4E7HA

Pfv intasome prior to 3'-processing, apo form (ui-apo)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7hA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7hA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7hA03
1VSMA 4I9QA 3RR7A 4CGDA 2IDOA 3SUPA 1KTQA 3P8DA 5SZTA 4CHPA 3NNQA 4W5TA 1KCFA 4FJMA 3ITHA 2R5MA 3OA6A 2EQMA 4M3XA 3AVCA 1EP4A 2BIVA 3UT1A 1X1PA 3V9XA 3OYJA 2EQJA 3VQCA 1OYXA 3T19A 4IG0A 4PLLA 3I0RA 2RHZA 4FLVA 3QJ6A 3RRHA 1NK8A 4DQIA 2B6AA 1A5WA 1RT4A 1TAUA 1FKOA 2HQXA 3PX4A 3TWHA 3V6DA 2QQSA 3DOKA 4B8AB 4FJXA 3OB9A 4HUEA 4LD6A 4AHCA 3AO3A 3RR8A 1N5YA 4GY5A 3LDSA 3RMDA 4QCLA 1KSPA 4DTJA 1RDAA 1YTAA 1WJSA 3QINA 2EKOA 4CJTA 4FJ9A 4FL6A 2P0KA 3QIPA 3LANA 4I2PA 3P8HA 3AVLA 4BDYA 2OYQA 2PQWA 3AVAA 1L5UA 2VG6A 3LGFA 4N56A 1HYZA 3ZSRA 4E7KA 3QEXA 4CEBA 4QQDA 3QERA 1ZBUA 5HRPA 4A4GA 3NTKA 2Q3SA 1NJWA 1WSIA 4FM1A 3FFIA 1RBTA 3SJJA 4KI6A 4B9NA 1U45A 3SQ4A 4F3TA 1QSSA 3DLKA 1L3UA 3BDPA 4TSXA 4G1QA 1XI1A 3C94A 1RDDA 4CJ5A 2P51A 3DB4A 4DG1A 3C6UA 1KFSA 1ASUA 3NTHA 4LY7A 2MWPA 4CERA 5D6WA 1WLJA 4CK2A 3LP0A 3TABA 1NKBA 1FK9A 3O3HA 3L2VA 1S9EA 3TAGA 3O3FA 2E6NA 4CF2A 4KTQA 3OYAA 1BCOA 4E89A 4Z4GA 1FKPA 3SI6A 4OLBA 3OYBA 4KKOA 5I42A 4CJSA 3U3YA 3AA4A 4RW8A 3CFRA 2D5RA 3QETA 2BE2A 3CG7A 2YNGA 4B8CA 4CF1A 2A1SA 3LP2A 2QK9A 3RRGA 5FRMA 3KJVA 1C1AA 5KI6A 4FJHA 2IOCA 1DTQA 3DRSA 4CIEA 3T1AA 5CIUA 4DQPA 3P1GA 1JLFA 1NOYA 4RW6A 1QSYA 1X9SA 4BE1A 1HJRA 1J9AA 4M45A 2Z1HA 5E41A 1EKEA 3NH1A 4C8OA 3HYFA 5J1EA 2PZSA 4DTOA 2G8HA 2HHSA 2RI3A 3SCXA 3PFSA 4FYDA 5C42A 1S1TA 5CZ2A 3ASMA 3LGLA 1IKWA 2YNFA 3E9GA 4YFUA 3LYIA 1IG9A 4DU4A 3WNHA 4RG2A 4AH9A 1W9HA 1J54A 4FW2A 1HMVA 4Z0UA 4FJJA 1A5XA 4ELVA 4OKEA 3AO4A 3LP1A 4LD0A 4NS5A 1RTJA 4DLGA 3OYMA 1NOZA 2PYLA 2HQEA 1L3TA 1KVAA 1OI1A 4EZ6A 4KHSA 3ZEHA 3LWLA 4LSNA 2XY6A 2DFHA 1RNHA 2R5AA 4PLIA 1KHCA 4CK1A 4KB1A 4DU3A 3HM9A 2JLEA 2DAQA 1RDBA 1VSDA 3L3UA 3CFPA 2OZSA 3NH0A 1IKXA 4A4FA 3VQDA 5C25A 3QEWA 5C6SA 4M3YA 4KREA 3SUNA 3F73A 3VQPA 4CGJA 3VQ5A 4RW7A 3HVRA 1RT6A 5M9OA 4O0IA 5HRSA 4F2SA 4OPJA 1HPZA 1GOCA 3MEVA 2KTQA 2ZQBA 3K5LA 1JXEA 2FBVA 4DFKA 4EZ9A 3FLGA 1T03A 3MP8A 3KD5E 4C5EA 1RI0A 4FU6A 4ZTJA 1WGSA 2PYJA 4DSLA 1L3SA 4DFJA 4OVLA 3L2UA 5CY4A 4UC4A 4DTMA 3HSTB 4DTUA 3VQ7A 2EQUA 4QQ6A 1TL1A 4I9LA 2ZD1A 5D6YA 4KTWA 4CF8A 2HHVA 1Q9YA 1C0MA 1EXQA 4DSJA 2RJDA 4CHQA 3QEPA 4C8NA 3TR8A 4E19A 3QLHA 4CJWA 4N4HA 5IAYA 1N6QA 3ISNC 4FJIA 3D45A 3M8QA 3S3NA 2KZZA 4NCAA 4E7IA 1RBVA 5JS2A 1VSLA 4Q5VA 4QOZB 3LX7A 3C6TA 2G3RA 5CYQA 2B4JA 4OGEA 2BDPA 3MP1A 4B9SA 3TAMA 1RBRA 4OVAA 3PY8A 2LTOA 4M41A 1NK5A 2GBZA 1XC9A 2W42A 4KHNA 3VA0A 3IAYA 2YNHA 1XNIA 2X4YA 4DLEA 3V1QA 3EAEA 3ZSVA 4CHNA 1BI4A 1B92A 4CCHA 3HXMA 3KK1A 4FJNA 4LH4A 3LH0A 5CYMA 3K59A 2RKIA 3JSMA 4PA1A 3DB3A 2VYTA 1LW2A 3M8PA 4CJEA 1T7PA 3AV9A 2B8AA 3MXMA 3O8VA 4K8XA 1VK0A 2RHYA 4B3OA 4L59A 4N4GA 1RILA 4KHQA 4FJ8A 2X6SA 1VSHA 3VQ4A 4J2EA 5HP1A 1U49A 1BGXT 1DTTA 4B9MA 1N27A 4BWJA 2XO7A 4MFBA 3SYZA 4DS5A 3E9FA 3NHGA 1LWCA 4CIFA 2GFAA 3RMCA 4FJLA 2LDMA 4KI4A 4EP5A 1D5AA 1SL2A 3QIIA 5KRTA 3DLBA 3ZSXA 3QNNA 4RW9A 1NK0A 4OLAA 3DRRA 3AA3A 2F8TA 4RW4A 4M3UA 2Y1JA 2Z1IA 3SQ2A 2HHXA 2GUIA 5T7BA 2E5QA 4DSFA 1YVUA 3ZT1A 2O4XA 1S5JA 4CHZA 4FM2A 2ZE2A 4A4HA 2Z1JA 2HVHA 1JXBA 3MXJA 3AVIA 4FLXA 3VN5A 3TAQA 3MEWA 3NGZA 1RTHA 3O4QA 3OYLA 2R7YA 2DFEA 4HCZA 4O4GA 4H8KA 3HT3A 3HP6A 4IG3A 4B9UA 3C4SA 4Q5WA 4CGHA 3PX6A 1BIZA 2I5JA 4QW2A 3NH2A 1S1WA 1W0HA 2G8UA 3ZT2A 2HVIA 3HJFA 4EDUA 3ULDA 1JL2A 2DY4A 1QS4A 3G10A 3FC3A 3AVKA 3UWNA 3CYMA 3OYGA 3L8BA 3NCIA 3OVNA 1SL1A 2G8IA 5J39A 3AO1A 4L8RB 3LAKA 4JS5A 4CFAA 2X4WA 3O3GA 1Q8IA 4WE1A 3AVBA 4F8RA 3AVNA 3OJSA 2RHXA 3ZSOA 1U04A 1Z26A 3D0PA 1SL0A 1YT3A 2LRQA 2HB5A 2LVMA 3SV3A 2DIGA 3FDRA 1MHNA 1TKTA 4CIGA 1JLAA 1C1CA 2RO0A 4FLWA 4QAGA 4IFVA 2X78A 3I0SA 5HBMA 3PX0A 1LWFA 1TVRA 1LV5A 4C8KA 1H3ZA 4CJFA 2O4IA 3VQ8A 5FROA 1T8EA 2P5GA 2VG7A 1NJZA 4F4KA 2HNYA 2WONA 4DQRA 2BGGA 1S6QA 2WOMA 4M3RA 4W5OA 3KIOA 2JTFA 1VRUA 1TKDA 1S1VA 4FLYA 3KD1E 3V1OA 3MO8A 4W5NA 1Q9XA 1CXUA 2D0CA 4ZTFA 3V1RA 2OPRA 3ZT4A 4FLTA 4GMJB 4O0JA 1WNSA 1CLQA 1VSIA 4IURA 1RT2A 3OYEA 4Z02A 3QEVA 3WNGA 4GW6A 1TAQA 3DRPA 4CGIA 4PL6A 3DLGA 4FZYA 4DTNA 5EU7A 2EQKA 3LZIA 4FCYA 3AVHA 4BDPA 2JGUA 3AO5A 4IFYA 2FHDA 1EETA 4F2RA 1SV5A 5JS1A 5J2QA 4OGCA 1SKSA 1U4BA 4IDKA 1ASVA 4DMNA 3QEIA 2Y1IA 4N4IA 3HL8A 4ZHRA 3ZCMA 1RT7A 1IH7A 1T05A 4DSKA 3MEDA 4K8ZA 4KO0A 2X74A 2HHQA 1UA0A 3EYZA 4H4OA 4DFMA 4DTSA 5DMRA 5I3UA 3V9SA 4CRIA 4CJLA 3HK2A 1QSLA 1A5VA 3P83D 4KHYA 1VSKA 4OKJA 2WACA 3ZT3A 3RMBA 3RWUA 3QIOA 2ITGA 2NUBA 1JL1A 4CESA 3LALA 3U6FA 3SPZA 2IGIA 4J2AA 2QQRA 3KKRA 4CFDA 1C0TA 2ETJA 3H6ZA 1RBSA 3AA2A 1VSEA 4II1A 3OJUA 1RCHA 1RT5A 3K57A 4CGFA 3SD4A 1ASWA 2QXFA 3META 3MEGA 2DFFA 2DTUA 2G8FA 4NCGA 3PNWC 1XHXA 3KK3A 5C24A 1B9DA 2XDPA 4CEFA 3U3GA 4FJGA 2HHTA 1WJQA 3T3FA 4N47A 2A1RA 1LW0A 1RT3A 3FEOA 4QVZA 3Q1JA 4M3TA 3AA5X 3OYHA 3NTIA 2FBXA 4AHTA 2DIQA 3H08A 4UQGA 3OY9A 1C0UA 4KAZA 2RI5A 5J26A 4CEAA 2M16A 4FW1A 1NKEA 2X6NA 4HHTA 