4E7HA

Pfv intasome prior to 3'-processing, apo form (ui-apo)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7hA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7hA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7hA03
4CJPA 3OYNA 3ZSRA 4FM0A 4ZTFA 3DM2A 2YHAA 1RNHA 4LH5A 4B9WA 1S6PA 2FC0A 5C42A 4F3TA 4Q5WA 1KVAA 3ISNC 3GOXA 4Z4IA 1T7PA 4K8XA 2E6MA 4KHUA 1ZBLA 1ZBIA 2DIGA 3H8ZA 3LP0A 1LAWA 4IUQA 1C0TA 1LAVA 4G1QA 2XY6A 3VA3A 3NAEA 4I2QA 1GOCA 1NKCA 4DLGA 2OYQA 3NFAA 3OS0A 3DB3A 1VSDA 4AH9A 3OYAA 1S5JA 1RBTA 4CF8A 3M9QA 4CJUA 1EKEA 4CGHA 3ASKA 2PZSA 4OKJA 1YTAA 4DQPA 3OMCA 5D6XA 5CYMA 5KRTA 3DLHA 4FJMA 2D0BA 1C1CA 3F70A 3DLBA 2YV0X 2R7YA 4HTUA 1RDDA 4FM2A 4FJXA 4EP4A 4BACA 3B6OA 2RHYA 1ZBUA 4OVAA 5EU7A 2EQKA 1TKDA 3S3OA 3KLFA 1QSYA 1JL1A 3AVCA 4N56A 3NH1A 3PO5A 3AVIA 2IC3A 1WJQA 3C6UA 1RTHA 4RW7A 2X4XA 1JLEA 1N27A 3S9HA 2WONA 5C25A 1ZBFA 4QW2A 1DTTA 3AVAA 3U3GA 4UQGA 3V9WA 4BDPA 3OJUA 3CG7A 1JXEA 3CQ8A 4FZZA 3TAMA 1JL2A 1BL3A 4CJWA 4B9VA 4B9XA 2HQXA 4J2DA 4IG0A 2QQRA 5C6SA 4FLVA 1WSJA 4QQDA 2YKNA 3SQ2A 4GW6A 4JS4A 2PY5A 1KSPA 4C8KA 3MECA 4KHSA 3KLGA 3OA6A 3MEUA 4B8AB 1RT4A 1WSEA 3S3MA 4KB0A 5KE2A 1S9EA 3K5MA 4CEOA 1B9DA 3KK1A 3AA4A 4BWMA 1KRPA 5KTQA 4F8RA 2LDMA 3E01A 3DLRA 1TKTA 2R5AA 2X35A 1G5VA 3NGZA 4MFBA 2FHDA 4ZHRA 4DF8A 1JLBA 3C6TA 1RT3A 3NGIA 4ELTA 1WAFA 4F2SA 1RT6A 4IUPA 4FJ8A 4FJ7A 3OYIA 2B6AA 2O4XA 3MXMA 1WSFA 3WNGA 4W5RA 1YVUA 2R58A 5E41A 1OYXA 2DIQA 4N47A 5HRRA 1BQMA 3CM6A 1XHXA 4QAGA 3O3HA 4CHNA 1A5WA 4CGIA 2OA8A 3OB9A 4DTMA 3LAKA 1IO2A 4DTNA 3L2RA 4WE1A 2D0AA 2FBXA 4A4FA 2RHIA 4BWJA 3M8PA 2I5JA 5CYQA 1FK9A 5KI6A 1BI4B 2VG5A 1NKBA 4FW1A 4C8NA 4C8LA 2G8WA 3CEYA 1BI4A 1SUQA 3I0RA 1EP4A 3AVNA 1D9DA 4DQIA 3QBYA 3HPOA 5KE3A 2GUIA 1TKZA 1LW0A 4E7LA 3HYFA 2IDOA 4KPYA 4JRPA 1D8YA 2CKKA 3K2PA 2A1SA 5FRNA 2GFUA 5HRPA 4CJLA 2G8UA 1NK7A 4DFPA 1KLNA 2YNHA 3HO1A 3G10A 1Q8IA 4BE2A 2G8VA 1TL3A 5CZ1A 4HHTA 1IKYA 5HLFA 1R0AA 1REVA 3AVKA 4RW4A 3O8VA 3KK3A 5D3GA 5J39A 1RILA 4DU4A 2XY5A 4PL6A 3ZSYA 4IFVA 4DU3A 1N6QA 3NCIA 4NCAA 4RG8A 4J2BA 3U3YA 4E7IA 1TL1A 2QKBA 4RG2A 3L2UA 1K6YA 3SJJA 3D45A 1MU2A 3VQPA 2KZMA 3ALYA 1X9SA 3O3FA 3QNOA 1HYSA 3TAFA 1IKXA 1G15A 2X4WA 1H3ZA 4E7KA 3NH0A 2LVMA 1UWBA 1RT5A 1A5VA 4CJSA 2GFAA 1SL0A 4FJKA 3OYDA 3LDSA 3KD5E 4FYDA 2Y1IA 2X74A 1NK4A 4DMNA 3AVMA 3TARA 2D9TA 2L89A 4LSNA 3QEVA 2B4JA 4B3OA 3RTVA 4M3ZA 3PX4A 3ZSXA 3NNQA 4KV8A 1U45A 4B08A 2F8SA 3JSMA 1JXBA 2HNYA 3SPZA 4GY5A 4C5HA 1U47A 2HHQA 5CY4A 3UT1A 3OQ5A 1IG9A 4CEZA 2IS3A 3AO5A 5HRNA 2BIVA 4QQ6A 3MAQA 3V4IA 1U4BA 1SKWA 4LY7A 2KQ2A 3CFRA 2K3XA 1OZ3A 3HPHA 4JLHA 4PUOA 5HP1A 1XI1A 2IG0A 4GMJB 4QOZB 4OLBA 1HMVA 2DY4A 4ELVA 1TK5A 4KTWA 2OZMA 2F96A 3EY1A 5JS1A 4IUUA 4F3OA 4C5GA 1C0UA 1WNSA 3SV3A 2OPPA 3VQBA 3KD1E 2ETJA 1YT3A 1VSFA 2OPSA 4CFCA 4B8CA 3MEWA 1SL1A 4ID1A 4CJKA 4CK3A 3SYZA 4B9SA 1ZYQA 4KHNA 1RCHA 4BE1A 3VQ7A 1C1AA 2RI3A 3C95A 4QCLA 4J2AA 1QE1A 4DSLA 4CK2A 4Y1DA 2X4YA 1CXUA 1J53A 1S1TA 1U49A 2E5QA 4R5PA 1VK0A 3RRGA 4PLLA 4OGEA 2BDPA 3UWNA 3L2WA 3AO3A 3MO8A 3S3NA 4FLYA 3LPUA 3MP6A 2A1RA 5KGXA 4DSIA 1VRUA 5DMRA 1L3VA 3P5JA 4M3UA 3P8HA 2YHBA 3KUFA 1T05A 4ELUA 1CZ9A 4XIUA 3OYKA 3A2FA 4CIGA 2KTQA 3E9GA 1VRTA 1BISA 1WLJA 4KKOA 4W5NA 1WN7A 3QKJA 2G3RA 3VQ4A 4KREA 3DB4A 1NK5A 2EX3A 3HT3A 1IKVA 2AJQA 4ICLA 4Z02A 4M42A 3QEPA 3QNNA 3SCXA 1U04A 3NF9A 4N4GA 3V1OA 4FJ5A 1HPZA 4FJLA 3TR8A 3L42A 2G8HA 3KLHA 1BCMA 1ASWA 1S1VA 1VSMA 2LCCA 2F8TA 3OYHA 1ITGA 2YNGA 1X1PA 3PUFA 3AVFA 2HW3A 4FLZA 1Z26A 3KKSA 4ZTJA 4E1NA 2RJEA 3L2QA 3V9SA 2E6NA 1Y97A 2OPRA 1WJSA 3SQ1A 2GBZA 4KHQA 2BE2A 1D9FA 4X34A 4FK2A 3BDPA 4JRQA 3LP1A 2RN2A 3ZSQA 1LWFA 1IH7A 4Z4CA 1VSHA 1L3UA 2G8FA 2FBTA 4Y1CA 3SUNA 3QETA 3OYLA 3ZSOA 3LPTA 2QKKA 3O3GA 1NK9A 3LP2A 2EQMA 2X6NA 4L8RB 4CJ4A 3LALA 4FJHA 3MP8A 3G0ZA 4M45A 3VQQA 4I9QA 4AILC 2HNZA 4BE0A 4E19A 3SQ0A 1UAXA 1NOYA 1D5AA 3V1QA 4N76A 3V9ZA 1JLAA 1UA1A 3KJVA 4FZXC 4CHQA 3MP1A 4DSEA 3HM9A 4NCBA 4EDUA 1UOCA 4Z0UA 5KRSA 3P8DA 4HCCA 2VG6A 3RRHA 2KZZA 3VQ8A 3IG1A 2HB5A 3HPGA 3AVHA 4DFKA 2ZD1A 2XDPA 3QIPA 3HP9A 1TKXA 3OY9A 4KI6A 3OMGA 1KCFA 2RJCA 2YKMA 3NTHA 2P51A 2DAQA 1J54A 4EZ6A 3HVTA 1GOBA 2RKIA 4DQSA 4EP5A 4CIEA 3QINA 1BGXT 1X9MA 4PWDA 3SQ4A 2NLUA 4W5QA 3DRPA 4BD3A 1HJRA 4CIFA 1NJYA 4CF9A 4CFAA 4KHWA 3RR8A 5IN1A 1T03A 4JS5A 4BDYA 4LSLA 3FFIA 3L2VA 4DTPA 3TABA 5K14A 3K5NA 4QQGA 3LWLA 3QLHA 4B9NA 3LYIA 3HVRA 3PX6A 1KVBA 3P83D 3FDRA 3CFOA 5KH6A 4C5EA 4CECA 3HJFA 4IG3A 4KI4A 2VYTA 4CF2A 4C5IA 2EHGA 3SUQA 4M3YA 4CF1A 3MEEA 2IAJA 4CHZA 4OGCA 3VA0A 3IRXA 1FXXA 3BGRA 1HRHA 1HNVA 1WSHA 4KTQA 3TI0A 2GV9A 1I3AA 2ZE2A 2BUDA 3AA5X 2M0OA 4KTZA 3K59A 4AHTA 4AHRA 4C8MA 4CK1A 4CEEA 2DFFA 1JKHA 3ZCMA 2L3RA 3ZSWA 3DLKA 4YFUA 2O4IA 3I8DA 1ZBHA 5HBMA 2QK9A 3NTKA 4PQUA 4IFYA 1RT7A 2BGGA 4CGGA 1QTMA 3H6ZA 3RWUA 3QESA 4LD0A 1BHLA 4OVLA 2HVIA 4CF0A 4HVJA 3U6FA 2P5GA 4OJRA 3KKRA 3Q1JA 4FLWA 4BDZA 1X9WA 3JYTA 3ME9A 4E0DA 4O0JA 3NF7A 1CZBA 1RBVA 1SKSA 4CFDA 1RDCA 3V6DA 3DMJA 2BANA 2E4LA 2R57A 1QQCA 4KRFA 1W9HA 2LTOA 