4E7JA

Pfv integrase target capture complex, apo form (tcc-apo), at 3.15 a resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 98
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7jA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7jA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7jA03
3RMBA 3O3GA 4DSFA 1QSYA 4RW7A 4PLIA 1C1BA 4ELUA 4C8MA 2EKOA 3OY9A 3AVKA 3ITHA 4FJNA 1U45A 3LANA 3LP1A 4DQPA 3BDLA 4IG0A 1SKWA 1WNSA 2BE2A 2HNZA 1L3SA 3MO8A 4FLYA 3JSMA 3CG7A 1TK5A 1JLGA 1WSJA 3ASKA 3QIIA 4FJ5A 3ZSXA 1Q8IA 1A5XA 3AA5X 4AHTA 1RT1A 3M8RA 1D9FA 3LALA 4O44A 4N4GA 3HYFA 4QOZB 3AVAA 2P5OA 2RJEA 4CJFA 1UWBA 4KB1A 2O4GA 1XNIA 3F9KA 1K6YA 1NJWA 4FJ7A 4NCBA 5KRTA 1Z26A 4RW6A 4BWMA 3KKSA 3KK1A 4N76A 3E9FA 2K3YA 4C5EA 3QO9A 4HUEA 2P5GA 4PLLA 1NJZA 2F8TA 3ZSVA 1TKZA 1J9AA 4EZ9A 3TAQA 3P1GA 1DTQA 3C6TA 2HHUA 3AO5A 4QVZA 4DTNA 3PY8A 4DSEA 3IS9A 1RDBA 3IG1A 4R5PA 5J39A 3P8DA 4OLAA 2ZQBA 4ELTA 3OYAA 3K5OA 2RPIA 3NH0A 1U04A 2I5JA 4LY7A 3T1AA 4DQIA 1ZBHA 4E3SA 4FW2A 1JLEA 4AHVA 4Z4CA 4EZ6A 4F3OA 2OPRA 4DTOA 1LWEA 3NNQA 3MEEA 2RJCA 4HCBA 4GW6A 3PUFA 3KK2A 1U4BA 2HVHA 4OVLA 4KFBA 2G8KA 4PY5A 3QNOA 3SNNA 3IAYA 2EQMA 1U49A 2QXFA 4F2RA 3UIQA 2DIQA 4DLGA 3SI6A 2O4IA 1UOCA 4FU6A 4FM1A 1W9HA 2VYTA 4CHYA 3ASMA 4ICLA 4E89A 3ZSRA 2OZSA 3HK2A 1NOZA 2Z1GA 1ASWA 3ZSQA 3RR8A 4W5NA 2WONA 3AVLA 1X9MA 2XY6A 1RTHA 4X34A 2GBZA 1G5VA 2M1HA 4H4MA 4Z4EA 4M42A 3V1RA 4FJHA 3PFSA 4LD0A 4E7IA 3OJUA 2D0CA 1L5UA 4IBNA 4H4OA 3S9HA 3F70A 2ZD1A 3AVNA 2HHXA 1KVCA 3TI0A 3PO4A 5CZ1A 1ZBUA 5C25A 4CHQA 1HYSA 2GFAA 3HO1A 4CESA 3O3FA 2EQUA 1YTUA 3WNGA 4DLEA 4HVJA 2D9TA 2X4WA 5IAYA 3I0SA 3LAMA 4BDYA 1IKYA 5J2NA 4KRFA 3QJ6A 4C8LA 4N5SA 4A4EA 2RHZA 4CK1A 4DTMA 4CF8A 4JLHA 2R5MA 2QKKA 5T7BA 4L8RB 4IUPA 1TAQA 1TK8A 3E01A 4FJIA 1WSHA 3VQ8A 2JTFA 1VSLA 4O0JA 4DTSA 3OS2A 3LH0A 2K3XA 4RW9A 3OYKA 3LLRA 5KI6A 1NJXA 3RMAA 3WNFA 2PZSA 1S1UA 2RKIA 5CZ2A 1GOBA 2Y1JA 