNA 2C0TA 3W6KB 1AWXA 3RESA 4M41A 4KHPK 1YW9A 2ZF5O 3V6DA 1KVCA 4K41A 2ZSIB 4OWRB 3CIPA 4OIOF 5BREA 3PJRA 4OMFB 3CC4T 5D7UA 1OISA 4KA4A 2CZ7B 1EF4A 4H5NA 3FXOA 2NRZA 4AWXB 2X4JA 2SRCA 5KYUA 4FLVA 2OCCH 3HSRA 4XLEA 1VQKI 1ZG5A 1GCQC 1TP4A 2O8DA 3NPFA 1OH7A 5FROA 1CXUA 1YWPA 1NOYA 1ZBIA 4KKOA 5IT9O 4CJ3A 2OTLQ 2M0YA 3VOEA 3OYJA 1Q95G 4XLCA 2JA2A 3ZETA 5HNFA 1IBKK 4II3A 3Q1JA 4BY9C 4DYCA 5AQIA 2CP5A 3I56A 1GLEG 4KUDK 4B22A 2ZJQF 1XCVA 4PDKA 1TW3A 2WAEA 4ID1A 2EH3A 1B72B 2HAXA 2ETHA 2CZ1B 2OPRA 4Z2YA 3QPLA 3CCYA 2ZGYA 3K5NA 1E2XA 4M77G 1TXQA 2YRVA 2XKPA 1LDKB 1V4RA 2CV2A 1YJ9Q 5KAFC 1J2XA 2VV5A 1DGRM 1WH7A 1YQAA 2HVQA 3THXB 2LBFB 1R7JA 2E41A 3LM9A 3HTSB 2KT0A 1EX4A 4BHBA 3ZSRA 5IXBA 4X64K 4OFAA 2DTZA 4EGYA 1G99A 5GAN7 4HCKA 4J2DA 1C6VA 2VXDA 3CFOA 4M45A 1VI0A 2DFEA 1W5SA 1VQ9A 3G3ZA 4JI5K 3VRZA 2EQMA 5I2SA 5M5WJ 1DLOA 4WK8F 2YNHA 1S22A 3DLLF 2E6MA 1K4TA 2G7HA 4LG0B 2EIMH 4E7KA 4BGBA 4M75A 4BE0A 2ZNZA 3WG7H 2HBKA 3IKVA 2F5FA 1RBSA 4KMUX 2DI3A 4RA2A 3O9SA 5KE3A 1KQSS 4KV8A 4B3RK 1IG9A 3L2RA 3G6EN 4N56A 3MHXA 1EQYA 4Q5VA 5FU6C 4C3IJ 4DF4A 4Z88A 1ZAOA 4AVZA 3KYCB 3L3VA 1U0JA 2CW7A 1JEGA 2IP2A 2VPRA 3OTOK 3HOXJ 2EIJH 1RAFB 4G9YA 4AG2C 4Z4HA 2PAVA 2XG8D 2KMTA 2DF6A 2DTOA 4HNTA 1PYVA 1WAFA 5K5RA 2V26A 1YJNI 3M1CA 2OTJT 3AVIA 4IHXA 3R0JA 1R9TJ 4FPBA 4B6MA 3AAFA 3SDZA 4JS4A 3BZKA 4OB1B 4BVPA 1GCQA 4OVLA 4O0IA 4L8RB 5D5XB 4M77D 3HIFA 1O3TA 2CSOA 1R1TA 1NGAA 2E6ZA 4FK0A 4OB2B 4BHPA 3ZSOA 1ZC6A 1ATRA 5LJ5e 1RAEB 2NAZA 4MLHA 3VS2A 3FFKB 1WSHA 4O0JA 2DPDA 5GJVB 4Q48A 3V9ZA 3O8HA 2NRXA 5GMKe 2P84A 1DPRA 4AYBA 4E6KG 4X1EA 2YUOA 1WSIA 2HMAA 3HFOA 1ASUA 1UFFA 1HSTA 4PJMA 2YKMA 5C2FA 5C42A 2EYWA 1KAXA 4CFCA 3C7JA 2QGFB 4IURA 4J00A 2K5IA 1LWCA 3QBXA 2LP5A 1OVQA 2HQHA 2HI3A 1ZSZC 4UUTA 3NHGA 4BACA 4YIRX 2HBMA 3NF7A 3VS6A 4BROA 4QQGA 5CKDA 3BJAA 3LWFA 3LAKA 3R0AA 1QHTA 2JW4A 4JHDA 3KKSA 4YDUC 5DCMA 2JHJA 1ZGAA 2RPIA 2ECBA 3F0ZA 1NEBA 3O6WA 2YSQA 1O57A 2V9VA 3AVAA 5L3CA 5LJ3f 4RB3C 3KP3A 3R9PA 2QXLA 4N4NB 4PLLA 2M0MA 5C10A 2RREA 4M3FA 4C5GA 5EXWA 3CCQT 3HB9A 2FSKA 2V8IA 1PRMC 2CUZA 2P0PA 5GAN4 3I5UA 1VQ8Q 3CMEA 2R7TA 3JB9G 4LLLA 1YAGA 3WU0A 5GANh 1T38A 3CCRQ 3CCEN 4DQ2A 4FXDA 3I55I 2QWMA 1MA9B 4OF1A 3PMTA 2XDVA 5BOXA 4M3DA 2R4GA 1RABB 3ZFJA 1ZUKA 1G3YA 3PE0A 5GAGJ 2CH0A 4Q5SF 2QWWA 5J8FA 2DLLA 3GZNB 1ZR4A 1VQMI 2BH1A 2QGUA 2HKOA 5FFZA 4ENJA 2R7ZJ 1JCFA 2FL7A 3D2FA 2CUDA 3GPLA 1JCGA 2PN6A 1RAGB 3KEOA 4BY1J 3CQZJ 1IBLK 3CP8A 2C6YA 3HOZJ 1IHWA 1UJ8A 4EJUA 3KUFA 2DMOA 4LD9K 1OZ2A 1YCSB 1VQ7T 3G25A 2JS2A 1OOTA 4DR3K 1MNMC 3OYFA 4DKWA 1X2MA 2FF4A 3OYMA 5J4YA 2HEOA 1BL0A 2PJPA 5FW9A 2GIZA 2BZXA 3HG9A 1K6OA 1M30A 3S8PA 1PD1A 2WB1N 5BPDA 4FSXA 1ZQ1A 3E3VA 1PD0A 2ECZA 2JUGA 4IOAF 1NG9A 4DEYA 1QA6A 4CIFA 3FM3A 3JAMK 2LVSA 2E5QA 2DN0A 3MZ8A 4WXDA 2F4VK 3LGFA 1QWFA 