4CJVA 2IGIA 2O4GA 1RI0A 3UIQA 2KFZA 1KHCA 4A4HA 1SSFA 3OS1A 1VSLA 1HQEA 4Z4EA 4I2PA 2Z1HA 5SZTA 2RJDA 3V9XA 4II1A 3VN5A 3K5OA 1HQUA 3QIIA 2EFIA 5J2NA 3MEVA 2ZQBA 4FM1A 3AO4A 5DK5A 4KB1A 1FKPA 4M3WA 3L8BA 3MEDA 2JGUA 1BQNA 4CJQA 4CEAA 3C4SA 4FU6A 4RW8A 5J2QA 2HHWA 1KLMA 2Y1JA 2XRIA 4DQQA 2P0KA 2HVHA 4OKKA 3ZT1A 4KAZA 4DTJA 3VQAA 3O4QA 4QVZA 4H4MA 4GVMA 4FLTA 1LWEA 3NDKA 2B8AA 1XHZA 2WACA 1YTUA 3NHGA 1XWLA 3KIOA 2RHXA 1HNIA 4DSJA 1UA0A 1S1UA 4EZ9A 3H08A 4IBNA 1JLFA 3NGYA 4N41A 2MWPA 3AV9A 2LSNA 5M9OA 3VQ9A 4PY5A 3QJ6A 4I7FA 3SNNA 3QO9A 3FLGA 3AVJA 3AA2A 4CRIA 3HK2A 3CYMA 1LW2A 1ASUA 2FBVA 1KVCA 3RMDA 3QEWA 1VSIA 3LX7A 3TAEA 3L3VA 1CLQA 1TK8A 1J9AA 4DLEA 3M8SA 4DTXA 1C1BA 1EXQA 4O44A 3QERA 5J1EA 3TAPA 2Z1IA 4CHYA 4OLAA 1ASVA 4FK0A 4LH4A 1W0HA 4DTOA 1XNIA 4E89A 2HNDA 1Z25A 2XO7A 3LZIA 2G8KA 4TSXA 4N5SA 4DTUA 4Z4HA 4FJ9A 2B5JA 3VQCA 3MXIA 4F2RA 1OI1A 2QXFA 5T7BA 4HUFA 1NK6A 1C6VA 2RF2A 3F73A 2ATQA 3DRSA 4AHVA 3PY8A 3K58A 3ZT3A 3LANA 1WJRA 3NE6A 4CGFA 1NJXA 1Q9XA 3VQEA 4B9TA 1VSKA 4AHCA 3WNEA 3KLEA 1Q9YA 1JLCA 4CEQA 4UC4A 1NJWA 1TVRA 3DOKA 4PLIA 3O4NA 4CESA 4KHYA 1RDBA 1WGSA 2JTFA 3D0PA 4RW9A 4DSFA 4DSKA 5KGWA 4J2EA 3NH2A 4H4OA 3DYAA 4IURA 4CJTA 3CM5A 2M16A 4CEDA 1HYZA 4FJJA 2OZSA 1NOZA 4OPJA 3M8RA 4N4IA 5D6WA 4NYFA 3BDLA 2X6SA 3OYFA 3MEAA 3OYGA 1WSGA 3KLIA 4RW6A 2EQUA 4OPKA 3PX0A 3FEOA 1SV5A 4NS5A 4E7HA 2F5KA 4O55A 2ITGA 2VWJA 5KCOA 2HHXA 3DI6A 3NBPA 4YNQA 1XC9A 3LP3A 5FRMA 4IKFA 2E6LA 2RO0A 2MWOA 3F9KA 1KFSA 1NKEA 1QHTA 4FZYA 4CJFA 3AO1A 3PO4A 2FBYA 2XY7A 3RR7A 4FK4A 1KTQA 2Q3SA 3THVA 3EYZA 1RBSA 3DOLA 3V9UA 3VQ6A 3PV8A 4HCZA 1RTDA 5SWMA 2XK0A 3K5LA 5CIUA 1QSSA 4HCBA 4IDKA 2RHUA 4PA1A 1BCOA 1KFDA 5KCHA 3P1GA 3ZT4A 1S1WA 3VQDA 1IKWA 1TGOA 3ZT0A 4CFBA 4FJGA 4DS4A 4O0IA 1NK0A 4A4GA 1L3TA 3ASMA 4DG1A 2D5RA 3RMBA 4FJIA 2VG7A 2DFHA 5FROA 1I39A 4KFBA 1MHNA 1RTIA 3L3UA 1JLGA 4FVMA 3LLRA 5FDLA 1L3SA 4FJNA 3AVBA 1SKRA 2RI5A 3RMCA 3OYEA 4E3SA 4K8ZA 1B9FA 3T1AA 4O4GA 3ZT2A 3MEGA 4DTSA 3AO2A 3HP6A 2KW4A 1B92A 1TAQA 1T8EA 4M3XA 3QEXA 4FW2A 4FCYA 4CGJA 3OYJA 4NZGA 3LH0A 1U48A 4CJ5A 1S6QA 2PYLA 3DLMA 1WAJA 4FLXA 3TAGA 2RPIA 4CCHA 1TAUA 1RT2A 4M3TA 1BIZA 3V1RA 5D6YA 3K57A 2O4XB 3AVLA 1N5YA 1LV5A 2R5MA 3HSTB 5J2PA 3LWMA 4FXDA 3AA3A 4CHPA 4I9LA 5CZ2A 3PMIA 1HYVA 4CJ3A 3LZJA 3WNFA 3I0SA 4CEFA 2RI2A 3META 4DF4A 4Q0BA 2IOCA 3DRRA 4M3RA 1RDAA 5HROA 5I3UA 3T19A 5J26A 2HHSA 1GOAA 3QEIA 2DFEA 1WSIA 1QS4A 4HUEA 2P5OA 5I42A 4KO0A 2NUBA 3V81A 3OYCA 4Q5VA 3SUOA 2K3YA 3SD4A 4DQRA 1BIUA 2JZ2A 2YNIA 3KTQA 3ZSZA 5J2MA 3OJSA 3ZEHA 2YRVA 2P1JA 4H8KA 5HRSA 4HUGA 3PMTA 4N4HA 4DFMA 4FLUA 2X78A 4ID5A 1L5UA 3QIOA 1JLQA 1O1WA 4OKEA 3SPYA 1RTJA 2D0CA 3VQ5A 4F4KA 3SI6A 4AHUA 1NJZA 4B9UA 1C0MA 3CFPA 2Z1JA 4DFJA 3E9FA 3HXMA 4Z4FA 2G8IA 4NYNA 2PYJA 5JS2A 3OVNA 2BKDN 4IUTA 1VSEA 2M1HA 3SV4A 4CE9A 3DLEA 1EX4A 1S1XA 3C94A 4C8OA 3NF8A 4M41A 1OZ2A 2XY8A 3TAQA 4W5TA 1S9GA 4FL6A 2JLEA 2VWKA 2GF7A 3ZSVA 3MXJA 3NF6A 1J5OA 1DLOA 2HQEA 4NCGA 2Z1GA 4O5BA 1NK8A 4LD6A 3EZ5A 1EETA 4DS5A 4CEBA 4IUVA 3AVGA 1LWCA 1DTQA 1TK0A 2DTUA 3M8QA 3T3FA 3IS9A 4E1MA 4CJEA 1RBRA 2XHBA 4Z4GA 2HHTA 2QQSA 4B9MA 2PQWA 3TANA 3LGFA 3TWHA 3ULDA 4MQ3A 3OYMA 3B6PA 1FKOA 1QSLA 1A5XA 2YNFA 2HHVA 3FC3A 3PFSA 4CERA 3LGLA 4CHOA 2RJFA 3SUPA 3OYBA 5C0MA 4CGDA 4DU1A 2HMIA 2RHZA 3DLGA 4CJRA 1RT1A 5C24A 4W5OA 1VSJA 3PNWC 1SL2A 2WOMA 4B9LA 2L8DA 2EKOA 2HHUA 4DWIA 2LRQA 2OPQA 3LAMA 3NTIA 3EAEA 3HL8A 4AHSA 3OS2A 1RBUA 3KK2A 3WNHA 2W42A 1F21A 4DTRA 1TV6A 5IAYA 3S6WA 2KFNA 2EQJA 1CXQA 4A4EA 3IAYA 4E7JA 3SZ2A 4L59A 3RMAA 3ITHA
chains in the Genus database with same CATH superfamily
1IRFA 3S32A 4C2MJ 2KYMA 3M7GA 3CXCP 4J7FA 1NU0A 1MMAA 3ZCOA 4XKVA 2HNIA 3WU0A 1U8BA 2XAFA 5C42A 1YS7A 1K73U 4MDBA 5EZHA 2YHTA 3FXOA 1KVAA 2P0QA 5GAMg 3QHSA 1WHKA 2E6MA 3JB9J 4KHUA 1GLAG 1ATSA 1XOVA 2PG4A 2VXDA 3REBB 1LAWA 4IUQA 3D1NI 3HTUA 5LFAA 3AFHA 1LAVA 4G1QA 2CYYA 2RNAA 3CJRB 1WHJA 3NAEA 3A0IX 1NKCA 1TQPA 1I07A 2O9VA 1I5LA 2VIXA 2IAIA 2ICWG 1U84A 5FKMA 5K5RA 4AH9A 3OYAA 1RBTA 3BG6A 3KFVA 4CF8A 2YU9J 4M78E 1BA0A 1VIFA 1MBKA 3SYTA 4G7OF 1XQPA 2PJPA 3GEZA 1ZLJA 2QENA 4GYIA 3U23A 2JVHA 4HW0A 5CKEA 4QVCA 4DV3K 3I58A 3OMCA 5D6XA 5F64A 4RAFA 1IRXA 2D0BA 3J7ZI 4JKBA 1PUFB 3LCNA 3F70A 1PVSA 1V5EA 2HL3A 1BI0A 3ECOA 1X2KA 4AM3A 1RDDA 1EO1A 4BC2A 1HKBA 1WUAA 5AZIA 2JRTA 1DUXC 3B6OA 2RHYA 1R23A 2QQAA 2O8EA 1FOWA 4OVAA 4ZDOA 1TKDA 4KDPA 5DPKA 3EFRA 2KRMA 3EL2A 1QSYA 2HYGD 3D5RC 4E9GA 3TEEA 2WAFA 3UF4A 1HJDA 5CKBA 2DOFA 4EA5A 5DD8A 2MD5A 3R6SA 2UXNA 3AVCA 1B8IB 2EYYA 3NH1A 1KD1C 1QRYA 1HU0A 3R9PA 3AVIA 2IC3A 4E7ZA 2NS7A 3NARA 3AL0B 1WJ5A 1RDUA 1YHQA 1T56A 3T8RA 4RW7A 3G6EA 1Q81R 2E2JJ 1N27A 3D2EA 4QLCU 4JKEA 3OW2P 2A68F 1N5ZA 5GAN7 4IXAA 3H92A 1H92A 2WONA 5C25A 5HLHA 1ZBFA 3WGGA 4RM2A 1WRJA 5EJCA 5L3BA 3CG7A 3G1OA 3TAMA 5A2QK 5JLWA 4FPAA 2F9WA 1YS6A 1BL3A 2HQXA 4BC4A 4MHGA 5AQYA 2VCPA 4HX7A 2XF5A 2L9RA 4QQDA 3E9LA 3CF5F 3SQ2A 4GW6A 1I50J 2JPCA 1KSPA 4CCNA 4EMHA 5LL6Z 3LDOA 2XV4S 1ZLKA 2ID3A 1H3HA 3ZOBA 2OAUA 