4KHQA 3L2QA 3K59A 4FK4A 2VG5A 1H3ZA 4BWJA 1EETA 4FJKA 4CJWA 3NH1A 1S9GA 3FDRA 3Q1JA 3F73A 1CXUA 3TANA 1JLFA 3VN5A 3VQPA 4DTPA 4C8OA 4N41A 3NGZA 4FM0A 4KI4A 1KFSA 2LTOA 4M3UA 2NLUA 1WSGA 1RDAA 4RW8A 3QERA 2HHQA 2O4XA 4FVMA 1TKTA 3L3VA 3CFRA 2RHUA 4QQ6A 2Z1JA 2QKBA 4FLXA 1RBRA 4CFAA 1RT7A 4KHSA 3WNHA 3RRGA 5M9OA 4Y1DA 4B9SA 3SUNA 2G8VA 3LPTA 3TABA 3V1QA 3ZT0A 4HCZA 4Z4IA 5D3GA 3ME9A 3V9ZA 1D9DA 3QKJA 2R7YA 4CE9A 4FJXA 3AVBA 3PX0A 3AO4A 1BISA 3D45A 3AVJA 1JLBA 2PYJA 4HTUA 3KLEA 3DLBA 2DAQA 2XK0A 3SUPA 2XY5A 5C6SA 5DK5A 4B9NA 3K5LA 4B9VA 4CIFA 3OB9A 4FK2A 1RBSA 4KPYA 1TK0A 3A2FA 4C5IA 2RO0A 4TSXA 4WE1A 2OYQA 4QQDA 4CRIA 2E5QA 1N5YA 2GF7A 2Q3SA 1T8EA 2O4XB 1J5OA 3LX7A 3HM9A 3VQ4A 3LZJA 3EY1A 4FJ9A 1XWLA 2FBXA 3K57A 3KTQA 3OA6A 1HNIA 3SQ1A 2EQKA 3WNEA 3VA3A 3V9WA 4I2QA 2XRIA 3OYJA 1TVRA 3AVIA 2KZZA 4EP5A 2YKNA 5E41A 1Q9YA 4Z4GA 2X4XA 1J54A 1FKOA 2HMIA 4CGFA 1C6VA 5I42A 4DF8A 1SV5A 2OPPA 4IURA 2W42A 2R5AA 4E7JA 4E7HA 1S5JA 5JS2A 1RCHA 4FJGA 1TGOA 3OYEA 4KREA 1L3VA 2QQRA 2E6MA 4PL6A 3NF7A 1JLCA 3C95A 1QS4A 1TL1A 4Z4HA 1QSLA 1KTQA 1BGXT 3LP0A 4M3YA 4PWDA 2R57A 2OPQA 3C6UA 2PQWA 4ID5A 3TWHA 4FW1A 1WJRA 4PQUA 3SCXA 2XHBA 3NGYA 4IKFA 1RT2A 3CQ8A 3TAGA 4CGJA 4AHSA 3RWUA 3MEWA 3ZT2A 3DLGA 1BCOA 4KI6A 1IKWA 4JS5A 3DRRA 4DMNA 1C0TA 3OYGA 4CCHA 3P5JA 2VG6A 2IAJA 2P51A 1J53A 3TAFA 5J2MA 3KJVA 3AVMA 3VQ5A 3HPOA 3EYZA 4CEZA 5IN1A 1NKBA 4CHNA 2L3RA 4CFDA 4J2EA 3MEUA 4JRPA 1D5AA 1WN7A 2HNDA 1RTIA 4DFPA 1BQNA 4DS4A 1NJYA 4KB0A 2RHYA 3OQ5A 4N47A 4DG1A 5D6XA 1N27A 4M45A 3AV9A 2KZMA 4GMJB 4B8CA 1C0MA 5KRSA 3HPGA 2IGIA 3TAPA 3L3UA 2HHWA 2DIGA 2HQEA 1XHZA 5KH6A 3FFIA 1ZYQA 3ZSOA 1EP4A 2G8WA 3OYLA 3OMCA 4M3RA 4NCAA 1KHCA 2NUBA 1QHTA 1RILA 4IUQA 4IUVA 5HRPA 2ATQA 2Y1IA 3MP6A 2F96A 1ZBLA 5SZTA 1S6PA 2HB5A 4C5GA 4CJ4A 3MEVA 1VSHA 2JZ2A 3LYIA 3ULDA 1U47A 3V9UA 3V81A 4MFBA 3DLHA 1NK9A 3QBYA 3L2WA 4HUFA 3MXMA 3BGRA 1W0HA 3AA2A 1VSFA 3LPUA 4FZXC 