4E7HA

Pfv intasome prior to 3'-processing, apo form (ui-apo)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
368
structure length
368
Chain Sequence
b'LDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 107
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7hA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7hA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7hA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7hA03
2WACA 1TAQA 4B9NA 1YT3A 4RW4A 3CYMA 1JKHA 1UA1A 3P8HA 1TVRA 3HO1A 3NTHA 4F3TA 3PNWC 4CHNA 4FJGA 3D45A 4CGIA 3M8QA 1SSFA 4M42A 3KK1A 1OI1A 3KLFA 1WN7A 3OYFA 4A4GA 4J2AA 5SZTA 1BI4A 3DRSA 1VSLA 3DLRA 4AHCA 3DLHA 4EP4A 4DSEA 4AHSA 1BIZA 2DFEA 4CEZA 4DFMA 4NCBA 2LRQA 2B8AA 4YFUA 1RT6A 3KUFA 4AH9A 4LH4A 3CFRA 3SPYA 4UQGA 4KTZA 3VA3A 4DSIA 1NJZA 4FCYA 1REVA 3AA5X 4B9VA 3LPUA 1J5OA 3KJVA 3AVAA 3DYAA 4PLIA 4BACA 3ZT4A 1ITGA 4CJUA 5CYMA 1WJQA 3V9WA 3K5NA 2E5QA 3HP6A 4FLXA 4CRIA 1VSDA 3PMTA 4PUOA 3L3VA 1C6VA 1RBUA 1I3AA 3CFOA 1S6QA 3KIOA 1L3SA 2RHXA 1RI0A 4LD6A 3AVHA 3O8VA 2DFHA 2ITGA 1TL3A 1KLMA 2E6LA 4B9XA 1X9MA 2A1RA 3PO5A 1HMVA 1UA0A 2HVHA 3S3OA 4DSJA 1JLEA 4FM1A 3ZCMA 2D0AA 3FFIA 3JYTA 1B9DA 3VQAA 4B8CA 3VA0A 3AO2A 3VQ4A 4GVMA 3WNEA 3DMJA 3QEIA 4W5NA 3TI0A 4IKFA 3HYFA 1TK0A 2XRIA 1L3VA 1J9AA 2Z1HA 3NE6A 1ZBIA 4B08A 5D6XA 3LP1A 2OZMA 3LDSA 2G8WA 3DOLA 4O55A 4DU1A 3RR7A 3BDLA 3V9UA 4C8KA 1SKWA 1XHZA 4OKKA 4FJJA 1OYXA 4CF9A 1TKZA 3L2UA 1KFDA 5J2NA 2RHUA 4CJKA 3FDRA 4DFJA 2R58A 2QKKA 4PA1A 1T8EA 3BGRA 1DLOA 5JS2A 2EFIA 3NDKA 4JRQA 2KW4A 3CM6A 3PMIA 3OMCA 3VQDA 4CEFA 3MP8A 4KREA 4BDYA 1HQEA 4FVMA 1RTDA 3V9SA 4E19A 1VSMA 4FJXA 4HUFA 2Y1JA 3JSMA 3C4SA 3PV8A 2EQMA 2OPPA 3SV3A 3WNGA 3HJFA 2WONA 2HHXA 2RN2A 4H4OA 4BD3A 1CZBA 2G8VA 3T3FA 3MP1A 3ZSQA 4WE1A 2OPSA 4B9MA 3AO4A 3QIIA 4OGEA 3LGFA 4QQ6A 4C8OA 1YTAA 3SZ2A 1TKDA 4MQ3A 2OZSA 3L2VA 1UWBA 1SUQA 4CF1A 5IAYA 4EZ6A 4IUUA 1C1CA 5EU7A 3K5LA 3LP2A 3O4NA 1KSPA 4N4GA 3LP3A 4JLHA 4FLVA 2JTFA 4CJ3A 1WLJA 1G5VA 3V4IA 4KI6A 3WNHA 3L3UA 3NH1A 3DLMA 2DTUA 3KLGA 4TSXA 2HHSA 1LWEA 2HHUA 2XK0A 2EQUA 2EHGA 4YNQA 1I39A 2DAQA 4QVZA 3TWHA 4DTNA 4M3ZA 2HNDA 1BQNA 4DWIA 3HPHA 3LWMA 4FK0A 3NTKA 4FLYA 3OS0A 2D0BA 1UAXA 2IGIA 4FYDA 3FEOA 4B3OA 4M41A 4DF4A 1XNIA 1Q8IA 3MEEA 4DQPA 3S3NA 1L3UA 4FZYA 4DTMA 5CYQA 1LAVA 3TANA 2YKMA 4I2PA 3LAMA 4IG0A 3OYGA 3ASMA 5JS1A 2RJCA 5KH6A 3ITHA 2G8FA 4HTUA 3NFAA 2QK9A 4Y1DA 3P5JA 4Y1CA 1QSYA 3SQ1A 4KO0A 3OYBA 1XI1A 5C0MA 2BDPA 4RG2A 3QIOA 3LANA 3O4QA 4IBNA 3V9ZA 4KPYA 3KKRA 3E9GA 3LGLA 3F9KA 4DSLA 3C6TA 3C6UA 3V81A 4KB0A 4F2RA 2E6MA 5J2MA 3QNNA 1RBSA 3HM9A 3NGYA 4HUEA 1EP4A 4OGCA 2P5OA 3UIQA 2Z1IA 2QKBA 4Z4EA 2RI3A 1BQMA 4E1MA 4ZTFA 4W5RA 4GMJB 1JL2A 2XHBA 3F73A 4QQGA 1R0AA 2OYQA 3OYMA 2RF2A 3EZ5A 1WSGA 4N56A 2A1SA 3QNOA 1QHTA 3LALA 3NF9A 2ETJA 4OPJA 2XY5A 4FJMA 1GOBA 3M8RA 3S9HA 4DTRA 3U6FA 1NJXA 3RMDA 4DTXA 4CGFA 1X1PA 3U3YA 3CFPA 3MEVA 1WJSA 3K58A 2DFFA 5HRSA 3VQ9A 5C42A 1ASVA 1OZ2A 4DTSA 4DQIA 3LP0A 3NH2A 3HK2A 4BDZA 1RDAA 3NAEA 1CXUA 1BGXT 3ZSZA 3LH0A 3MEDA 2YNFA 3AA3A 2XDPA 4CESA 2VWJA 4EDUA 3SUQA 4IFVA 2X6SA 1NK5A 4IG3A 4Q5WA 1NKCA 2BE2A 3BDPA 3LAKA 5KCHA 4QCLA 4R5PA 1A5VA 3T1AA 2G8IA 3QETA 1QSSA 2XY7A 1FK9A 2JZ2A 1CLQA 4A4HA 3VQEA 3SD4A 3U3GA 4IUQA 4O5BA 3MEGA 4BWJA 1U04A 4PL6A 1BISA 4AILC 2F96A 3EYZA 1IO2A 3AVNA 1NK8A 3ZSXA 4BWMA 3ZSYA 4BE0A 4X34A 3K2PA 4IUTA 4CE9A 3MEAA 1BIUA 2VWKA 4OKEA 3OYAA 1VSEA 4DF8A 4B9WA 4I7FA 3OYCA 1N5YA 2KFNA 4B9SA 4M3TA 3CQ8A 3QBYA 1JXEA 2RHZA 4DMNA 3S3MA 3OYLA 2W42A 3G10A 3ZT0A 3S6WA 1U4BA 4M3XA 3B6PA 1SL0A 2BANA 2DIQA 3C94A 2IOCA 4JS4A 4EZ9A 4E7IA 4CHQA 2O4XB 4ELTA 4E3SA 4ELUA 1RT4A 2L89A 1RTIA 2KFZA 2E4LA 2VG6A 1RT7A 3AO1A 4C8MA 1RBRA 4FLWA 4CHYA 1BCMA 4F8RA 1QE1A 4FZXC 3I8DA 3TABA 1BL3A 1TL1A 2ZD1A 4CERA 1IG9A 3META 3IRXA 5KE3A 4NYNA 4DSFA 2HB5A 1D9FA 2BGGA 1JLGA 3OY9A 4CJFA 2EX3A 4CJSA 1TK8A 1Q9XA 5DMRA 4CJQA 5HRPA 2PYJA 1JLBA 3RR8A 3M8PA 1KFSA 1B92A 3KLIA 4E7HA 1JLFA 4CJEA 4PY5A 4M3WA 1HNIA 4CK1A 1Q9YA 2X4YA 4CHPA 2X4WA 4A4FA 4AHVA 2HNZA 4I9QA 1EXQA 4KB1A 2DY4A 4GW6A 4RW8A 2HNYA 4CIEA 4CGGA 3ZSVA 2X35A 4F2SA 1SKSA 1U47A 1C0MA 4I9LA 5KTQA 4CGDA 3RRGA 5HLFA 3UWNA 2KQ2A 4AHRA 3SQ0A 1WJRA 3NCIA 3H6ZA 1VSKA 3PO4A 4DU4A 4DTUA 3AO5A 3OJUA 2F5KA 2JGUA 2B5JA 3OYIA 4FL6A 2OA8A 3KK3A 4Q5VA 3HPGA 1WGSA 4CHOA 3LYIA 4W5OA 4O0IA 1NK9A 1QQCA 1TV6A 1KLNA 1JLQA 2FC0A 1HYZA 1S1XA 3SUNA 1CXQA 3QO9A 5C25A 1BCOA 3EY1A 2R5MA 1W0HA 1RT5A 3FLGA 3VQBA 4E7JA 4GY5A 1ASUA 4FJ9A 3AVFA 4FM0A 5I3UA 5KCOA 1RDBA 4FW2A 4DQRA 3ZT3A 3OVNA 4H8KA 3OS2A 2LSNA 5CIUA 1VSIA 4E0DA 4ICLA 4LH5A 3WNFA 4DTJA 3RMBA 3TAGA 2HVIA 5KRTA 2LCCA 4ZHRA 4Z4GA 3ZT1A 1LW2A 4QW2A 3VQ8A 3ALYA 1EX4A 4Q0BA 1HJRA 2E6NA 3P8DA 4CJWA 3VQ6A 3MXJA 3ZT2A 1GOCA 4CFAA 2GUIA 1NKEA 3KK2A 4AHUA 3L2RA 2JLEA 3THVA 3AA4A 3QJ6A 3SV4A 4CJTA 3KLHA 3DLEA 3ZEHA 2QQRA 3MXIA 4IURA 4LSNA 3I0RA 2FBYA 3P1GA 3SQ4A 2P0KA 1WSEA 1RDCA 1JLAA 3L2QA 1ZBLA 4CEOA 3C95A 3K5OA 2WOMA 5M9OA 1DTTA 4KHNA 2NLUA 4CGHA 3SPZA 5FRMA 4HCZA 1LWFA 5SWMA 3AO3A 5C6SA 1GOAA 2L8DA 3VQCA 1ZBHA 