5C0MA 3RTVA 1QVFP 3WUHA 2ZZDA 3DPTA 1X75C 3MP6A 2A05A 4FWKA 1YQMA 2F9WA 2ROTA 3M54A 2YLCA 5C6SA 5FRNA 1E17A 4A63B 1P6RA 3HC7A 2WBMA 1MMNA 1VQOQ 4FWPA 3CMAQ 3ULEB 4YFUA 2WAFA 4Z6YA 4DV0K 3WEEB 1QBJA 4LJZF 4ENKA 4M78F 4C92G 3CERA 1KQJA 4CCOA 3WGHA 4EQQA 2CUJA 2EIKH 2D5VA 2AKLA 5B3SH 3SPYA 3K1NA 1BIUA 1HDPA 2DA1A 4C2MJ 2QQ8A 3I54A 4JLGA 2F8TA 3ITHA 1LNXA 3CCET 3DU6A 2IXSA 3NARA 4M7YA 5E1WA 2OBPA 5D5UB 3TAMA 3O4NA 1VQOT 4IRGA 3VU3C 2Y48A 1VSMA 3OW2A 3J7AP 4HCZA 3J80O 3K2ZA 1HYVA 4Q0BA 3ZOBA 4MO5A 5EZHA 1QZ5A 1MMDA 1PG5B 4A4EA 2X6WA 1W7PB 3HBTA 1IRFA 1FMKA 1QVGA 1U47A 4YEJA 3CC2T 2E2PA 4V19K 5CQYA 3HKZA 4ETSA 1VQLA 3TKYA 3RRGA 5BRDA 1CLQA 2BW3A 2EZIA 1G3WA 1ULYA 2K3BA 4YOQA 3F0CA 3QZ5B 1RTJA 4L0YB 3IH2A 1TWCJ 4II2A 3SYTA 1T44A 4MHGA 2FYKA 4B43A 1L3UA 1T56A 4MQ3A 1RT7A 4GV3A 2M1BA 3LMMA 1TAUA 3VS4A 1S3XA 5GAHJ 4ZZDA 1ZBHA 1BYMA 3VENA 1LMZA 2RF2A 5CVUA 4PGGA 5ILSA 4HSBA 1UA0A 5AONA 2NRVA 1ESVA 3DTKA 2GXGA 2FLOA 3IL2A 3M4OJ 1TWBA 2KT8A 3LWIA 4JLIA 4NL2A 5E3OA 1LFPA 1RTHA 4J2AA 2D45A 1BOAA 3AKZA 4QIWN 2BXZA 5LJ5h 3MDQA 2CJJA 3AL0B 2HBLA 1WJ5A 4XMYA 1JJ2S 4EJYA 3SMSA 3V8JA 2ZNYA 1VRUA 3C7NA 3M6GA 1KLNA 2E71A 2CUBA 3TABA 2MF2A 4BY6B 1EH7A 1LUJB 2HQXA 4L3QA 1KFSA 2DPPB 4GNIA 4L5GA 3F6VA 1KFZA 3LP2A 1OCOH 3S93A 1B72A 1RCHA 2DQRA 3U1DA 3MK6A 3HPOA 3KLFA 3PFSA 4KTZA 5CY4A 4NLBA 2FE3A 3D0SA 1GVDA 4A3IJ 4GXOA 1YG2A 1RT3A 3F5TA 3M0PA 4R5PA 4HSTA 3H9NA 1NJZA 4OPKA 2EGCA 3RSEA 4CJSA 2P5OA 4DV3K 4DCHA 1I1JA 4JDSA 2E70A 1MV0B 4S05A 1XGNA 2X4XA 4CHPA 4HCBA 3CCRI 1FSHA 4C92C 2RQUA 3EZWA 3NWSA 3OMGA 4QS9A 5HDGA 2LQKA 1SVLA 4RBOA 3K5OA 1K8KA 3KZZA 4OMLA 1ODDA 3JRZA 1GV2A 4CYCA 4BB7A 3K4MA 4EMKA 3EHRA 3BCBA 4JS5A 2A37A 3O9RA 3NMZC 2UU9K 2A28A 4J01A 5E3LA 5GAMd 2VKDA 3JB9H 2NVTJ 1EH8A 3JCMg 5HRSA 3AVKA 1XSDA 5M1QA 2VLAA 4IQJA 3HOVJ 1CKBA 1HQEA 4FWRA 3TW6A 2L5QA 1LVKA 4HSRA 4DSEA 3DLRA 1T0FC 4C5HA 1M4ZA 4AM3A 2AXLA 1MUNA 1NG6A 4B3TK 3ERMA 1IV6A 1GVJA 4CW7B 1OFCX 3CBOA 3JB9F 1OYWA 3PQJA 3TTCA 3T1BA 1LWEA 3BTIA 1CF7B 2RNAA 2Q3SA 1UG0A 3OYBA 3I33A 1NBWA 4L6V5 3ZX2A 4DTUA 4BR7A 3CBPA 3RUXA 5A2QK 2Z1HA 2B5JA 2ZAEA 3DAWA 1XTAA 2E1MB 2H1LA 3FR0A 4IZZA 5HS9A 3VEOA 4QVCA 1L0OC 1ZBJA 1BA5A 4OKEA 3F3XA 3HXLA 2RQQA 1RESA 4LIVA 3SI6A 2VJ5A 3ZR8X 3KYDB 3UA6A 1BI4A 2W6LA 3K1MA 3CWTA 1HU0A 1LDDA 4F2SA 1JXBA 2WSCE 4B9QA 4PL8A 3RCOA 2IGMA 3CCMT 5EGOB 4JRIA 1TSFA 2N8GA 4HT8A 2AA4A 1KG4A 4EMKB 1KC8C 1BI3A 3KBGA 2EGEA 4NYFA 3PV8A 3JCMQ 3BG7A 5E20A 1EKEA 2KK4A 4LDUA 3BDDA 3CC4N 4M75F 1FIAA 2DMTA 2Z1DA 5GAOn 5FKKA 2HNHA 3OYGA 1Y6IA 1T3SA 3ZMSA 1D4XA 1KD1U 4RTYA 1UCRA 5KN8A 4RGRA 3WTWC 4J6XA 2P9SA 2DMQA 1N6AA 2VJJA 2KXCA 1DKGD 3HOSA 3HSBA 4IF4A 1FBSA 2XI9A 1IRGA 4ZHRA 1VQNN 4IWVA 4F92B 2DJZA 3EH2A 4ZYHA 2HSPA 4CSWA 2V51B 1YHQA 4WE1A 3A8LB 1KIKA 3BQYA 2KRHA 1RI9A 3DB3A 4V2FA 1UZCA 