3ZSWA 3DYAA 1X9WA 1TV6A 4XIUA 3EAEA 3LWLA 3M8SA 3BDPA 1XI1A 2XDPA 3DMJA 3PX6A 2D5RA 2CKKA 1X1PA 1NK0A 3NFAA 2MWOA 1TAUA 4FK0A 4IFVA 1WJQA 4CHOA 2IDOA 4K8ZA 1RBTA 4LH4A 4FJMA 1VSMA 4O0IA 4FLWA 4ZTFA 4DTUA 3RTVA 1KFDA 4II1A 1T7PA 1WSFA 4OPJA 4KTWA 4CIEA 4C5HA 3DB3A 1RDDA 4B9TA 2AJQA 2F5KA 2YNFA 5FRNA 3MXJA 1Z25A 2KFNA 1RDCA 3O4QA 4DTXA 1KRPA 3ZSZA 2BKDN 2P0KA 5HBMA 4DSKA 1RT4A 4A4HA 3ZT3A 4F3TA 4C8KA 4MQ3A 2DTUA 3HVRA 4OKEA 1HQEA 3QIOA 4AILC 2Z1HA 2ZE2A 2KFZA 4CEBA 2YHBA 1EXQA 5FRMA 3QINA 3S6WA 4OGCA 3K5MA 3DB4A 3H08A 2RJDA 3ISNC 3NF8A 3KIOA 4IUTA 3TR8A 2BIVA 3AO1A 3NTKA 4KHWA 2G8FA 3V1OA 3SPYA 5CYMA 1YVUA 1VSJA 1RBUA 4J2BA 1LW2A 2HVIA 1WSIA 3LP3A 4CERA 4AHCA 3S3MA 3ZT4A 1L3TA 3P83D 2X78A 3B6OA 2QK9A 2B4JA 3KLIA 3CFPA 4CJLA 3NTHA 4DQRA 4QQGA 3UT1A 4O55A 4Z0UA 4CJSA 5DMRA 2D0BA 3MAQA 2P1JA 4CGHA 1T05A 2X6NA 1KSPA 5FROA 5KE3A 3OYMA 2QQSA 1VSDA 5HRRA 5I3UA 1REVA 3RMCA 1ASVA 3QLHA 1B92A 1NK7A 1UA0A 5HLFA 2R58A 4CEFA 3DRSA 4Q5WA 3M8PA 3DM2A 4B8AB 1TKXA 1JXBA 4FLTA 3MEDA 1WJSA 3TAMA 2GUIA 3CM5A 4E0DA 1JL2A 3VQ6A 4KHUA 3C4SA 3L2RA 1L3UA 2L8DA 3L2UA 3SV4A 1BL3A 5J2PA 1IG9A 2OA8A 4FL6A 4KTZA 3NTIA 1VRTA 3VQDA 4BD3A 2Z1IA 2OPSA 2RHIA 4NYFA 4M3ZA 5JS1A 3HT3A 2BGGA 1RNHA 2G3RA 1XC9A 3AVCA 1DTTA 3CM6A 3T3FA 3K2PA 3L8BA 4QCLA 1NK8A 1LWFA 5FDLA 3NE6A 3OYBA 3ZEHA 3QESA 1LV5A 1X9SA 1C1AA 4ZTJA 2B8AA 5D6YA 4B9MA 3QNNA 1QTMA 1OYXA 4GY5A 4B9LA 4JRQA 1HNVA 1JLAA 4F8RA 1WLJA 1D8YA 1A5VA 3HJFA 4B08A 1NK4A 1F21A 2VG7A 3O8VA 4OKJA 1ITGA 3VQCA 1UAXA 4FJJA 1HMVA 2FBYA 2DFFA 4UQGA 3OYHA 3K58A 5D6WA 3OYNA 3OMGA 3QEIA 1LAWA 4G1QA 2A1SA 1ASUA 3HL8A 5J2QA 1Y97A 1N6QA 3O4NA 1C1CA 1IKVA 4CHZA 4W5QA 2E6NA 4E1NA 4LSNA 3RMDA 4IUUA 3SPZA 4CJPA 1R0AA 2VWKA 2YNGA 4PA1A 3U6FA 2E4LA 2PYLA 3E9GA 4Q5VA 3LP2A 3T19A 4UC4A 3NAEA 5KE2A 5HROA 3META 4DFMA 3NHGA 2D0AA 2E6LA 4DSJA 3M8QA 4LH5A 4HHTA 4YFUA 2B5JA 3VQQA 3KK3A 3DI6A 3PV8A 1WGSA 3MP1A 2G8UA 1GOCA 1QQCA 