4KRFA 2ATQA 1S1VA 4W5TA 4FJIA 3VQ7A 1KRPA 1N27A 1ZBFA 1HRHA 3KTQA 5HROA 1FKPA 3O3FA 2HHTA 3QEXA 3OB9A 4CK3A 4DFKA 4KTWA 3OYJA 2K3YA 5D6YA 4FJ8A 2Q3SA 2X4XA 4FXDA 4KI4A 4I2QA 3UT1A 2RHIA 4O0JA 2PY5A 3D0PA 1NK7A 3ASKA 2YKNA 3OYNA 4FJ7A 1RDDA 1RBVA 3KLEA 5CZ1A 3V1OA 1ZYQA 3VN5A 2BKDN 4O4GA 4OKJA 4Z4CA 1NOYA 3HPOA 3V1RA 1YVUA 1RTHA 4J2EA 1SL1A 3NF8A 1KVAA 3QINA 3AVJA 2GFAA 1NK0A 4Z4HA 2D0CA 4CJPA 4KHSA 1KVCA 5D6WA 4CIFA 3SNNA 1WSIA 2GV9A 2RJEA 4HCCA 1LW0A 4CK2A 4FM2A 4CJ4A 3DOKA 3PY8A 4B8AB 4B9UA 4F4KA 4NCAA 5J26A 2EQKA 1S1WA 3HT3A 4OLAA 3SI6A 4UC4A 2IS3A 2M0OA 3TARA 3OMGA 3V6DA 1J54A 4CJVA 1T05A 4NCGA 4RW7A 1HNVA 3K59A 4ID1A 3SUOA 4CEDA 3KKSA 1EKEA 1W9HA 4DLEA 3IAYA 3L2WA 1ZBUA 3LLRA 2L3RA 3CEYA 4CIGA 2D9TA 3AVBA 4BDPA 1D8YA 3OQ5A 1JLCA 3NH0A 1EETA 3GOXA 4CEAA 3CM5A 3PX4A 5C24A 1D5AA 4FLZA 4K8XA 3F70A 1IKXA 4Z4IA 4O44A 4DTPA 4FLUA 1LAWA 4FZZA 2KTQA 2RO0A 3OYHA 2LTOA 3OYKA 1RBTA 3DLBA 5KE2A 4JS5A 1BI4B 4OPKA 3ISNC 1VSHA 3L42A 2BUDA 3A2FA 1NKBA 4FJLA 4C5IA 1S9EA 4RW6A 4KHWA 2RHYA 3KD1E 2VG5A 5KGXA 3TR8A 4OVAA 4KV8A 4KHUA 3DB3A 1Z26A 1C0TA 1TKTA 2YHAA 1C1BA 5T7BA 4N4HA 2B4JA 3MP6A 5HBMA 1HYVA 4FJ5A 1C1AA 3V1QA 4HCBA 4CFCA 4CEBA 5FROA 2YNIA 5IN1A 2QXFA 1WSFA 5HRRA 2FBVA 2FHDA 4HVJA 3AVGA 3LPTA 2EKOA 2G8HA 1NOZA 4XIUA 4ZTJA 3HXMA 2R57A 4DG1A 3H08A 2XY8A 4B9TA 1SL2A 3RTVA 4DQQA 5FRNA 3DB4A 4CEEA 2PYLA 4FLTA 2YNGA 3QEVA 2RKIA 3AVLA 1RILA 3SUPA 4J2BA 2RI5A 3O3GA 3AVKA 4M3YA 3SYZA 1FXXA 3DRRA 2EQJA 4IDKA 4RG8A 5KRSA 4NS5A 4BE2A 5E41A 1RCHA 3QIPA 4N47A 2X74A 2IC3A 1XWLA 1VRTA 2IAJA 4NYFA 3NBPA 4CF0A 2O4IA 3RRHA 1YTUA 4CHZA 2Z1JA 4DS4A 2HW3A 3FC3A 4CCHA 4QQDA 2KZMA 2OPRA 1QSLA 4M3UA 2D5RA 1ASWA 4N5SA 3HVRA 1OZ3A 2Z1GA 3NNQA 5FDLA 3QESA 1TAUA 2O4XA 5KI6A 1NK6A 1RT2A 1N6QA 4B9LA 3E01A 1K6YA 1KHCA 2K3XA 3HSTB 4OLBA 1WNSA 3OA6A 1S1TA 3LZIA 4OJRA 3NGZA 4DU3A 4OVLA 2ZQBA 4II1A 2OPQA 2LVMA 3B6OA 4FK4A 2G3RA 1IKYA 1TGOA 1VK0A 3NGIA 3MAQA 3NTIA 3K57A 4QAGA 3Q1JA 3TAFA 2VG7A 2KZZA 4C5EA 4H4MA 3OYEA 1S6PA 3LZJA 3SJJA 4LY7A 2IG0A 4PLLA 4FJHA 1RTJA 4CJRA 3CG7A 4KKOA 4NZGA 3AVCA 3O3HA 5K14A 1VSJA 3QEPA 2VYTA 2DIGA 1WAFA 1KVBA 3VQQA 4C5HA 4DSKA 3DRPA 1RT3A 4L8RB 1QTMA 2I5JA 4C5GA 1JXBA 4DTOA 5HRNA 2YHBA 4JRPA 4F3OA 1X9SA 3TAQA 2XY6A 4LD0A 1A5WA 1A5XA 3P83D 3MO8A 4RW9A 2RJDA 1CZ9A 1UOCA 4AHTA 2HQXA 2X6NA 5CY4A 2QQSA 4K8ZA 3TAEA 4E7KA 4IUPA 3K5MA 1T7PA 4KHYA 1KCFA 4LSLA 4CF8A 4DLGA 4MFBA 1O1WA 1XC9A 1X9WA 1NK4A 1S1UA 2XO7A 2HMIA 4N41A 2MWPA 2PQWA 4FK2A 4CFDA 3ZSOA 1MU2A 4DFPA 3I0SA 4C8NA 3ZSWA 2F8SA 2YRVA 2GBZA 1U49A 2ZE2A 3SQ2A 4KHQA 1TKXA 3H8ZA 4HUGA 4CECA 1LWCA 3V9XA 5J2PA 1DTQA 4HHTA 2GFUA 1L3TA 3IG1A 1HPZA 2NUBA 3EAEA 2MWOA 3DI6A 5J1EA 3HVTA 4KFBA 3LWLA 2RJFA 2HHVA 3NHGA 3L8BA 3DLGA 2GF7A 1Y97A 5J39A 4N76A 2O4GA 3RMCA 3QLHA 4CGJA 1IKVA 4KAZA 4Z0UA 1S5JA 4M45A 3PX0A 3DLKA 4PQUA 3T19A 1T03A 1D9DA 1C0UA 1LV5A 2X78A 3QKJA 1JL1A 4W5QA 4FU6A 1IKWA 4N4IA 4CEQA 4FJKA 1WAJA 4CFBA 2G8UA 3OYDA 3OJSA 3E9FA 2P51A 3HL8A 2HQEA 3TAMA 4G1QA 1VRUA 2PZSA 4L59A 4PWDA 2R5AA 3RMAA 1S9GA 1L5UA 3NF6A 3MEWA 3RWUA 2F8TA 3AA2A 5CZ2A 3VQ5A 4CJ5A 3LX7A 3PFSA 4C8LA 5HP1A 1SV5A 3M8SA 4EP5A 1KTQA 1BHLA 4BE1A 4KTQA 1U45A 2BIVA 2FBXA 2B6AA 1J53A 4M3RA 1Z25A 3PUFA 3TAPA 1H3ZA 5DK5A 4E7LA 1XHXA 1F21A 2CKKA 2Y1IA 4DS5A 3MECA 4J2DA 2HHWA 3OS1A 1RNHA 1NJWA 2IDOA 3DM2A 5D3GA 1HYSA 4IUVA 4A4EA 3IS9A 1MHNA 5KGWA 2YNHA 2HHQA 3QERA 3M9QA 4FW1A 4Z02A 4CF2A 2RI2A 2AJQA 1B9FA 5J2QA 2M16A 3AVIA 2P1JA 4ELVA 4QOZB 1WSHA 3G0ZA 1NJYA 1RT1A 4CJLA 3MXMA 2P5GA 1FKOA 3HP9A 3AV9A 4E1NA 3MEUA 5I42A 3NF7A 2M1HA 2G8KA 1U48A 3ME9A 4DQSA 2FBTA 1VSFA 3ULDA 3KD5E 1QS4A 1SKRA 2LDMA 4E89A 3SCXA 3AVMA 3PX6A 1WSJA 2YV0X 4FJNA 1IH7A 2RPIA 2R7YA 4ID5A 4IFYA 1TK5A 3ZSRA 3VQPA 3QEWA 1HQUA 4Z4FA 1G15A
chains in the Genus database with same CATH superfamily
2YLBA 4KUIA 4BRCA 3CDIA 5DCFA 2G6FX 4I99C 4B9NA 4HTLA 1WEIA 2FYKA 4NO7A 2AZVA 3E6DA 1TVRA 3HO1A 4DCHA 5GANg 2PFBA 3NTHA 2R7FA 5LHHA 1T2KA 5KN8A 4DEXA 1HW1A 2NVQJ 2XV4S 3M8QA 1IRGA 2TDXA 4G9ZA 3CQZJ 1T0FA 4C1NK 5IT9Z 2ABKA 5D7UA 1SZ2A 5J8FA 3OYFA 4Y91A 3UDCA 3FRNA 2R3SA 3B8AX 1NLPC 3FHNA 4M75A 1IV6A 4AHCA 1J09A 1YJ9I 4ZGDB 3QU6A 1BIZA 4JKAA 2DFEA 4CEZA 4DFMA 2LRQA 3GLLA 4IO9L 4IFEA 4PJMA 3FDYA 5FWBA 4HBLA 5CPRB 5CVIA 3SPYA 3R0JA 1I8FA 1XQSC 3WTYC 2DM1A 3W0LA 3EUKL 1IC8A 4KH1B 5D5VB 4LDXA 4LDVA 3V8JA 3CCJQ 4JP0A 4B9VA 3QDKA 1EZZB 1J7KA 5ICGA 1I4K1 2EYQA 3C6AA 4J9DA 3KJVA 3AVAA 5ICCA 2JTMA 4BRLA 1FBQA 2K9SA 2A42A 3GCMA 2OTJQ 1ITGA 4IOAL 2RN7A 5CYMA 4KNYA 3MZHA 3EKUA 4KN7X 1MSEC 5GAGJ 1LVKA 2DXIA 4JBAA 1W2BA 2DL3A 4X62K 4OPAA 1YS6A 3NPFA 2AKKA 3SZTA 1C6VA 1RBUA 1I3AA 3CFOA 4Q48A 2RHXA 2DA9A 3GF5A 3O8VA 3CBPA 2ITGA 3JCMb 1Z9CA 1KLMA 4EAHD 2QZ8A 3H36A 1X9MA 3FZVA 2EFOA 3PTAA 4IRHA 1HKCA 2AXTC 1XJWB 2Y75A 1FOXA 1PD1A 5LHIA 1R00A 4HYEA 5D5WB 4FM1A 2DT7B 4L9TA 3ZCMA 1WH7A 1IN8A 3H9NA 4LE9A 2NWMA 3VQAA 3VA0A 1B9NA 3SAGA 2VXZA 3O1WA 5M1QA 1X19A 3CMAT 2XC7A 2DT5A 3G6EN 5FKLA 2FMYA 2W03A 2KMTA 3L6QA 1L3VA 4PHTX 4KIFA 5D6XA 1ODDA 4EV0A 2QYOA 4BU2A 4M77A 3LP1A 