3ENHA 3CUQA 4B8AB 1WSEA 3RERA 3EO3A 2ZPHB 1JT6A 2HTJA 2VLAA 1FWZA 5KE2A 3FIWA 1O4XA 1B9DA 4JBAA 3KK1A 2K4YA 1KRPA 4KN7X 2ZJQL 2LDMA 3E01A 1TKTA 2VVKA 3QDKA 1UFFA 2B63J 4MFBA 5HVQC 4ENJA 3Q3SA 2DYRH 2EYWA 2WTEA 3BLYA 2AXTC 1IN8A 2X85A 2ZJPL 2GOMA 5IOZA 1GLFO 4UVAA 3G25A 1ZBJA 2KI7A 1RT6A 4IUPA 4JLIA 2VOPA 2B6AA 2VONA 5GADJ 1RUWA 1T6CA 5HDKA 3WNGA 1T0JA 1SZ2A 4OWRB 3I5RA 5AR0A 3CCET 4B3RK 2DIQA 4JI3K 1D0ZA 2CJJA 1VQPT 5GANj 5LBQA 2KJBA 3D2FB 4PSXA 3CCVI 2PFUA 3VYSB 4IPAA 1OH5A 4XLFA 3CJ1A 4LLNA 3LAKA 2YR2A 1EJ9A 3C7JA 1ZQ3P 4JX5A 5DCFA 4CZZA 3S1NJ 2RHIA 3VF4A 1DQUA 4BWJA 3HG9A 3KBGA 5CYQA 3ZLJA 2K5FA 3A8OB 5GAMh 4BR5A 3A02A 1FK9A 3KLOA 4IIMA 4KIGA 5AYFA 1Y71A 3I0RA 4OINF 2GNCA 1O57A 1VQKI 5D7UA 3M0UA 2EV6A 3C0CA 3HPOA 3FK6A 1JJ2S 2RGVA 4ABZA 3CCEQ 2GQQA 3THXA 1LW0A 1M1KR 2NS0A 3BG9A 4E7LA 2P9UB 1VQPQ 2DJNA 5FRNA 1FP1D 5HRPA 4CJLA 5M5YJ 4MZMA 1NK7A 3HO1A 4BE2A 1WGXA 4PJNA 4ELZC 2HZDA 2HKNA 4B43A 4UVCA 4XU3A 1REVA 3AVKA 4DEYA 5LMUK 4JHDB 2E1OA 3U9ZA 3HOXJ 5D3GA 2CUZA 1XNQK 3F2KA 5BPLA 3QBXA 2YJEA 3ZSYA 1N6QA 2I7PA 1SVMA 3IUOA 3URGA 4RG8A 4BG9A 2RQVA 3Q5FA 2VPRA 2ELHA 3L2UA 1K6YA 1XX5A 2CP7A 3CPWA 2V1XA 3SJJA 2UUAK 3D45A 3TREA 1NJIC 1ZUKA 1KQ2A 3O3FA 5GMKe 1D0XA 1E4GT 3VKIA 2KL4A 1SVLA 1H3ZA 4DR2K 3QWYA 3I0TA 3UA6A 3A5OC 1GT0C 1RT5A 4D7NA 5EY4A 1JHFA 4FOEA 2KLAA 4KGXB 4C0ZA 1Z7UA 2QWQA 1W4MA 4FJKA 4RLQA 3OYDA 3KD5E 5I11A 4F9OA 4I0BA 5B1BH 3AVMA 2L5QA 2ED0A 3LWIA 1VFCA 2L89A 2B4JA 2V6EA 4XQFA 2AXLA 1QLYA 2YXYA 1QA6A 2GGRA 3CC7N 5IHIA 2F8SA 2IGMA 1JXBA 4XRMA 4ME7A 3LSTA 5GAHJ 4X66K 1O7FA 1WH5A 5IXBA 4M78B 1OCPA 4BQNA 1IG9A 1J2XA 3AO5A 1BC8C 4OMOA 3CPWS 1FEXA 3C0BA 4JYAK 1M4ZA 4CC4B 3MWTA 3TW6A 1NMDA 5K5OA 3SBGA 3ERMA 3T0YA 1YNZA 4JLHA 3C7NB 1W36D 3G71I 4ZNXA 4FL9A 1XI1A 4QOZB 4IOCF 2KEAA 4ENNA 4YELA 5GJVB 1HMVA 2DY4A 2M9HA 3L4IA 1T0HA 3M57A 1J5YA 1TK5A 2YG8A 3F21A 2JXBA 1ZGWA 2OZMA 4A3GJ 4KHPK 3WXIA 2COBA 1T6SA 1L3LA 3EY1A 3CD6A 5JS1A 4IUUA 3LFKA 3SV3A 4DZJA 3WODF 1JGGA 2XB0X 3KD1E 2ETJA 4B8XA 2WSEE 4E2FB 2OPSA 4CFCA 2DPDA 1QZ6A 1MUZA 1Z91A 3SYZA 3O8MA 4KHNA 2PMZA 3VQ7A 4LN2A 1VQPA 1NZ9A 4J2AA 4M9ZA 1FBQA 1X19A 1J53A 4BR7A 1U49A 3QYGB 4BUPA 3CC4I 1VK0A 3CCJT 4C92A 4PLLA 3K4LA 4KITB 3L2WA 4RB2C 4UY8I 3LPUA 3BY7A 2BZTA 2JA2A 1WYXA 2NVUB 2Z33A 1U6GA 3P8HA 4FYWB 2YHBA 4CCJA 2CH6A 4OP0A 1PNJA 2YHWA 3BW1A 2JJ9A 3UDCA 3J80Z 2W1OA 3HSRA 3H9QA 1SG5A 1Y0UA 1K78A 1Z05A 3K7AJ 2QZ8A 4RM3A 2GCXA 5GANe 3AG2H 2KTQA 4BY7J 1PUEE 2VUMJ 1OCTC 2E41A 3VEZA 4KKOA 1A31A 1Y56A 1B1BA 2K2MA 2ZBKA 1CF7A 3CCJQ 2NUZA 4J9DA 1NK5A 2EX3A 3HT3A 1IKVA 2KPMA 4Z02A 3PIPF 2QQ8A 3QEPA 1T98A 2A61A 2L3DA 3WXLA 2V6CA 1R0CB 2UUCK 2DE0X 2Q36A 5C3EJ 1UB4A 4FJ5A 1HPZA 5FW9A 4FJLA 2LNBA 4EPCA 1BCMA 1W7PD 4HSTA 1UG1A 1I6HJ 2V7YA 1SRLA 2EV0A 5L3EA 1NG6A 1OCOH 2UXCK 1GBRA 3O6BB 1X1PA 3EG9B 2HOSA 1YQAA 2HW3A 2KYBA 4FLZA 2V75A 1Z26A 2P9LB 2M4KA 1YQMA 1NE8A 1V5GA 1OYYA 2RJEA 4RMOA 4WF2A 4FVUA 2YLBA 3CBPA 2DZCA 2OPRA 1U9OA 1WJSA 4WF9L 1HNXK 2CW0F 4Y17A 2HOTA 4KHQA 5E3NA 3I5SA 3LQRA 4L5EA 2BE2A 2DFUA 1XMXA 2WADA 3SZGA 3BF3A 2LP0A 4S05A 1LNWA 5F08A 4HNUA 1FT9A 5J4YA 4EJVA 5DY9A 2EW3A 3KTUA 2E2HJ 2KZGA 1LJ9A 1W1WE 4G9YA 4C8QE 2XU8A 2WAQA 3N4QA 1VSHA 1L3UA 3BT9A 3QETA 3I9V2 3OYLA 2CUEA 3O3GA 5KK1A 2X6NA 1KC8R 2K9MA 2JWKA 3EGXA 4FJHA 3VYRB 3JTHA 2A5YB 4XLEA 5H1SQ 4XNFA 4NC7A 3G0ZA 1JUMA 4MZTA 5GANg 3MWPA 4M7YA 1ZSZA 1OR7A 2E1ZA 4AILC 4B09A 2HNZA 4BR4A 3FZLA 2GTJA 4CCKA 2NYSA 2PN6A 4A53A 1K9MC 5LD2C 1UAXA 5AQVA 2NRWA 1VQ4A 3MJXA 3FZFA 3JCMc 4XN3A 1UA1A 5M1OA 3CMAI 2VQFK 1YIJA 4I09A 4FZXC 5KVRA 2NZTA 1MIJA 5M3FJ 1T95A 3MP1A 4IHTA 4DSEA 3QU3A 3WG9A 2KGTA 3VDXA 1UOCA 5EEAA 4Z0UA 4YY3K 3P8DA 4OPHA 2H1KA 1WHUA 1OEBA 2I2LA 4CH7A 1LCUA 1WHHA 1WXTA 4BROA 4L9JA 1JE8A 1QVFP 4YEJA 3QIPA 3M8FA 5LEKA 2KMTA 1KCFA 2CUBA 3ZFJA 2K40A 2IBDA 2P51A 2EFWA 3HVTA 1GOBA 2QVOA 1EIFA 4HSRA 2EK5A 4IEJA 1OOTA 2E12A 4ILHA 5C2DA 1OH7A 3HXLA 3CCJA 1PP7U 4LJZF 1K76A 3C2BA 1QP2A 4DA4A 2NLUA 4W5QA 1NGIA 3KCCA 2KIQA 4II2A 1WEFA 4BD3A 5IWAK 1NJYA 1TOVA 4CF9A 4UUSA 5I22A 3DXKB 5AT1B 3WE2A 1CGPA 4ENMA 3BFMA 2EJRA 3RR8A 5IN1A 3BCBA 5IT9Z 1T03A 1G2BA 1X3UA 4AIAA 3ZX0A 1WHMA 4EJOA 1QO0D 1S7EA 4BY6B 3WHBA 3HRTA 1IGUA 3CCQN 4JI4K 3ZPLA 3K5NA 3JRGA 1Z9QA 3J8AA 3HUGB 1HR0K 2BY3A 4ITVA 5FU6C 3LYIA 2ZJPF 3GBGA 4Y91A 1KVBA 3FDRA 3CFOA 4ZZDA 4CW7B 2R5ZB 4C5EA 8AT1B 1X58A 4YG2F 5HY6A 3FHGA 4IG3A 4KI4A 4CD1A 1S22A 2R7WA 3WEEB 3B6CA 3SWNB 4A3EJ 4C5IA 2EHGA 3KHYA 3SUQA 2HKXA 4M3YA 2VXEA 4FWKA 3DXMB 1GV5A 1FTZA 2FBHA 1KU3A 4DOVA 3IRXA 3VA0A 2E6ZA 2G7UA 3SBTA 1HNVA 4XKWA 3CXCS 1R1VA 1Z1DA 2F5DA 3TI0A 1ZHFA 4DYQA 4A5BA 2M30A 2NRAC 2CUDA 4KTZA 2HSPA 2Y0SN 4E9HA 4AHRA 4C8MA 4CK1A 4DKWA 1H8KA 2RKHA 1S7OA 2HF4A 3EGDB 3VF2A 2O4IA 2W24A 2QK9A 2WUSA 2NWMA 3A8LB 1OYIA 3S14J 4JI8K 4M7XA 2EZHA 3S16J 4Y52J 4MLEA 1IXDA 5EOYA 3H6ZA 5KYUA 2NRZA 3OSGA 2NOJB 3IFRA 1BHLA 5HLIA 4FT8A 1VQ5I 2R7VA 5ERIA 3R8EA 3MFKA 4CF0A 1U5TA 5H20A 1WLPB 2P5GA 5ECAA 2X1DA 5HDNA 2X6XA 1X43A 2KNBB 3Q1JA 4FLWA 4BDZA 1USTA 4M7AD 3IHUA 1ORKA 