2PY5A 2HHWA 3KK2A 4B9WA 1B9FA 2YNIA 1U48A 3NF7A 3C95A 1HNVA 3K2PA 3AVJA 3OQ5A 4JRPA 3V81A 3ZSYA 1TGOA 1IKYA 2E4LA 4IUTA 4DTXA 2JZ2A 4CJKA 3OYNA 2XRIA 2X4XA 2RI2A 2X35A 2R58A 4FJKA 2M1HA 2M0OA 2VWKA 3MEUA 4IKFA 1L3VA 1X9MA 4Y1DA 2VG5A 2R57A 3HP9A 3LZJA 4C8LA 4CEDA 2HNDA 3KLGA 1NJXA 3F9KA 1WSGA 3ZT0A 4E1MA 3SQ1A 3KKSA 4OPKA 1WJRA 4HUFA 2FC0A 1R0AA 3SPYA 4AHRA 3K5NA 2F8SA 1HNIA 3DMJA 4DTRA 4CEQA 3DLRA 2RHUA 4Q0BA 4W5QA 4FVMA 3IG1A 3SV4A 1RDCA 1BL3A 1BHLA 2KW4A 3LPTA 2RJCA 4DQSA 1SSFA 2P1JA 2XY7A 3M8RA 3MXIA 4E7JA 3L2RA 3OYIA 3LWMA 4FLZA 4H4MA 2O4XB 2HHUA 3S3OA 4RG8A 4IUQA 3SZ2A 1ZBLA 3HPHA 4YNQA 1XWLA 1FXXA 4E0DA 3ASKA 2EFIA 1JLGA 1QQCA 3DLHA 3I8DA 1D9FA 4KFBA 3PMTA 3V4IA 2IC3A 1KVBA 3AO2A 4CEEA 2RN2A 3V9ZA 3UIQA 2HW3A 4CF0A 3NDKA 2XY5A 3F70A 3VQBA 4CJ4A 1I3AA 2BUDA 1OZ3A 1ZBFA 1JLBA 3S6WA 4DSEA 1X9WA 3S9HA 1RT1A 2FBYA 2QKBA 5HROA 4CE9A 4HTUA 1TV6A 5FDLA 1BISA 1O1WA 1LAWA 3AVGA 3VA3A 3GOXA 5KRSA 4BE0A 1JKHA 1IKVA 2HNZA 4CJRA 2RPIA 4KTZA 5J2NA 1NJYA 3G0ZA 1S1UA 4B9LA 2AJQA 2YHAA 2EX3A 4CJVA 4FJ7A 4M3ZA 5C0MA 1HQUA 3ZSQA 4OJRA 5KGXA 1C1BA 2GF7A 4J2DA 3CM5A 3EY1A 1KRPA 4CHYA 5D6XA 2IAJA 3MEAA 4FLUA 1Z25A 1LAVA 1MU2A 2LCCA 2XHBA 3NF8A 3TI0A 1HYSA 1NKCA 4I2QA 3IS9A 3ALYA 3TARA 4O5BA 4Z4CA 4AHUA 4X34A 4Z4EA 4CJ3A 3NBPA 4ELTA 2P5OA 1JLCA 4N41A 4BE2A 4CJUA 4LSLA 4QQGA 1JLEA 4ID5A 4ELUA 2IS3A 4HCCA 2K3YA 4KB0A 1WSEA 4IUPA 1SKWA 4HCBA 1TKXA 4R5PA 3ZSZA 2XK0A 1C6VA 4F3OA 3TAEA 1S9GA 2E6LA 1BCMA 2VWJA 3HPOA 4AHVA 2BANA 2OA8A 3WNEA 5J2MA 3OYFA 3VQ6A 4NZGA 1TK0A 2FBTA 3RTVA 5KCOA 1KVCA 3ME9A 1CXQA 3VQ9A 3PO5A 3P5JA 4CFCA 3TAPA 2KQ2A 5D3GA 1S1XA 3VQQA 4C5HA 3M9QA 1QE1A 4FZXC 1QTMA 4FZZA 3VQAA 3L2WA 4DU1A 3OMGA 3OS0A 3L42A 4ICLA 2GFUA 3QESA 3MEEA 3KUFA 4Z4FA 3K5OA 3AVFA 3NGYA 4JS4A 4AHSA 1QHTA 2GV9A 1XHZA 5FRNA 4KPYA 4N76A 2YKMA 1HYVA 1IO2A 3OYCA 1DLOA 4NYNA 3OS1A 3BDLA 3TANA 2RJEA 4DQQA 4PY5A 1Y97A 5K14A 4FK2A 3QKJA 4E7HA 1UA1A 3AVMA 3CM6A 5KCHA 3IRXA 3KLFA 3THVA 3HVTA 4J2BA 2XY8A 4B9XA 2YKNA 1WSFA 5KE3A 4W5RA 3OYKA 5HLFA 3NAEA 4CGGA 3B6OA 2O4GA 4A4EA 2F5KA 4DF4A 1WSHA 3TAFA 2KFNA 3PMIA 1TL3A 4Z4HA 1CZBA 4CEZA 1LWEA 1REVA 1EX4A 4IUVA 1NK6A 4O44A 5IN1A 4E7LA 4E3SA 1F21A 3K58A 4ID1A 4M42A 4E1NA 2CKKA 4CK3A 2D0AA 2RF2A 3OS2A 3QNOA 3CEYA 3SUQA 3KLIA 3SNNA 4PUOA 3HO1A 3E01A 4FK4A 5KGWA 4HUGA 4Y1CA 4CJQA 2RJFA 1S6PA 2BKDN 4C5GA 4EP4A 4B9VA 3NF6A 1I39A 3KLHA 3M8SA 3HPGA 4N5SA 4BACA 1TK5A 2LSNA 1ZBHA 4MQ3A 3KTQA 4CJPA 1GOBA 3OYDA 1J53A 1YTUA 1GOAA 4FXDA 3S3MA 3ZSWA 2OPPA 1BQNA 2YHBA 4KV8A 1WN7A 2K3XA 4PWDA 2YV0X 2G8KA 1UWBA 3NE6A 3CFOA 4B9TA 4IUUA 4CEOA 2NLUA 1BQMA 2MWOA 4OKKA 4CHOA 1KFDA 1TK8A 3DLEA 3PV8A 2L8DA 3DI6A 2L89A 4DF8A 2L3RA 1BIUA 2OZMA 4KHWA 1ZBIA 3SUOA 1K6YA 3PO4A 4CFBA 4DTPA 1D8YA 3LP3A 4JLHA 3OMCA 3DOLA 1NK9A 1VSFA 4BD3A 1UOCA 3DM2A 5DK5A 4DS4A 3PUFA 4NYFA 2D0BA 5CZ1A 3MP6A 4I7FA 3DYAA 3O4NA 3MECA 4FJ5A 2RHIA 1VRTA 1KLMA 1BI4B 5HRNA 3L3VA 1VSJA 3EZ5A 2Z1GA 1JLQA 1NK7A 3SQ0A 1WAFA 5KH6A 3B6PA 1KLNA 4CF9A 2EHGA 1NK4A 4CECA 4Z4IA 3MAQA 4FM0A 4HVJA 1RBUA 1HQEA 2G8VA 4DSIA 4C5IA 3K5MA 4BDZA 4AILC 3LLRA 1WSJA 1SUQA 1ZYQA 1HRHA 5KTQA 1UAXA 4B08A 3V9WA 1J5OA 5HRRA 4C8MA 3LPUA 4FK0A 3LAMA 1G5VA 3KLEA 2HMIA 2QKKA 5KE2A 5SWMA 4LH5A 2OPQA 1OZ2A 1G15A 1ITGA 2G8WA 2OPSA 2E6MA 4BWMA 2YRVA 4XIUA 4PQUA 4JRQA 2D9TA 3BGRA 3CQ8A 4KRFA 3NFAA 4DFPA 2ATQA 1RTIA 1D9DA 2F96A 2KFZA 1CZ9A 2IG0A 3A2FA 3QBYA 1TKZA 3DLMA 3WNFA 1RTDA 3NF9A 4O55A 2KZMA 1SKRA 4M3WA 2B5JA 4GVMA 5J2PA 3RMAA 1U47A 1WAJA 4NCBA 3NGIA 3VQEA 4KHUA 3V9UA 4IBNA 3QO9A 3JYTA 4DWIA 3L2QA 3H8ZA
chains in the Genus database with same CATH superfamily
1VSMA 2VPRA 4I9QA 1U1SA 1SG5A 2DJIA 3L0QA 2RB6A 1H641 2IDOA 5GADJ 1KTQA 3P8DA 2XV4S 5E3NA 2R5MA 1ZGWA 2NS7A 3SDBA 3P9CA 2V9KA 3F10A 4M3XA 3VJPA 1KQSA 1X1PA 1HKTA 1C0FA 2D1KA 3URGA 1G6NA 5H6RA 4IEJA 3K4MA 5EEAA 4GLMA 4L5GA 1K4SA 4IOCF 4CZMA 4J6YA 3CC7I 3HRSA 5H2FC 3SBTA 1NK8A 3WGIA 4FWPA 3CPWM 1RT4A 1P4WA 2RAEA 2F7TA 1XMOK 2QAZA 3M3ZA 3LWIA 3H3UA 4NQWB 2QQ8A 3I55N 3EH1A 2MH2A 3CCVA 2ME6A 4LD5A 1ZA2B 2GQQA 2ZPGB 4B8AB 2W4SA 3J80Z 4BY6B 2E1NA 4FO0A 4L9TA 4LD6A 2GX9A 1AWJA 1RAIB 3AO3A 3MMVA 3P39A 1PG5B 2PZ1A 1WFXA 2NOIA 2EBIA 2IGMA 1KO9A 4B3TK 4J9DA 3ZETA 5M1NA 3OA9A 1X1DA 1RDAA 4IOCL 5HLIA 3J7AO 3VS2A 2OFKA 2W00A 3M8JA 4BRPA 4FJ9A 3DTKA 3QIPA 5E1WA 2QQBA 2OYQA 1MJBA 3IQLA 3AVAA 1Q7YO 5GMKi 3L4QA 4J9FA 4N56A 1HW2A 3QEXA 1IHVA 2LY1A 1NMNA 4GRIA 3MVPA 4QQDA 3QERA 1FEXA 1ETVA 3V7CA 1M3CA 4S04A 1Y8RB 2HS5A 1MMGA 1QKXA 4F55A 5HRPA 4A4GA 1FLIA 2EGEA 1Q95G 1ZH5A 4EAHD 3TEEA 4ETSA 1PSFA 2VBZA 2VWBA 1KQSM 4DV4K 1PD0A 2HHHK 2Z5UA 3NGPA 3VTIA 3SJJA 3PFIA 2LMJA 4ZNXA 4KI6A 5GPCA 3NEUA 4B9NA 5GMKe 3SZGA 2LD5A 3H9GA 1SKUB 3BDPA 1OCOH 5J47A 5BMZA 1Y07A 2H3GX 1M4ZA 3G4SI 4Z8AA 1QQMA 4MFEA 4CJ5A 2P51A 1PU6A 1R23A 3PO3J 1DPRA 5JLWA 2O3FA 4XLHA 1WLJA 3QYBA 3HOYJ 1NKBA 1A36A 1SD6A 3ZQIA 3PIPF 4OIPF 1M90O 3GEZA 3T1BA 2GXBA 4Z94A 2HYGD 1S9EA 4CBWA 1GLBG 4B44A 2E6NA 4IWVA 4LB6B 4YDUA 3X26B 2DKGA 1FC3A 4X66K 2ECCA 3QBWA 4E89A 