3ML6A 2MBFA 1VQLI 1A36A 2VGMA 5EEAA 2E4HA 5DYMA 2OZMA 4M3BA 1YN8A 1VIFA 3CUQC 2KXDA 5CKTA 1WQ7A 4LK0F 4BUGA 3DOLA 2QTDA 3RR7A 1N75A 3V9UA 4A3CJ 4C8KA 1SKWA 2CW7A 3ZPLA 1B7TA 4HKEA 1JKQC 1ATSA 4MEXF 1YW9A 3H9JA 3WTSC 1OYXA 5GAMj 1G59A 2RK1A 1XNRK 3CC4A 3DKYA 2FQ4A 4CJKA 3S17J 3DP7A 5CQGA 5LJ5f 4DFJA 2QKKA 3A8HB 2VJ4A 4M77F 5LJ3d 5CKBA 1O13A 3PO2J 4I6MA 1YRNA 1BB9A 5GAN7 2KW4A 3VQDA 1M4ZA 3CJ7A 4BDYA 2OANA 2EV0A 4DR6K 4WXDA 4DYQA 2P7CB 1IUFA 4HUFA 2Y1JA 1X3ZB 2E7WA 1QPIA 1ABQA 4B4CA 2W85A 2OPPA 4WQ5A 2DQLA 2NRWA 4JKDA 1YIJQ 4KBMB 3HJFA 2WONA 4H4OA 3QFPA 1XGOA 3BOQA 3AY9A 3CXCS 4WE1A 4B9MA 4IRIA 4OGEA 5IYCJ 3KZZA 1O3TA 4QQ6A 2FBHA 1TKDA 4DEYA 4NBQA 4HCKA 1PP8F 5GAN8 3WHBA 5JR3A 3WGGA 4MFDA 3JRHA 3EO3A 3CJBA 2C6YA 1M30A 3O8GA 4EZ6A 2HDCA 3EG1A 1C1CA 3SEZA 4J6YA 3G71N 4HLXA 4DV0K 4GLKA 4AU7A 4BGDA 3B02A 1YJWT 3ECHA 5HS9A 1RPWA 2BY2A 3ZX3A 1VQ6T 1IUYA 2FRHA 2COZA 3CD6Q 3L3UA 2HOEA 3QBWA 2WC9A 4TSXA 1VYUA 4K2EA 3MFKA 3M0UA 4HZFA 1QCOA 3M3YJ 5AIQA 2CH4A 2JVGA 2DVEA 5E1XA 1Y1VJ 1ON2A 2EHGA 1UG2A 4CCKA 1JQQA 2DAQA 2EGAA 3LDLA 1Z7LA 4KULA 2HNDA 3E2UA 3UE5A 1TUUA 4BBRJ 3L1PA 5HS8A 4WFBL 1ZG5A 2XAUA 3NTKA 3S93A 1ZRFA 2ENMA 2XAQA 1XGMA 3TQ7P 2QA4T 2IGIA 3CW7A 1YI2Q 4KN4X 5JLXA 2V9KA 1OLTA 1Q8IA 3S3NA 4JKFA 2CWEA 2XF6A 5ICFA 4C92G 2OTLN 3K0SA 4HOBA 3D7SB 4MEYF 1YW7A 1ZLKA 4M78C 5IXBA 1HX1A 3LDNA 3CDHA 1UFFA 2KK4A 1DGKN 5DM6L 3E5QA 3OYGA 4F7UE 3ASMA 4ILHA 3WHCA 5KH6A 4PCQA 2LYCA 3I4MJ 3CCSA 2QK9A 2KRHA 3CC7N 3MKDA 3P4IA 1PUEE 5HCKA 5IP6A 3SQ1A 3WODF 3OYBA 1XI1A 4HLYA 4AD9A 5GANe 2KRNA 3LDQA 2K40A 5AR0A 3V9ZA 2IP2A 3E9GA 1H3HA 4J8FA 3V81A 1WXTA 2CG4A 4F2RA 2QEXT 2J5OA 5J2MA 1P9QC 1RBSA 3SBGA 1UG0A 1RAFB 1RKWA 4YOQA 4FL9A 4RAFA 2EKHA 2YU9J 2J6KA 4C8QB 3C2GA 5IOZA 1RRSA 1X75C 1EA3A 5GAMh 2PMHA 2RI3A 2GBQA 4W5RA 5B5EC 3HSBA 1JL2A 1HBXG 1YQAA 2XPUA 2KSSA 2JWLA 3F73A 5BRFA 4QQGA 2DILA 4J9GA 3CC2I 1MH3A 2IT0A 1VQNN 3L1AA 1CSKA 4M9SA 4OMFB 1YX3A 3T69A 2OU2A 1YBYA 2QTVA 4EJUA 5CJ9A 4WFNL 1Q1VA 4B47A 3OSVA 5B1BH 1YITI 6PAXA 1VYVA 4LLLA 4OPJA 4IOCF 1HSTA 1GOBA 4DTRA 5EX5A 1NJXA 4CGFA 1QCFA 1Q7YC 3MX2A 3CFPA 1O57A 1RFQA 1UHMA 1WJSA 3M57A 4A3MJ 3PL8A 2PJPA 4IHYA 5HRSA 2F5VA 3KEYA 2NOFA 3M56A 3CCUQ 4DTSA 2MYSA 3NH2A 3DXJF 2CP3A 2JS0A 3HTSB 1E6GA 4BDZA 2FSWA 5KQ8A 1I5LA 1UGQB 1BGXT 3LH0A 5IXFA 1V1CA 2Q0RA 2E41A 3MEDA 3AA3A 3GTJJ 2E19A 4C8QD 2CZ0B 4GYGA 3BW1A 3SDBA 1EFNA 2X6SA 2NOGA 5M1FA 4IG3A 2ZJQF 1EWRA 4Q5WA 1NGDA 2CRGA 2BE2A 1Q18A 2QXLA 2LH9A 1OQYA 3Q0UA 4IPAA 4D7NA 3ECOA 1IB8A 4AMCA 1A5VA 2XHIA 4OWRB 1JXOA 5M3FJ 2NUTA 2XY7A 5K7FA 2RM4A 4A4HA 3SD4A 3U3GA 5LMUK 4O5BA 2KJBA 3CCMT 2BTTA 4YORA 4MHGA 5CE3A 2CQ7A 2NNNA 1K8AO 2Z3YA 4DBQA 1U04A 1OU8A 4C92E 5C44J 1QNTA 1USTA 4PL6A 2KJCA 4AILC 3DWLE 5I21A 1IO2A 1DT9A 1GT0C 2KY9A 3OL3A 1M2VB 4DQ8A 4BEHA 4H5NA 2LJ3A 1FSEA 4BE0A 2F5FA 3UA6A 1NTCA 1BIUA 4L5EA 5HY6A 3OYAA 3CMYA 3AAFA 2FVUA 3CF2A 4BS9A 1VFCA 5H20A 4B9WA 4I7FA 3OYCA 1I5OB 3QQAA 3VYUB 2GTJA 1T3SA 4CBXA 2QSFX 3QBYA 2VB6A 5BPNA 2W10A 1JTXA 3S3MA 3RR6A 1YQRA 3OOUA 1JJ8C 2QSGX 2ZPGB 4FWPA 1TZLA 3G2BA 1HCRA 2DO7A 1ZGAA 1U4BA 1Z0XA 3BP8A 2IIRA 5H6RA 3MKYB 3EFOA 2F5DA 2BANA 1WXBA 1ETVA 1MDMB 2DPDA 1SKUB 2VOPA 5GAHJ 2FZGB 1U2VB 2JN6A 1U3OA 3HDDA 3I64A 3JRZA 2KFZA 3JS6A 4S05A 3S2HJ 2CP5A 4LF6K 4XOPA 4CHYA 4F8RA 3C65A 4R55A 1BL3A 1TL1A 2ZD1A 1SQKA 1WHUA 4EA4A 2EIJH 3HM5A 3HG9A 4NYNA 4AG2C 3GDQA 4DSFA 2QQAA 2E1OA 1UTIA 1JLGA 2HQ5A 2K4YA 2EYXA 2EX3A 2LQ8A 1SVMA 3H0DA 1Q9XA 1T3VA 1GLCG 4M77G 2ZM6K 3WXJA 1KQSM 3RMSA 1OYIA 1MNDA 1W4SA 3HRTA 1BK2A 2HWVA 3G6EI 1VQ5I 1G4DA 4AFQC 1HNIA 1Q9YA 2VQFK 2MIOA 3L2ZA 5FKKA 2W57A 5GAN4 4CHPA 4F16A 2X4WA 4A4FA 1YCYA 2XUBA 4HVWA 4LDUA 4KB1A 4GW6A 4KGXB 2FZKB 3D2EB 2X35A 1EIFA 2ZXJA 4O6JA 5LJVA 1U47A 1IF1A 1C0MA 2F69A 5HLFA 5LFAA 1VSKA 1EQYA 5BREA 3PO4A 4MO7A 3OJUA 1HSJA 3QG1A 5E8IA 3WU2C 1KJWA 4JUVA 2B5JA 2JGUA 4M75E 2HBLA 2JPSA 5D5XB 3DPTA 5TRDA 4D6WA 4ZZLA 3FHGA 4DV2K 3PLAA 3J81E 1QQCA 1TP4A 5TISC 4EIKA 3M3ZA 3CJRB 1WI3A 2FC0A 3GXOA 1BCOA 2P9NA 1SVOA 3CCEQ 5J40A 3EY1A 2R5MA 5LJ5g 2VI6A 3FLGA 2EQIA 4GY5A 2Y9ZA 1FT9A 1FBUA 1ASUA 1U5TA 3AVFA 4FM0A 1X6OA 1BBYA 2LP5A 2JSPA 2Q2EB 3CCLT 3CQXA 4FHTA 2KIMA 2KI7A 1RABB 2FX0A 1PU6A 4X64K 2RV8A 1VSIA 2DQRA 1NPPA 1TT5B 4ICLA 1R4MB 2WY7Q 1TWHJ 3WNFA 4DTJA 3DXKA 3AG2H 3WGIA 3H6EA 1ZQ1A 1SAUA 2K2VA 2HVIA 1RI7A 4CZGA 5KRTA 1T95A 2LCCA 4ZDPA 2NOHA 3EGDB 1RKTA 2HMAA 4Z4GA 3QO3A 1OOTA 3ALYA 3RZOJ 3Q0VA 2E6NA 3GTGJ 5TJJA 2I10A 4CJWA 5GAMd 4CFAA 2GUIA 3ZMTA 2RN8A 1WHLA 4Y7NJ 2P84A 2ESWA 2TRTA 3GPLA 5DLQE 3L2RA 2O2OA 3J80K 2O9SA 4C0DB 3TSZA 3HKZN 1BA5A 1RUWA 1XMKA 1TUCA 1HLUA 1UZCA 3TREA 3BTJA 1H89C 2JWTA 2NRXA 4JLIA 4A3IJ 1W7PA 2GXGA 2A6AA 2BZTA 1YJ9Q 1VQKN 2JHNA 4CYCB 3G71I 3ASNH 1GBQA 2G9WA 3MXIA 4RM3A 1ZR2A 2VBZA 4YOXA 4IX7A 1E3HA 2QI2A 2K3BA 4YEJA 1JU5C 4GBQA 3ZEUA 3SDZA 3FX3A 4BR7A 3SQ4A 3JAMO 4J01A 4IOCL 1MUYA 3JCMP 3GW2A 1UB9A 4CEOA 3C7NA 1XQPA 1D1CA 4IHXA 3H0IA 1MPGA 3CUOA 1N5ZA 3VYTB 3CLOA 2QASA 9ATCB 5BRHA 3CPWM 1HR0K 4CBUA 3HOWJ 4HCZA 1TWGJ 1D3YA 2OV7A 3RVCA 1VIEA 3AO3A 