2NYXA 2WV1A 2LFBA 4G6DA 3ROUA 6AT1B 3NF7A 5BRFA 2RAEA 1AD5A 2OTJN 1Z0XA 2ATCB 3GZ6A 5FO5A 3E0JB 3KE2A 1ESVA 2RN8A 1P8ZA 4JKFA 3V6DA 4NHJA 3DMJA 3HOZJ 1MWKA 2W82A 2YRDA 2R57A 4O5VA 3EH1A 1W9HA 4ORZA 2DMTA 1LEBA 3DKMA 5AQFA 1LDDA 5HDGA 4GDFA 3A5MC 2CGJA 2CH4A 2ZPFB 2NRVA 1WHLA 5C10A 2V26A 4WFBL 1G6NA 2GXGA 1GLJO 2CV2A 3QDRB 1VTNC 2VODA 1JXMA 5CO7A 2A0FB 1HQEA 2EYQA 1WA7A 3RIRA 3H0HA 4I2PA 1SS6A 3BJAA 2JT4A 4Y4RA 4BGAA 2F2WA 3VOVA 4UXNA 4II1A 2MABA 5GANh 2ZGWA 3QIIA 5IYCJ 4EIAA 2XSDC 1ORPA 3MEVA 2ZQBA 1E3HA 3AO4A 5DK5A 2XGCA 2HWVA 3MVPA 2NUPB 2HF3A 1ILYA 5CHZA 4HSBA 5D4RA 2CREA 1X2QA 5AQNA 3OW2S 1BQNA 3GBQA 2JJ7A 3C4SA 4HT9A 1NYGA 2HQNA 3NEUA 1VYVA 4HRIA 1ITYA 4RW8A 3LWHA 2O8XA 3CCVA 3ESWB 3WGIA 2P0KA 1VQNI 4DQQA 5KYXB 1HX1A 3VS4A 4KAZA 3D0SA 4XK8E 4QVZA 4IFEA 3DF8A 4MDAA 1U2VB 1UECA 2M45A 2R0QC 1YTUA 2YUSA 1YQKA 4L9NA 4S0HB 2RHXA 2QEXN 4O8KA 4DSJA 1Q86U 1WI7A 3PO3J 3W2VA 4C8QB 2RQQA 2DA3A 4V2GA 1NEBA 1X3ZB 1JJ2M 4U0WA 4AFZC 4N41A 4YOQA 3AV9A 1VQKA 1O7LA 4EMSA 2LSNA 3VQ9A 4H5WA 2KIMA 3O5BA 2YUNA 4BRFA 4BRMA 3VS6A 3QO9A 3MQ0A 5HCKA 1ZR2A 2L9SA 4CRIA 4LD9K 4XU2A 2ZGZA 3CYMA 2BGCA 2Y4XA 1YF5L 1IJJA 3KEYA 1EWRA 4A5MA 4CGZA 5A0LA 3MPUB 3RMDA 1M3CA 4PIIA 5GIPA 1X75C 3VW4A 4M75F 5HNHA 2YHYA 3TAEA 4ZN3A 2PLYA 1M90R 4DEXA 1N75A 1TP4A 2DD4A 2Z1IA 4LG0A 1Q1VA 4L0YB 4FK0A 3U1KA 1NWKA 2OA4A 4LH4A 1X6GA 3VRZA 2QGFB 1NGJA 2HNDA 1Z25A 1C0GA 3LSJA 2YX7A 4NB5A 3H0FA 1KSWA 4DTUA 3RDIA 3TO6A 1AHDP 3GFJA 1YI2T 3BWGA 2HQAA 3NAUA 3H41A 2OQGA 2XAGA 1VHXA 1DP3A 5T7BA 2QM3A 5IHKA 1C6VA 2HOEA 5BN8A 5LJ3j 3K58A 2D0OA 3LANA 3LWFA 1WJRA 3EUKL 3VQEA 2IS1A 2MYSA 3SAGA 5GAOm 3JREA 2JUFA 2P7VB 4AHCA 1Q7YC 3WNEA 3KLEA 1P4XA 1GCPA 1NGDA 5LHIA 4PL7A 3CJQB 4M72A 4HVVA 2VBYA 3CC7I 4UC4A 1KQSP 2FG0A 3J80E 2GTOA 5IY5H 1TVRA 3T69A 3DOKA 2K7AA 4PLIA 4XKBA 3CMEN 1HW2A 1A6QA 4KHYA 3VS2A 2HMPA 4B9QA 3F3XA 2E7WA 3BR3A 4RW9A 3JCMV 4XTUA 3ZMDA 1OR7C 2EFPA 1G99A 1D5YA 3I4MJ 5AQKA 1VQ6I 1GDTA 3VU3C 1QVGA 1YI2Q 1UHMA 1A04A 3ZN1A 4XTVA 4AQYK 2CP3A 1HYZA 4BY1J 4FJJA 3E6BA 1TBXA 2N8GA 3TPQA 3G71A 4N4IA 4OMLA 4P1WA 3WTVC 3EE8A 4PJOF 3DEEA 4IEEA 4R79A 3OYGA 1WSGA 2KISA 4RW6A 1V29B 2EQUA 2ESWA 3PX0A 1SV5A 4M9SA 4BGDA 1RAHB 1QQMA 2QSFX 5FLXZ 4EHTA 4FASD 2ZPIB 3CBMA 4HQEA 4YNQA 4D5CA 4ENKA 5FRMA 4V2SA 5LHHA 2TDXA 4EEFG 4IKFA 3TMOA 1BU1A 3RSNA 3IDHA 2DTOA 2EFQA 3RR7A 3CC2I 4KBOA 1M1KO 1ZG1A 1ZR4A 2E65A 1HNWK 3CC4A 1QVPA 5GPCA 5SWMA 2XK0A 3K5LA 2WTUA 4H0PA 1QSSA 3PLAA 1X2NA 2RHUA 1VOMA 3AGKA 5JHFA 2MC4A 4M7DG 3K9TA 1NK2P 2LG4A 3J81Z 5BPIA 1ETOA 1KFDA 3O80A 5KCHA 5F6FA 5IYBJ 2DF6A 4FWSA 3ZT4A 2XRNA 3I4PA 3VQDA 4IOAL 1IKWA 1IW7F 1MDUB 3ZT0A 3ABLH 4DS4A 4MGRA 2XMFA 1NK0A 2FNAA 3SMPA 4FWPA 2B0LA 5HOOA 1YJNT 1KFZA 5FFXA 2VG7A 2ABLA 1VQ7N 2DFHA 1I39A 3R61A 4KFBA 2L3PA 5JVTA 4HQMA 1RTIA 1JLGA 5BNGA 4LXCA 3GL1A 5AZJA 5FDLA 5FB2A 1L3SA 3HHHA 2P9KA 2LX7A 3KPHA 2W10A 5FD5A 3OYEA 3V42A 4F52A 3ZT2A 2E71A 4AWXB 1BUPA 3MEGA 1TAQA 1FMVA 1X4PA 4M3XA 4OIRF 4FYVB 4IEIA 2JN0A 4PFPA 3JCUC 4FYXB 4FW2A 3O9QA 3PIOL 4CGJA 4NZGA 1D1CA 4F7UE 4CJ5A 2GQVA 2P0PA 4FOIA 4WK8F 1S6QA 4XRFA 4CYDA 1JUSA 4XH4A 4LF6K 4FLXA 1H1VA 3DLLL 4CCHA 1TAUA 4H0OA 1JT0A 1RT2A 2ZXIA 1YJNQ 2RQPA 5DLOA 5I21A 3WU2C 1WEIA 2R5MA 4G9ZA 5J2PA 1XG7A 5GAMd 4H03B 3I4NJ 3HI0A 3MK6A 1B4AA 4IO9L 3K0SA 4K43A 4Z94A 4JI6K 4AG1C 1KD1U 3C6HA 2Y75A 1HYVA 2VN2A 1U5TC 1FYLA 2YUPA 3WNFA 4TVRA 2HSEB 1HQCA 3I0SA 2E1NA 4CEFA 1RIOH 2LKSA 2DMNA 2RI2A 3MEXA 1TT5B 4HPQA 4Q0BA 2MLGA 1Y6IA 5F0CA 4M3RA 4H0YB 5EGOA 5KYYA 4C8QF 4B1VA 1AKHA 3C18A 4DNCA 1TTYA 5HROA 2BTTA 2A6EF 4BUGA 1JXSA 5J26A 1GOAA 3QEIA 1Y57A 4CYCA 2QA4T 2DFEA 3R0AA 1WSIA 2JN6A 1SD5A 5DLQE 3EFOA 2PI0A 1R59O 4P55A 2E3IA 2M0MA 3W3CA 2NUBA 3HJEA 3DPTA 5IYDJ 1N6AA 3ABKH 4Q5VA 3CDLA 2PU9B 2WSCE 3M6GA 4LDVA 3ZMUA 2P5KA 4C1NK 3D4VA 3CMAA 4RWTA 2HMAA 4FM4B 4E47A 1BIUA 1Z9ZA 2NNNA 2JVGA 2YNIA 3ULEA 3ZSZA 2LH9A 3G6EN 3FX3A 2GZWA 3SHFA 3OJSA 3G2BA 3ZEHA 2KDOA 1I94K 3CCMI 3THWA 2E1YA 4H8KA 3VODA 1NMNA 2A42A 4M7AG 3PMTA 1X3NA 3VS7A 1XSVA 1Q81C 4JQFA 3ZL7C 4DUZK 3EDPA 4XSZF 4L5GA 3GZNB 4Y0WA 2VC8A 4RGSA 1W7PA 3S2WA 4B9UA 2DYBA 5DUIA 2O7OA 3KZYA 2XUBA 4DFJA 1A5JA 4BREA 3OBYA 4L18B 4MMKA 4GCVA 3K6GA 2G8IA 3CJ9A 5DM6L 3SFIA 2FOKA 4AFQC 4MNUA 5BRHA 1VQNT 2CQQA 5AQUA 1ACMB 2JSCA 2Z5UA 2DPPB 1P9QC 1ON1A 1EX4A 1OU8A 1WNLA 1NM7A 2L0AA 1WI3A 3FHFA 3S2DJ 4E9FA 3LSIA 4C8OA 4NLCA 1AOJA 1QVFA 4EW0A 1IN5A 4KH5A 4FL6A 1MH4A 3JCMX 2JLEA 3GMEA 3CCQI 1W97L 2HQEA 1VQLT 5IP9J 4M63C 4NCGA 2PZ1A 2Z1GA 4O5BA 3EZ5A 2H27A 4IUVA 4UUTA 1V4SA 4XLPF 3X24B 5EDNA 2ASMA 1IRGA 4BJ6C 2BE9B 3FMQA 1UB9A 1TK0A 4GBQA 1Q82O 3M8QA 3F0ZA 3W6KB 5LJ3g 2ROTA 1LE8B 4Z4GA 1VQNQ 2HI3A 2KRHA 4ISEA 2IVMA 2JM8A 5J6XA 3MCPA 3KYDB 1SFKA 3KX2A 3LGFA 3TWHA 1J9IA 3B6PA 1FKOA 4R1HA 1QSLA 2ZNZA 3BG3A 4XAXB 3CXCM 3M3YJ 4A12A 2QWLA 2WY8Q 2JA5J 3F9MA 4MIMA 5E3MA 4IO8A 2DTHA 1QVFS 3I3LA 1QPMA 1XN7A 4CCOA 1MDMB 1VQLQ 3GFMA 1K8AR 1JCEA 2ZGYA 2AHQA 1SFXA 3I55I 3BDUA 2HMIA 2F69A 4ZYDA 2HCKA 3HRGA 3OYYA 1ETVA 1VSJA 1W2BA 3ZETA 3ERED 