3CWAA 5GMKj 1OCTC 4Z4GA 2Z3YA 1WHUA 3SEQA 5TKWA 5I42A 1N78A 2FQ3A 1HKGA 3V8KA 3C6AA 4RW8A 3CFRA 3QP6A 2YNGA 3FIFA 3GLXA 3TOAA 2X48A 1WH5A 1VQ6N 3A5MC 1ZTRA 1SQKA 3KJVA 1C1AA 2A36A 4FJHA 4HV5A 1ETXA 1UDLA 2ZKZA 3SEMA 3PIPL 1X9SA 1R5GA 4WX9A 3TSUA 2M34A 4M78C 1J9AA 2VE8A 1X2KA 2ZM6K 4IL6C 3KZYA 2FNAA 4XTWA 1VQMT 3CJ7A 2H3EB 5E41A 2DO7A 3NH1A 4MFDA 1NGJA 4DTOA 5L3CA 3UR3C 3ABMH 1FJGK 4FYXB 4C8QC 3FZFA 4J8FA 2NVUB 2IS4A 3THXB 1DDNA 1XNRK 1TL8A 1ATRA 2UXBK 1S1TA 4AQYK 5CK9A 3LGLA 2H09A 1IKWA 2XF7A 4XEIA 1IG9A 1YIJT 1RRQA 2HKQB 3HZ6A 4HW0A 3ZL7C 3WNHA 3VFZA 3GPLA 3KFWX 1W5SA 3Q7CA 2BE5F 4FW2A 3BC8A 3CUQB 4FJJA 4IRIA 3SZTA 2R7RA 2XAHA 4HF1A 1HKSA 4OB0B 2OI3A 2P8TA 1PSEA 4EZ6A 4KHSA 3MZHA 2YHTA 3ZEHA 2A61A 2P9LA 5IYDJ 2XY6A 2DFHA 5CQXA 2BZTA 4OX9K 2R5AA 4PJOD 5CVUA 2DK5A 1BDGA 3HOUJ 3HM9A 4DU3A 2CUZA 1RDBA 3ZFJA 1VSDA 3CC7A 3L3UA 5LEJA 2CREA 1YOVB 3KWIA 5CQGA 3IWFA 5BRDA 3NH0A 2CV0A 4RGXA 4U87A 4PFZA 3B8AX 3ER0A 2DQLA 4B3RK 1ZLJA 3CMEN 4M75A 4KUMA 1MNDA 4A2UA 4HCKA 1NBWA 3SUNA 3F73A 2BHYA 2A7YA 3O08A 4M3FA 4M77B 5L8RE 4WQ4C 4H0YB 1TC3C 2AQFA 3HVRA 2CU7A 5M9OA 2LDUA 4JD2A 2FA5A 5EX5A 2XU8A 3VSKA 4JYAK 3WQUA 2KTQA 1Z67A 4AUXA 4J19A 1Y0MA 1NLPC 2ZQBA 2O9LA 2LC4A 4R0KA 3I56T 2FBVA 4H0EA 3WHCA 4D1QA 3GE1A 3LFUA 2PYJA 2P4WA 3I5RA 3QU6A 2OF7A 3NPFA 3BPVA 3L2UA 2KY9A 5TGTA 1UGRB 3U1KA 4JJBA 3J7AP 2DLPA 2RV8A 3RMQA 3PVQA 1SFXA 3SAHA 1JCGA 1TL1A 3KVGA 3D2FA 2W03A 1EXQA 4M7DF 2PG4A 2DLLA 2K57A 2E1MB 3ZR8X 4HVUA 3RBBB 3WTSC 1YQLA 2WB1A 4CW7B 4BB7A 5BOXA 5AQZA 1LVAA 2XIGA 2A41A 1QBJA 2HEQA 4CC3A 1VSLA 1O3RA 3FXMA 4Q5VA 5J3BA 3HSEA 2FL7A 1FP2A 3RI4A 1V4RA 3IH7A 4G7ZF 3EFOB 5BPMA 2UWMA 3MKLA 3G4SA 1CQTA 5AONA 2O8XA 3AKZA 4KRTA 5LMUK 3C6TA 1M1KR 2G3RA 2KI7A 3GL1A 1BA0A 2V1QA 2B4JA 1UZCA 5BREA 5F0HA 3PNYA 4BKXA 3MP1A 3NVMA 4B9SA 1RBRA 4OVAA 3ZOBA 3ZCOA 3TW7A 4EJZA 4LF4K 3HRUA 5FKLA 1A6IA 5GANe 3J7AY 2GOMA 3K4BA 3CCQQ 2GUPA 4EATA 1QU3A 2Q1ZB 4C3HJ 3Q0UA 3N0UA 2LFBA 2JT4A 5GIPA 4FVUA 2RQRA 3IL2A 4WFNL 2DL8A 3VDXA 1JRIA 2V7YA 4PJOG 2HKNA 3W6JB 2B9SA 1VQLT 3THYA 2M7BA 5LJ5f 3LM9A 1Q86R 2VKHA 1QCOA 3KK1A 4FHTA 4LLNA 5EXWA 5B66C 1NPPA 4FJNA 4E9GA 1HQCA 2YPRA 3N5BB 2ITMA 4JJCA 2IVOA 2IJLA 1LW2A 4CJEA 1YO5C 1EFNA 3AV9A 1T0HA 4D5CA 1FPQA 5JVGF 1ZUUA 4WQ5C 5EF6A 3O8VA 2ZAEA 4JKGB 4K8XA 3OOPA 1VK0A 2WAFA 2V9VA 2XDVA 1WVRA 4CGZA 5TISC 5HL7L 4RGSA 4KHQA 1GCQC 2X6SA 2PUOB 5B1AH 1DGWY 5HP1A 4UV9A 1U49A 1AOJA 2CW7A 1RAFB 4FPBA 4FT2A 1LDKB 2Y90A 4MFBA 4DS5A 1SEMA 3GTKJ 3NHGA 3VYHB 1LPQA 2YRCA 3ZQ7A 3RMCA 2DEQA 3J81E 1SMTA 4XQ3A 2JWKA 4IO8A 2LDMA 5GINA 5JVGL 2VVKA 3AARA 2P9UB 3O2PE 1M3HA 5GAMg 1Z9CA 3DWLA 4JI1K 2NLXA 1FZPB 1NK0A 2IAIA 4OLAA 4M7DD 5EEHA 3WU0A 3CCQN 3WE2A 1WHKA 5C4XJ 4AG2C 4IX7A 1X43A 2QXLA 5CKFA 2F8TA 4M78D 1NWKA 2DPDA 2DRKA 4CCNA 4CZEA 2P0WA 2J7IA 1FBQA 2JM9A 4EJUA 2M51A 4KIBA 4F7UF 1KU7A 1UFFA 4FX4A 4C8QD 2M30A 1XB4A 4HNVA 1YIOA 4DSFA 2O4XA 2I2LA 4CHZA 4IFEA 5LJ3j 3PSIA 2ZE2A 4QPOA 1K4US 2HEOA 4M9ZA 1Q86O 1BR1A 2LNVA 3H41A 2A5XA 4AYBN 3VGKA 1K0SA 5GAN7 4BY9C 2LT4A 4CZHA 5AQYA 4CVNE 1XQPA 1R1VA 3J8AA 1KC8R 3C4SA 4Q5WA 3PX6A 5M1FA 1NYFA 1W0HA 2COMA 2XAFA 1RUWA 3ZMSA 2OTJQ 3E2UA 5FU7C 2DY4A 2J5PA 1NLVA 4HQMA 4WTOB 1PJRA 2DEUA 2XHKA 4NQWA 2G8IA 3M4GA 2D0NA 3WTUC 2A42A 4BRAA 1JKPC 3IP4B 3AO1A 4L8RB 3BY6A 4GV6A 2STTA 4CFAA 2FBKA 1O4XA 3ECHA 4WE1A 1YFNA 2BH1A 3LH5A 2RHXA 3ZSOA 2FVUA 2DVJA 2E2PA 4BJ5C 4DR2K 3ABTA 1VQ8I 4LNPA 1SL0A 4UVCA 2R7SA 1YT3A 4ZYDA 2HB5A 2LVMA 3CCVN 2KJCA 2NRXA 3FDRA 3TO9A 3ZMVA 2ABLA 1JLAA 5EJCA 4ATOA 2GXGA 4PHTX 1OYIA 4G12A 1V5EA 4QAGA 3X2QH 2X78A 2XI9A 3I0SA 4HV6A 1LV5A 4C8KA 2E1ZA 1HC8A 3HYIA 4QIWN 1RAHB 2P5GA 3K0SA 1D1CA 2WOMA 1OPKA 4W5OA 3KIOA 2HDDA 2K4YA 2YXYA 5J4YA 3G1JA 5IP6A 4HZFA 1RETA 1MUDA 3CVTA 4ENKA 4GMJB 1WNSA 4GYGA 4M7DG 1MBHA 1IB8A 4IURA 2GIVA 1RT2A 4B21A 2V26A 3U9ZA 4CZJA 2OD5A 5HDGA 1SHFA 1ZQ1A 4B8XA 2GBQA 4S05A 4J00A 3FKJA 1PKSA 1TAQA 2OTJN 3H46O 2Z0WA 3VGLA 2VJJA 5J1YA 1ATSA 4FZYA 4C8QG 2E20A 4QLCU 3S6IA 1OYYA 1O9SA 2XUBA 3WG7H 3AO5A 5LJ3g 1QRYA 1QKWA 4IFYA 2L0KA 4OB1B 1TUUA 1QQOA 4PKIA 3VEXA 4CI6A 3R8EA 4C1NI 3QEIA 4CC2A 2D8JA 1IN7A 4HX7A 5KYYB 4LLLA 4ZHRA 4KISA 2HSPA 2W40A 3UATA 3VEZA 2X6YA 1LJ9A 3GTJJ 4YOTA 3M8EA 2QWLA 3RQIA 5DM7F 3GNFB 1AOYA 4HYEA 3D5SC 4BGAA 1QVFA 2ZZDA 1VQ4T 2A5YB 4DFMA 2VJIA 1UUEA 3J80K 2E71A 2F4IA 2NZTA 2E41A 3MCZA 5GAOp 3SMPA 1O7LA 2RPNA 3QPHA 3R0JA 2RNAA 1JE8A 3I56Q 1SAUA 2VC1A 3DQVC 3IHUA 2G6FX 4FIBA 2ZCFB 3ROUA 1IGUA 3M5AA 1KYZA 1EBMA 3RMBA 3QIOA 2ITGA 4DNCA 3KX2A 2EYXA 1JL1A 4CESA 2Y30A 1YITT 4B1YB 3FDYA 3SPZA 4FYWB 4J2AA 2PN6A 2QQRA 3KKRA 4KUDK 3ZX0A 2FOKA 5DM7L 2MFZA 5CHZA 3TQ7P 2GCXA 4RA2A 4CDGA 1YW7A 2A68F 2M4KA 1REPC 3H6ZA 5M3MJ 1XQOA 1RBSA 1XGOA 4II1A 2ZGZA 4JKHA 1D0YA 5AFUA 3RPUD 2PI0A 1BC7C 1U78A 2MIOA 1RT5A 2OTLT 2EAYA 1ASWA 1CKAA 1IGQA 4DJAA 2CUFA 2V1NA 4JP0A 1TYQA 4O8UA 2G8FA 4NCGA 1GXQA 2EK5A 1I0CA 1J09A 4AFSC 3JB9F 2DYBA 1LUJB 2CFOA 2EWSA 4IOXA 4FJGA 1WJQA 1KONA 4CZIA 3T3FA 1GHCA 1WH7A 2DT5A 1LW0A 3BR0A 3JRGA 3IKMA 3FEOA 3M8FA 