3FF5A 3VQCA 1FYKA 4M77E 1HJDA 1ZSZC 3V4GA 1QVUA 2QAZA 1S1VA 4Y0WA 3J7AP 5J1RA 1N27A 2HVSA 2O9VA 1TYQB 1ZBFA 2CP2A 5HROA 4LN2A 3PIOA 2KDOA 3RKYA 4JDSA 1EH8A 1P7JA 1U0JA 4KTWA 1QVFP 3QWXX 1SD7A 2DA6A 3OYJA 2K3YA 5D6YA 2ZJQL 4ZDLA 2STTA 2Q3SA 2DL4A 4KISA 2CSOA 4KI4A 3AHUA 4O3MA 4CXFA 1EF4A 2RHIA 4DGWB 3IFRA 3ASKA 5KYUA 5HK0A 3H45C 1V29B 2KHMA 2YKNA 5E18F 1XMXA 3BR2A 5FKMA 4FJ7A 4FIBA 1SS6A 4HVUA 3MKZA 2CUDA 1Z91A 2LF8A 2DBKA 1D1AA 4OKJA 3PIOF 4UB6C 3M0PA 3V1RA 3TL4X 3AL0B 4J2EA 1B34A 3O2PE 4B09A 5KAIC 1LKXA 4M4ZA 3AVJA 5LEKA 1QKWA 1FWZA 2OQRA 2P9KA 2GFAA 4PKIA 2D0CA 1PYVA 1QP2A 1JKPC 2DXUA 2KMUA 3GZ5A 2PX9A 3N97A 2RJEA 1I3QJ 2HF4A 1VQLQ 2PUKB 5GMKm 4NXMK 4CK2A 4FM2A 2VC1A 3PGGA 3IKTA 1ZREA 1O7FA 5DEQA 2E1YA 4ILJA 2Y0SA 1I1GA 2DMPA 5HVQC 1B1BA 4F4KA 4M71A 5J4YA 1Y0NA 1FTTA 4A2AA 5J26A 5EXWA 5EDNA 2YUPA 1UECA 2CGJA 3HT3A 1CKAA 2LT4A 2O03A 1RAEB 2CT3A 2CSIA 1UMQA 2FSNA 3V6DA 2LKXA 1DIZA 4RAGA 2VBWA 1O3SA 2YR2A 1HK9A 1PC0A 4D0PA 2E35A 3K59A 1VQNI 2E2OA 3R4KA 3SUOA 3QOPA 4L9NA 2ZWHA 4BKXA 5C4XJ 1BI1A 2D5VA 4IIOA 2ZSIB 3CIPA 4CDGA 4AI4A 5FKNA 3GTQJ 1ZBUA 4YIFA 3RKXA 3KP2A 2JMAA 2D6FA 3ZR8X 2E5NA 1VQMI 3CCJA 4B1YB 2D9TA 3UF4A 4F14A 1VQPA 1D8YA 2NS0A 4M78A 1S1NA 4CEAA 1R1UA 1D5AA 1MV0B 2UUCK 3EG3A 3QPSA 3BWGA 4NDLA 4JI8K 4BL0B 3H41A 3OYHA 3OYKA 5F0CA 1RBTA 3DLBA 5KE2A 3DEEA 4M7AC 4OPKA 4Y33A 1ZLMA 5JVTA 5AIPA 1VSHA 4QS7A 2CDTA 3CCRT 4A5AA 3BLYA 2CZ7B 2NAZA 2RHYA 2X4JA 2VASA 3PIPL 4KV8A 4CD3A 5ADXA 4KHUA 4BVOA 3DB3A 4WXHA 2KVQG 2UWMA 2ZCFB 1ZC6A 4G8XA 1TQIA 4E1JA 4HNVA 5JVHL 5IT9O 2RA2A 4NC6A 2FD5A 4DBFA 3O9TA 2O8XA 1C1BA 3OR2C 1SD6A 4N4HA 2VKEA 2FF4A 1CGPA 1HYVA 4A4KA 1QVGP 2P7VB 1C1AA 2LNHB 4CEBA 2MABA 2YNIA 3EN9A 3KWGA 5J8CA 1DUXC 4HVJA 3AVGA 3CJQB 3LPTA 2EKOA 4D9JA 2HBPA 1NG9A 4ZTJA 3HXMA 2R57A 4G6QA 4FOEA 4BB7A 2W4SA 1YJWI 1L0OC 4DQQA 3I55A 1K8AC 4HW0A 1QA6A 2X48A 4CEEA 3HZ6A 2LVSA 2IS6A 4FLTA 1AOJA 1X58A 4FISA 3WG7H 3N4PA 5E3LA 4DR7K 3OSGA 2V26A 2MD0A 2F9TA 4BRIA 1ZG1A 4M73A 3SUPA 2NNWA 2P9SA 3O3GA 5LJ5e 2A07F 3REAB 3AVKA 4R8HA 4M3YA 2JTEA 3G4ST 3SYZA 3CC7T 3DRRA 2GWRA 2LC4A 5E41A 2EZIA 1RCHA 2X74A 4UY8I 3UKUB 4YRVA 2DTRA 3NBPA 3IC7A 3RRHA 2Z1JA 5B66C 1S7EA 2HW3A 4OFAA 4Y4RA 2K9QA 1GLBG 2X51A 1LJOA 3DTEA 2HPIA 5B8HA 4I98B 3P31A 1OZ3A 2Z1GA 3NNQA 4XRSG 1NK6A 2DPUA 1RT2A 3PVLA 4B9LA 3E01A 1K6YA 1KHCA 1GDTA 3O9UA 2JXBA 4CZFA 1K7AA 4OLBA 1QZEA 3HXLA 2IW5A 4QPQA 3NQOA 1S1TA 2YXYA 4XH4A 5J3BA 3MX5A 5LJWA 3H3VK 1LPLA 4HVVA 1KO9A 3KVGA 4RB3C 1BG3A 3EZWA 5M1PA 2CGKA 3C2BA 3CTAA 5BNGA 5AQPA 3NGIA 4JOMA 3NTIA 3LNQA 5GANj 2NVXJ 2F4VK 3HHHA 4BROA 3K57A 4J7IA 1IZ6A 1KAXA 4LF9K 3TAFA 1PKSA 4HX7A 1S6PA 3SJJA 4LY7A 3CC2Q 1VQON 3CESA 2JMCA 1LNXA 1A0NB 2HKOA 3TP3A 2X6WA 3HSCA 2DAOA 3JR9A 2LJ0A 3WXKA 1ZA1B 2ITMA 2WUSA 3KP6A 1QBJA 2VIXA 3LL7A 3PT9A 1WX6A 1YITQ 3CD6A 4C5HA 4DSKA 2JT4A 2M51A 3DRPA 3LAJA 3MEXA 2H3GX 3J7AY 4KYWA 1KA8A 3BY6A 2CW0F 1RT3A 3ZOBA 4L8RB 1QTMA 1ZK8A 1AKHA 1APLC 1WGXA 1JXBA 4DTOA 2CT4A 3IWZA 4JX5A 1SD5A 2YHBA 1X9SA 4EPCA 1KQSS 3Q3SA 2XY6A 3P83D 4RW9A 2O01E 3WT0A 5AQHA 2GXBA 1IN7A 3E1YA 2EZHA 2O0YA 2W0ZA 2QQSA 1WZ2A 3BUZB 5E3OA 4AVPA 1DEJA 4E7KA 4IUPA 1V5FA 1WVRA 1T7PA 2KLOA 3CWUA 1IZ1A 4II3A 2XICA 5GAOn 4DLGA 3GVAA 1RACB 3OGDA 4MFBA 1NK4A 1S1UA 1MMAA 2CUEA 3GZNB 2HMIA 3CC4T 4FK2A 3T0YA 4R0KA 3CUQB 1BBZA 4CFDA 2OFIA 1NGEA 3A0HC 2P9IA 1GHCA 4C8NA 1UJ0A 1K78B 3JB9F 1B3QA 4FWRA 1U49A 2ZE2A 2DYBA 3HRUA 2ED1A 2C0IA 2A0FB 1AWCA 4J6XA 1LDDA 1W70A 4ISFA 1DTQA 4JLGA 5BN8A 4HHTA 4EM2A 1Y1WJ 2RNJA 2LD5A 1L3TA 3IG1A 3VEOA 5E1WA 1EBMA 2NUBA 5L8RE 5M1OA 3A1PA 5E8GA 2F4MB 3E66A 1VTNC 5GMKe 2EPFA 4WQ4C 4G9YA 4BR4A 2XI9A 2D8JA 2CH5A 2RJFA 2ASMA 3HOSA 2P9PA 2LBFA 3DLGA 2GF7A 1GLDG 3EUHC 1DU6A 4PJNA 1RAIB 2CUZA 4N76A 2O4GA 2D0OA 2EWSA 5M5YJ 3K4KA 7AT1B 1K73U 1G2HA 3VODA 1T03A 3H5RA 2ZJRF 4XTWA 1HPMA 5A0LA 2QW9A 2KFDA 3M1EA 4W5QA 4WCGA 1IKWA 4J9HA 3TSPA 4N4IA 2AO9A 2HF3A 4Z89A 3FXQA 2DKGA 4OAZA 1KC8U 4O5VA 4CFBA 2K7AA 2ZPFB 4EMKC 2G8UA 2HVQA 4QSHA 3E9FA 3F0CA 4BRAA 3HL8A 3TAMA 4ZN3A 4V19S 1SFUA 2PZSA 1T0HA 4PWDA 3RMAA 1OH6A 2K2MA 1W97L 2E1MC 3THWA 5C2FA 3I71A 5H1SQ 2F8TA 1OCRH 2O8DA 4CJ5A 3RSEA 1WJBA 2WAFA 3S14J 5HP1A 2L54A 3QZ5B 1VQ8A 1SV5A 2IGKA 3J81Z 3OIOA 4BE1A 4KTQA 1CF7B 4HSBA 2QF7A 2CGLA 3ER0A 3T1HK 2DA5A 3OBYA 1J53A 2V1DA 4XRFA 3TDZC 3CPWS 2QGFB 2BOLA 4BQQA 2NOZA 1TW3A 1QCNA 3NARA 5EEGA 4HPQA 1F43A 5DK5A 3OH9A 2K9LA 4E7LA 3G6EQ 3ABMH 1SFXA 1VQ5Q 1X9JA 1Q95G 1F21A 2IAIA 1Q82U 3CMEA 2QKLB 3MECA 3SEQA 4N0BA 5FWCA 2AZSA 4GV3A 1GLNA 3OS1A 2YJEA 2OX7A 5BPMA 4HEA2 4C92D 1HYSA 1E3PA 2HHQA 3IH7A 3WTXC 3M9QA 3WXMB 1KU3A 4Z02A 3SZGA 4MGRA 2RI2A 2M16A 3AVIA 4ELVA 5DCMB 2DX1A 5AQOA 5ED4A 4QS8A 2JMWA 4B23A 3AG3H 1NJYA 1K8KA 4G7ZF 2EJGA 1ZSZA 1JT0A 4Z2YA 4UNOA 1MMNA 4Y13A 4DR2K 4OMOA 4CZIA 2XIDA 1Q81O 3IKMA 4C23A 4Q5SF 2ID6A 2FBTA 4ETSA 3V7SA 2TCTA 3IUCA 2Q0UA 1RLQC 1QU3A 3IH2A 4RM2A 1WJEA 1L3LA 4E89A 5JHUA 4N9HA 3AVMA 4FWMA 2J4RA 1R5HA 1OPCA 1WJDA 1VYTA 5CR2A 4LLNA 1W1WE 2K9GA 1YIJN 2R7YA 2MCNA 2OPTA 4L6V5 3QEWA 5DY9A 2HDWA 4Z4FA 