5EU7A 1HQUA 4L9JA 3BZCA 2LT4A 2LCLA 1MH4A 4OOIA 4CEZA 3SQ4A 2DA6A 4JKDA 3MMVA 1XGOA 4CJTA 4BDPA 2P9UA 2JRMA 4HV6A 4AIDA 1RAHB 5EZGA 2E19A 3DTIA 1QU3A 5GAOp 3JB9D 3GZ5A 4KTQA 3H0IA 2E1ZA 4M78D 3LLRA 4CZZA 3RVCA 3EG2A 2KNBB 3WE3A 5D5WB 2B8AA 2JT1A 3TU4K 4BWJA 4BRIA 3EGXA 3VYHB 3OYYA 2CG4A 3I3LA 1HKGA 2P9KA 5LHIA 1WLPB 5AQHA 5JVHL 3BDUA 4MFDA 3IH7A 1Q1HA 1ZHFA 2A41A 3ZSYA 4KGXB 1YRNB 3G6ET 3QWXX 4IO8A 2YT6A 2E1CA 2QK0A 1RPWA 2MK5A 2VL8A 4L9TA 1VNDA 3X20B 1WWXA 4GY2B 2DTUA 3HZJA 3VERA 1MZBA 2L3SA 4FJJA 4QVZA 2K40A 3SQNA 1YJNQ 2KT1A 4Y13A 4LDYA 2IVNA 2E5NA 2CV0A 2P0KA 1MIJA 2WACA 2JPSA 5E41A 4XU0A 4EDUA 1SVMA 2OF7A 4J9EA 5HRNA 5AQSA 5CQXA 5LJ3e 1OX8A 3CXCP 3ZT1A 4KH4A 1G8XA 3CCMA 2VOPA 2HOEA 5CKFA 1IF1A 2KFDA 2X78A 2XRLA 1J53A 1U2WA 2E7XA 3SMPA 1W7PD 2FOWA 4Y52J 2ZE2A 4M3UA 2ROLA 3JREA 4FJ8A 1SC7A 1XN7A 2W24A 3SB2A 1CZ9A 4JX6A 2BE5F 4LFUA 3EZ5A 3O9QA 1J6ZA 2YRCA 5J40A 3LQRA 2ESNA 3PT9A 3AG1H 2XB5A 2O5RA 2XC7A 2DA5A 1ZUYA 2RHZA 3R8EA 2F2EA 3H3NO 4QWQA 3WXJA 3LDPA 1BCMA 1DP3A 1DT9A 5FRMA 2A07F 3EFOA 3G4SA 1GLLO 3JYTA 4PKHA 3QJYA 1NGCA 2OA4A 4N9IA 4OU0A 3QO3A 3PNTA 3GTOJ 3Q0VA 4N4GA 3OBWA 5FLMJ 4MZTA 2KHMA 5ED4A 2JNGA 4WWCA 3O1BA 2NRWA 1BIAA 1BM9A 1R49A 4LSNA 4PK4A 2GWJA 4G12A 1OULA 1U5TB 4CGFA 1MDMA 1KK7A 1OVYA 3DOKA 5LL6S 1DGKN 1YS7A 1HYSA 1TUGB 4CZLA 1OYYA 2RD1A 3JRHA 1I81A 3H35A 3FB9A 3QXEB 1YFNA 3J7AF 1B7TA 1ZLKA 3E01A 2PX9A 3S17J 1FOYA 4A3EJ 3I56Q 3DKMA 3U1KA 1VQPN 1LWFA 3GTJJ 1PP7U 5BNGA 3LZIA 5I42A 2CREA 5FWBA 4P55A 1NM1A 1U04A 2EPFA 1FTTA 5IP9J 3ECHA 3A98A 2IAIA 4NDLA 3PVLA 1BISA 2VWFA 3IHOA 1Z05A 1W1WE 3DYAA 4IJAA 1ZA2B 4IUQA 5TKWA 1UJYA 1Z9QA 1Y71A 5L23A 4HBLA 1SG5A 3OSFA 3TSQA 1N6QA 1D5VA 3LWLA 1SEMA 4KN7X 3HSFA 1VQ4Q 5GAN8 3AFHA 2NS0A 1D3BA 2P4RA 3X28B 3UE5A 1VSIA 4R8HA 4XQFA 3FK7A 1C1BA 5HKCA 1YP5A 5AZJA 6PAXA 1JO8A 2E1NA 5FKLA 1HNXK 4WX9A 3VQ8A 4H5TA 2O8BA 3E6MA 3J81E 1JT0A 1ZG3A 3P9IA 2CS3A 4R1HA 3LGLA 1R5GA 2E4HA 2ZC2A 4O8UA 1MPGA 3R3LA 1RADB 2CP0A 4N0AA 3NAUA 4J9CA 2P5LC 2LKPA 2YCHA 2XAGA 4M7AB 1NJXA 3G0QA 3LL3A 2PNIA 4KDPA 1ZH5A 4I02A 3A8OB 4AIKA 4JV5K 2UXNA 2KTQA 4EJZA 1XX5A 1MWKA 4DLEA 1FYLA 3MCAB 3PUBA 1M27C 3OHRA 3DKWA 5HS8A 2DPNA 3ZGKA 5K5OA 1Q86O 2KYBA 1WSFA 4J83A 1RAAB 4QT7A 2ZJQL 3LSIA 2V8JA 3RKXA 4M7DD 4KI4A 1Q82R 4F93B 1Y64A 3O5ZA 1YXQA 4RTZA 2E12A 2LY9A 2XSDC 1JXOA 3KJVA 2R58A 3P8HA 1M2OA 1KU2A 2WAQA 1U45A 1SUQA 3ZMZA 2BTFA 1R58A 5EGOA 1WGXA 1IB8A 1TNSA 3F8BA 2L01A 2RJFA 2P9PA 4RTXA 2XPUA 2JPCA 5C12A 4M73A 1IDYA 1X01A 4DUZK 1N39A 2M30A 3M8PA 4M77C 2F5VA 5AQVA 1S1UA 1BR2A 1KLMA 3G1MA 3CCSI 3T7ZA 1NGFA 2CFXA 3MEWA 3DEWA 2WFBA 3WNHA 3I56N 3MN9A 3S32A 5DEQA 3DLHA 4IRHA 2UV1A 1NKUA 3K4NA 1ZK8A 2XRNA 2GQVA 2VB6A 1XMXA 3FEOA 4FISA 3KP5A 1BG3A 2FSWA 2QTVA 4FJ5A 3Q7BA 1VSDA 4BRDA 4G8XA 3HOTA 2ABLA 5DCMB 3AVMA 