4CCOA 1PCXA 4DHYA 4FQGA 4XLPF 2DQRA 3NRVA 3NTIA 2FBXA 1MUZA 3G0QA 1P2FA 5A0LA 1E3PA 3JCMg 4RM2A 1YJNT 1H1VA 2ISZA 2IS1A 2Q1NA 1ARKA 1XDSA 3F72A 4JK8A 4UUVA 4G6TB 1VQ5T 3F2KA 1Z91A 3KK2A 1G83A 2YNIA 1U48A 4IHSA 2DODA 3DV8A 1AWCA 2DJNA 5AQMA 1PUFB 1HNVA 2JN6A 3RJPA 4ZYAA 1G59A 5CVJA 1VQMI 1VQLQ 4M77A 3CC7N 4UB6C 3LSHA 2QCOA 3UF4A 1P9QC 4DTXA 1VQ8A 2MA3A 3AAFA 4NUBA 2EJGA 4NB5A 3BFMA 2X35A 1GBRA 4EGZA 4PL8A 4M6XA 1DUXC 3A2KA 3FKIJ 3TO6A 1KQ9A 1YIJI 1NG7A 2ID3A 1L3VA 4Y1DA 2QBYB 3GLLA 5D8LB 2YS9A 2VG5A 4OMOA 2KZGA 2M3AA 3V4GA 1W36D 4C8LA 2WC9A 4C92F 2YWWA 5HCKA 2H1LA 4MDAA 3CJAA 1QHGA 2P0PA 1NJXA 2RQUA 2ETHA 2RN8A 1WSGA 5LJ5e 3SQ1A 2CUJA 4OPKA 1ABQA 3SAGA 1WJRA 3U4LA 1J75A 1BW6A 2FC0A 4AHRA 3GX4X 1VF9A 4M7AA 3HRTA 3CIPA 2KMTA 4DTRA 4Q0BA 2X1DA 3IG1A 3G71T 1KGSA 5JHFA 2IVWA 5HY6A 1RDCA 3EE8A 1BL3A 1BHLA 5HDKA 2HDCA 3ZQHA 3LPTA 4EMSA 1OKJA 3EFOA 3G1LA 4DR4K 2LKSA 3L2RA 3T69A 1IBLK 3OYIA 3BDDA 3M53A 4PKHA 3LWMA 3VF4A 5KN9A 1MKMA 4XH1A 5BPNA 3ZRGA 2LQ8A 2WB1N 4IUQA 1OULA 4YNQA 4GCVA 2GZWA 1FXXA 4Y3OA 2K86A 2KIQA 5AQWA 2H27A 1VQNT 1LJOA 2CSOA 1P7JA 3DLHA 2NRTA 3G4SN 2EVRA 3JB9D 1J59A 3UIQA 1R1TA 1W7PD 4Q4ZF 1K9MR 4CF0A 1AA7A 2VQLA 4LIUA 3F70A 4V2FA 4YY3K 4NDLA 3SWNB 4CJ4A 3RIRA 1W1FA 1U9NA 1OZ3A 2EZIA 3GO5A 4EMKB 4XRSG 4DSEA 3WHBA 1WXBA 2K40A 3AT1B 4B3AA 4JI8K 3RESA 8AT1B 5FDLA 2JM8A 4BXUA 4XH5A 1O1WA 1LAWA 3AVGA 3LSPA 5KRSA 1VIEA 3O5ZA 4CJRA 4M77E 5JR3A 1JT6A 1UHWA 3DKXA 4LDVA 3M0TA 4WCGA 5J2NA 4BRQA 5EG2A 3HHTB 3TTCA 1NJYA 4DOWA 4J83A 1VQ9T 5K5QA 4JKGA 5F1RA 3VYGA 3KP6A 3KYLA 2VQHA 2EX3A 5C0MA 1EWQA 5C2DA 1VQKT 3EN9A 1C1BA 2GF7A 1SAZA 1VTNC 4CZLA 4J2DA 4CZZA 5GAN8 2F4VK 3NWSA 1KRPA 2BV6A 2IAJA 3A8MB 2ZMEC 1IXRC 4J9IA 4FX0A 3NF8A 1R0BG 2LJ3A 5CVVA 5AQJA 5A2QO 3CC4T 3ID8A 4I2QA 3TARA 4O5BA 2F1LA 1UG0A 2BBYA 1IBMK 4CJ3A 2PQ8A 4C92D 3KTUA 1JLCA 2K9QA 1P59A 2P9UA 3HSFA 1G2HA 2WBNA 4CJUA 3HDDA 3L4IA 1PWTA 5H20A 2FXUA 4RB1A 1YW9A 2Z33A 1JLEA 4D8DA 4M63C 2XASA 4HCCA 2K3YA 1ORKA 2W41A 1M2VA 2IBDA 4M7DB 2HSTA 2W0ZA 3C0BA 3JSOA 1DP3A 1Q1HA 5D6FA 5F64A 3C7NB 2BW3A 2XK0A 1KG2A 3CMYA 2OUMA 4DYQA 2I5WA 4AHVA 2VXZA 1SAXA 3D5LA 1FYLA 4AC0A 4OMMA 3KBGA 5J2MA 1Z6RA 4XLAA 1P90A 3SJMA 1EZZB 4AIKA 5LJVA 4YIFA 3RTVA 1VQMA 1Z3XA 1KVCA 2UUCK 1I6XA 3LM2A 2DF6A 3VQ9A 2V6EA 4FM4B 3H0GJ 1QE1A 3BZCA 1OH7A 4CYDA 2AHQA 2E60A 9ATCB 3NFCA 3QSUA 3VQAA 3ZEUA 3JB9G 2F2EA 3OS0A 4DU1A 3L42A 1WSUA 4Z4FA 4KGVB 4LUEA 2LMDA 3CQZJ 3K5OA 1KA8A 4IQJA 2KQRA 5HS9A 1O7FA 5DLQE 4BL0B 1ZC6A 2YKMA 2R7VA 1XNQK 4F7ZA 1YJWI 3SHWA 3U2RA 2VGMA 4V19K 3ERMA 4EQQA 1NKUA 4OMPA 2HOTA 2UXDK 1Y57A 1UA1A 3AVMA 2CMPA 5FD5A 2WADA 3Q0VA 3IRXA 2QA4T 1VQ4Q 2P9SB 2E10A 2FJ1A 3LNQA 3JV3A 2QWNA 4CGGA 4DR6K 1IBKK 3VF2A 5E1XA 1SS6A 5FB2A 5FW9A 4XM3A 5J8CA 3CETA 3I0TA 1JKRC 1NH3A 3C6HA 1BW5A 3RMSA 5EEGA 3EG3A 4CEZA 3WXLA 2JPBA 4N4OB 1TUDA 3GVAA 1WX6A 2RQQA 3WTTC 1NG9A 2DOFA 4XU1A 2VQEK 4E7LA 4E3SA 4LC9B 1KD1R 2CJJA 4M42A 2VB6A 4C92G 1J6ZA 2NS8A 2F5EA 1OQYA 2DA2A 2F48A 1RLQC 1B59A 1TNTA 4BC4A 1GXPA 3FHZA 4PUOA 3FHNA 1L3LA 4ILJA 4FK4A 3DEWA 4J6WA 3PSFA 3ZN1A 4HUGA 4Y1CA 3MWTA 5FLXO 1TT0A 1S6PA 1OQKA 1UE9A 4EP4A 1T39A 4J9GA 2CW8A 3NF6A 2DMTA 4JKEA 3M8SA 4H0VB 3HBTA 4IZ9A 4ZYGA 4ZDPA 4LDYA 2LNHB 2ZPEB 1GOBA 3OYDA 4F7UB 5AN4A 1U5SA 4FXDA 2DERA 2ZF5O 5K7ZA 2WTEA 2G7HA 4KNYA 1YJNQ 2YHBA 5H6QA 4JI3K 2DA5A 2G8KA 2NRAC 3CFOA 1E17A 4GY2B 1IGNA 2YUSA 1VQ5Q 5KYYA 4JRKA 1BQMA 2MWOA 4CHOA 2DK8A 1GLJO 1U2VB 1K73R 4BJ6C 1K1ZA 4OPAA 1ZBIA 1D5YA 2BE7D 3MN2A 3VTHA 2E1CA 4DTPA 1K6OA 3OMCA 1VAZA 3DOLA 4ZGEB 1VSFA 4ZGJB 3MPUB 3MK6A 5J4VA 2P9NB 5AQVA 1JHFA 5CZ1A 5DEQA 1OMIA 2O61A 4IHWA 3OH9A 2CYYA 1JO8A 4WFBL 4FJ5A 2RHIA 2AK5A 1GXIE 4IXAA 3EZ5A 2Z1GA 1NK7A 2D1VA 2XAGA 5KH6A 3B6PA 1KLNA 5I2SA 1OR7A 4IF4A 3RVCA 4CF9A 2EHGA 4CECA 2HQAA 2LKPA 2F6CA 3S14J 3Q9VA 2JNGA 4DGWB 1RESA 3N5NX 4HVJA 3HSBA 1RBUA 4BHCA 4JKDA 3BWGA 4DSIA 4DOVA 4FYVB 3IHOA 4EA4A 1ZYQA 5CAIA 1VQ8Q 4HNTA 1HRHA 4BHPA 2XKOC 2XPUA 5HRRA 1V3FA 4PJ0C 2FPDA 3BG7A 4D5FA 3I64A 1M8MA 5CR2A 2HI3A 1WBDA 3S16J 2X6OA 2CH4A 1E6HA 3WT0A 2W84A 5DPKA 1WI9A 3TSZA 3G6ET 2LBFB 3CBOA 4DEXA 2V1DA 5HKCA 3BR6A 1GFCA 4PJMA 5JI6A 4Y91A 2E2NA 2OPSA 5IXFA 1JQQA 1MV3A 3M0PA 4LG0B 2XGCA 2YRVA 4DK9A 5GAN6 2O03A 2F5CA 4X1VA 1H0MA 3TPQA 3AGRA 1XOVA 3LSGA 4JRQA 4PJOA 1UMQA 4AFUC 3QHSA 4KRFA 2I7PA 3NFAA 2HOEA 4PIIA 1VQOT 2YHWA 4XKWA 2CGLA 1D9DA 2DXTA 1NEGA 4PL7A 1CZ9A 3QBYA 1YQMA 4JKBA 1LFBA 1TKZA 2K9GA 1YJWA 3WNFA 3F6OA 1LEAA 4O55A 4JX6A 4PJLA 1DU6A 4I98B 5J2PA 1JUPA 3RMAA 1WAJA 4HPQA 4F52A 1LWWA 1B07A 2LZ6B 4EGYA 3NGIA 1PUFA 4YIIA 5FLXZ 4M75F 3V9UA 2P9KA 4IBNA 5C4JJ 2HMPA 1KQ0A 5D5VB 1YITI 1XMKA 4EJVA 3CC2T 1RL2A 3CMAI 2BY3A 4CHPA 2FEIA 1K79A 1AU7A 2JHJA 5HNFA 2QDYB 3CJBA 1O3TA 3AVCA 2Y4XA 3FISA 2BIVA 4M7XA 3QZ5B 1ODDA 1NJIC 1GCPA 2OTLI 2QBYA 3OYJA 3CCMI 2EQJA 4QPQA 3QWYA 3EKUA 1OYXA 1VQ9Q 1VQ8N 3OGDA 3T19A 5D4SA 5AT1B 2AT1B 3FBNB 1NE8A 4PLLA 2Y9YA 2DMNA 3F23A 2JS0A 2GWRA 2JOYA 2PMUA 3RZDJ 5JLFA 4BEHB 3T1HK 1TAUA 5FKNA 1YG2A 1YBYA 2ZXHA 1E3MA 1VQ7I 