2NRRA 2IS1A 4AC0A 1NGAA 2E5KA 3JRAA 4UUSB 5IP9J 2K4BA 2XVCA 3FB9A 1VQKT 4RW4A 1I94K 3A0IX 3CYMA 2NXNB 3O8HA 3ENHA 1YWPA 2W6LA 1KYZA 3EYYA 3WU0A 3FK7A 3GUDA 3I4NJ 3D45A 4ILGB 4CGIA 1Y8QB 3ZGKA 4L9JA 3VEPA 2UV1A 2Q31A 2K57A 2ZPBB 1LCUA 1TL8A 5AQUA 4HSRA 4J2AA 3G71Q 1WCMJ 2OFKA 4X9CA 4XTUA 2L7FP 3FXKA 2HBKA 3BG9A 1IBLK 4PSXA 3DRSA 1VSLA 3SFZA 3VUZA 2EAYA 4AHSA 5LRSA 1U78A 1BI3A 4NCBA 2B8AA 4YFUA 4Y17A 3DTIA 4X1EA 3KUFA 1WWXA 1BC8C 1W2BM 1S3XA 2DD4A 3I56T 1VA7A 4AYBA 4H0YB 3LM2A 4B21A 5AZIA 3WU1B 3LWHA 1KXPA 4DSIA 2B0LA 1NJZA 2MGQA 4FCYA 1RAAB 1FYLA 1REVA 1FMVA 3M8JA 4LITA 4WTOB 3GBQA 3DYAA 4PLIA 1P4XA 1YF5L 4BACA 2WBNA 4EMGA 2VYPA 1QQJA 3ATVA 3ZMDA 2W41A 4CJUA 2EJRA 1WJQA 3V9WA 1C0GA 4JJDA 1MBFA 1QVTA 3VB2A 2CP6A 2E5QA 1PD0A 3CMAA 1NGIA 1W36D 4FLXA 3JRFA 2BH1A 3QYEA 3M4OJ 4PNOA 2A7YA 2R0QC 1WZOA 4M7DC 1O3QA 4OMQA 5CAIA 1TWCJ 4A63B 2ADUA 4UY8O 3AVHA 2DK3A 1Q86R 4PJJA 4M7AA 5FB2A 1A6IA 2D1HA 3CCEA 3PE0A 4DQ2A 2VE8A 2BY0A 2BTFA 4B44A 1LEBA 2HVHA 2DOAA 5GMKl 4M77B 4CBWA 2LRDA 1J3TA 3S16J 3DXMB 2YSQA 2D0AA 4DZJA 2DBMA 4LD9K 1B9DA 1YUWA 1MBHA 3R0AA 3AO2A 4M78E 1X69A 2ZXIA 2ISZA 3WNEA 2LTPA 3QEIA 4QVDA 5J1YA 4KGVB 1MDUB 3HYFA 1TK0A 3RYRA 4JZ4A 1H1VA 5GAOq 1R7JA 4LD5A 4XLCA 1KC8R 3MMVA 5CK9A 4K41A 2YX7A 5HKCA 2O88A 4HX8A 2RK2A 1M90U 2ZJRL 4HNUA 4DU1A 5DV5A 3BDLA 3DQVC 3J7YP 3G1MA 5A0GA 1XHZA 4OKKA 3JREA 4BRFA 4FJJA 1VQOI 2KYMA 3A8MB 5JMVA 4CF9A 1TKZA 2JT1A 1VQNQ 1KFDA 4FPBA 1UGRB 1NGCA 1PUFA 4PA1A 3VMFB 1T8EA 4DNCA 3BGRA 3VDXA 2E1HA 3NDKA 2XKPA 4JRQA 3CCSN 1I0CA 4M77D 4BAYA 2IVPA 4LNPA 3JB9G 1TWFJ 5JHFA 4BQZA 1VQMQ 3HOUJ 4FVMA 1RTDA 1YHQI 2YCHA 4BJ5C 1VSMA 4LG0B 5AFUA 2PJRA 2JRMA 1PRMC 2CO5A 2BVLA 3PV8A 5HDNA 1FP1D 2EQMA 3GTOJ 2HNIA 4B1RA 3SV3A 1VQ6A 4B1WB 5IY5H 4BD3A 3M54A 1Q86C 1CZBA 2G8VA 2XSJC 5GANd 1OEBA 1V76A 3A98A 2UXDK 5A0DA 3N5BB 3LDPA 5DM7R 1Z21A 3QIIA 4RKUE 2EQRA 1O9SA 4KT0E 2JPCA 2ZGYA 4RMNA 4MQ9F 1Z05A 3IWFA 4II2A 3M8FA 1R23A 5EJCA 1NZ9A 4AFUC 4RB0A 4ZYDA 5KYWB 3IH3A 3FSPA 2EFQA 3S1NJ 3A1YA 1M8VA 2OD5A 2HEOA 1SUQA 3PO3J 4JKGA 5FLXE 1P7IA 4IUUA 3RESA 2YHTA 3I8BA 3K5LA 4A5NA 2SEMA 3GMEA 1NM1A 4NC7A 3T1BA 1KSPA 2IA2A 4N4GA 3MDQA 1S29A 3QICA 3LP3A 4JLHA 2JTFA 4PJOA 5C0YA 4M9XA 5CR4A 4ESRA 1G5VA 3V4IA 1B4AA 1K4TA 1KU9A 1W5TA 3M5RA 3NH1A 1NYFA 2R5YB 1A5JA 2DXCA 2ZCWA 2DTUA 1MKMA 3KLGA 2E2QA 2NVUB 2HHSA 4DV5K 3H3ZA 4OMMA 3K1NA 3M1FA 2XDVA 2XDDA 4ZZDA 1YJWQ 2DO3A 3HHGA 2DTIA 1LB2A 2JJ7A 1YJNN 2PQ8A 3PJRA 2AKLA 2ZJPL 2EQUA 4YNQA 1O7LA 1VQLA 4DA4A 3DTKA 4DTNA 3JB9H 2MPXC 1HXDA 2R5ZB 4PJOF 5F1RA 2D0NA 1BW5A 1KG3A 1BQNA 1KD1O 3HOZJ 3RPUD 3QBXA 4C8QC 2GIZA 3DKMA 1QVFA 4JZ3A 3M07A 4FLYA 1HNZK 3OS0A 4X0GA 3RKQA 3RBBB 2QEXA 4PJLA 1UAXA 4FYDA 4M41A 4CH7A 2BY3A 1XNIA 2QGUA 4JK8A 4DQPA 1KQ9A 2O8FA 2EBIA 5CYQA 2DYRH 3ZLJA 3R6SA 1YXQA 3J7AF 2YKMA 4B1VA 4C2MJ 4IG0A 4CZHA 5JS1A 1OPLA 4L5GA 5LJ5j 3JRDA 1IHWA 2G8FA 3KCCA 3W2WA 1EV7A 4J5YA 2E36A 3F8BA 3W6KB 4HDUA 1HW2A 1QSYA 1Z3XA 4I01A 2DA4A 3VGMA 4Z8AA 3P39A 1IN4A 2IGNA 2XAGA 5C0MA 4YY3K 4G7OF 1Y71A 3LANA 1VQ7N 1YFHA 2BW3B 2HTJA 2AK5A 4BVPA 3F9KA 4DSLA 3FXOA 2L9VA 5E79C 1FNNA 2I5WA 3S41A 2L0AA 2QWNA 1P7MA 5HNHA 2N8GA 3S2WA 5D6FA 4JJBA 4IQ4A 1N25A 1F5TA 4HUEA 3FLCO 4GV6A 4WQ4A 4B6MA 4ANJA 5FO5A 4OGCA 2P5OA 2V9PA 2MH2A 3R61A 4BRHA 2IEKA 1JEGA 4E1MA 1K83J 3EUHA 4RWTA 5AN4A 2PZ1A 2XHBA 3SEMA 1QWEA 1R0AA 1P8ZA 4JI4K 4U0WA 4X1VA 1S72T 1N32K 4G12A 4BRGA 4DR5K 2A6TA 4I76A 2RF2A 1FTZA 4NB4A 1S7OA 2CYZB 2HQNA 1WH5A 3X26B 1NG6A 4A6DA 3NF9A 4U7DA 2P8TA 2ETJA 1AT1B 1YLFA 3GL1A 3LH5A 1RZ4A 4FJMA 3HSEA 4J9CA 1KGSA 4AIKA 4EMKA 4JX4A 2V1XA 3ZETB 1X1PA 5E17F 2GA1A 2BEOA 3U3YA 3P9IA 2EV5A 4C30A 3CCMA 2EFWA 2V1NA 4M72A 2Q8KA 2DFFA 2LX7A 2KEAA 3FXUA 2FBIA 4A69C 2DF6A 5C42A 2DXTA 1VAZA 1ORPA 1OZ2A 3H46O 2K02A 4DQIA 4XIDA 3S1QJ 1Q81C 3LP0A 1M90R 3LA3A 5AQNA 2YT6A 4BC3A 1RDAA 4AF1A 3NAEA 4EMSA 3GTLJ 1CXUA 2CV1A 1S22A 2YNFA 2KRFA 2DA3A 5EYRA 3RJPA 3CWSA 1ZH5A 2VWJA 2DETA 3SUQA 1Y0UA 2XB0X 4IHVA 1WIEA 1NK2P 2LY1A 2FUG2 5FKOA 5GAMf 3QYHB 3CCVN 3M6GA 1ZYRF 3KYCB 2K79A 5KCHA 1IG8A 2L7ZA 4B3SK 3T1AA 1D0ZA 3DPUA 3QETA 1U06A 3KFVA 1FK9A 5GADP 2JZ2A 1WKMA 3KX2A 3VQEA 1O4XA 4IJNA 4HWIA 1QVGA 3CCJT 3ESWB 4DW6A 4CJ7A 1MJAA 2OAZA 4Z94A 1XGNA 3RZDJ 4L0ZB 2F96A 3K4BA 1KYWA 1P6RA 1P92A 1UCRA 5LHGA 4QKUA 5EEHA 4BWMA 2UUBK 3G3ZA 3ZSYA 1QRYA 3ROUA 4E7ZA 2OTJT 2DA1A 3A5NC 4IWVA 2LREA 2EZLA 3K2PA 4CE9A 3MEAA 4W97A 2WB1N 3DF8A 1DU0A 1BOBA 3U1KA 2A5XA 2XU8A 4JYKA 4A5BA 2ZPEB 5GMKj 4L5JA 1AOYA 2W42A 1SF9A 3A8OB 5IPAA 3V8KA 3G10A 5GAEP 3FBIB 2HKNA 2DMQA 2L5QA 4BUPA 3IRRA 3TSUA 2NNYA 4BQLA 3K1PA 1PVSA 2K6DA 4YOTA 2DIQA 4K11A 1C6VX 4JS4A 4A0ZA 1R36A 4EZ9A 2O4XB 3VS4A 1U6ZA 4ELUA 1QQMA 1BOAA 1Q1HA 4BJTA 2VG6A 2AQFA 2E88A 1OR7C 2JWKA 3ZMZA 2MAMA 1RBRA 3FXJA 2PBIA 2FEIA 1M90C 1VQ9N 3O4WA 2FF6A 1BU1A 3TABA 3P9CA 4KT5C 3META 3OWTA 4CZKA 1IGUA 1FLIA 4MDWA 4CZLA 1NBEB 1W2BS 3G1LA 1JO8A 3X24B 3M8EA 1WBBA 4RTXA 1G8XA 2FSKA 3ERMA 2BGGA 2CV0A 1REPC 2DN0A 1LMZA 4CJFA 4CA0A 1GBRA 4CJQA 1Y07A 4ENMA 5AQIA 3F22A 4ORZA 2KQWA 2E12A 5D8LB 2KISA 