2QM3A 4CK1A 4FTHA 4NC6A 3FBIB 4XK8E 4M6YA 4CERA 2X4YA 3ASNH 4HUFA 3ZN0A 3ZQGA 1NGDA 3OSVA 1WSEA 1S8NA 1F9NA 4HX8A 4E3SA 5HBMA 4CH7A 2FZCB 3G1LA 4B1YB 2UUCK 2K2VA 2COBA 4M3ZA 4CHYA 3RPQA 1JUMA 4LIUA 3QYBA 1AVZC 1HNWK 1E6GA 1M1KU 2L4MA 5BS6A 1ZUUA 5EX5A 1WVRA 2YXYA 3DQVC 2V1NA 4H0VB 1H9GA 3A5MC 1TKDA 1YHQQ 3TW7A 3FXMA 1FOWA 1TQPA 1AOYA 1B4AA 4RB2C 3N05A 4IRIA 2FJ1A 3KWGA 2XRIA 4OKJA 5GAHP 5A0LA 5ICEA 4ZN3A 3UKUB 4DZPA 1VQ9I 4IXAA 3PIPA 4C5IA 3M0QA 3E7LA 1GLBG 4KB0A 1IN5A 2LDUA 2OANA 1KD1C 2QDLA 3Q0UA 3DV8A 5LJ3j 4CCMA 1X9MA 4EVVA 1B9MA 1UDLA 2NXNB 1U5SA 4LK1F 5LHHA 1TH7A 3D45A 1T05A 3OYEA 1XMQK 2WADA 5IXFA 4FSVA 1UA1A 4KHUA 3UKRA 3OVNA 2XGDA 4WQ5A 4ZYDA 1DU0A 1WSGA 3PNYA 2Q1NA 2FXUA 2BE7D 4CJEA 2J7IA 3GMEA 1U3EM 3L4IA 4UB8C 2H8RA 4I2OA 1WJEA 4YNQA 2KRCA 3Q7CA 7AT1B 3A4CA 2XGCA 3X24B 5GAMf 3C7NB 4K8XA 5BRHA 4PFPA 2NWMA 2I10A 4OPAA 3QPTA 1AKHB 1OX9A 2ASPA 3CCUT 4FL6A 4N0BA 3KLEA 4X65K 3FBNB 2CRGA 5JHUA 3J80Z 4EZ6A 5CIUA 4M7AA 3UT1A 4B8XA 3PO4A 1YITQ 5GAOl 2XSJC 2M02A 1S9EA 2NUBA 5JLXA 1JLQA 1VQ6T 3AHUA 1D0XA 3FKJA 4J9DA 3P9CA 4HF2A 1W0HA 4ELZC 4R55A 2K9LA 4RTTA 5KHDA 4MEYF 3HTVA 3PVQA 2R7OA 5A0GA 2A1RA 1ZRCA 3H8ZA 1YHQN 1DTQA 1YLFA 3THXA 2A3SA 2RKIA 2GOXB 2A5XA 2ASOA 2XAQA 2KZMA 5HY6A 2ID3A 2RN8A 5AQLA 1ZBLA 2HHVA 1P9QC 3BR3A 2W1OA 1IRXA 4UQGA 3G71A 3KP6A 1MBEA 2Y9ZA 4CJWA 4WF9L 4QQ6A 1UGPB 2HGCA 3MZYA 3CJRB 2O0YA 3S15J 2XF7A 1U2VB 4FZZA 3MKDA 1SKWA 1FW6A 2VQCA 2RHKA 4LG3A 2W04A 4L5EA 4NO7A 2X6XA 4NUBA 1KG6A 1CKAA 4ZTFA 4H0PA 4RCBA 3LPTA 1HKQA 4LDVA 1DJ7B 1V5FA 1YN8A 3VUZA 3E9OA 1YJ9I 3MVPA 2K5FA 2I7PA 1X6OA 2RHXA 1DIZA 5F1XA 5AQMA 1K8AC 4BAYA 3EY1A 3U21A 5HODA 4B1WB 4CESA 3VPZA 2HVHA 1F1BB 4DIQA 4PJNA 3QODA 1DDNA 5J2QA 2J5PA 4RTFD 3B6OA 2ME6A 4A3LJ 1QTMA 2WC2A 1DTTA 1SFXA 3ULEA 1IAWA 4I9QA 2EFQA 1KD1R 2CGHA 3CCSA 4CJ5A 2ZJPL 4M78A 4DU4A 4XONA 3TR8A 3BDPA 1TYQA 1MD0A 3PSFA 2I2LA 2P5GA 2YUSA 1U5TA 3GF2A 2P0QA 1N36K 2VWJA 3SFMA 4BS9A 3LDNA 2XPWA 3KLIA 2G9WA 4KNYA 4BR4A 1PU7A 1WZ2A 5LHGA 3HXMA 1N27A 5CZ2A 1VQ6A 3GCMA 3DLKA 1IKYA 1XG7A 2QSGX 1WJBA 5IYBJ 3EG9B 4JK9A 5AJ3K 3H3ZA 3BP8A 4RMNA 4V2GA 3O8MA 4CJ4A 2P8TA 4Y0WA 2H94A 5H1SQ 4WFBL 4UVCA 1NU0A 1NK5A 2ITMA 3K5LA 5CZ1A 4AIAA 3C2BA 4A2BA 5GTHC 3P9KA 4MGRA 3ZQ7A 3O5BA 4I99C 2BY0A 2P9UB 3A8HB 1ZSZB 2DBKA 2XMFA 1ONVA 3J7ZO 2KDSA 3FXLA 1SFUA 4L5IA 3JRIA 5CKBA 1KTQA 2CSQA 3BG5A 1SRMA 2V1XA 4JKGA 2JA8J 1FP1D 1S9GA 4C2TA 5LJ3d 4E9FA 2CS7A 5LJ3g 2R7SA 3NWTA 2ZMEC 1VYUA 3EG1A 2CGPA 4IDHA 3SDGA 4PFOA 1IXSB 3D6RA 2M5WA 2QKBA 5FLXZ 2CGKA 2X9DA 1Y39A 1H3HA 5EY4A 4OINF 3DWLA 1FBUA 2GBYA 3ATUA 3VEZA 2P9SB 1RRJA 1J9IA 2DAOA 1LFBA 3PIOL 3FDYA 4A3BJ 1KHCA 5AYFA 3H0HA 2DXUA 3C95A 2XIDA 2COYA 2XICA 3CC4A 3IV5A 3M9QA 1H3ZA 2YU9J 4ENNA 5FDLA 2XAHA 3S2HJ 3HZ6A 1X1BA 1HKCA 4JK7A 3OH6A 5H20A 3LQQA 4XOPA 3VEYA 