4QVDA 3TU5A 1JJ8C 4GFBA 4OB2B 1FKOA 4CYCA 3PX4A 1P92A 2K85A 3K4NA 4L3QA 1PRMC 2F9WA 1X1CA 4FSXA 3CC4Q 2QQSA 3AAPA 2GBYA 4FJXA 4XTXA 2A6AA 1XJWB 5F0XA 4AF1A 1WHGA 3OB9A 4E70A 1IUFA 3RR8A 4GY5A 2L3PA 4CZKA 3EG2A 3JAMO 2HCKA 1NM7A 1GLAG 2YJFA 5A2QE 1RAAB 1I1GA 4Y92A 1IHWA 4DTJA 1U0JA 1F43A 2DBBA 4FE7A 3DTEA 3CCET 2LKXA 1V5FA 3E19A 1X3NA 4FWKA 3QINA 1WEIA 2JTEA 4CJTA 4E9FA 3JRFA 1S72I 5GAMd 4IQ4A 3LANA 2K02A 5C10A 1RDWX 4NNJA 3A03A 2PQWA 2DPNA 2XPWA 2PEXA 3OIOA 4E9HA 1MWKA 3ZSRA 2E2IJ 4DUZK 5TKYA 1T0FC 1S3JA 4CEBA 3OIPA 3SWNA 2P5KA 1TWBA 1ZBUA 1S9HA 2I0NA 3IRQA 4EMKA 1QVGS 3M54A 1MGQA 4TVRA 1LB2A 2Q3SA 5GANg 1A6QA 1NJWA 1WSIA 1QHHD 4F92B 1XUPO 1STZA 2WSFE 2D0OA 3OSVA 3UPUA 5AQKA 2JRMA 4BY1J 4IHTA 1QWEA 1HKCA 4B1ZA 4TSXA 4KH5A 4G1QA 4FWRA 3C94A 3I9V2 1Q1VA 5IPAA 3VS1A 3J7YP 4DG1A 1KFSA 4Q5SF 1ASUA 3EPZA 2DRMA 4FOEA 2MH9A 3FZVA 3G71I 1FNNA 1WJBA 2YR2A 3GBGA 3TABA 5FU6C 3E1YA 4AG1C 4B09A 2EYWA 2DYSH 4G7OF 2CW0F 3HTSB 4K2EA 3O3FA 3N4QA 1YQAA 5EDNA 5GAN3 1ZG5A 2OANA 1IF1A 4I0BA 1KG5A 5I2MA 3WU1B 1FKPA 3SI6A 1JUMA 1YF5L 2COBA 3OYBA 4KKOA 1N3AA 4CJSA 4RTXA 2DXIA 2V1RA 2ACJA 1WWXA 4MDBA 3D2EA 3AA4A 1VQNI 4NC8A 1MUNA 1TQIA 3W2AA 4NO7A 1IV0A 1TLHB 3TREA 3UKUB 1VQPT 4C92B 1HDDC 1KQ1A 3LP2A 2JJ7A 3WQTA 2HXOA 2F9TA 3G73A 4JZ4A 3D7EO 1I5OB 1X4PA 1RNLA 1DTQA 5AQGA 4EM2A 5ILVA 2HZDA 2V75A 3KK7A 4U67L 1POGA 1PP8F 1N32K 3P1GA 1N9SA 4RW6A 2MBFA 4M7DA 4JI7K 5A0GA 4BE1A 3N4MA 3NMUA 2L9NA 3TP3A 3C7NA 5AQRA 4HQEA 4MLHA 1EKEA 4UNFA 5FJ8J 2G8HA 2HHSA 5DD4A 4UV8A 1KG6A 3IH2A 3JXUA 2RI3A 4C8QA 3PFSA 1T6CA 2E19A 3SLCA 4RDUA 1YYVA 5CZ2A 2XKPA 3EZWA 3CCRT 2E3IA 4YFUA 3LYIA 3C3WA 4MQ9F 4EVIA 1I94K 3PUBA 2DXCA 1YITA 3JW4A 1GLEG 1TU0B 1C0WA 3JAMZ 3CMAA 3I3LA 1A35A 1VQKI 4PGHA 4J8OA 4LD0A 4NS5A 1VFCA 1OV3A 2HF4A 1RTJA 3OYMA 3E9LA 4A5MA 3DAWA 4NLCA 5FLXE 1KVAA 1VQMN 2OTLA 2VPLA 5HODA 3QODA 2L9SA 3CCMA 4MEYF 1PRLC 1GLFO 4LSNA 2K4BA 4B48A 1KHCA 3AG3H 3EUHC 4KB1A 2KHOA 3FMRA 2R5YB 3OHRA 3CFPA 2EJFA 4FT8A 2KYBA 2DX1A 1VQ7A 2OZSA 2K6DA 1IKXA 3VQDA 1M27C 1TTHB 5C6SA 4F9OA 2XICA 2BXYA 1EV7A 5KPZA 2PNIA 3ONQA 3B6CA 3DTIA 1YHQT 4CGJA 1R00A 3MN7A 4RW7A 3INZA 4G6DA 5AQOA 3GF2A 2JZYA 4O0IA 2AZSA 3GNGA 4F2SA 3X24B 2B0LA 4U0YA 3MEVA 2EPFA 5AQQA 3VEPA 4EW0A 3DFGA 2EZHA 2A6HF 4Y15A 1JXEA 1WQ7A 3FLGA 4XL9A 1RRSA 4X6AJ 4HSBA 1RI0A 1J0RA 4ZTJA 1PYVA 2WSCE 2CDTA 2LQKA 1S72A 2L3SA 3DPTA 2FX0A 3CO6C 4UC4A 4DTMA 1X3MA 3EYIA 4XKVA 3G2BA 3I59B 1X1BA 3MN5A 2JPSA 1U06A 3EEQA 2EQUA 4QQ6A 4I9LA 4CF8A 4WWCA 4KTWA 5AIPA 3IH3A 4M7DE 3CPWS 5KQDA 1G99A 4MNUA 3J7ZO 4UUTA 4DSJA 3G6EQ 2RJDA 3QEPA 3AL0C 3C2HA 4EJYA 4C8NA 3TR8A 2O8DA 3QRFF 5IAYA 1N6QA 4XKCA 1N75A 4ZZDA 3VEVA 4BI3A 3EH2A 3D45A 3JRIA 2W1OA 3M8QA 3A5ZB 4NCAA 1RACB 1NJIU 4E7IA 3M0SA 3A0HC 2QA4I 4QOZB 1TWCJ 3HSRA 2JSPA 3VENA 1W6XA 1MMDA 1G2BA 1XDUA 1ZLKA 1HXDA 2QQAA 2BY0A 3V8LA 3G71A 4BROA 1V29B 1S22A 1Y7XA 2IPQX 3CCJT 3CCUT 1J2XA 3OL4A 3ZPLA 1NK3P 3JCMd 3JB9I 1HSTA 3CP2A 4CICA 1QPMA 2QYZA 3R61A 4JHDB 3J7ZI 1ZBXA 2CT3A 4ZN3A 2PMZA 1NK5A 4HXJA 3KHYA 1YFHA 2V1UA 3LSTA 3CC2Q 5EY4A 3Q7BA 1J5EK 2P9NA 4B3SK 3IAYA 4DV5K 2IP2A 1XMAA 4DLEA 2ZNYA 2NVXJ 1VQNA 4CHNA 1R77A 1WKMA 1RIOH 4JK9A 3RZOJ 1B92A 3ZMZA 3LAJA 3EG9B 3QZ9B 4JKAA 2W6LA 2YUQA 3CPEA 1PM3A 4LH4A 3LH0A 2O8KA 3K59A 2Z9OA 2JA7J 2JPCA 1O3SA 3FJPA 2VYTA 1TW2A 4L6V5 2O9SA 2KAFA 1E6GA 2MD5A 5F6FA 3PIOF 5KYXB 4B1VA 2HOAA 2EYZA 3I55T 1JCFA 2ZJRF 4KN7X 3M1EA 2DVEA 1HKQA 5GAMh 1R1UA 3RPUA 3FXKA 3P9KA 2P4TA 4FJ8A 5EOYA 1F1ZA 3ZETB 2IGKA 1AZEA 1GCQA 4ZN1A 3U8XA 2R7DA 4QVCA 1V54H 2GA2A 2XD0A 1E2XA 3X25B 2LBFA 3RQ4A 4F04B 2ZMEB 2JA8J 1N27A 3S41A 3SYZA 4BG9A 1WLPB 2HQRA 2KLAA 3REOA 3VS6A 1SC7A 5EGOA 1VQKA 1APLC 3Q0WA 4LG0A 3LL7A 4GYIA 5IYCJ 5B8HA 3H3NO 2A69F 3PIOL 3CCEQ 3QIIA 2FEZA 4XRSA 4C3IJ 1YJ9I 4B24A 2J6FA 2ZJRL 1ZSZC 3DRRA 4H0XB 3I5SA 3E9OA 2QEXA 1KC8C 2CUBA 2L2PA 3FWEA 3COAC 1M3AA 3JSCA 3MKWB 4KUIA 4P96A 4Y17A 4M3UA 3FBIB 3K2ZA 4AIJA 4XTUA 4F7UE 1W0UA 4PDKA 2GUIA 3A0BC 1FY7A 3K4CA 4DOZA 3PO2J 5IWAK 4GO1A 5K1YA 4LK1F 2KRNA 1ZLMA 1YJWN 1S5JA 2PU9B 3V42A 4GXOA 5KHDA 1HNWK 1JXBA 3MXJA 3E66A 2XF6A 4A2AA 1SSHA 1R71A 3MEWA 3WTZA 3NGZA 3K69A 1RTHA 4CZFA 2M02A 2R7YA 1X01A 2L5QA 2NAZA 3M55A 4XTYA 2LX9A 3LSRA 3HT3A 2GAUA 2DMPA 3TMOA 4B9UA 4CGHA 4KT0E 1TQPA 4UVAA 2FXAA 3MQ0A 3LOCA 3CJNA 2G8UA 1LOJA 3M4YA 3TCJA 4EDUA 3VEOA 2GOXB 2DTOA 3ULDA 1NEBA 4A3DJ 2CH6A 2GNCA 4XLEA 3R6SA 3EGUA 4WF2A 1MWMA 4CCJA 3CYMA 4N9HA 4FPAA 2V6CA 4XN0A 1SL1A 1KG1A 2R3SA 3LSMA 4MO7A 2HBMA 4XK4A 2COYA 4DV7K 1QVGP 3BG3A 1VQOI 4J7FA 2EJRA 2X4WA 4M7AF 4OOIA 1WQ2A 3O3GA 4F8RA 2ED0A 2DZ9A 2K5LA 1VQ6T 4JQFA 3O1WA 4UHTA 1U04A 4XK8E 2RMOA 3PL8A 1V4TA 1ZRDA 1I8FA 2V9PA 1WJAA 3ATVA 3THKA 1KYWA 2P7CB 2CZ6B 5KPRA 2XDBA 2KBTA 3CF5F 5F04A 2AS5F 4X64K 1TKTA 2MC4A 1W70A 3CDHA 4YDUC 2QA4A 4MTDA 1C1CA 4LF8K 2X3XD 4XONA 1QVGA 2L7KA 1GBQA 4IFVA 2CS7A 2V8JA 1TVRA 1N36K 3OW2S 3DLAA 4CJFA 3N97A 4KDPA 1Q81C 4RMNA 1QO0D 1T8EA 3VYTB 2H8HA 4F4KA 2HNYA 4YELA 4H5NA 2WONA 1S6QA 2EYYA 3RKYA 2IEKA 2F2VA 4AWXB 1W7PA 