3GBTA 1KC8O 1SL2A 4B9LA 2EKOA 3BF1A 3LAMA 3NTIA 4DR7K 1NEGA 2J7IA 2P6SA 2EYXA 3BZ6A 2JK3A 4AHSA 1TWCJ 5CKTA 4RUGA 4AIDA 3KK2A 1R36A 2VQCA 2ZXWH 3J7YJ 4MQVA 3I8BA 1VQ5A 3C6AA 2BHZA 3S6WA 2KFNA 2EQJA 4Z2YA 3HGGA 2ED1A 2FEZA 3SZ2A 4GKJK 4L59A 1N9RA 3UA7A 5GAGJ 3ITHA 2AT1B 2P9PA 4ZGDB 2DW4A 1B6AA 1RGIA 1EWQA 5L23A 2IS4A 2DL5A 5M5XJ 2IS2A 1ETXA 1GLLO 3GPLA 1JBMA 4NQWA 4LH5A 2CQNA 1RI9A 1S6PA 2NVXJ 2FC0A 4Q5WA 3FM5A 3HSEA 1RLPC 4BBRJ 4C2TA 3M5AA 5KPRA 5AJ3K 2HBJA 3VFZA 1UE9A 1TWAJ 4B3MK 1ZBLA 1J0RA 1UDLA 2CZ1B 1U6ZA 3BC8A 3HRSA 2VC1A 2ISZA 4CZCA 2XY6A 2W03A 3M1EA 4I2QA 2R7RA 1GOCA 2HPMA 4F7UB 2OYQA 1SAXA 5HL7L 2O03A 4LIUA 2EPFA 3OS0A 4BR0A 2FVUA 3EUHC 2KK4A 3K1PA 5M5WJ 5CR4A 3TL4X 2O8DB 1NH3A 3TTFA 2WFBA 1YX5A 1SSHA 1SAUA 2IXSA 1HBXG 3S8PA 3OW2M 3ASKA 4HV5A 3DKWA 4MQ9F 2YT6A 1FX7A 1YJWT 3MX5A 5LJ3f 3CETA 2HKQB 3CC2T 4DQPA 2D1VA 2DL7A 1VQNA 3OSSC 4FJMA 3PFYA 2XIDA 5FKKA 4XEIA 5K1YA 4DBHA 3SDZA 1ZN2A 2R7YA 3RZDJ 3O08A 2QEXI 4FM2A 3UR3C 3IV5A 2O8EB 4EP4A 3ABTA 2DMPA 4BACA 1H9GA 5E84A 3JW4A 3S3OA 4M7AA 3KLFA 1MJBA 2ETHA 1MBFA 2VQHA 1WPKA 2LLKA 4M78D 4H0TB 1JL1A 1FJGK 4CZEA 3GWZA 5L3CA 4M77D 4GO1A 3NHNA 1YJWQ 3F8MA 1WJQA 3CD6N 3CC2Q 1RTHA 2Y30A 5H2FC 1JLEA 1WDXA 2ID6A 2IEKA 2NNYA 3IH3A 2X9DA 4RAYA 2K9GA 3KFWX 2QWNA 3V9WA 4BDPA 3OJUA 1JXEA 2PMZN 5CYVA 1VQPN 1WWXA 2RB6A 1JL2A 1F43A 4KA4A 2OX7A 4B9XA 2X0LA 2VKDA 2A07F 5C6SA 4FLVA 2ZF5O 3ZQHA 3CO7C 1WSJA 4QVDA 2YKNA 3J80K 5LJ3h 4JS4A 1U1SA 4EMGA 1F1BB 3BY5A 4JKDA 4C8KA 1RADB 3KLGA 4I6MA 4RTZA 2HBWA 1PJRA 3S3MA 2UUBK 1TTHB 2LK2A 4OO1J 1Q1HA 4U0VA 4JJDA 1S9EA 1T33A 3SB2A 4LUEA 2LT1A 2VBXA 1D1AA 3AA4A 4BWMA 4JI2K 3BR0A 4F8RA 1MGTA 1M9SA 3DLRA 2L2OA 4RTVA 2X35A 3NGZA 3QOEA 2W25A 3KP3A 3J81E 3C12A 5CR2A 2EJFA 1YJ9T 3Q9SA 3F6VA 4I2OA 1JLBA 3VS5A 4ZGEB 3CC7A 1RT3A 3DWLA 2NRXA 5KYWA 3BPXA 3C2HA 3FSPA 2DLLA 5FU7C 1BI3A 4DV6K 2VUBA 3VUZA 3M8JA 5TKYA 3VEOA 4HV6A 1LNXA 5GAOp 5BRDA 2Z3YA 4PUSA 2E2PA 2CQKA 4HCKA 3E7LA 3TW7A 1VQ6A 3VEXA 1QQOA 4BNCA 4N47A 1BR2A 3FHNA 3CM6A 1WJEA 4LFBK 2H1LA 3TP3A 2RH2A 4BHCA 4X64K 1XHXA 1M30A 2ZWHA 2CH0A 5CCAA 2W0ZA 3EHRA 2OA8A 3OB9A 2FRHA 3CWSA 3QPSA 3OSFA 4OB2B 3L2RA 1KAXA 4WE1A 3AG3H 2D0AA 2FBXA 2A05A 1ZA2B 4NXMK 4Y3OA 2PJRA 2JUGA 3CCLI 1S3XA 4E6RA 2A7YA 2ZFUA 2ZPBB 5KI6A 2Z16A 2VG5A 1NKBA 2ZXJA 2Z2SB 4OB3B 4EVVA 2G8WA 3EFSA 5AQPA 4DQIA 4AIKA 3CQXA 2EZLA 1E7OA 2CP2A 3BUZB 3THXB 4BJTA 3CC2A 2FO0A 5D5WB 2GUIA 1TKZA 4ZDLA 1AEYA 1XNRK 3GTPJ 3HYFA 4ESJA 3GW2A 1E17A 1KYWA 1MNDA 2J5PA 3PNTA 4D7MA 1IJWC 2BUPA 3MMVA 1GLNA 5AQMA 4ANJA 2YNHA 1Q8IA 3CJBA 2SRCA 4HHTA 2R5YA 3JB9H 2OF7A 1R0AA 3JAMO 1KQSS 4CI6A 5EF6A 1VQ4N 4GFBA 3BR6A 3KK3A 4RTYA 1RILA 2XY5A 1RDWX 4IFVA 4DOWA 4DU3A 1YIJN 1VI0A 4NCAA 5IH2A 3THKA 4J2BA 3U3YA 2LBFB 4E7IA 4QS9A 1VQ7I 1MW7A 3BR2A 2EWSA 2QKBA 2C6YA 2JW4A 1VA7A 4KUDK 4JEPA 2K4BA 3UNGC 4DIQA 4KGZB 1VQ9T 5GANd 1WPYA 1P6RA 3QNOA 1HYSA 1NG2A 4EJYA 2X4WA 1KG3A 4Z6YA 1F5TA 1UWBA 2YWWA 3QWLA 4HBLA 1R8OB 1CSKA 4JI5K 1A5VA 1I27A 4CJSA 1TG0A 2GFAA 2O9SA 4B23A 2CZ0B 2DA7A 3GG4A 2LKPA 4JKHA 4BAYA 4M7DC 5M1PA 1OCCH 2D9TA 3F8BA 1VQMT 5C44J 1FOXA 3BTCA 3CCJN 5IT9K 4UUVA 3QEVA 1MJ9A 4WCEL 4EGYA 3RTVA 1UHFA 3PX4A 5IOYA 2J6KA 1SFOJ 1MSFC 2LMJA 4HOBA 2J06A 4A3KJ 4C5HA 2XIGA 4FWNA 3RSEA 1VQ9Q 1F36A 3UT1A 1YO5C 1EH7A 1WJBA 2F4MB 4FWMA 3E2UA 3L1AA 3DQVC 3I59A 1SKWA 4H5VA 2DYSH 2Z0WA 2KQ2A 1FMKA 2K3XA 5KPZA 3MDQA 1OZ3A 3HPHA 2PEXA 4PUOA 1M2VA 2IG0A 2W85A 2O8CA 1GLEG 5E79C 3DTKA 3LDQA 4XOTA 3N4MA 3M58A 2LX9A 4J7IA 1W1FA 3DTIA 2EQIA 2QWOA 5A2QO 4IL6C 4AFUC 4KYWA 4P9FA 2E8AA 1X1AA 2I5WA 4C5GA 2E88A 4A6DA 4OIPF 2BW3A 4J5YA 1YT3A 1VSFA 2OI3A 3E19A 4B8CA 5CQYA 2XKOA 1SL1A 4ID1A 4KISA 1TQMA 1ETKA 2FOWA 4KJZA 1O75A 3CBOA 1ZRDA 4AI5A 1RCHA 1YX3A 5EYRA 3M8EA 3P9IA 2GUPA 2RI3A 4ZYGA 1TNTA 2ZKZA 3C95A 4QCLA 1QE1A 2QXLA 2X4YA 2V7FA 2E5QA 5E18F 4R5PA 2L2PA 4WX9A 2UXXA 1Y0MA 2BDPA 4IXCA 3BR1A 5EX5A 4J6XA 2QK0A 3IH2A 5K7HA 3CCMA 5FKLA 5KGXA 1XS9A 4N0BA 2GOXB 5IHNA 4B47A 2HBKA 3LW5E 3R6NA 3EG1A 1Z21A 2CGKA 5GJWB 4GVEA 2OZ6A 3NWSA 3S1QJ 3RKXA 2MBFA 4NO7A 1CZ9A 4DYRA 1N8RR 1YW8A 3JCMe 3VETA 2L01A 1K73O 2YG9A 4CIGA 3MN7A 1NGFA 1BISA 1WLJA 3KNTA 2P0WA 3KETA 1GCQA 4W5NA 3JCMP 1J3TA 2E2NA 2P7CB 1AWCA 3L6QA 1WN7A 3TQ7P 3QKJA 2DD5A 1W5CC 1CF7B 2ZJ2A 4KICA 2QDLA 5DUKA 1NGEA 3VQ4A 1UG2A 3DB4A 4PFZA 3DLAA 3Q9VA 4BRHA 4EQQA 1X6BA 2LY9A 3TSWA 2NRHA 4M42A 3WHCA 2UUZA 3ID6A 2K9LA 1MSEC 3NF9A 2G9WA 4LNPA 4M7AC 3RMSA 2MI6A 1LVAA 1LPQA 4PNOA 3CCQA 3E5XA 2ELKA 2OC6A 1X2MA 4WCGA 3CDIA 2WBNA 4A3FJ 3OIQA 1ZELA 2DK5A 2K5LA 1ASWA 2CS3A 1R58A 1S1VA 1WI9A 1VSMA 2LCCA 4K42A 5ICGA 2KIUA 3O9TA 1PKTA 1ITGA 2YNGA 3AVFA 1MBEA 3MN6A 3VENA 2A6HF 2HQ5A 4H5NA 4D6WA 3PUBA 2M0YA 3V9SA 2CGPA 2STTA 1R22A 4YDUC 3FGUA 3R2XC 1OQYA 2RHKA 1U2WA 3QQAA 2D45A 1QVFM 3BR5A 1RRSA 4JRQA 1WBBA 3JB9D 3KYCB 2RN2A 3ZSQA 5H6QA 3V8JA 3HOWJ 1HLUA 3I55A 1LWFA 1IH7A 4Z4CA 4Y1CA 3REAB 4M78G 2GWJA 2CZ7B 3PJRA 3SMSA 4ESBA 4CXFA 2OCCH 2EQMA 3TBIA 3CCUT 1S8NA 4A0XA 3PM1A 2MGQA 1YBYA 4M77G 2EZKA 4PJ0C 4YOVA 3A8HB 