5LGUA 3EKSA 4WCGA 3E9FA 3NHNA 4RW8A 2ZFWA 1MWMA 3VF6A 3DLLL 4CICA 1O1WA 4CJUA 3LAMA 2RMOA 4HRIA 1KQSA 4OIQF 1VQMT 3KE2A 1T39A 1B07A 4OMZA 4F3QA 3CCUA 1U4BA 4MDAA 4DTRA 1WX6A 1VRTA 4M7DF 3A0BC 5KCMA 2BZYA 4Y3OA 2CQXA 2O4XB 3M5AA 2W00A 2RJCA 2BDPA 1BC7C 5IHIA 2W57A 2DKGA 2BE9B 1OH8A 3CQYA 1X2KA 3M0SA 3P7NA 1Y96A 2F1LA 4CGDA 3CCQI 1FWZA 1ABQA 3E5QA 4PJJA 4D1QA 2OAWA 3F6OA 1QNTA 3A8YA 3EO3A 2FBHA 1A5XA 1F21A 4YFXF 4UUVA 2ATCB 1XMOK 2Z1JA 1T2KA 2LX7A 3QPSA 4E1NA 3J80K 5IOYA 4BBRJ 1MHNA 3IAS2 3MEVA 1P4XA 3CJBA 3IKTA 2KRSA 4PJOA 1WBBA 4KT0E 1VQLQ 1TUCA 1AHDP 1FKPA 3CC2N 2EAYA 4B8AB 4K42A 2PMHA 3HTUA 1NJIU 2P5VA 4EHUA 4DW6A 2A6AA 3FX3A 1EH6A 3IC7A 5JMVA 4LFCK 2LKSA 2HKXA 1MW7A 1TLHB 3CMEI 3JCMX 1CZBA 2M9HA 2LP0A 2GXAA 1ZTRA 2BANA 2V79A 2RNJA 3LP3A 3VETA 3WTYC 4CEAA 3M5RA 4XSZF 4BRCA 1MH3A 2BEOA 4D0PA 4GYGA 4GV9A 3WODF 3EUHA 2DL8A 1JXSA 4CXFA 2CDTA 4CC3A 5H2FC 5GMKi 1SF9A 3ALYA 2AIRB 1V29B 2OQGA 1ZLMA 1B9FA 4QQDA 1FZPB 1C1CA 4FK2A 2JJ7A 4XL9A 1UHCA 1Y1WJ 4CIGA 2ZJRL 2DD5A 3ELKA 2DXCA 3QEVA 3CO6C 3EFOB 1ETKA 1ASVA 3EHQA 3A01B 4JNEA 1SL0A 1APLC 3AVJA 1X27A 2K5LA 2OYQA 2VUMJ 1OLTA 2EQJA 3BWGA 4ENMA 2CH4W 3CC7A 4BXFA 4PJ0C 2R5YB 3GOXA 3TCJA 3U6FA 1VQ4N 3QJ6A 2CU7A 4HA8A 4H0OA 2E1HA 4M7DE 5AQQA 4FJHA 3CD6N 4ILHA 1X3MA 2NOJB 2FRHA 1ZARA 3A0IX 4DV6K 3DLLA 4UVAA 1WEGA 5F04A 1MKMA 3HUGA 4II1A 3B73A 3PIPF 3ZSZA 1WYXA 3KHYA 1YI2A 1MMAA 1BB9A 1ZYRF 4WQ4C 4B9MA 3CC7N 2MH2A 2ZMEB 4CF1A 3M8RA 4Z4EA 3V7SA 2V1UA 1KONA 5F2RA 4FSSA 2NYXA 3ULQB 1YVNA 2RK2A 3SBTA 2HZYA 1ETWA 2GWRA 3CC4Q 1XPXA 5KH6A 1FT9A 4OMMA 1RDCA 2EILH 2XDDA 1WQWA 1JTXA 4A0YA 1M3BA 1U49A 1E6HA 4XKCA 3O9UA 1ZBSA 2HOSA 4B1XB 1X9SA 1E4GT 3TQ7P 3EYIA 5I2MA 4RLQA 2A5YB 2ZPEB 3LWHA 2KFZA 1OCPA 4K43A 3TAPA 3O3FA 5J3BA 1ZG1A 2A6EF 5B5EC 3KYLA 2GTDA 1OCZH 1YJNA 2QEXA 3BOQA 4NCBA 5J39A 2ZJPF 1TUUA 1M1KR 4Z02A 2AO9A 1NJIR 3DLGA 3SWNC 2HYJA 4FWNA 1QVUA 4BRQA 2MLGA 1MSEC 4LE9A 3U2RA 4KMFA 3RPUD 3DBRB 4YPRA 1V54H 1VOMA 4QPQA 2K57A 2VG5A 3RTRA 3OS2A 1QCOA 2YNFA 5K5QA 4WYBA 4FM4B 1UJ0A 3VGMA 2KP6A 3H5AA 1ZA1B 1D0YA 1OR7C 3PY8A 2RO0A 3CM5A 4KIBA 1BW5A 5KK1A 2RQRA 3ZX0A 5AQNA 3V1RA 3CCRT 4W5NA 4A69C 2FG0A 4W5OA 4BHCA 3UNGC 1P2FA 4ZJZA 1CZAN 2VKVA 2VUBA 4A5AA 2QUFA 1WHUA 2EV0A 1YNZA 3GL1A 1UOCA 4M3GA 3Q9VA 2YPRA 1I94K 4AC0A 1BUPA 1XHZA 4ZDOA 1QE1A 1FIPA 1REVA 2O9VA 5E8IA 4J7FA 1IG8A 3VA3A 3ZSQA 1QVGP 2FBXA 3K2PA 5IP7J 3CO7C 4JD2B 1S5LC 2GLOA 2KJBA 2QXFA 3SXYA 2LR8A 4G1QA 1BI1A 1Q82O 5CVJA 3DEEA 4KBMB 2GXBA 3UF4A 3ZP5A 2DJNA 1YJWT 1EETA 4UV8A 4BC3A 2ZPIB 4GVMA 5BR8K 2EWSA 3TSZA 4OMQA 1NLOC 1X9WA 2FRYA 3JB9J 4CGGA 4HNUA 2X6SA 3SJHA 4JZ4A 3HYIA 1BIBA 1Z3YA 2YG9A 2LCCA 2XROA 5FPMA 1N3AA 1R36A 3DMJA 2NS8A 2O8XA 3QERA 2W25A 3M1FA 3CBMA 2LX9A 1LE8B 1VQKA 3SZPA 3V9WA 3SZTA 2Q2EB 3EGXB 1Z6TA 5M1PA 5AFUH 2QCOA 