4MO5A 5B1BH 4AU7A 5K7FA 3K1MA 3CCRQ 2JTFA 1TKDA 1UGPB 1S1VA 3QFPA 4BRHA 2MGQA 1N8RC 5C2FA 2HD0A 2QUFA 4W5NA 2P84A 2P9LB 2D0CA 5AQLA 2OPRA 3L1AA 4O0JA 2DCEA 1ACIA 3CF5L 3KYCB 4YPHA 3BOQA 3CBPA 1QVPA 1HW1A 3M1FA 1JJ6C 2RN7A 4E6KG 1JUSA 1ENHA 3RKXA 4JYKA 3DRPA 4CGIA 5IHIA 4PL6A 3DLGA 2WWYA 4BRGA 2F5TX 1Q82O 4M75B 5EU7A 3QOEA 2EQKA 4W1UA 4FCYA 4BDPA 1BBZA 2DA3A 2NOBA 5AQTA 1HJOA 1SV5A 1Y64A 1OFCX 5JS1A 5J2QA 1VIFA 1LNWA 2P5LC 1W1WE 1H88C 3EFSA 1ASVA 2DPPB 1ETQA 3DF8A 4B47A 4N4IA 5HK3A 3CMET 2MD0A 5D5UB 3QXEB 4A3KJ 2HBKA 3UB5A 3VPRA 3E6MA 4C2UA 3IKTA 4K8ZA 3RCOA 4MDXA 2E2HJ 4DTSA 3CBMA 5DMRA 1IRXA 1MBGA 1QHAA 4C92A 4HWIA 4K42A 1QVGM 1HYOA 1HUXA 3VOVA 2JA5J 3KP4A 4EVVA 2HDWA 1YUWA 4BGBA 2DJZA 2R7OA 4XR6A 3NMZC 2KRFA 4AFZC 3CCSQ 1YJ9A 2AKKA 3T8TA 3I0XA 4N9IA 2K5FA 2WAQA 1YI2I 1H3HA 3FGUA 1CKBA 3H1VX 4GV3A 4XAXB 2SEMA 2LOOA 3HFNA 2NUPB 2JTMA 2IGIA 3MN6A 2CSQA 3ENOA 2O5RA 4ZDLA 2ASPA 1CSKA 2D1XA 2NOHA 4JX4A 2ID6A 2PJPA 2WAEA 5KVRA 1VSEA 4I6MB 3DKYA 2RQTA 3OJUA 1B9MA 1RCHA 4H5WA 3SD4A 2QXFA 5LJWA 3MEGA 2DTUA 1P7IA 2OJ2A 2YJEA 1XHXA 1LCUA 5ILSA 4DV2K 3PQKA 1D1AA 2CP6A 3JRCA 3U3GA 3HHGA 2VGNA 4N47A 1FYKA 4RTVA 3BUZB 3SZPA 1NGNA 4QVZA 3Q1JA 1Z1DA 2D6FA 2CGPA 4LFCK 1KU2A 3CMAN 3JR9A 4KH1B 3CCJQ 2GELA 4AHTA 2K27A 4QS8A 3OY9A 1C0UA 1ZN2A 2I5UA 1VQPI 3THYB 2L4AA 3EYYA 2NOLA 2R5YA 4NC7A 2M16A 2M1BA 3S15J 2LK2A 1HK9A 5BPDA 4HHTA 2OTLN 2LNBA 1WIEA 1WZOA 3CPWP 1Y56A 4JAXA 2XRLA 3CCMN 3RTRA 1B34B 1X3ZB 3FR0A 4YOUA 1VQOA 4RM3A 2HKXA 4NHJA 3K2PA 2EIFA 4MZTA 1GVJA 3AVJA 1PU8A 3VEYA 4K11A 1JCEA 1WJCA 1TGOA 3VETA 4HNUA 1NG6A 4PUSA 4ESRA 1MJ9A 2JZ2A 1Q7YC 1WJDA 4BR0A 4CJKA 1VQ7N 2IVNA 3CCSN 3OYNA 4MZPA 2CUEA 4C9YA 2EPDA 2KKZA 2MK5A 1WXUA 2ESHA 4FJKA 2M0OA 1IXDA 3AAQA 4GKKK 1PKTA 2VWKA 5AQUA 5FPEA 1KC8U 2DO3A 3RDVA 2R57A 3REAB 2DOEA 2O8EB 4C92E 3S1MJ 2QYOA 3LZJA 4CEDA 2HNDA 3I59A 4HF2A 4CZGA 1SFKA 5D6EA 3ZT0A 1T98A 4HLXA 1WYXA 3PNVA 2EKHA 1LWVA 1WRJA 3VS3A 3K5NA 5E84A 1S72N 2EQRA 3AY9A 4BVPA 5GMKl 1NHAA 4NOYA 4CEQA 3DLRA 4DKWA 4RCCA 5GAHP 3JAMK 1K9MC 3WEEB 1TUYA 2KPMA 3SB2A 3SV4A 2Q0UA 4UUSB 1HJDA 2KW4A 4M7YA 4OMFB 4EV0A 3E3VA 2FZCB 5AR0A 4KA4A 1WEGA 4B3XA 3M8RA 4AIAA 3MXIA 2V51B 2OQGA 3CCQT 1B1BA 4XU2A 4CBUA 3O8HA 4A3LJ 3T8RA 2O4XB 1YHQI 4MEXF 2VOPA 5CKBA 3CCLI 1XWLA 4RCHA 3U1DA 4E0DA 2F5FA 4JHDA 3RKWA 5BQTA 2M0YA 2EFIA 2IRFG 2K9SA 1OKRA 3CJTB 3V4IA 4CEEA 1KVBA 2RN2A 2OZ6A 4K0KK 2HW3A 3NDKA 2XGXA 3G71N 4DZJA 3VQBA 2R93J 3MWPA 3T0YA 3HRGA 3N05A 1VA7A 3ZX3A 2FF3B 1GRIA 1ZBFA 1JLBA 3F8MA 1X9WA 2EW3A 4KH0B 3S9HA 5LJ3f 2R7TA 2EIMH 5DS9A 2KNBB 2P5VA 5HROA 2VBYA 3EG9A 2RGVA 2PMZN 2QEXQ 4NXNK 1F4KA 2CV1A 4I0AA 2P6SA 4Y0WA 3LDQA 4QSHA 1JKHA 4RTYA 3BJ6A 2C0TA 5L3BA 5KYXA 4E9EA 1YI2A 1LE8A 4A3IJ 5AZJB 5I9EB 1NJIR 5EC7A 4FJ7A 2IGOA 3VS5A 4V19S 5KGXA 3FJ5A 4QS9A 3M3YJ 1QP3A 4KH4A 4CHYA 1I5LA 4BQAA 1NNEA 2Q2EA 1IG7A 4BBRJ 2E88A 1VQ6Q 1LOTB 1Z25A 2ZMEA 1TUCA 1LAVA 1MPGA 4M3DA 1TWFJ 3CCUI 3CCVT 2DILA 2L02A 3HTUA 2FE3A 1G3TA 3QB0A 1HYSA 3ZXSA 3IS9A 3ALYA 5L3GA 2R92J 2D5VA 4Z4CA 4AHUA 1IJJA 1P4AA 2BTTA 2ZJQF 3AFHA 4R55A 3NBPA 2ROTA 2EV6A 3HG9A 5E26A 4OAZA 2B7EA 3IWZA 1YS6A 2X9DA 3FRNA 4BH9A 1PP7U 4PJOF 4X9CA 1WI3A 2HSEB 4E2FB 4ID5A 4ELUA 2IS3A 2RQVA 3EL2A 2FMLA 2VQCA 1N34K 4GKJK 4BY6C 1TUGB 3CD6Q 4R5PA 1VQPA 3CJ9A 2IA0A 3K9JA 3ZSZA 1C6VA 2YSRA 5DM7R 2I8DA 3TAEA 1UG2A 1S9GA 4DQ2A 3HC7A 1BCMA 3S1QJ 2VUMJ 4I01A 2OA8A 1KEAA 1USSA 3F5TA 5GAN2 3UDCA 3HM8A 3WNEA 4XH4A 1N25A 2ELKA 2QEXN 2R7ZJ 3VS7A 1N39A 4NZGA 1TK0A 4LD9K 3QPTA 2ZJQL 3ME9A 1CXQA 4IHXA 4JKCA 5EG0A 2OTJT 4RAGA 4CFCA 1MJAA 1EWRA 4NLBA 1WZ2A 5GANd 5D3GA 1QW1A 1B6AA 1QWFA 4A53A 1S1XA 3JCMf 4A3JJ 1Z9ZA 3M9QA 4Y52J 4FZXC 1UTIA 3GZNB 3QESA 1ZYRF 2PBIA 3WVDB 3OW2P 4JS4A 3AVFA 4DR3K 1RI9A 1XHZA 5FRNA 1QVUA 1M1FA 3IUOA 2Y0MA 1X2MA 3E0JB 1NJIO 4JJDA 3P8BB 2ROLA 1DLOA 3CMEQ 1JTXA 3JTHA 3OS1A 3H5RA 3ATUA 3BDLA 4KGXB 3TANA 4FK2A 2Y2ZA 3QKJA 2A6TA 5LGUA 2OCEA 5M5YJ 4HEA2 2K3FA 4RLFA 3S2WA 5LY3A 1KD1C 4BRIA 2CQKA 3OW2A 1QVFS 2YHYA 4J2BA 1AHDP 2ZGWA 3LWHA 1BA1A 2XVCA 4C0GA 4IIMA 3B6OA 3ID6A 2LTPA 2F5KA 2VC8A 4DF4A 3KZZA 1U5TB 3MCAB 2BZXA 3PMIA 4ZDOA 3CD6N 2E1OA 1FT9A 3PNTA 2MF2A 2BEOA 4FT4A 1T8IA 5KAFC 3VPZA 4C2MJ 1REVA 1YHQA 2ZXJA 3MMYB 3CCLA 2DL3A 1X1AA 1EX4A 1JXMA 5KNLA 3RUXA 1TYQB 3K9KA 3HOSA 5GAEP 1ZREA 4N0AC 2QA4N 3K58A 4ID1A 1WNLA 3CESA 5GAOr 4CK3A 2LP0A 3KZIC 1J7KA 3OS2A 5DV5A 3QNOA 1FSHA 2IA1A 4H5VA 4L9NA 3OTOK 4JI5K 3M57A 1K73C 1Q7YU 5D5WB 2RJFA 2EFOA 2Y31A 1IJWC 5HLTA 4C5GA 2VKEA 3ULEB 2O8CB 2CUDA 2OQRA 2Y75A 3KLHA 3A1PA 2MW8A 1YS7A 2Q8KA 4N5SA 2ZJPF 4BACA 2YLBA 4HT8A 3M4OJ 1MV0B 4MQ3A 1DEJA 4V2SA 3W0LA 2KGTA 3CMMA 2NUTA 1KZHA 1M8VA 3S3MA 3ZSWA 1OU8A 4PWDA 3BG5A 3FK6A 1JBMA 3IUCA 2O8FB 1UWBA 3CUQC 4BXXJ 4IUUA 3TOBA 4CEOA 2NLUA 1KU3A 4OKKA 2ZXWH 3JRBA 1KFDA 1XQSC 4UXNA 1JKOC 4YTLA 3PE0A 1QZYA 5EZGA 1LCKA 3DLEA 3PV8A 3OSFA 5GAMe 3HEFA 5CE3A 3OW2M 2L89A 4DF8A 2DI3A 3W3DA 2OZMA 1LDDA 3LAPA 4M71A 3SUOA 1X4OA 4NL3A 3H3OB 1HPMA 1K9MU 3NAUA 1YX3A 3BROA 1KSWA 3J80E 3CCUA 3R60A 