2G7UA 3CHWA 3F6OA 4XN3A 3REBB 2KAFA 1Z3YA 4E7HA 2ZFUA 3B6AA 3VEVA 5I2SA 4PY5A 2BVMA 3NVMA 4I09A 1NNEA 3B73A 1WHHA 2IJLA 3BF3A 1JI8A 3EG9B 1X2KA 1YP5A 2L4MA 2HNZA 4I9QA 3CCLA 3I0TA 3L00A 1HDPA 4BI8B 1EXQA 2EPDA 3CBMA 4BY9C 4KHPK 5LRRA 4XNFA 4LB5A 4CIEA 1RR7A 1FEXA 4JYAK 4ZYHA 4A0XA 4I9LA 1Y96B 4XTVA 4CGDA 2KQ2A 1OFCX 1WJRA 5AQZA 4RBOA 4BREA 4YFNF 3H6ZA 4C0DC 5ICEA 3AO5A 5GAN6 4GKKK 5F64A 1WOQA 3SWNC 1TS9A 4UVAA 2GTOA 4PKHA 4WX9A 4CO8A 2QWMA 1MUDA 4W5OA 4NC8A 4XLAA 1KLNA 1JLQA 1HYZA 3VS0A 3D5SC 4Y28E 2OI3A 4X9DA 2X4HA 1IRZA 2O31A 3K9TA 3GEZA 3CCSI 1UGSB 4XH1A 4OIQF 2LZ6B 2BXYA 5LGNA 4V2SA 1G99A 3A02A 5BPIA 2NOEA 1RDBA 3K4JA 1RDWX 1BO5O 3HI0A 3URGA 2P4TA 1FYMA 3EFRA 5JI6A 4CC4B 2XF5A 3ZQFA 5JLFA 4H0XB 3OW2P 5D5UB 1UB4A 4EEFG 1X1CA 4F91B 4LH5A 1UFMA 5I22A 2NOIA 4BY7J 5E3NA 3TAGA 5CVUA 4EA5A 4F7UF 3TDUC 2DCEA 5FW9A 1BN5A 4ZHRA 1SPKA 1LW2A 4QW2A 4EW0A 2R7DA 4HF2A 1PRLC 1EX4A 4EHUA 4Q0BA 3A8YA 5FLMJ 4U67L 2HDAA 2H6CA 4MZMA 3GFIA 3P8DA 3VQ6A 3MXJA 1NKEA 2BHYA 3CD6T 3KK2A 5LEJA 4QS9A 2Z0WA 4AHUA 1I1SA 3VJPA 5IWAK 4DBRA 2JLEA 1Z9ZA 4PJOG 1IG7A 4V2GA 1N8RO 4JKEA 2M1BA 3QJ6A 1N34K 4RTZA 3JCMh 4M7AE 3SV4A 1JJ2P 3KLHA 4EVIA 2YX4A 3ZEHA 3L7WA 3G1JA 2NZTA 2H6BA 2D2WA 1RR8C 5HL7L 4U88A 3FGUA 3I0RA 2DFIA 1MMDA 2RDPA 2QSHX 5CKDA 1Q82O 2P0KA 2VT2A 1WSEA 3E6MA 2JQ7A 2K5IA 3A8LB 1GRIA 1Z6RA 3AL0C 3K5OA 1X6BA 2WOMA 5M9OA 4KHNA 4RCBA 3CBOA 1YI2T 5FRMA 2DPNA 5CVVA 1YJNI 3ZX0A 2ME6A 4GKJK 2L8DA 3TO9A 1MA9B 8AT1B 3SHFA 1HKQA 1X3NA 4BQAA 2JG6A 2VWBA 3NRVA 3Q7BA 4W5TA 4FJIA 3K7AJ 3FZHA 3QU3A 1FKPA 4WWCA 2FRWA 2FJ1A 3OB9A 2GOMA 4HQMA 2KLAA 2RF0A 3HRSA 4C2TA 3VWBA 3GTPJ 4NHJA 3FISA 4DYCA 3UT1A 2DW4A 3FWEA 1RLPC 3HTVA 2PY5A 3K1MA 5IT9K 2ZPIB 2HOAA 1A35A 3B6CA 5LJ3h 2IVOA 3OYNA 3E9PA 2H27A 2F5TX 4QT7A 3AT1B 2GIVA 5CZ1A 1F9NA 1ZYQA 3I5UA 3VN5A 4O4GA 2XAHA 3J81O 4N9IA 3FIFA 2DOEA 1KG2A 4Z4CA 3KP4A 3AARA 4XR6A 2RQVA 2HL3A 1SL1A 3NF8A 1KVAA 1TUYA 1WYXA 3FMQA 3O3KA 3K4CA 1BR2A 3I55N 3WEEB 3K0LA 4Z4HA 1VQ7I 3OMYA 2L2PA 4JI1K 4CJPA 1NEGA 3DLLA 3TU5A 2ECBA 4FX0A 2GV9A 4HCCA 2P4RA 2L9SA 4CJ4A 1PNJA 3DBRB 3DOKA 3PY8A 1AU7A 4XU3A 1VHXA 5E1ZB 4B9UA 4YOUA 4UHTA 3A01B 4NCAA 2EQKA 2E34A 1MGTA 2EW3A 3SI6A 4UC4A 1VQOQ 2M0OA 3G71A 4JKBA 1K1ZA 3TARA 3HSFA 1BI0A 1VQ8T 4CJVA 4FE4A 3JB9J 1T05A 3LQRA 4A3EJ 3RYPA 5LJ5d 4FTHA 1FYNA 4RW7A 3RKWA 5FLXZ 2YUNA 2GEMA 4G6TB 4C8QA 3F8CA 2KIUA 3AKZA 2YU3A 4PJOE 3CCRA 3FMRA 3CCUT 2Y69H 4IDHA 1ERDA 3R60A 1R59O 4DLEA 4CI6A 3IAYA 3L2WA 3LLRA 2D1VA 3AGKA 1YHQQ 2OCEA 4CVNE 2P9LB 1XGSA 2V52B 4U7BA 3D5RC 4XH5A 1P2FA 2BV6A 2V7ZA 4CIGA 5JLWA 1VQ4N 3AVBA 4BDPA 1KG1A 1CZAN 3SMSA 2EWNA 3BR3A 3BCBA 3OQ5A 4FYYB 3PM1A 3O9SA 1QMCA 3K2AA 3GOXA 2VBYA 2ZFWA 3PX4A 5C24A 1FBSA 1TWAJ 4FLZA 4K8XA 1IKXA 4L9VA 3LDOA 4FLUA 2XASA 1LAWA 2LKSA 5F04A 3JSPA 3ZCOA 2LTOA 4CCOA 2P9UB 1MD0A 4MLHA 2FSJA 4CCJA 1BI4B 3SAHA 1X1AA 4PFZA 3GNFB 1T98A 2W7NA 3LWIA 2DZCA 2ASOA 3L42A 2GAUA 3IL2A 2BUDA 1C0FA 1YYVA 3A2FA 3GFLA 2HYGD 4C5IA 4RW6A 3KD1E 3OTOK 2OTLA 2VG5A 3AAQA 2XSDC 1BW6A 2JRTA 3TR8A 3VTHA 3CCVI 2CFXA 5GAMg 2E2IJ 1Z26A 4C9YA 4UV8A 3BC8A 2ZGZA 1C0TA 4DBHA 5AQVA 1Q7YU 4F52A 1NWKA 1TKTA 4ZYEA 4QIWN 2HSTA 1ZGWA 1LOJA 5JVGL 4LGWA 4OINF 3G4SA 3LSIA 3MP6A 3CC7A 4FJ5A 2DFUA 3V1QA 5CVRA 1W4MA 4HCBA 3QYBA 3MD2A 4IXAA 1XQHA 2QXFA 5IN1A 5EG2A 4JD2B 5AONA 2WV1A 2RQWA 2G8HA 4XIUA 2F2XA 5GAOm 1KFZA 5GP9A 3H08A 4A12A 1LFPA 4LFUA 1KZHA 4G7HF 1YS7A 1WXUA 3LL3A 4PDKA 3G25A 3W3DA 4C0ZA 4LIVA 3VEZA 3CWAA 3KP7A 2P0WA 2RKIA 4M75F 3AVLA 4CICA 2JOYA 1M2VA 1XDUA 2C0TA 2HOTA 3I35A 1AZEA 4ENNA 4OPHA 4F93B 2X3WD 4M6XA 3TMOA 2EQJA 3U9GA 1VQNA 5HDGA 4NS5A 4N47A 3D7EO 3H3OB 1N39A 4BHPA 1VRTA 3F0ZA 2O4IA 2YRDA 2NUZA 1JB0E 3FXMA 2Z99A 4DS4A 4D5FA 3FC3A 4BBSJ 5DD8A 1GXPA 1R0BG 2PMZN 2VQGA 4XTYA 3JAME 4CCHA 4IEIA 2GX9A 4QQDA 3JCMd 1SVLA 3FZFA 3VF6A 2OPRA 1VQ9I 1QSLA 3A8GB 4WF9L 4F9OA 2M8EA 1MDMA 2NOBA 3I54A 3QESA 2MK5A 3I4PA 1M3QA 3TKYA 1U2VA 3LSTA 4DB3A 4MLEA 1TWBA 1UEBA 5B1AH 2Y31A 2K3XA 1MUNA 1WNSA 2F48A 5IHIA 3QRFF 3OA6A 3LZIA 3P8BB 3NGZA 4DU3A 5GPCA 1G3WA 1VQ5N 4II1A 4KBOA 1TNTA 2OPQA 1IBMK 3B6OA 4FK4A 2V6CA 5AQQA 2G3RA 1IKYA 1TNSA 1X2MA 4IL6C 3OA9A 2H1KA 1X27A 3VRZA 4RTTA 1O75A 2X6OA 2KZZA 4I7HA 3OYEA 3LZJA 2HDDA 2ZXHA 3CCET 4CJRA 3LOCA 1BR1A 3CCQN 2J5PA 1NGFA 4M7DB 2LNBA 4Q4ZF 4F7UG 4KA4A 5AQXA 1HDDC 1VSJA 2VYTA 5L3BA 3R2XC 1XSDA 3GZ6A 5A2QE 5DDGA 4JV5K 1GV2A 4XQ3A 3D2EA 3H35A 4ENJA 3WVDB 2LFBA 3CO6C 4OIOF 5FJ8J 3PVQA 3W3CA 1ESVA 1YOVB 2HZYA 4XQFA 3M0QA 4WCIA 1OR7A 4F3OA 4ME7A 1T6DA 2XAFA 3LA2A 4FASD 2AS5F 4GDFA 5E84A 4QWQA 2RJDA 1UOCA 1H88C 3FXLA 2HQXA 2J06A 2X6NA 3WTVC 2V1QA 3TAEA 2Y9YA 2B86A 3CMEN 1I50J 1MW7A 3VYHB 4YDUC 2LQNA 5K1YA 1ONVA 5K7ZA 3VEYA 2E5LK 4A3JJ 2VVKA 4HNTA 4C92C 4DR1K 1NMDA 4DOVA 1YJ9T 1M1KO 1K9MR 1FN7A 4JEPA 1S9HA 3QAHA 2MWPA 2Q2EA 2PQWA 3QDRB 3VSKA 3WTWC 3FKIJ 1ZSGA 1QVPA 2W04A 2F8SA 1HYOA 2YRVA 4M7DD 4AUXA 4KHQA 1TKXA 4CD1A 3H8ZA 4CC3A 2CV2A 5J2PA 1WJAA 4JAXA 3TU4K 2OZUA 2J6OA 3EGDA 4XEIA 2KXCA 2GFUA 4NOYA 3RERA 5LGUA 1ZBSA 5I9EB 4XOTA 1XQOA 1IXCA 2YHWA 3DI6A 