1Z9ZA 1R71A 4PQUA 4O5FA 1MBJA 3JCUC 3P8BB 2EYQA 3HJEA 4BU2A 3GNGA 2L2PA 2OU2A 1GLFO 3PQKA 5FD6A 4UNFA 3RRHA 3MD2A 4Y33A 1VQPI 3OW2M 4Z4IA 3HM8A 5ECAA 2IC3A 2CWEA 3N5NX 5FLXE 5GAGP 1VQMA 2PVDB 4CCLA 1YI2Q 3GX4X 1RTIA 4L9NA 2Y0SA 1YIJA 2EIFA 1RDDA 4WXCA 3V7RA 4CCJA 1TKTA 2ZXWH 1KU9A 1FMVA 4BBSJ 1MUZA 4CK2A 3K0SA 1H8KA 4E0DA 5D6WA 2O8EA 1UHMA 2PI0A 4X66K 3E9LA 3K5MA 4DMNA 3J81K 3OSSC 3N97A 3C6TA 1LCUA 1UTIA 1VQ9Q 2LQWA 2FB7A 1USSA 3VWBA 3T69A 3FK6A 3ISPA 2MSYA 3SAFA 1TQIA 3SV3A 4RGUA 4A62A 4M7AG 3OMYA 4CE9A 5DTDA 4F16A 4HTLA 4W5TA 3CCMI 2RI3A 1OU8A 1TU0B 4UC4A 3S2DJ 4FT2A 2H56A 3L4QA 5GAN3 3WNGA 3N4MA 2XF5A 3F2KA 4YY3K 2V8KA 3U3GA 4XRMA 2XKOA 4M3XA 4DZJA 3CHWA 3L6QA 2WAQN 4L9VA 4EMKC 5E84A 2JUCA 1EBMA 4QSHA 5DLQE 1NE8A 3ZQFA 1N32K 3IKMA 2VQHA 3F8FA 2YSRA 2J06A 4M3EA 3P5JA 5LJVA 4OJRA 4PA1A 3CCEQ 4UUSA 1K1ZA 2EGAA 2G8UA 3PIOF 4H0YB 3LDLA 3KLNA 1VQ5N 3KP7A 2YUNA 4GYIA 3G6EI 1STZA 4Q5WA 2GOMA 4IO9L 3VYSB 2DRMA 4DOWA 1MUYA 1IN7A 5ICGA 5J8CA 4JI2K 2E2IJ 1TWAJ 4I0AA 4DBFA 2HSTA 3R4KA 2O61A 4BI8B 3NAEA 5JFRA 3ROUA 3QSUA 5E3MA 5HDNA 2VE9A 2Y30A 2CV1A 3QB0A 2HXOA 1D3YA 2M3AA 1Z26A 4M77A 4XRSG 1FLIA 3OS5A 2KBTA 2NUPA 4KH1B 3DBLB 4DQPA 4FJ7A 3VQAA 4B1ZA 2NRRA 3JAMO 1B34A 4QTRA 3GF5A 2QWOA 4RAGA 1Z21A 2KL4A 1XS9A 3WE2A 2H3JA 1R59O 3ZMUA 1JL1A 1SV5A 3KCCA 5GPAA 1YS6A 3I9QA 3H92A 4E47A 1XUPO 3P31A 1QVTA 2B0LA 3FRNA 4JJCA 4M78B 5EC7A 5AQZA 4FLUA 2HHQA 2HWVA 5TKYA 4UOBA 1WFXA 2MC3A 2L9VA 5TGTA 3GW2A 5H6QA 3QFPA 3M59A 1DUXC 1FBQA 5IWAK 3V8LA 2FEIA 1HSQA 4O8KA 1REPC 3CCLT 2DFHA 3TP0A 3CMAT 2FPDA 2DTIA 4TV7A 2MI6A 2HXIA 4LF8K 4JI3K 4Y7NJ 3AA2A 4DTSA 3NVMA 1JKPC 3KK7A 4FQGA 3SUQA 1RRSA 4I01A 4FK4A 5KYNA 2VJ4A 2K3XA 5J3LA 3EKUA 1IXDA 2K3PA 2HPMA 1X2NA 2K4JA 2K9QA 4IUVA 5CKHA 3G4SQ 2CGLA 1O7LA 3GG4A 4Z4CA 5FKMA 2PLYA 3H5RA 4Y1DA 1SD5A 5GAMh 3IRRA 1JLAA 1U2VA 4W5QA 1IC8A 1WJQA 4MDXA 3SQ0A 3CFPA 1VA7A 3FZFA 3I8DA 2LT1A 5DM7F 2F8SA 4M7AC 1QHHD 1KQ9A 3FKIJ 1OEBA 4MTDA 2B86A 5AT1B 2W0ZA 3NF9A 2P7CB 1JLCA 5GAMe 3MKWB 1YVUA 4FW2A 2QEXT 1K4US 2QDYB 2DY4A 3CCJI 4U7BA 4AIJA 1GFDA 3I0XA 3TEDA 2FPEA 2QW9A 3G4SN 1K73O 2HHTA 2DXBA 3AG2H 3CCSN 5B1BH 4H0XB 4WQ5C 5JLFA 1OH5A 1WH5A 1NBEB 3QYEA 3LDSA 4OKKA 1QSLA 2CUFA 1IN4A 3MEEA 1UB4A 5HNHA 2HQEA 3VOVA 2K5CA 2W48A 3VS3A 4PJLA 4AHSA 3CCVI 1K8AU 5HLTA 3SBGA 3SWNA 2JRTA 3M0UA 2UXDK 4C8MA 2E1MC 1J75A 3CJNA 1VFCA 5LEKA 3CYMA 4N4OB 4FVUA 4D8KA 1JLEA 2AKKA 4CD1A 2HDWA 1HYZA 3ENHA 2YS9A 2E10A 4JRKA 2MYSA 3CXCS 2RM4A 1YQKA 1UG1A 5BN9A 1I8FA 2F2WA 3F9KA 4HDVA 3VGLA 1ZRFA 4ME7A 4CHOA 4AHCA 1Z77A 1UE9A 2ID6A 1X58A 4JX4A 3G71N 4U87A 4LNPA 5BR9A 3TU5A 2DZ9A 2GM4A 1HMVA 1AZGB 5C3EJ 5EDNA 3QYFA 1BJAA 1RLQC 3FXJA 4KITB 4I6MA 4HKEA 3FXQA 1NK2P 4DBQA 4C8QG 3EGUA 4GBQA 5HRPA 3QG1A 2RC4A 2EYXA 1UHSA 4ASNA 1QVFS 2Q2RA 2YRDA 3NGPA 1BO5O 3N0UA 