4BD3A 4BQNA 4B23A 3CW7A 4DS4A 3R4KA 2ZJPL 3ABUA 2B86A 4XU3A 4BBSJ 3JB9H 3BCBA 3J7YJ 2FF6A 4I7FA 3DYAA 2ED1A 3CJQB 4U0VA 2E64A 3FM3A 1BI4B 2WTUA 5HRNA 3A01A 1VSJA 4X0GA 3I0WA 3LDPA 3SQ0A 1WAFA 3DXKB 5GAMj 1JEGA 4RGRA 1R4NB 4ENMA 1Y0UA 4LDUA 2IT0A 4M7AB 1ZKGA 2DTIA 1AZGB 1ZG1A 3IDHA 1NK4A 1JJ2S 4JI4K 4AM6A 4M78F 3M9AA 4JLGA 2NUPA 3MAQA 4M77C 1TOVA 2FYKA 5HOOA 2G8VA 3FX3A 4B9QA 4C5IA 3SBGA 4BDZA 3H9JA 1I4K1 1Y39A 1K76A 1WSJA 4C8QF 4JEPA 3RKQA 1YJ9N 5ICEA 3I71A 4E47A 1OU9A 4I6MA 1WI7A 2H6CA 2XKOA 1BO5O 4DA4A 3LPUA 3G3ZA 3BZKA 2WAQN 1RAEB 1G5VA 3WXKA 4BG8A 3KLEA 2AXTC 4ME7A 4CC7A 2R7FA 1ULYA 2YSQA 1Z05A 4UOBA 4JI6K 1ITGA 4ORZA 2VN2A 4L5EA 5L3EA 3X28B 1G3YA 5IT9Z 4G9ZA 4RGUA 4CJ7A 1S7AA 2A07F 4MQVA 4BWMA 3CERA 3BG6A 1KK7A 1ZR2A 3QP5A 4J01A 4PQUA 3JRZA 3GTLJ 2G0EA 1W7AA 3VYRB 1W5CC 2BY1A 3HHHA 4AVZA 3TGNA 4DFPA 1RTIA 1ZBSA 3G4ST 1XCBA 4IEEA 1IZ1A 1ZSZB 1RTDA 1WJ5A 3NF9A 2RQWA 3FZLA 3VB2A 3BR3A 1DIZA 2KZMA 4X1EA 3CDLA 3MCPA 1PHTA 2RC4A 1XGSA 4YFNF 1B34A 4M75E 2P9PB 2CQ7A 5AQFA 3VQEA 3BG9A 1ZHIA 3FZKA 4Q47A 3QWXX 4JKFA 4HX4A 4EHTA 2D0QB 1SANA 3L9FA 2OPTA 3RR7A 1XSDA 2NXNB 4CGDA 3C1DA 4XBFA 4ITVA 3SUPA 4FTHA 2NYXA 2DXBA 1Y71A 5SZTA 3NNQA 4W5TA 3K4JA 2E5NA 1KCFA 4FJMA 3NHNA 2EQMA 2RDPA 2AQEA 3KETA 1VQON 1ORPA 3AG4H 3UT1A 4IIOA 1PDNC 2E2QA 1FJLA 3CXCA 5HK0A 3QYFA 3CTAA 3FB9A 2PTKA 1BOTO 2QW9A 4BRKA 2Z2SB 2OBPA 2O8EA 4IG0A 3EG1A 2RHZA 4H5TA 3F9MA 1RDUA 2ZJ2A 1QLYA 4U7DA 4KULA 4BRDA 5L3FA 3I8BA 5LJ3e 5LRSA 1PD1A 2Z1DA 1HU0A 5DDGA 3SQNA 1M1KO 2YU9J 1CZAN 4ZZLA 2ZFUA 3GFJA 3K7AJ 3CCVQ 4J9BA 1R58A 5E8IA 4JI0K 1M2VB 2K7AA 3VUBA 3FM5A 3WEEA 3ZQLA 4QT7A 3HGGA 4UUSA 3VESA 2BW3B 2M4GA 1TT5B 5FKKA 3DCFA 1XS9A 2COWA 2NVYJ 1N5YA 1V5GA 1UJ8A 2K3PA 3RMDA 4GLKA 1IDYA 2CS3A 1QZZA 5GANh 2UUBK 4ISEA 1OYWA 1YTAA 1HW5A 3EGDB 1FN7A 1EA3A 1WJSA 4M73A 2DT6A 2VT3A 2QKLB 5CHIA 1MW7A 2P0KA 4XSZF 4I2PA 3K0LA 3P8HA 4RB2C 3AVLA 5FLVA 4BDYA 3QBXA 1Y6IA 4BXFA 1L5UA 4E7ZA 2VG6A 5HS8A 1IUYA 3ZEUB 1KD1U 2CP0A 1UCRA 5AZIB 2LH9A 3HGYA 4M72A 4D8KA 4II2A 2NOFA 2FU4A 2QGUA 4CCKA 4L18B 4XTVA 2XSJC 4RMOA 4FM1A 1XX5A 4E4HA 1ZQ3P 2CZ0B 1FW6A 3DKWA 2JWLA 2A3LA 2C0OA 1E3OC 4F3TA 1HKBA 2DE0X 3DLKA 1L3UA 5H1SQ 2W24A 1FOWA 2STWA 1XI1A 2VJ4A 3KEOA 3F3XA 3JCMP 3MKYB 3DB4A 5AZJA 3NTHA 4KH6A 2MWPA 3P31A 2PJRB 2E35A 5D6WA 3EDPA 1IO6A 4DIQA 4F16A 1DPUA 4O6JA 3LSJA 3O3HA 3L2VA 3KEQA 2V7ZA 4HF0A 4A6EA 4JPBW 4OF1A 4CF2A 4KTQA 3CCQI 1KQ8A 5LL6Z 2JVGA 1NGHA 2M87A 1YI2N 1K73U 3JCMe 1UGQB 2EFPA 4OLBA 1GV5A 1DT9A 1I27A 3U3YA 2AZVA 2FMYA 5LD2C 2D5RA 2O88A 1QVTA 2BE2A 5LJ5d 4B8CA 1GUUA 3DLLA 4CF1A 3OIQA 3GXOA 3UNGC 1D1BA 4XSXF 3JCUC 3LW5E 3RRGA 4RUGA 2IW5A 3DWLE 3T1AA 5CIUA 4DQPA 4A5BA 2ZB9A 2MSYA 4QWQA 2VXEA 2Q0RA 1NOYA 1M1EB 5LBQA 3GG4A 1QSYA 4A0XA 3QDKA 1HX1A 5E3LA 2X6WA 2JW4A 3C0CA 1HJRA 1UELB 3H0HA 4M45A 2Z1HA 4EMGA 3QDFA 2QDLA 1W5TA 2L7ZA 4BC3A 1W97L 4M78G 1XC5A 2EIJH 2PZSA 2VV5A 1R0CB 1QGPA 1KC8O 2UV1A 1TZLA 1Q81R 1VI0A 1WUAA 1QVFP 1XN7A 1IN5A 3WE3A 2YNFA 3E9GA 2LCLA 1ATNA 1VQPN 4DU4A 2LY2A 4RG2A 4AH9A 4HSTA 2RNGA 2QGFB 1W9HA 1N9RA 2UZKA 1MNEA 1N8RR 4OMZA 4ELVA 4CHUA 5KYNA 3AO4A 3LP1A 2LT1A 3ZMDA 4DLGA 2KXCA 5M5WJ 2HQEA 4M9XA 3THWB 1T33A 3TKYA 2E12A 1B9NA 1OI1A 4ZYEA 3LWLA 2ELJA 4RLQA 3A02A 2E5ZA 4ZH4F 1OJLA 1IRFA 1K0XA 1GLLO 1OX8A 4BR7A 4EHUA 3G25A 2JQ7A 3CC7Q 2ZWHA 2ZSHB 1HDPA 4DCHA 5D4RA 2EA2A 4OMYA 1JT0A 4A4FA 4K25A 5C25A 3GCMA 4M3YA 5GMKm 4KREA 3PIOA 2WV1A 3E6CC 3VQPA 4XLCA 2QG9B 3VQ5A 4H0PA 1D5VA 3U9GA 2F5DA 1RT6A 2UUZA 2DD4A 3OS5A 5HRSA 4IPAA 4OPJA 1U5TA 2IVPA 4I02A 1UHMA 4K43A 2K3BA 1XTDA 1OCCH 5BRHA 1ZR4A 5BR8K 5EZHA 2DL5A 5JLHA 3K5LA 1MMNA 4DFKA 3EKSA 1B7TA 4EZ9A 4WXHA 3FIWA 2OTJI 4FU6A 2AKLA 1WGSA 3WTYC 1KG7A 4DSLA 2FUG2 3A1YA 2A3ZA 1L3SA 4DFJA 3GZ6A 2EJ9A 5CY4A 2MI6A 2ESWA 4JN4A 3MWMA 2E1HA 1U6ZA 1KQ2A 4DTUA 5JHUA 4KMFA 3VQ7A 2ZD1A 5D6YA 3CCLN 1ZBJA 4QS7A 1Q9YA 2P81A 4PJOB 2ESNA 1OR7C 2KLOA 1BUPA 1BOAA 4CHQA 4E19A 1YN8A 1XGNA 4OIOF 3ASOH 1TXQA 3ULEA 2O8CA 2FZKB 3F8CA 3UE5A 4BI8B 2BE9B 2L3QA 2CRGA 3CHWA 1RBVA 3L6QA 5JS2A 1QVFM 3K70C 4L5IA 1FBUA 4EEFG 1FSEA 1YQKA 1JJ2P 4XLFA 1E4GT 3KE2A 2E7XA 2P9KB 3ZQQA 4ZYHA 2O8FA 3G4SQ 3IC7A 5CYQA 3SJHA 2V52B 3A8GB 2ASMA 2BDPA 1YNZA 1O13A 3DP7A 1SHGA 3TAMA 4A0YA 3PY8A 1VRLA 2KT8A 2LTOA 3WTXC 1Y1VJ 2ICWG 1XC9A 2LRDA 3OOUA 1TSFA 3VA0A 1JJ2A 1IZ6A 3HI0A 1BB9A 2YNHA 4LOCA 2HNIA 3V1QA 3U21A 3DPLC 2YDLA 5FFZA 5ED4A 5LGNA 3EAEA 1JXSA 3ZSVA 4BUGA 2XHIA 1BI4A 4CCHA 1Y1WJ 1VQ8T 2GWKA 4CYCB 3DXKA 5CYVA 2D4WA 4Y13A 5GTHC 1Q7YR 2RKIA 4BRCA 3JSMA 3CCUN 3CP8A 4AVPA 3M8PA 2XB0X 1T7PA 1EH7A 2UXNA 1NGIA 2BGCA 2OCCH 3VEWA 2JUGA 3O3KA 2NRWA 2M9UA 2Y69H 2HBWA 2M45A 4L59A 2NVQJ 4YRVA 4N4GA 4PJNA 1RILA 2LP5A 2YX7A 3RSEB 3GP8A 1HCRA 1VSHA 2HTJA 2DA9A 1KXPA 3BQYA 4I6ZA 3LMMA 1DTTA 4B9MA 3E6DA 4BWJA 1DGRM 2XO7A 3QMLA 3E9FA 5AYFA 2YUOA 3S93A 4ENJA 4OFAA 4U0WA 3LL3A 3I56I 3B73A 5JMVA 1DP7P 4FJLA 4M9SA 4KI4A 3O9QA 2FOWA 4EP5A 1M90R 1GT0C 1D5AA 1A31A 3I4PA 5DCMB 1SL2A 4PZJA 5C15A 2VJ5A 3EFRA 3DLBA 5IXBA 1QP2A 3ZSXA 2VODA 3QNNA 3J81O 