2VXDA 5J1EA 2EYYA 3E9OA 2CMPA 3P9KA 3O9QA 1VQPI 3MMYB 4HF0A 1ZRCA 4CYCA 5F0HA 4KAZA 4BC5A 1E3OC 2F5EA 3DLKA 2L7MP 1MV3A 2QKMB 1NJIO 1SMTA 3QSUA 2QWOA 3BQZA 1QP3A 5J1UA 3KLOA 1D9DA 2X78A 3LMMA 4OAYA 3FE1A 4FU6A 1T3LA 2B7EA 2K9NA 1B07A 4CEQA 3JTHA 1GVDA 1WAJA 3A0BC 2R7UA 2Q97A 1WPKA 5JLHA 1GLAG 1Z9QA 1Q7YR 1G6NA 4BXFA 3JTGA 3OJSA 1F4KA 3ABUA 5EZHA 3QODA 3O08A 3C0BA 2HBJA 2HKQB 3E7LA 1S9GA 4AWXB 1L5UA 3NF6A 3RWUA 2CH6A 4B3TK 4MFEA 4C8LA 1FIAA 1ZELA 2PN6A 2NUPB 2XIGA 3E0JB 1TYQA 2RPNA 3VESA 1YW8A 3N05A 1YVNA 2QQ8A 1KTQA 1K9MC 4EATA 1VQLT 5KNLA 5I11A 1MBGA 2B6AA 1XDSA 3I33A 4DK9A 4CSWA 2E3IA 1S6LA 4KUMA 4PIIA 1AD5A 2VJIA 1GXQA 3BR5A 3TAPA 4GXOA 2W48A 5GAMe 3HEFA 3I55I 2Q36A 4ELZC 2DDAA 4H03B 2HHWA 1RNHA 4P1WA 3GP8A 4HXJA 3DM2A 3VW4A 3M53A 1KQ2A 3SLCA 1Z77A 3CMAN 4A4EA 5KGWA 1KG7A 3T5XA 1W36C 1SHGA 4ZN1A 4B8XA 1ULYA 4P96A 4CF2A 3HKZA 1B9FA 4QOZB 4X65K 1DP7P 1VQKA 3JCMc 1W0UA 2GTDA 1NG2A 1N9RA 4H0EA 1FKOA 5C10A 1LWVA 4DV7K 1M3CA 3LSHA 3IMXA 3NF7A 3G1OA 3ME9A 1IGQA 4DQSA 3ULDA 3CCSQ 4FWKA 3HM8A 1QS4A 1G3YA 3ATUA 1NMNA 2UUZA 4JHDB 1VQMN 2WAQN 5B3SH 1ETKA 3PX6A 2L3SA 1YQLA 2VC0A 2CQXA 2WTEA 4PJ0C 2Q1ZB 1VQ4I 4R56A 4H0TB 2RPIA 3HTUA 1NHAA 4FWOA 3M58A 2LSOA 2O9LA 4ID5A 2V1RA 4IFYA 4JI5K 2CFOA 3I56A 1G15A 2P81A 3FZKA 5FFZA 2HPMA 1TAQA 3J8AA 2M4GA 2K7LA 5DPKA 4V19K 3JCMJ 1YT3A 1JKHA 2MFZA 3P8HA 1UA1A 1U8RA 2X3XD 2RNAA 1UHWA 4AI5A 4F3TA 3PNWC 3L0QA 2CS7A 4CHNA 2ZKZA 1JCGA 1OQKA 1UGVA 4M75G 1SSFA 4M42A 1ZHFA 2IS4A 4NQWB 3KK1A 2WA0A 5CLSA 1OI1A 1UG1A 3BFMA 1WA7A 1GCQC 1WN7A 5LY3A 1D3BB 4I0AA 2K86A 1EH6A 2JVVA 3RQ4A 2EA2A 4QVCA 3I59B 1XNQK 2BZYA 4QTRA 4EP4A 4DSEA 5FU6B 2NOLA 2R7SA 4HA8A 3ZQHA 2UUAK 4M77C 4ESBA 1J2XA 1RT6A 2MLKA 1QW1A 4AH9A 1OJLA 2DE0X 8ATCB 3CFRA 1D5YA 3FBNB 2PI0A 4JRIA 4KTZA 3VKIA 1H641 3KP3A 4AM3A 1YJWN 2X9DA 1VQ6N 5H6QA 1IJWC 2V8JA 1YJNQ 1XTDA 4E9FA 4BGBA 5HOOA 3LPUA 3QWYA 3JB9I 5EC7A 3OL4A 4DOZA 3BY5A 4OIPF 4NL3A 3ZT4A 3JRCA 3BG3A 2D1KA 4RLFA 5AZJB 1U6GA 1U3EM 4CRIA 3CETA 1VSDA 3PMTA 4V2FA 4CI0C 3LM9A 3L3VA 1GFCA 1WPYA 1SSHA 2O8KA 1KU2A 1N78A 5AQFA 5EY4A 1RAHB 1RI0A 2DFHA 3ZMSA 4A0YA 2IS2A 3K10A 2DTOA 2MC4A 1X3UA 4A3GJ 2UXBK 2COYA 2QA4N 3PO5A 4Y92A 2CUFA 4J83A 1UA0A 3A5LC 3TTDA 4RMOA 3S3OA 4DSJA 3INZA 2Q2RA 5CQXA 1TC3C 1K8AU 3FFIA 3PNYA 2O8CB 2HQRA 3JYTA 3FXRA 4LOCA 3UKUA 2P0QA 3WUHA 4H4KC 3FHFA 3L4IA 3VQ4A 4GVMA 1JUSA 4MMLA 3MWMA 2V1UA 1VQ7Q 1R4NB 1BOTO 3TI0A 4IKFA 2CH4W 3CC2T 5AQJA 2M0YA 2AA4A 2Z1HA 2D0QB 4KUDK 1WB9A 4XLPF 1ZBIA 3BT9A 1B72B 1LNWA 4M6YA 4CCMA 3ISPA 2LP0A 2LCLA 2PUOB 1YITT 1BIAA 1B8IB 3QYFA 1ZA2B 1JGGA 2QEXN 3N5NX 4O55A 1WFWA 4BC2A 3ZYYX 4X6AJ 1GLLO 2ROLA 3HBTA 1SC7A 3JSOA 2JJ9A 3QFUA 4IO9F 5MLCQ 3J7ZI 3RMQA 3CCQI 5KYYB 2RHUA 1YWOA 3FDRA 3KEOA 3ZXSA 1S8NA 1H8KA 3K70D 1DLOA 4DHYA 2Q0OA 5J6XA 2IA0A 3MN7A 3CM6A 3OMCA 1GVJA 3BTCA 4CEFA 1MBJA 2YSRA 1VQ8I 1HQEA 4XTZA 1PVEA 2ZO4A 2KZVA 4CYDA 4XU2A 3V9SA 3CXCP 4E19A 2VWFA 2W84A 2EVRA 4FJXA 3BJOA 3JSMA 3C4SA 5KPRA 2VXEA 3OW2A 4ZGEB 4EJWA 3F23A 2BUPA 5C2DA 1RESA 1H9TA 3CJNA 2RQQA 4BI3A 3WNGA 1OVQA 2IBDA 2HHXA 1NM7A 4J8OA 2RN2A 3COAC 3MCAB 4NB5A 2RE2A 1V4SA 4EHTA 3ZQGA 3MP1A 2GGRA 4MDBA 2QQ9A 2OPSA 1FOWA 3FZLA 3CMEI 3LGFA 4NNJA 4C8OA 3SZ2A 4KRTA 2QK0A 2R7WA 1H9GA 4MO4A 2LDUA 3JW4A 2E7XA 4I0BA 1R49A 2L3PA 2OZSA 4XRMA 2IRFG 2XPWA 3F72A 2L2OA 3L2VA 3UKRB 4IZZA 2QWRA 2F2EA 4P5OA 1M9SA 4ABZA 1VZ0A 3CCVQ 4CF1A 5GAOl 1JJ2A 1IHVA 2MW8A 1I1JA 4ISEA 2D4WA 3OV8A 3LP2A 3DFGA 3VV0A 2MD5A 3SWNB 1WHJA 1M1KC 1A6QA 1QZYA 1VRLA 3ZQCA 4FLVA 1BL0A 5BPLA 3I0XA 4CJ3A 1BWFO 3JAMZ 2M3AA 5KN9A 4BG9A 3CUQA 1QVFM 5FU7C 1V4RA 4OMLA 3ABKH 1K78A 1M1FA 5LLQA 2ICWG 5DD4A 3CCMN 3NHNA 1LWEA 1KQ1A 3EFSA 4JKHA 5BRDA 2JA5J 1NU0A 4OFEA 3DCFA 3GOIA 2HZTA 4BQNA 3N4MA 2AQEA 1K76A 2PEXA 4IQJA 4GV9A 1I39A 4RB2C 3R6NA 3DV8A 4UB8C 4M3ZA 1UELB 2VKHA 5F1XA 2RC4A 3EHRA 4DWIA 2E2HJ 2LOOA 2RQTA 2Y0MA 5M1KA 1VQOA 3H5AA 5JFRA 4BI4A 3JRGA 4FZYA 3CDLA 3MHXA 1NJIC 3I5RA 4YDUA 2IA1A 3EGXB 2JA7J 1LAVA 1R58A 1TH7A 3KTUA 3BTIA 4BRDA 1IGNA 1JCEA 4B43A 3EE9A 2JA2A 4XONA 3CJ1A 2HBWA 1VQ9Q 2XB5A 3HB9A 3VERA 2RJCA 3ITHA 3G6ET 2EILH 4KIBA 3VTIA 1S72A 5A2QZ 1R5ID 5GAOp 1MMSA 2CSQA 3P5JA 4Y1CA 1O3RA 1LE8B 1HKGA 1XSXA 4H5VA 4KO0A 2AT1B 1R6RA 4RG2A 2ROTA 3QIOA 2JUFA 2NRZA 3O80A 4KPYA 4HAMA 3LGLA 3M4GA 4WK8F 4KB0A 4CZEA 2GUPA 3QNNA 2OC6A 2DRMA 2E2NA 3QP5A 3DEUA 2DJZA 3HM9A 1CF7A 1AWOA 2FRYA 4MQVA 4FT2A 1WHMA 3RPQA 1ZBJA 3UIQA 2Z1IA 2QKBA 1BQMA 1HQCA 4ZTFA 3CMAI 2LNVA 1PP7U 4FOIA 3Q9VA 1M3AA 1ETQA 4L5IA 1MBEA 2F1LA 3BG7A 1NEBA 5LL6Z 3R1XA 1CKBA 3I9QA 3RI4A 1XCVA 4FE7A 2E5ZA 5M3MJ 3EZ5A 1K8AR 1WUAA 3M7GA 2MH9A 4X66K 5FLXO 3GTKJ 3LALA 2QBYB 4A2UA 4UUTA 3X28B 3KPHA 4G94A 3M8RA 3H0GJ 2G7HA 4DTXA 3FFKB 1ON1A 2E10A 4S0HB 5KYXB 3C7JA 3D6RA 1RNLA 1LOTB 4XAXB 5CKEA 3MEVA 5DCMA 3H1CA 2RKHA 3K58A 4RGSA 3VQ9A 5LGTA 3OSSC 1WJ5A 2ZGWA 1X01A 2DEQA 2RAEA 3EPZA 2L9NA 1QVGM 2R7OA 3K9JA 3VUBA 3HK2A 1ORNA 2Q1NA 2FMLA 2OTJA 2X9HA 2DRKA 2LLKA 1GLFO 3ZSZA 3H3NO 5GINA 3WE2A 3OBWA 3VS2A 3C2HA 3G71T 2KDSA 3CCLN 2XDPA 4LC9B 4CESA 3NAUA 