1W6XA 5F64A 1B3QA 2R7RA 1HPMA 2W6KA 4BJ5C 5EOYA 3NF6A 2CYZB 4UVBA 4KTWA 2BOLA 3I59A 4FCYA 2OCEA 3RYRA 2FRWA 2DIQA 4ICLA 2LKXA 1SVOA 2ZCWA 2DDBA 2M16A 4DV7K 4DTJA 3QIOA 4BRAA 2Q1ZB 2PEXA 1NK6A 1TNTA 2KYMA 3T19A 4WFNL 4R56A 3DU5A 2EA2A 1NOZA 3HPHA 1SKSA 4FASD 1FY7A 2G0EA 5CJ9A 1AZEA 3E5XA 1EA3A 4EPCA 1T0JA 3EYZA 3OSGA 1VYTA 4PKCC 1S6QA 1W7AA 1SHGA 4DBRA 3W0LA 4RAZA 2PVGB 1LOTB 3OOPA 4HQEA 3AG4H 4FYWB 3HL2A 2P9NA 3QP6A 1C0UA 4KH6A 1LAVA 3VA0A 3TQNA 4JZ3A 1RBUA 2P9KB 4LOCA 5ILUA 2D0AA 4HXJA 5DMRA 1TV6A 4DSFA 3HJFA 1NYFA 2QG9B 1Z25A 3HYFA 3W3DA 1CXQA 1KAYA 3GBQA 3VQEA 4G6DA 5HRRA 3F73A 1B6AA 2UWMA 3MWMA 2R7WA 1IUFA 2XDPA 1YYVA 4CHQA 4YDUA 3U8XA 2QEXN 5CKTA 2R5YA 1YIJI 1KQ8A 1SD4A 4DNCA 4AHUA 4DV4K 2QA4I 3G71Q 1GLJO 4UY8I 3MP8A 5F0HA 2OTLT 4LD5A 3M7GA 2M4GA 3RMCA 1QP2A 2JTMA 4GRIA 1UECA 2HL3A 3ONQA 4LB6B 2O9SA 3AO4A 4E9HA 1TZLA 1VSHA 3QIIA 3A2FA 4G7OF 1VAZA 3RBBB 3AGRA 4A5BA 3HI0A 4CECA 3C2HA 1D09B 2E3IA 1HKSA 3OB9A 3C12A 4LY7A 5J26A 4OLBA 4B1UB 3H9QA 5LBQA 3DJCA 2LFBA 3ESWB 2EQUA 2NS7A 3KLGA 1L3VA 4CEOA 3IP4B 3G2BA 3AGKA 2QAZA 4ISGA 4NL3A 4AIHA 3EDPA 3CC2Q 3H3UA 4WF2A 2GV9A 3K9KA 1T6CA 2EFWA 5FFXA 1WXUA 2FX0A 2L9SA 4EATA 1IDZA 1KC8U 2ECCA 2A0FB 1Z1DA 3H9JA 2P0WA 1TS9A 5IT9E 2WWYA 2ZD1A 2QWLA 2NNYA 4HTUA 3VB2A 3SPZA 5CR4A 1Q81C 4PWDA 3Q3SA 2V7FA 3G6EA 1BBZA 3CDIA 2BUPA 2DA7A 4CJQA 3I55T 1JUSA 3AARA 3ZYYX 2DO3A 1Y96B 4ATOA 4I6ZA 3G4SI 4A12A 3M3YJ 1U1TA 2YHBA 3KP4A 5AFUA 5KYXA 1GLCG 1ITYA 2A36A 3RZDJ 2Q0OA 1OQYA 3LNQA 4CGIA 3V4IA 1HX1A 3CMAI 3CCEA 3HOUJ 2HMPA 3J7AY 2ZWHA 2HOTA 3UPUA 5FKNA 3HPGA 3OIQA 2R93J 2PFUA 2ZXIA 2HZDA 5CYQA 2HVIA 2QA4N 2M8GX 2D1VA 4IHWA 1U84A 1TWHJ 1PSFA 1A36A 1TGOA 1WNSA 1HPZA 3K2AA 2GIVA 2VCPA 1LQ1A 4BRMA 5SZTA 2F6CA 2NUTA 2HPIA 1G2BA 2O31A 1RBRA 3FC3A 3HL8A 1I5LA 3HRMA 2ZSHB 2A1SA 2JMWA 2KDZA 3VS1A 2Z1GA 1NG7A 3BTLA 2KVQG 3GE1A 2WV0A 1QCFA 3THYA 3DWLE 3CC7Q 3CCVN 4QAGA 1OR7A 2EA4A 1M3QA 5BPMA 4I7HA 1NTCA 4C8QB 3TBIA 5M1FA 2BVMA 1NK0A 3LFKA 3BG3A 4JRQA 5E17F 2KDOA 1EXQA 1TL8A 1XDSA 4XTWA 5E79C 4H5VA 3M4YA 2YHAA 2DYRH 4K2EA 3F8NA 2WA0A 1W5TA 2E35A 3OIPA 4Z4GA 2ELJA 4GO1A 4BEHA 3JCMW 2Z3YA 4U0WA 3MEXA 2P9NB 2H6BA 1WHMA 1VSJA 3C6UA 4KYWA 3IMXA 4GDFA 3CCJQ 2LRDA 1A04A 1HK9A 3L2CA 4G6QA 2W41A 3C6HA 1Q1VA 4CEFA 3NTKA 3U4LA 4M4ZA 5F1JA 1XGSA 3HT3A 1TKXA 2CFOA 1S7AA 2R0QC 1SMTA 5EG0B 4XH5A 2ZPHB 4EMGA 1NGGA 4XRFA 3HM9A 4A53A 3NFCA 2W42A 3C0BA 2OPPA 1JJ8C 2QSFX 1J7KA 4FL9A 4LF6K 1Y07A 1QVFA 1ATSA 3VDXA 1UG2A 4PZJA 2BY3A 4LF5K 1ETYA 4GGGA 2YX6A 3F10A 4MIMA 2F5TX 4DR7K 1TOVA 3PNWC 2STTA 1C1AA 2A68F 3KTUA 5KRTA 3CDHA 3A0HC 2OZMA 4GY5A 3M53A 4CHNA 3CDLA 5JHFA 4BE2A 2NRAC 1V76A 2W84A 3D2EA 2IGOA 4PGHA 1XMKA 4IG0A 5KN9A 3V1OA 5GP9A 3MN7A 1WXBA 1UELB 4Q4ZF 3M07A 4P9UA 1UGRB 2LK2A 3P1GA 4A0ZA 1M1KO 1JKOC 3THWB 3CXCA 4C92E 