3JCMg 4IHSA 2ZMEC 4EGZA 4A5NA 1TNSA 4BE0A 4E19A 3SQ0A 3HZ6A 4DBQA 1NOYA 3CLQA 1D5AA 4OOIA 3OV8A 3V9ZA 1KIKA 1JLAA 3KJVA 1PD1A 2KBTA 3CF5L 4CHQA 2IPOB 2OCEA 1V3FA 3C3WA 5AQZA 3VS1A 5E1WA 2DEUA 2VG6A 3RRHA 4BRGA 2FEIA 3DTEA 5LGNA 3IG1A 4GV3A 1JTXA 3AT1B 2KRSA 3AVHA 2TRTA 4CHUA 5IXFA 3X2QH 1D4XA 4LFAK 3HP9A 3HTVA 3CCUQ 1YFNA 4KI6A 2XVCA 2RJCA 1X69A 1ZQ1A 4IJAA 3NTHA 1BO5O 2DAQA 1J54A 4EZ6A 2QLZA 3TO9A 5F2RA 1T3VA 1M90C 4KFCA 4DQSA 3I56T 3QINA 5KQDA 1BGXT 3JSCA 3K1MA 2QTVA 2NOBA 4JYKA 4PWDA 3OR1C 4HX4A 3DRPA 2H8RA 3CESA 2VB6A 1GLCG 1XCBA 4CIFA 4PJOC 4XMYA 4CFAA 4KHWA 3OGDA 4I98B 2HDWA 2Y0MA 3F22A 5KAIC 2V1NA 1FLIA 2ADUA 3T8TA 3CCLT 2HOAA 5C0YA 1GXIE 4A3DJ 4BRQA 1LQ1A 3JB9I 3L2VA 2KZVA 3OHRA 4PKCC 2FZCB 1NGAA 1I1SA 4Y15A 3VTHA 5K14A 3RQ4A 5AQRA 1BN5A 5GAEP 4EJTA 3KP6A 3HKSA 4H0XB 1USSA 3HVRA 2FSWA 3V8LA 2VKHA 3P83D 1RAGB 1ZA1B 4RCHA 1W5TA 3IAS2 4X65K 1JXOA 3I56Q 4CECA 4J00A 1W5SA 4PKHA 4CD3A 5DCMA 2OBPA 5HK3A 2FPEA 1HCRA 4CF2A 4I01A 2FQ3A 3H5RA 1I4K1 4FO0A 1QZZA 4RBOA 4Y92A 1KU7A 1AOYA 2QEXA 3EN9A 4M6XA 1WQ7A 3MEEA 3UE5A 2MD0A 1GRIA 4B48A 4UV8A 1R5ID 3LM2A 1FXXA 3BQZA 3JRDA 5FLXK 4KTQA 1IZ1A 2DTRA 3CCLQ 2GV9A 5BS6A 4NC8A 1I3AA 2BUDA 1BC7C 3AA5X 4QSHA 4OB1B 4XLHA 3K59A 3QRFF 1FIPA 1K8AO 4JKGB 3IL2A 3QZ9B 3BG7A 2DFFA 4YORA 5LJ5f 4EV0A 4OMNA 3AAFA 4BQZA 3BJOA 4B1ZA 3ZSWA 2R3SA 3CJ7A 2DDAA 4AMCA 3FXJA 5FWCA 1T3SA 2P9UA 5HBMA 3CCEI 4IHVA 3M56A 1KAYA 3MN9A 2P5LC 4PQUA 4IFYA 1R77A 5FWBA 2BGGA 4CGGA 4C3IJ 3CHWA 2EIMH 1Z3XA 3GTKJ 1TQIA 1QTMA 2EJ9A 2DMUA 1BWFO 2E5ZA 3HFOA 4JRIA 3A1YA 3K70D 4LD0A 5A0GA 4OVLA 1U5TB 1DPUA 1Q86C 4JHDA 4HVJA 1RETA 3U6FA 1HKQA 3J81K 2AO9A 4D9JA 3MD2A 1M1EB 1EQYA 3FZVA 3JYTA 3ME9A 4XQ3A 4E0DA 4AU7A 2M5WA 4AT1B 1ULYA 4LE9A 3QWXX 1G83A 1WOQA 1E3PA 1RBVA 3CCUA 3FZKA 4OMPA 3BJ6A 3QUIA 2FB7A 2HBLA 2YJFA 1ZH5A 1T2KA 2BANA 2E4LA 1IBKK 1P4AA 2F5CA 1ZGAA 2NOZA 4ZDPA 1QQCA 1WCMJ 4KRFA 3I5UA 3JSPA 3JAMZ 3OH6A 1RI0A 3UIQA 3GP8A 2DPNA 2KFZA 1KHCA 4Y7NJ 4GXOA 3OS1A 3EG0A 3ULQB 2LR8A 1VSLA 3T1HK 3JCMJ 3V7SA 2DQLA 3I33A 3IWZA 3VOEA 3K4KA 2RJDA 4L5IA 4DYCA 1WVRA 2OJED 1SVOA 3JCMh 2CH5A 4PL8A 2CT3A 3QYBA 3K5OA 5GADP 1QP3A 3AAPA 2AZSA 4KRTA 1AU7A 2XKOC 1U9NA 1IV6A 4C9YA 1R6RA 1TC3C 1ZXOA 4M78A 4XTZA 1FKPA 3EYIA 2G0EA 3L8BA 3CO6C 2C0OA 4CJQA 4BH9A 4S04A 4M77A 4IRHA 2JTMA 5A0DA 4IOCL 4JP0A 5J2QA 2HHWA 1KLMA 4J6WA 3TKYA 2GM4A 1X1DA 1YI2N 3O4QA 1SEUA 4GVMA 4FLTA 3GNFB 2XAUA 4HF0A 3VRYA 2V9KA 2J6FA 1ZUUA 1XHZA 1OV3A 1ZK8A 2FA5A 3CCLA 3HSCA 3NHGA 5FKNA 1HNIA 3F5TA 1S1UA 2A3ZA 4M3BA 3RKYA 3RYRA 1VIEA 3NGYA 1FOYA 3O1WA 2MWPA 4KT0E 1XMAA 2ZNYA 3CMMA 1HKTA 2ELJA 1RLQC 2QKMB 1VYUA 1GCQC 4PY5A 1BL0A 2JMWA 2QI2A 2OU2A 1T44A 4I7FA 1Q81U 4J01A 5IP7J 3FLGA 3AVJA 3KEQA 1X1CA 2QCOA 5LMNK 1KQ1A 2HZYA 2OJ2A 1UHWA 4HKEA 1FP2A 2ZJRF 3ZQGA 4FSXA 3NMUA 3SAHA 1KQSM 1MJAA 1NNEA 1VSIA 2XHKA 3LX7A 2DODA 3ZMZA 3ELKA 1CLQA 1TK8A 3G4ST 4DLEA 2R7FA 4Z8AA 1WJCA 2M3AA 5LEJA 2HVQA 1ZC6A 3NVKA 3QERA 2D4WA 1WFXA 1VAZA 5J1EA 3ZQLA 2L4MA 3KVGA 4OLAA 2KXDA 3WE3A 2JS2A 4N0AA 1ASVA 1XDSA 1VQ7A 1YFHA 2J5OA 1W0HA 4DTOA 4KH1B 1XNIA 2E35A 1FJLA 3WTZA 4OAZA 2LNVA 4NC6A 4M3FA 5C4XJ 1Z3YA 1IDYA 4TSXA 4D1QA 5CAIA 2NXNB 4IQ4A 4CICA 1UTIA 6PAXA 3PIPL 3LA3A 3HOUJ 3CF2A 2B5JA 2IGOA 1N78A 3MXIA 3REOA 1OI1A 2QXFA 4HUFA 4ILGB 2RF2A 4HNTA 3WTXC 3FRNA 1QHHD 1IHWA 3PY8A 1HLVA 4XORA 3NE6A 1NJXA 1Q9XA 3R60A 3CCJI 3G4SQ 3FXQA 2LT4A 5BQTA 1YCSB 1EV7A 2F4OB 1JU5C 2L3QA 3L2CA 1B9MA 5GPAA 4BRCA 1NJWA 4B22A 2Q0OA 3EQLF 5GAHP 3O4NA 2F5TX 3CMYA 1LPLA 4RB0A 2DN0A 3LOCA 2ENMA 2NOFA 2DBMA 1APLC 2JTFA 1IBLK 3D0PA 1LUJB 4AIHA 3U8XA 2XDVA 3BPVA 1KQ8A 4F04B 2P9LA 4J83A 4J2EA 3NH2A 4MFEA 2K5CA 1NKUA 4K25A 3DYAA 4IURA 2FSJA 2M16A 3CJNA 4CEDA 3U4LA 5GAEJ 2VXFA 2OZSA 1IDZA 1G3SA 2ZZDA 1NOZA 3M0PA 3O5ZA 3M8RA 1GL5A 3LDNA 4NYFA 5E26A 2ECCA 2AS5F 2X6SA 5J40A 3MEAA 4M7DE 4C0FA 3M55A 2CU7A 2E10A 2E1HA 2GXAA 2BY1A 4FE4A 3JB9G 2VWJA 3LA7A 1YW9A 1P2FA 2DRKA 3DI6A 3FZHA 2NRRA 2XHIA 3NBPA 1QQIA 3PT9A 1T39A 3LP3A 1DP7P 4RCBA 3JTGA 4O3MA 1RAFB 3F72A 4FZYA 4JLGA 1M1KU 4L0ZB 2PMUA 4AYBA 4FK4A 1OPLA 2L7MP 2K3BA 3THVA 4BRNA 5LJ3d 2W4SA 4JAXA 1ZG5A 3DOLA 3RKWA 3VQ6A 3QXEB 1NLOC 4KH0B 1RTDA 4YIIA 1NJIR 4BS9A 4LF8K 5LRSA 1HSJA 2LJ1A 1UELB 1FMWA 1R4NB 2CO5A 2XAQA 4NBQA 1JKOC 1BCOA 3JRBA 1B3QA 3P1GA 2VV5A 3RI4A 1UG0A 5E8IA 1VQ5N 1ZTRA 3K0LA 2EIKH 2NUTB 1TGOA 3ZQQA 1VQ8T 2H56A 3U21A 4A4GA 4MFDA 1OPCA 3G1MA 4UNFA 2MG4A 3RMBA 4FJIA 3CQTA 1W4SA 3VESA 2FMLA 2GQIA 2K3FA 3PL8A 2P9KB 2DBKA 3IRRA 4FJNA 2LRDA 1SKRA 2RI5A 1TT0A 2DL3A 4JK9A 2GXBA 3F6OA 3T1AA 2JQ7A 4OMQA 1BA5A 3AO2A 1RI7A 3FXUA 1POGA 3O1BA 3GTGJ 4C92G 1OMIA 4FETA 2DXBA 4F14A 3DXKA 4DBFA 1BKBA 2VOOA 4DQ2A 2MH9A 3K4CA 1NYFA 2FF6A 4XK4A 3DLMA 3GE1A 3TAGA 4M3EA 3V8KA 2RPIA 1VQ8Q 4IZZA 2DL4A 4O5FA 4M3TA 3H9NA 1YE9A 3HUGA 1JJ2A 3K57A 2O4XB 3L4QA 3AVLA 3HSTB 2LY1A 1PKSA 3RTRA 2E3HA 2R5ZA 1OX8A 3LWMA 2I10A 4NB4A 3M4GA 1IXRC 1RAAB 1D0YA 1J5EK 4I9LA 3WEEA 4ZGJB 2CGHA 1QCOA 1PCXA 3H5NA 1ZGJA 4CJ3A 3LZJA 5K5QA 1DT9A 3ZMSA 2H94A 3DXMA 3OL4A 