2EFPA 2E2JJ 1NKCA 4PSWA 5DM6F 2VONA 1OX9A 3BDPA 4IF4A 1S3JA 2G8IA 1S7AA 1QSSA 4M78F 3PQJA 1CLQA 4YFXF 3EHQA 4P5NA 3WQUA 2XF7A 1KAZA 1HKBA 2WADA 4UUSA 4XORA 4BGAA 3MEGA 1KK7A 4BWJA 3TSQA 2UXNA 4YIRX 1STZA 2CH0A 2EK5A 3KETA 2GM4A 2LG4A 1ETOA 1BISA 1YO5C 4A3DJ 2EYZA 3MAJA 4WCEL 1RRJA 1NK8A 3I3LA 3ZSXA 2A6HF 1E6HA 1IDZA 4A93J 4X34A 3EDPA 4PGHA 1VOMA 4KGZB 2K3PA 4IUTA 5ILSA 2WAEA 1VQPQ 2DL5A 4OKEA 4A6EA 4BYYA 2DJIA 4DF8A 4ZNXA 3D2FB 1NGHA 1RIOH 1HF0A 3WG9A 1N5YA 3C3WA 2KFNA 5GTIC 1VQ6I 4M3TA 5IH2A 1JXEA 3CQ8A 2RHZA 5GAN2 5HLHA 2OTLT 4YPRA 3NWSA 1R1TA 1I07A 4OO1J 3VYGA 2HU9A 2M9HA 3B6PA 2ECZA 2WFBA 3DLAA 2WSFE 2LKPA 3W6JB 2OCCH 2EJ9A 5LD2C 1U5TC 1Y7XA 4R1HA 3VU3C 1RT4A 2F4OB 2FL7A 4DUYK 2YUSA 2NS8A 3AO1A 4ASNA 2PVDB 5F0FA 4ISGA 4C8MA 5BS6A 4FLWA 1I27A 1XC3A 1BCMA 4MO5A 2LMDA 4FZXC 2ZB9A 1X2QA 3Q0WA 4CERA 1IG9A 5K7HA 1RAGB 5GAN5 3D4VA 2LQWA 2R7QA 3VYRB 1E2XA 3DJCA 2QA4I 2HB5A 3CVSA 3OHRA 2DYIA 1MNMC 2HXIA 2V9VA 3VSLA 3EG2A 3OY9A 4XL9A 4PGGA 4LF5K 2Z2SB 4EJTA 1GCQA 1YIJA 2MOXA 3M8PA 1KFSA 1B92A 1RL2A 3I55Q 2W1OA 1JLFA 4CJEA 1GFDA 3S1MJ 4M74A 1UHSA 1Y39A 3DXMA 4CK1A 4NUBA 3T8TA 1VQNT 2IPOB 4E2FB 2VC8A 2X4YA 3BDUA 1AZGB 2VUMJ 4F7UB 1QO0D 1QPMA 1M8MA 2RB6A 5KTQA 2YRCA 1IAWA 3RRGA 3W6VA 4AHRA 4OX9K 1VQMT 3LSRA 3GYHX 2QEXI 3NCIA 1HU0A 4JJNK 1FP2A 2LC2A 4B22A 2RD1A 2YPRA 1X4OA 3KK3A 3HPGA 1WGSA 4CHOA 3LYIA 2OJED 3J7ZO 4GLMA 2WSEE 1M1EB 3GWZA 2DD5A 1VNDA 1NK9A 3MZYA 5EG0B 1TV6A 1QHAA 4AFZC 1AA7A 3SHWA 1SRLA 5C25A 3CJTB 1W0HA 1HW5A 5KCMA 3LFUA 2VQHA 1YHQN 3K6GA 1OCTC 4U0VA 3HL2A 4FJ9A 1T56A 3J81K 3LA7A 5KCOA 2OZ6A 4DQRA 4AQYK 1J5EK 1VQ4Q 1B6AA 4H8KA 3PFYA 3LSGA 2LSNA 2F7TA 3THXB 1XMQK 3MZ8A 3G73A 1QKXA 5CIUA 3S8PA 4DV4K 4FQGA 3ZMUA 3E19A 3PIOL 4E0DA 5IT3A 4A3KJ 1E4FT 2M0CA 3WTTC 3EE8A 1U84A 1P4AA 1U1TA 2MG4A 2K5LA 3VYSB 1X6GA 3HGGA 3ZT1A 3J80E 4LG0A 3VQ8A 3MN2A 1YI2A 2MLGA 4FT4A 3F5TA 1JXMA 3ZT2A 3AFHA 2JUCA 4B3AA 4GFBA 3AA4A 3ENOA 3BE3A 5BR8K 3F3XA 4U87A 1T39A 2HD0A 3C12A 5HK3A 2ZMEB 1R9TJ 4CJTA 3EETA 3RPUA 3DLEA 1P90A 1LFBA 3CJCA 1FPQA 3IHUA 1LCKA 3CCRN 3M4YA 4A2BA 3TP0A 4IURA 2ME0A 3JCMX 4EVVA 1Y64A 5L3DA 3IDHA 1FIPA 2FBYA 4N0AC 5KYWA 1ENHA 4EW4A 1W5CC 3P1GA 4LDWA 1Q86U 3HZJA 1ATNA 1JLAA 4PL8A 3L2QA 2V51B 4WYBA 2JA8J 2KRMA 1DTTA 3CCMI 2NS7A 1Y8RB 2NLUA 4CGHA 1IV8A 3REOA 4GO1A 1LWFA 2KE9A 2O8BB 2H3EB 2CU7A 3ZN1A 4WF2A 5TKYA 1NGNA 1GOAA 3E1SA 3TGNA 4KRFA 5HNFA 2A28A 2ZXWH 2IVMA 3TBIA 1TXQA 2R5YA 4BHBA 1QQNA 2W24A 2KP6A 2GA2A 5EGOB 3VQ7A 4UVBA 3EQLF 4XBFA 4C92B 4HX4A 5FD5A 1HRHA 3KTQA 5KAFC 3CQTA 3ZQLA 3TCJA 2RQPA 4BH9A 1JHFA 4IOXA 1RGIA 2BE7D 4CK3A 4J7FA 3ULEB 2OAUA 3THYB 4HQEA 2A05A 2QM1A 2V75A 4FJ8A 2E60A 2X4XA 4FXDA 1WJFA 5AQYA 2R5ZA 1OU9A 1LDKB 2H8RA 2DTHA 2VCPA 3DKWA 3JCMf 1NK7A 3G4SN 1QHHD 3VGKA 4JK7A 2LMJA 4CZJA 1QVFS 1RDDA 4ITVA 1RBVA 3OIQA 2PFUA 3V1OA 3J7YJ 1DKGD 3Q5FA 3Q7CA 3MKLA 3HPOA 4LF8K 5J4VA 1YVUA 1BJAA 3ZRGA 1UUEA 5GAGP 3X20B 2QWPA 2P5KA 3QINA 3CCUA 2KZGA 3WE3A 1NK0A 3JV3A 4K0KK 3HUGB 3HJEA 4HT9A 3O1BA 5GANh 1WSIA 2O8EB 1WQ2A 2I7NA 4QPOA 3GG4A 1ZARA 4D8DA 3JSCA 1LW0A 1X4PA 4B8AB 3DU5A 4KH6A 2DLLA 2M02A 1K6OA 2BW3A 4IXCA 1LQ1A 3O9RA 4OLAA 2JNGA 2W00A 2IS3A 3OMGA 2M30A 1J54A 5HLIA 5IOYA 1DJ7B 3CCQQ 1R71A 1BDGA 1KG5A 1HNVA 2Z9OA 2MF2A 4OF1A 4ID1A 1XPXA 5ILUA 2UU9K 2RQRA 4LG3A 3KEQA 3IV5A 2RH2A 5IHKA 5FFXA 1MBKA 5LJ3f 2CYYA 4C3HJ 1VQ8Q 2KQRA 1FJGK 2L3RA 1ZKGA 3TTFA 4M78G 3CEYA 5I2MA 3KLNA 2E2PA 2MMPA 5L23A 1OISA 5GIOA 5F2RA 2K5CA 3KFWX 4XKBA 1YJNA 2YG8A 1ZQ3P 2YI1A 3CM5A 2ED0A 2VQCA 2HCKA 1BR4A 3F70A 4O44A 1D09B 1UJYA 4FZZA 3ZP5A 2KTQA 2RO0A 2DK5A 3EL2A 2LK2A 1X1BA 2PVOB 3CMEQ 3KK7A 5FPEA 3KE2A 4JS5A 3ZETA 4M75B 3JCMV 4CC7A 2NVTJ 4Q47A 1MWMA 3T1YK 1FW6A 2P5VA 1WRJA 1BYMA 2M8GX 4XK4A 3CCLI 3SAFA 3EKSA 4FJLA 2L02A 3JXUA 3NVKA 2L7KA 2E1NA 4RLQA 5J47A 4IZ9A 5KGXA 1OULA 2E71A 4O8UA 3BDDA 1D0YA 5LBQA 2FNAA 4A57A 1PU8A 3Q9SA 2RNGA 5ECAA 3CC4N 4Y52J 3UNGC 3L2CA 5T7BA 4MTDA 4TVRA 3VPRA 1JUPA 2O3FA 5EZGA 2W82A 4CFCA 5FROA 5HRRA 1WSFA 2FBVA 1Q81U 4H5WA 2FHDA 5BN9A 1VQ7A 3QPLA 1X43A 2DTZA 4DG1A 4YOWA 4B9TA 1QVGS 1SL2A 3X2QH 2D1XA 5CQYA 2H8HA 3DB4A 3HRMA 5D6EA 2Y4YA 2X6YA 2XGDA 5BQTA 3EYIA 2YNGA 2JN0A 2Y4XA 3QEVA 1FY7A 3MK6A 4LMYA 1RADB 4M7XA 2STWA 3BQYA 3WTUC 2EB7A 2KT0A 2E70A 2WC2A 3CWTA 4M75D 1RILA 3VOVA 5FGMA 2LCSA 4ZC3A 3FR0A 3DKXA 1FXXA 4RG8A 2CZ6B 3KYDB 3WXIA 3I58A 5KRSA 3CERA 2IC3A 2IAJA 4NYFA 1SANA 2ZNYA 1TTHB 4JI3K 4LDYA 3GBTA 2RGVA 1DPUA 4AIAA 1GV5A 2KROA 3EEQA 4FPAA 2A68F 5M5XJ 2KZMA 3MWTA 2E1ZA 3E5UA 5ADXH 4LF7K 4M3UA 2D5RA 1ASWA 4F92B 3HHTB 2HAXA 3HVRA 3PIPA 2O4XA 5LL6S 3I9V2 1Z1DA 1N6QA 1ZUYA 4DV1K 4ZJZA 1TU0B 3HSTB 3PQKA 1N77A 1I6HJ 4XRSA 2VQEK 2EH3A 1RI9A 1TW2A 4OJRA 3BY7A 3R9PA 4BY6B 1ZBXA 4JKCA 4BNCA 3H5NA 1PU7A 4JI0K 1BA1A 3VPZA 1AHJB 2NRAC 1ACIA 1R5GA 1T8IA 2ZNZA 4A62A 5GMKi 2Y48A 4M7AF 3A5OC 2W6KA 1ZRDA 1TGOA 1VK0A 2OF7A 3CP8A 1FC3A 5CYVA 3PIPF 2DBBA 1HC8A 3J7AO 2UXXA 3QHSA 3BTLA 4I6MB 1YRNB 3GNGA 3CMAQ 2WBMA 3CCVA 2IVNA 4XU0A 4QAGA 2VG7A 3CO7C 3GLXA 4H4MA 3L09A 4JK9A 2GWKA 4FJHA 1IW7F 2F2VA 4C1NI