1KG3A 1GXQA 1BA0A 3HM5A 4NCAA 2ESHA 1H92A 3REBB 2GUIA 4ISFA 4PL6A 2FBYA 3GZ6A 3ABMH 4LUEA 2A5WA 1WIEA 1G2HA 2QQAA 3TAQA 1VQ9N 4RM2A 3E6CC 1FTZA 4KRTA 1X6BA 3I56I 3EG3A 3E9GA 4BXXJ 2KQ2A 4DQSA 2FU4A 3VEXA 4CI6A 4C8KA 2ZXJA 2LOOA 4DBHA 2Y1JA 1XHXA 3C3WA 1YRNA 1I6HJ 3PSIA 2R7DA 1U78A 4J9FA 1J3TA 2X6NA 4LD6A 2LNHB 1HJRA 3E0JB 5C15A 4JRPA 3F9MA 3E2UA 3ML6A 5FB2A 2DERA 1SRLA 3I0SA 1YWOA 2M7AA 3HUGB 2YV0X 1M90O 4DU3A 1MU2A 4ID5A 4BQAA 4Y15A 4CZIA 2HDDA 2DVEA 4LH5A 4U0YA 2RV8A 4I2PA 2R7VA 3VPRA 1IO2A 1P8ZA 3OBYA 3I8BA 2LNBA 5JVGL 5I9EB 2D8HA 1PDNC 4CC4B 2DOFA 4DGWB 5LGNA 3KD1E 4E7IA 1AOJA 3HTRA 4X9CA 3S3NA 4AQYK 2O8CA 1O75A 1C0FA 1NKBA 2M4KA 1M5Q1 1AWWA 1TW2A 5HCKA 1PJRA 4ILJA 4KHWA 1NPRA 5DM6F 1T3LA 5IHNA 4CEQA 1VQ7Q 4YOWA 2BHZA 3HVTA 2RB6A 4PJOG 3CCJN 1RUWA 4E7HA 3HO1A 1IW7F 1QRYA 4GKJK 4P5OA 2M87A 4HUEA 2CZ0B 3TTDA 5GAN6 3ZPLA 1SAZA 3CWAA 3S6WA 3SUPA 1YI2N 4M7AE 1RT4A 2EVRA 1XC5A 4C92A 1WJCA 3E6DA 4M42A 3ULDA 4JOMA 2HBWA 1KEAA 5IYDJ 3B6PA 3M8SA 4M3TA 3I0WA 1RDWX 1P4AA 4YELA 2NLUA 1SFOJ 1VSEA 1Z67A 2LMDA 4B23A 3OIOA 1HW1A 1JJ6C 2KAFA 4ZYAA 3LOCA 3R6OA 1RAIB 4DSLA 3IH4A 3K59A 2ASMA 2AZVA 5DY9A 1KGSA 2LNVA 3ID6A 3TPQA 1JB0E 4HQMA 3CVTA 3CCUQ 4E9GA 4DOZA 3L0QA 3QQAA 1E7OA 2KHOA 4F7ZA 2IA2A 4O44A 1KC8R 2LVMA 1YTUA 4IBNA 4TSXA 2H1KA 1K78A 1QO0D 1GDTA 1WGSA 1DP7P 1ETXA 2E36A 2A7YA 2AZSA 1FP2A 4JP0A 2UYTA 3D2FB 2V6CA 4XNFA 4FWOA 1S72T 5AQXA 4UB6C 2BIVA 4FWQA 5GANe 1X4PA 2LH9A 2DX1A 4DV1K 5C2DA 2CP6A 4LUDA 3DKXA 1BU6O 4IG3A 1OPLA 1H1VA 2R57A 4XSXF 4RS8A 5KE2A 4RTVA 2CZ6B 2IDOA 1K9MU 2D0OA 1PM3A 4M3YA 1GCPA 2JQ7A 5D3GA 1RILA 2F5DA 2P9LB 2QA4A 4E70A 2DL3A 3BF1A 1M3HA 3BJOA 1VSFA 2ED1A 2L0AA 3ZL7C 2W10A 1A6IA 2KMUA 2HMIA 3L7WA 3AY9A 2E5ZA 2IRFG 5D4SA 1JJ2A 4YTLA 4D7NA 4MZMA 1YHQI 4F7UA 4BRFA 3KNTA 2K27A 1VSLA 4FYDA 3CJ7A 3LH0A 3K4BA 1L3SA 5AQFA 3U9ZA 3VSLA 1O9SA 5M1NA 1QP3A 2Q97A 3LPUA 1AU7A 3DXMA 1LE8A 4M3RA 2P9IB 1SL1A 3V9UA 1Q18A 4G7ZF 2KRFA 3VMFB 4EA4A 3EE9A 2ZXHA 4A54A 3LSKA 3SQ1A 2VOOA 5KRSA 4J7IA 4H0EA 2IS2A 4XLAA 4U67L 3FWEA 2NOHA 3WXKA 4FJKA 1V1CA 2D1HA 4J9IA 3C6AA 3SHFA 1OMIA 3HGGA 2NOEA 3LCNA 2DK3A 2CKKA 1M3AA 2JN0A 3QO9A 2O2OA 3ENOA 3RSEB 2K9MA 4CJPA 4FZXC 4M7XA 1K61A 3LH5A 2EZKA 2OTJI 4IOCL 5GMKj 4M75B 4A6DA 1KYWA 3I59B 3RYPA 4CZMA 2MOXA 1WI7A 2ZPBB 3T1AA 1M8MA 4CHZA 2QVOA 5GADP 5AQJA 2JTVA 3L2VA 3AVHA 2KGTA 4FPAA 1SZ2A 1D1AA 1I1SA 4XM3A 2M8EA 3CC7I 4HDUA 1VQOA 3WXMB 5AQKA 2M7BA 3KFVA 4NC8A 1NH3A 3QEPA 3NGIA 2OD5A 4KHSA 4M75G 4EMSA 3CPWS 4B8CA 1KZHA 3QEWA 3BROA 4D7MA 3G73A 2P9PB 4HAMA 1TUDA 1K83J 3H46O 2EFNA 1H8AC 3OL4A 3RERA 3CJTB 1M90U 4HX4A 2VPLA 4J2EA 4HF1A 2AJQA 4RCCA 3H1CA 4AT1B 1K76A 1OPKA 3AA3A 2IS1A 1ZBUA 4OAYA 3NH1A 3F72A 3FF5A 2JVGA 4B47A 3QEIA 4PNOA 3DPLC 4WCEL 3TI0A 1ZBFA 3O3GA 1YX3A 1HYOA 1QVGS 1R0CB 1B59A 1VQMN 2L89A