1GLDG 1WZ2A 2KT8A 4DV7K 2IIMA 4PJMA 2YCHA 2IVOA 2JPSA 1VQNN 4DV4K 3LM9A 4M7AE 4DF4A 5EGOB 4KT6A 3DRRA 1AKHB 2A40A 1S72I 2O61A 1IHVA 3E6DA 2M34A 1NG9A 5FU7B 5I3UA 4BC3A 1T8IA 2CT4A 1UHSA 3EGDA 1LVKA 2R7ZJ 1NLPC 2HR3A 3MZ8A 4HUEA 1BA1A 1VQLN 3PVLA 1T0FA 2JWLA 5J47A 1Z77A 1RAIB 4M73A 3U9DA 4DQRA 1AT1B 4NXNK 2QKLB 2KXCA 3IP4B 2E70A 2LCLA 2OUMA 2QDYB 3ULEB 1IN4A 2W48A 2Y90A 1C0FA 5KCMA 5AIPA 4M75E 3VYUB 2HKOA 1M3QA 3SJHA 5C15A 2Q2RA 2NOEA 2QWRA 4DFMA 4FLUA 3GLLA 2P5VA 5B8HA 3QIOA 4M78C 1W7PB 2VWBA 4OKEA 1RTJA 3SPYA 4YIFA 1NGHA 2LF7A 2EGCA 1TW3A 1NJZA 1N8RO 4DR5K 1IG8A 4M77C 2FF4A 3RUXA 5F0HA 3E9FA 2K27A 3HXMA 1MMDA 4UB6C 3J7AF 5BPDA 2G6FX 4YPRA 5KQ8A 3M9AA 2QWPA 1EBMA 2IA0A 3PE0A 2BKDN 3OVNA 2A69F 2RREA 2M1HA 3SV4A 4CE9A 2BE5F 1MUNA 3CCST 3HGYA 1VQOI 1UUEA 1T6DA 3DWLE 2ECBA 4BQOA 2D6FA 4EMKA 4G94A 2CUJA 3TAQA 2ROLA 3IRQA 1S9GA 3VF6A 2VWKA 3W6VA 3DKYA 2KVQG 3VJPA 2HZTA 3NF6A 1DLOA 1IRZA 1PM3A 5JMVA 2QTDA 3KK7A 3KZZA 4BHBA 3NFCA 1SC7A 3KWIA 3ONQA 4WQ4A 2DFIA 2E36A 3JCMb 4A3LJ 2AP1A 3M07A 2DTUA 3WTSC 4ZH4F 3T3FA 3IS9A 4E1MA 2DYIA 3QYHB 5MLCQ 2L4AA 1W6XA 1G59A 2HHTA 1IN6A 2QQSA 1K0SA 3EEQA 3CCSQ 3TANA 3KZBA 1VQ6N 3U9GA 2NOGA 1A5XA 2O8KA 1K9MR 2FRYA 1U2VA 4PJOE 2XRLA 4N0AC 4M7DB 2LKXA 4LFUA 3FC3A 4I6ZA 3PFSA 3ATUA 2HXOA 1HNZK 3WTWC 4AM6A 4CGDA 5FLVA 3FJPA 1KC8U 1YAGA 1RT1A 5FGMA 4EW4A 4W5OA 1JUPA 1DDNA 1R7JA 3SDGA 2XGDA 1P90A 1LWYA 3LAJA 3CCEA 2LRQA 1K8KB 2FXUA 2MAMA 2HQRA 2OPQA 4UNOA 1U5SA 3FBNB 1N34K 3HL8A 1J09A 5D4SA 4LB5A 2NVTJ 1YJWN 3BZCA 2IPQX 3M0RA 3CC2N 3I0WA 1M3HA 5EG2A 2VJ5A 5IAYA 2O8FA 5D5XB 4XTWA 2QGUA 4Q5SF 1LCKA 1CXQA 3IAYA 4EM0B 4M71A 2F2XA 1ONVA 1FPQA 1MBGA 3RQIA 5B5EC 1OJLA 1IB8A 2OTLT 2P9PB 3RMAA 3B02A 2Q0RA 3K4BA 3HM5A 3HOVJ 5FPDA 4CJPA 1XJWB 5GAN6 3ZSRA 2Z1DA 3ZMTA 4FM0A 2ZSIB 3DM2A 2X3WD 2YHAA 2LQ8A 1NG7A 2GA2A 5IT3A 2Q31A 1B72A 4F3TA 3QAHA 2ZAEA 4PKGA 3KP5A 3ISNC 1V55H 1CQTA 4Z4IA 3H35A 3OA9A 1H88C 2LNHB 2XC7A 1OX9A 4CC2A 1S9HA 2D2WA 1FBUA 1ODDA 1IV0A 1B9NA 1BG3A 4WFAL 1U1TA 2DIGA 3W2WA 3VEWA 1C0WA 1C0TA 3K2AA 1OCZH 1MWMA 4M4ZA 3ECHA 4L9VA 3TSPA 3AG1H 3LSMA 2OTLQ 3ZMVA 2AA4A 2KIFA 4DLGA 2CZ6B 1MNEA 3NFAA 3QYFA 4RGUA 3DB3A 1VSDA 3O8HA 3EH2A 3M9QA 4LLGF 1BB9A 3VMFB 1UJ0A 4BRKA 1DGRM 3TOBA 4A3IJ 1FBSA 1YTAA 4V19K 3F8NA 4QTRA 3CDHA 1Q82R 5KRTA 2DNUA 1A36A 1WIEA 1YI2I 2FSKA 3DLBA 3CCRT 2YV0X 2CGLA 2IW5A 1YP5A 2KMUA 1OQKA 4FJXA 1SD7A 3BY6A 4MTEA 1G8XA 5EU7A 4M7AB 2UU9K 5JI6A 2OV7A 2BY2A 3THYB 3E9PA 4PGGA 1TLHB 5LL6S 5GTHC 4N56A 1YN8A 3H6EA 2LQWA 2Z9OA 3CUQC 1V5FA 1F4KA 3C6UA 4KMUX 4XONA 1FOKA 1DJ7B 2X4XA 3CPWP 2RN7A 3GTOJ 2JM9A 2XSJC 2RMOA 3CCRQ 4QW2A 4QT7A 1YW7A 3Q0VA 4UQGA 1YXQA 3CMET 2D0NA 4AVPA 1QPIA 1HW5A 1KEAA 4MEYF 1RUOA 3O6WA 3CZ6A 3A98A 4M75B 4J2DA 1QZ5A 4IG0A 2IVNA 2QWWA 4LC9B 1GVDA 1FTTA 3N4PA 2I7NA 3TSUA 2PY5A 4J9BA 2EA4A 3CCMN 2DA5A 4DW6A 1JRIA 2O6GE 3RCOA 3VYHB 2BTFA 4C0DC 5AQWA 4I6MB 4KHSA 4JK1X 1QZYA 3E97A 3VERA 3UKRA 1C6VX 1M8VA 1I5ZA 3K1NA 4F91B 3P7NA 2ZMEB 2VL8A 3WXJA 1A35A 1ZG3A 2CYZB 3FIFA 4CEOA 1Y8QB 3VPZA 1N3CA 1IO6A 2Z99A 1QU3A 3X25B 2R5AA 5GTIC 3OMYA 3BEXA 2HU9A 2VQLA 4FT2A 2Y31A 1VNDA 4ZHRA 2Q2EB 4DF8A 3CXCA 1WH7A 3H0GJ 1X9JA 3OOUA 2DOEA 2KAFA 1XMKA 1WEGA 1F1ZA 4CCLA 1XSXA 1S72T 1HPMA 2EFOA 3VYGA 3AHUA 1RR7A 2XB5A 3ABMH 4FJ7A 3OOPA 5AQXA 2IJLA 3OYIA 1NPRA 2V1DA 2DCEA 3MXMA 4AC0A 2EBPA 1YVUA 3SJMA 1YJNI 1MA9B 3GVAA 1D3BA 1S29A 3GIBA 2CV0A 4M3GA 5EG0A 4CO8A 2BVLA 2K2VA 1BQMA 4Q4ZF 2CG4A 1ERDA 1JCGA 1FYKA 3M59A 3CJAA 1VQ9N 3S15J 1KD1O 4I7HA 2V1UA 2RNJA 3LFUA 2AK5A 5JHUA 5EZGA 3D6RA 4CGIA 4DTMA 1IUFA 4B21A 3TQNA 1IO2A 4F7UG 4DTNA 4M7DF 4RS8A 4PJOB 4A4FA 1GHCA 4M3DA 3JRIA 1U0JA 5CHIA 5L3GA 5AQQA 3M8PA 1S72Q 2Y69H 3ZXSA 5F0XA 2XG8D 4C8NA 2LVSA 4FTHA 2DTIA 3CEYA 1BI4A 1U8RA 4JX4A 1SUQA 4IHYA 4YOWA 1N3AA 1EP4A 3GCMA 3MCAB 1D9DA 3QBYA 4G7ZF 2CWEA 3I55N 3E5QA 5AFUA 4OPAA 4JRPA 4XOPA 2CKKA 2L54A 2A1SA 3HOSA 1SFUA 1TUYA 4A93J 3ID8A 1BJAA 4EMKC 3WXMB 2H3JA 1FN7A 4IHXA 1VQOT 4QPQA 1IKYA 3KP4A 1M90U 2CDTA 4CCMA 2GEMA 4A6EA 3FKJA 3IHOA 4U7DA 1E6GA 2QUFA 2VQGA 5J39A 4DU4A 4PL6A 2FJ1A 2PVGB 5I2MA 4WXDA 1H9TA 5FLMJ 2CFOA 3SDBA 1TL1A 4PDKA 2KHOA 4DZPA 1Q7YR 3M0QA 2K9SA 5B3SH 4WFNL 3LDPA 3IQLA 1O13A 3JCMd 5D8KB 2QA4I 1MU2A 3OW2A 3VQPA 4RTXA 3IKTA 3ALYA 4O8UA 3H1QA 4LG3A 1G15A 3UKUA 4GYGA 4H5TA 4E7KA 3NH0A 1GV2A 2LVMA 5CKFA 4BRIA 5JLXA 4N4NB 1SL0A 4FYDA 1VQOQ 1NK4A 2M87A 2R4GA 1JKQC 4ZYAA 2YX4A 3QPLA 2YU3A 1YVNA 4LSNA 2Q8KA 3GTJJ 3OSVA 2HS5A 3E6CC 2V8KA 4XU0A 4J9HA 2AHJB 4KV8A 4IJNA 3WU1B 2UYTA 4B08A 2HNYA 3RSEB 3PIOA 2CW8A 1ETQA 2HHQA 3W2AA 3H46O 5CY4A 3AGRA 2HBMA 4HZFA 1MUDA 4CEZA 1YHQT 3CTAA 3G6ET 1BOBA 4F55A 1XC5A 2BIVA 3HHTB 3DLLA 1LE8A 2KRCA 3MAQA 1ABQA 4A2UA 2X9HA 3LH5A 4BI4A 3F8FA 3CFRA 4C92C 3EG2A 2WBMA 2X1EA 1HDDC 3TDUC 2P4RA 4YOTA 4JD2A 2EYZA 5ILVA 4XR6A 2GIZA 3ZRGA 2VKVA 4IDHA 2MC3A 2COMA 1PYVA 4HVWA 4KTWA 3DU6A 4M7AF 1S72A 1MDMA 2F96A 4JI0K 4KUMA 5LJWA 5JR3A 3IKMA 4DR4K 3SAFA 1PD0A 4A0ZA 4BXXJ 2YS9A 2VASA 5KYNA 1C0UA 2BW3B 3W0LA 1BDGA 4JN4A 5HK0A 1YTYA 3VQBA 