4RW9A 1AEYA 1ZSZA 4EJTA 1IN8A 3AA3A 2VXDA 1QQJA 2KKOA 5E3OA 4MIMA 5D8KB 3R6MA 4RW4A 2P9PA 3FK7A 1JJ2M 1ETKA 2Y1JA 2Z1IA 3SQ2A 2E8AA 4MMKA 1BK2A 3A5LC 5T7BA 2LC2A 2W48A 2NNNA 2Y0SA 3H5AA 4M4ZA 4A3BJ 2E6ZA 3ZT1A 3F21A 3K1NA 1NM1A 1TNSA 2F4OB 3K10A 4FM2A 2O2OA 2K5CA 2L9VA 4A4HA 2NVTJ 2QF7A 2HXIA 2DT7B 3REBB 3AVIA 3H3VK 2EILH 3VN5A 1OISA 2QVOA 4ILGB 3GUDA 5EVZA 2X0LA 3MEXA 2P4RA 1UFMA 3KFVA 3GTOJ 2K5IA 2DFEA 2QWMA 1BWFO 1H8KA 5LJ5h 4O4GA 4H8KA 1H9GA 1A04A 1ZGAA 4IG3A 1IAWA 4CUGA 1JKQC 3ZQCA 2CO5A 3SWNC 5AQIA 2P0QA 1H8AC 4QW2A 2RHKA 2BHZA 4EMKC 2KT1A 1S1WA 2OTJA 1RADB 3M58A 3ZT2A 2HVIA 3OSGA 3ASNH 3D2EB 3JCMX 1R9TJ 5TJJA 2K9NA 4OMQA 3E6BA 5JFRA 5IHNA 3AVKA 3CJCA 5FO5A 3OYGA 3SXYA 3ZBDA 3L8BA 3OVNA 4MMLA 3JTGA 4JLIA 4BRNA 1YWOA 5J39A 5I22A 4M7AE 1U2WA 1AD5A 5DYMA 4CXFA 4JS5A 2KSSA 1CGPA 3CLQA 1K4TA 1VQLI 1MMAA 1K7AA 3IV5A 5KK1A 4M78B 2D1HA 4OB3B 2L2OA 1BI1A 2H6BA 3AG1H 4ANJA 3D0PA 2CH0A 3VYSB 5IT9K 3PLAA 1IV8A 1HF0A 1R22A 3IH4A 1K9MO 4C8QB 2DIGA 4MLOA 1YRNA 1MHNA 4CIGA 1XTAA 3EGDA 3HFOA 4XICA 1NMDA 2RO0A 2FZGB 4YPRA 4FLWA 4LLGF 5HBMA 3PX0A 2MC3A 2GM4A 5HLHA 2CGKA 1H3ZA 2P7VB 3VQ8A 5FROA 3RDIA 5KPTA 4EPCA 3JCMQ 3HOXJ 4F93B 3I33A 3BW1A 1TWGJ 3VKIA 2CFXA 2JMWA 3D1NI 5AZIA 5GAHJ 1T3LA 1YIJA 1T44A 1S29A 1S6LA 1VRUA 4FSSA 1HA8A 1T6SA 2ATCB 4FLYA 3KD1E 4MTEA 1IW7F 4YHHK 2J05A 1I5ZA 1Q9XA 2DK3A 4M7DC 1Z0XA 1IC8A 3V1RA 3ZT4A 1IG8A 1BI0A 1CLQA 1IN4A 2DYRH 2YUPA 4CSWA 5FWBA 2X51A 1K9AA 3R2XC 3J81Z 3A0IX 4CA0A 2H56A 4H4KC 3K70D 2HYFA 1X2QA 3LZIA 2PJRA 3AVHA 2JGUA 5DD8A 2VYPA 5JICA 1EETA 4F2RA 1R7JA 2OAZA 1BR2A 1ZXOA 2CGJA 1XG1A 1UHFA 1U4BA 4HSRA 4IDKA 4DMNA 3WODF 2GQIA 2OX7A 1HR0K 2VIXA 5F2RA 1ETYA 3ZCMA 1RT7A 1IH7A 2HBLA 3MN9A 1T6DA 1T05A 3SFIA 4DSKA 2HQHA 1JGSA 2VC0A 2HHQA 3C18A 2JMCA 2K79A 3JS6A 3LSKA 3OH6A 4IRHA 2DJQA 5I3UA 1JTYA 2K2VA 2O0YA 4CRIA 1XC3A 4DB3A 4CJLA 1TWHJ 1KU9A 1A5VA 4KHYA 3I56A 1U3EM 2RKHA 3S2HJ 2K9LA 4FL9A 2WACA 3SHFA 4BRFA 2DA4A 2HVSA 2BTFA 1RC9A 4JZ3A 1DGKN 3Q3SA 3RWUA 4AI4A 2Q97A 2O8DB 2IPOB 3LALA 3DPUA 1UB9A 2KIMA 1KFZA 2D0PA 3HTRA 2GXAA 4DEYA 3WGHA 1MBKA 4BR5A 2CV2A 4LGWA 3H0DA 2MOXA 1SVMA 1XG7A 3FHGA 2BUPA 1SRMA 4EMHA 1QMCA 3K57A 5KAIC 1NYGA 1MBJA 3BZ6A 4IEIA 4OFEA 2QSGX 3ZMUA 5C24A 1RUOA 2F2WA 1MH4A 1RAGB 4J9HA 3THWA 1SFUA 3QOPA 1ITYA 4HBLA 1AWXA 1WHHA 3E97A 1Z21A 4B1XB 4A4KA 4H0OA 3F0CA 1OH5A 4UB8C 1J3TA 1BIBA 4WFAL 3AA5X 3QG1A 3KWGA 3D4VA 5C12A 4E6RA 2LVSA 1I81A 1V55H 2CWEA 5B3SH 2EIKH 3DU5A 3FZHA 1SFEA 5J3LA 1FX7A 1JHHA 5J26A 4CEAA 1D3BA 2CP5A 1NKEA 3VOEA 2UUAK 4WF9L 3HL2A 3A4CA 2K4JA 3NARA 3Q5FA 3BF1A 1P4XA 2HZYA 2X9HA 1B9FA 3BR2A 2EZKA 2EH3A 4DV0K 3NF7A 1QCFA 5BNGA 3CLOA 3C95A 2XPVA 2CZ7B 3V8JA 1TQMA 1VQLA 2OJED 2H8RA 4PSWA 2ZPHB 3OQ5A 3LQRA 3OBWA 4P55A 3V81A 3ZSYA 2QWQA 4DYCA 1IKYA 2E4LA 1KD1O 3A98A 3A8LB 1T56A 3OR2C 1W2BS 2F69A 1X58A 4BRLA 3ZQGA 1HLUA 1UHCA 2X4XA 2RI2A 3VMFB 2M1HA 4AI5A 2M5WA 3I54A 5K5OA 3H0FA 4IOAF 3UKGA 4IKFA 1X9MA 4XOPA 3KXTA 2O6GE 4KJZA 4A54A 5FD6A 2UU9K 3O6WA 1U9OA 2HU9A 5EGOB 2BVMA 4BREA 1B3QA 1VYUA 2VE9A 3KKSA 2EV5A 2L01A 1VQ4I 1R0AA 2ISYA 3WXJA 1CF7A 5ILUA 1HNIA 3M56A 5GANj 1NZ9A 3E9PA 3DMJA 2ABKA 2RHUA 1EH6A 5C3EJ 2X4HA 2DBKA 3OR1C 3MHXA 1K73O 1QZEA 4IOAL 3C7JA 2L0AA 5FKOA 5DM6F 1SSFA 1K61A 4RB3C 5GAEJ 2HPIA 4E7JA 1A0NB 2A6EF 4J6XA 4W97A 1G3WA 3K9TA 1RABB 3QUIA 2HHUA 3GTQJ 4RG8A 5GTIC 4UY8O 2HNHA 3D5RC 2EGAA 2HPMA 1ZSGA 1OH6A 2EWNA 2ZPFB 1YJWT 3I8DA 1D9FA 3TTFA 4KFBA 3ZGKA 4FYYB 2IC3A 2DA6A 4KICA 5AFUH 3H0IA 3V9ZA 3A5OC 4WXCA 5IHKA 2ZPBB 3OWTA 1YTYA 4LE9A 1TW3A 4K41A 1I3AA 2Q0OA 4LF6K 1BI3A 4M74A 2JTVA 4JDSA 1XSVA 3S6WA 4Y28E 5AQSA 1X9JA 1S1NA 3CWSA 5DM6L 1RT1A 2UXXA 5FU7B 2PVOB 2FBYA 2YX4A 5K7HA 1RGIA 3C12A 4LDXA 4HTUA 3WUHA 1QZ6A 2W57A 3TDUC 1XCVA 2MLGA 3GOXA 4BE0A 5F1JA 2DBMA 5BRFA 1YJNI 1IKVA 3DXMA 4B43A 1G4DA 4UY8I 1MDMB 1XMXA 2RPIA 1JB0E 1OCZH 4AMCA 3W3CA 1S1UA 1VQ5I 4OO1J 2ZFWA 3HXLA 5GAGP 1XPXA 2AJQA 3M1CA 2KRMA 3IAM2 4H0TB 4XKBA 5I21A 3DEEA 2YCHA 3ZSQA 4OJRA 3S1RJ 1FOKA 1JI8A 1O3QA 2XB5A 3RSEA 5FPMA 2M9HA 3KLNA 4RB0A 2ME0A 4NB4A 2FO0A 1X27A 3R9PA 4FLUA 1YQRA 2KISA 3SDZA 2QTVA 2XHBA 1BKBA 4A3FJ 1W36C 3TI0A 1M5Q1 3TL4X 3GBTA 1NKCA 2LQWA 3EQLF 4X34A 1BJZA 4Z4EA 2V79A 3KPHA 1U8BA 1W7PB 4KT5C 2DXUA 5DCMA 4N41A 4PJOE 1WXTA 1BL0A 4E7SA 3G7ZA 3JCMV 4J7IA 5M5XJ 4KIGA 2G7UA 4LSLA 4QQGA 4IJAA 4AD9A 2MYSA 1WSEA 2XRNA 1Q18A 1SKWA 4JUVA 5KCMA 1J5YA 5FGMA 4FE4A 3GTGJ 3E5XA 3HJEA 2A05A 2O8BB 4F3OA 4A5AA 1IRGA 2E6LA 3U9DA 3HPOA 4WCEL 4BC5A 2BANA 2DYIA 1GV2A 3FXJA 1BI2A 2FBHA 5M1OA 3OYFA 4ELZC 3VQ6A 4LF7K 1LFPA 5KCOA 3I58A 2R7XA 2YG8A 3BR5A 1R36A 1VQMQ 3FXQA 3E5UA 4XOTA 1NGBA 3P5JA 3PO5A 1YVNA 2OAWA 3TAPA 2KQ2A 1R8OB 2QKMB 3BJOA 5IOZA 4DBFA 2VUBA 3LA3A 3VQQA 4C5HA 2CT4A 4YG2F 1R49A 1H92A 2W04A 4FZZA 2Y0SN 3L2WA 2OV7A 4ICLA 2GFUA 4PFOA 4WK8F 2VI6A 3K2AA 1BC8C 1JU5C 1OEBA 1LPLA 3NGYA 4QTRA 3HPWA 1YIJQ 4AHSA 4ZGDB 1QHTA 4KPYA 5J6XA 1B8IB 3Q9SA 3C2BA 4B1WB 4LK0F 3OYCA 4XRMA 2MLKA 4NYNA 3SFMA 2RJEA 4DQQA 4PY5A 3ZP5A 4X65K 2ZCWA 2RNJA 4ON0A 5GPAA