1VQLI 1LB2A 1K7AA 4A57A 2LQNA 5HODA 1XGOA 1K1ZA 3MEWA 3J80O 4CK3A 3QBWA 2M8GX 1YHQQ 2FE3A 1QMCA 5BOXA 1O3TA 1C1AA 3HBTA 2P9NB 5E8GA 1QKWA 2VC0A 4DSLA 2WWYA 2LREA 1CXUA 2ZM6K 4HVUA 1HUXA 4OMFB 1N25A 1HA8A 1NJIO 1GUUA 4G7HF 4CBUA 2VWFA 3KZIC 3AO3A 3MO8A 3MX2A 1WQWA 4JPBW 2HEOA 1ETWA 2GWRA 1VRUA 5DMRA 1L3VA 5CVUA 4C30A 4M3UA 4BQQA 3WTUC 5E20A 3PVQA 4I0AA 3KUFA 3AARA 4UHTA 1T05A 2IGNA 1LOTB 4ELUA 3ZR8X 4BQAA 1DPRA 1SRMA 1IUYA 4XIUA 4HWIA 1XSDA 2E7XA 1WFWA 3A2FA 2DPUA 1VRTA 4RTUA 2WB1N 4ZYEA 3F8CA 2ZCWA 2DO3A 4FQGA 5BR9A 1KQ9A 3D5LA 2E1CA 3JAMK 3CCUN 3H5AA 1GVJA 1IXSB 4B3SK 2WC9A 5J8CA 3K70C 1VQOA 1XQHA 3FZMA 2AJQA 1SKUB 3RYPA 2GELA 4HLXA 4MDXA 4FE7A 4BQLA 2MCNA 3L0QA 2QASA 1SQKA 1S7AA 4OAYA 2L9NA 3BDDA 5DM7F 3GOIA 4F7UA 2QBYA 3V1OA 4NL2A 3H1VX 3L42A 1PP8F 2K9NA 2G8HA 2O8DA 2VJ4A 4L3QA 1QCNA 1Y96B 4JX6A 4GV9A 3MKWB 4M77E 4LIVA 4DV0K 2KRNA 3OYHA 2CP6A 2DBBA 4JZ3A 4XH5A 1K4US 4NNJA 1ZSZC 1KXPA 4DV2K 3N05A 5KN8A 4QIWN 4NL3A 4E1NA 3G1JA 3HHGA 4PJLA 3L2QA 3OS5A 5GMKj 5E1XA 2FRWA 1FYMA 2QYZA 1Y97A 1MUYA 4MTDA 5BN9A 2ZFWA 3I56N 4X34A 1D9FA 4P5NA 2CSIA 1XUPO 1Y39A 4KNYA 3BDPA 3U2RA 2M7AA 3OIPA 2WA0A 5F0FA 3AKZA 3I9QA 1QQNA 5HNFA 4JV5K 2G8FA 2FBTA 1P92A 3Q0UA 3SUNA 1DGWY 3M0SA 2JHNA 3H3ZA 3GDQA 3ZSOA 4BVOA 2EWNA 3LPTA 2QKKA 5M1KA 1NK9A 3J7AY 1KG7A 3CCLN 2R7TA 2FD5A 3LALA 2OFKA 2C0IA 3JXUA 2PBIA 4M45A 1I3QJ 4I9QA 5GMKl 1FSEA 3J7YP 1YJWI 1LFUP 4MDWA 1YQRA 1KK7A 1UCRA 5JVHL 3LL7A 9ATCB 4JI1K 3V1QA 4N76A 1BR4A 4EIKA 1OCRH 4A62A 3ATVA 4YOUA 4DCHA 3VS0A 5GAGP 3HM9A 4NCBA 1YRNB 4JNEA 5KRSA 1UZCA 4HCCA 3VQ8A 3HPGA 4KBMB 1JHHA 3H1CA 5IT9O 1ZHIA 4BEHA 3NWTA 3A01B 1AVZC 2ZD1A 5AQGA 1TKXA 4MMLA 5GAMf 2PX9A 2XPVA 1P4WA 3Q7BA 3NQOA 2YKMA 3KP7A 1OYWA 3IH7A 1BI1A 1HW1A 1K73R 1IBMK 3IAM2 2LJ3A 2RKIA 2QGGA 5AQJA 2JZYA 5J8FA 4CIEA 3QB0A 2FBKA 3H3VK 3M53A 4IHWA 4J9GA 2W6KA 1X9MA 1NPPA 1XGNA 1A6IA 3ZQFA 4XRSA 1N36K 3JRAA 2XPUA 1IXCA 3PNVA 1S1NA 2GWKA 4A2AA 1YYVA 3FXKA 2I5UA 2AKLA 1LFPA 4JS5A 4C0GA 4LSLA 3CD6T 3C65A 2CV1A 4DTPA 2L02A 4HDVA 1RPWA 2DA4A 1BK2A 1BOTO 2EINH 4GKKK 3UKGA 3RZOJ 5HLGA 3B6AA 3JRHA 3PX6A 5KH6A 2RQUA 2PUKB 3O9SA 1J7KA 2P9SB 5DCMB 1KA8A 4G8XA 1YI2A 1N33K 3HJFA 4LK0F 2KY9A 3O9RA 2H6CA 2E5KA 3H36A 2GBQA 2DERA 4CSWA 2O8BB 4E70A 3HEFA 1I1GA 5CK9A 1H89C 4CF1A 3R4KA 2GX9A 3QODA 1M1FA 1K9MO 1D5VA 2IAJA 4OIOF 4CHZA 4M6VA 4IX7A 4OGCA 2X1CA 3K10A 5EEGA 1YJ9I 1OU9A 5IT9E 1HKSA 3CPFA 2XGEA 1K8AU 3CD6Q 2ZE2A 3QSUA 1PRLC 1ABOA 1QHGA 5D6EA 4EJWA 4CEEA 4CBWA 3KEOA 1JKHA 2D1XA 2QG9B 3QOPA 3ZCMA 4AUXA 4RLFA 2EA2A 4HG2A 2DMQA 2JTEA 1ZBHA 1AHJB 1MV3A 4KULA 2DEQA 5LJ3e 4BVPA 4M9XA 3VS3A 2NOIA 3PTAA 4U67L 2W57A 2IT0A 3QFUA 3J7AP 2DU9A 3QESA 4AYBN 3I53A 2LSOA 2DTZA 2WY7Q 2WAEA 1Y1WJ 5K7ZA 3F0CA 1KO9A 2DXCA 3VPRA 4XSXF 2BZXA 3FB9A 4UB8C 2A36A 2LBFA 3CJCA 3HM8A 2V1RA 1ZYRF 2DO7A 1OULA 1E4FT 4P9UA 4LFCK 2P6TA 2NVQJ 4HA8A 1TWGJ 2DAOA 4XN0A 2BXZA 2QA4Q 1IN7A 4HNVA 2FUG2 2V4JC 1NBWA 4RTWA 4YFXF 5GIOA 2XROA 2LTOA 2IGIA 4RTTA 4ISGA 1H0MA 3BCAA 1I1JA 5BR8K 4A4HA 1SSFA 1QVGP 3GF2A 5EEHA 2A6AA 4ESRA 1P59A 5FKOA 1TYQB 3SHWA 2Z1HA 4BI3A 4BI8B 2BZYA 4X1VA 2P4WA 3HYIA 2PVDB 4IOXA 1UJ8A 3VN5A 3W3DA 2JHJA 3G4SN 2EFIA 4BHPA 3A5ZB 4QKUA 1EF4A 2F6CA 4K41A 2FNPA 3MN2A 4KB1A 1YJNA 3P39A 2GBYA 4NLBA 4RTFD 2ZPEB 4CJ7A 4M77B 3WQTA 4YRVA 4CEAA 1VQ9I 1GXPA 1IF1A 1QHAA 2ME0A 4JUVA 1VQ4T 4FU6A 2M1BA 4LDWA 2XRIA 1TSFA 2HVHA 1TZLA 4YPHA 2LDUA 4EJUA 1YIJT 3E9OA 2F2EA 3FM3A 2BEOA 4YIRX 4H4MA 2DT7B 3TSZA 4C3JJ 5CKHA 3FJ5A 3T1YK 3KIOA 5CKDA 1VQMI 1ZX6A 1JEGA 5EC7A 2GAUA 1UA0A 2QWMA 3BTJA 5J3BA 1JLFA 2KP6A 3S41A 1AZEA 1QW1A 4XU1A 3Q7CA 2CS7A 1NGNA 5J4VA 4U7BA 3QJ6A 3SNNA 2R7DA 1Y7XA 4UV9A 1U78A 2X48A 2VGMA 4B24A 1VQ4Q 4C3HJ 3KYLA 1ASUA 3RDVA 1TWFJ 1KVCA 1YIJQ 1UGVA 1JKPC 1B07A 2DJZA 4PJJA 1MH3A 3A8MB 3M8SA 4DTXA 1H8AC 2KJCA 4O44A 2DILA 1X1BA 3E5UA 3TAPA 3RR6A 2PFBA 1LMZA 2FPDA 1XTDA 4RKUE 2NOLA 4FWRA 2M02A 4F3QA 1ZLMA 1M1KC 4E89A 1FNNA 2DVJA 1D1BA 2QA4A 3ZEUA 2XO7A 5GAN4 4MO4A 3LZIA 3HKZA 2KROA 2G8KA 5J1YA 2XI9A 1TUDA 4N5SA 1W0TA 4M74A 4CC3A 4H0VB 1KG6A 4Z4HA 1OH8A 4E6KG 3ASNH 2PBDA 4B4CA 2VT2A 1O3RA 1K9AA 4HDUA 4F2RA 5GAOr 1R49A 1GFDA 3HBLA 3NGPA 3JRFA 1NK6A 3QFPA 1AWOA 3HIFA 2ATQA 2X6OA 3DRSA 4AHVA 1RL2A 2HDAA 4KH6A 4F17A 2HVSA 4U87A 3HSBA 4JKAA 2F5FA 2AIRB 2P8TA 1KONA 1KZHA 4RDUA 4ILJA 1BBZA 2K9QA 1RACB 1Q9YA 1B34A 3CWUA 2AQFA 2O2OA 4DOZA 4A59A 1PWTA 2ZPGB 4ISFA 3T7ZA 1ZAOA 1YITI 4IQJA 2DMOA 2P4TA 2H3GX 4AFSC 2YI1A 2LY2A 1V76A 5FLXO 5ELZA 2CQ7A 1XGMA 4PCQA 2E2QA 3I64A 1VQ8N 3A0HC 5AN4A 3T1BA 1DEJA 1CKBA 1PDNC 4R56A 2FXAA 2JVVA 1KG4A 1I81A 3M3ZA 1X01A 1HDPA 2LCSA 1FIAA 2QW9A 4BU2A 4U0YA 5D6WA 1R5HA 3P31A 4EHUA 2B9SA 1VZ0A 5M1NA 3R1XA 4GY2B 4OPKA 2MOXA 2IRFG 2BV6A 3FEOA 5AZIB 4E7HA 2F5KA 3G3ZA 1KGSA 2ITGA 3MCZA 2HHXA 1OLTA 3HTRA 2R92J 1G3YA 3J81O 2MIOA 3IWFA 3LSGA 3TCJA 1VQLA 5BPNA 3HRUA 4FISA 2RO0A 2Y4YA 1KFSA 1NKEA 1QHTA 4CJFA 1N9SA 4LK1F 2VGNA 3PO4A 2YHXA 3VTIA 3ENBA 2FBYA 2KR3A 2XY7A 1J75A 4DK9A 2Q3SA 4CZJA 2ECZA 3EYZA 1U06A 2FX0A 2G7HA 3V9UA