4CHPA 1DLOA 2GFUA 1BI4A 2VWJA 3SQ4A 3SJJA 4BDPA 2HQXA 4B9UA 4LD6A 4DSLA 3ALYA 3V4IA 4DU3A 4M41A 4DTJA 2KQ2A 4DTRA 1IH7A 1VSEA 1HYZA 2XO7A 5KCOA 4ZHRA 1BQMA 2M0OA 3FEOA 1T03A 3OYFA 3V9SA 4DQQA 2FC0A 1RT5A 4GVMA 1S6QA 4Z4FA 4B3OA 1SUQA 3PO5A 1C0UA 1MHNA 1SL0A 1RI0A 2LVMA 3D0PA 1TKDA 1S1VA 4EDUA 2KW4A 3VQ7A 4CF2A 4LSLA 1BIUA 3LZIA 3RR7A 2YV0X 2DY4A 2RI5A 1QE1A 2PY5A 4CEOA 1O1WA 4W5OA 3QEXA 2FBVA 4M3TA 1B9DA 3VQEA 3KKRA 4NYNA 4CJ5A 1IKXA 2RI2A 1LWCA 1JKHA 3SUOA 4CF0A 3LGLA 2LDMA 2LRQA 3DLKA 2RI3A 3S3NA 1BI4B 3QEVA 1GOAA 4E1MA 3DOKA 2RHXA 3M9QA 3CFOA 4FYDA 3H8ZA 4N56A 4CJVA 4FM2A 3DLMA 1VK0A 4CEDA 1NK6A 3OS0A 4CGGA 4CECA 4QAGA 4IG3A 3G10A 4DS5A 5J1EA 2ITGA 3AO3A 3H6ZA 1JLQA 1BHLA 2IG0A 3PNWC 5C24A 2KTQA 3NBPA 3KD5E 2X35A 1HQUA 4DFKA 4KAZA 1SKSA 4A4GA 3OS1A 4Y1CA 3NF9A 4OPKA 1NKCA 1BCMA 4BACA 3MECA 4W5TA 2IS3A 3FC3A 4W5RA 3ZCMA 3AO2A 3AVFA 2OZMA 1JXEA 2LSNA 4E19A 5HP1A 1LW0A 4FLVA 3TAEA 1JL1A 1NKEA 3VQAA 3VQBA 1Q9XA 4BE1A 4RW4A 5CIUA 4H8KA 1KLNA 3SQ2A 1WAJA 4CFBA 1XHXA 3VA0A 2EX3A 2BUDA 4CGIA 2IOCA 3TARA 3DLRA 4CF9A 4I7FA 2FHDA 3OYIA 1ZBIA 4CGDA 3NCIA 1MU2A 4AH9A 3KUFA 1RT6A 4FZYA 4E7LA 4KV8A 3LWMA 3RRHA 4ID1A 2YNHA 3OJSA 4I9LA 2WOMA 2JLEA 4F2SA 3OYDA 4QW2A 4KHNA 1FK9A 4Z02A 5EU7A 2F8SA 4CF1A 4DQSA 1I3AA 3LDSA 1KCFA 4RG2A 2X74A 3CEYA 5CY4A 4OVAA 5KGWA 4HUGA 3QIPA 3SV3A 2YNIA 1SL1A 3L2VA 4AHUA 3SQ0A 1BIZA 4M3XA 2G8IA 4O4GA 4CEEA 1HYVA 4BE2A 3DOLA 4NS5A 4CJRA 3SZ2A 3NH2A 2L89A 1ZBFA 3VQ9A 1VRUA 2EHGA 2HW3A 3NF6A 3I0RA 3MEAA 3KD1E 1WAFA 1EKEA 2YHAA 3MXIA 1RT3A 3OYCA 3P8HA 3ZSYA 5KGXA 3QETA 4DSIA 4C8NA 1HPZA 1VSIA 1YTAA 3DRPA 3HP9A 5HRSA 3PMTA 4FZZA 1FXXA 3V6DA 2A1RA 4DFJA 2YKMA 4FJ8A 4EP4A 3HXMA 2ETJA 4OLBA 1YT3A 2HNYA 1S1TA 1QSSA 4CFCA 1G15A 4FJLA 4O5BA 5J26A 4KHYA 3G0ZA 4AHRA 4I2PA 4CJTA 4DF4A 1RBVA 3SD4A 4B9WA 3OVNA 3KLHA 3EZ5A 5KCHA 4FLZA 3SUQA 2IC3A 5KTQA 3THVA 4FXDA 5C42A 4NZGA 4KKOA 1WSEA 1CXQA 1NOYA 2DFEA 3IRXA 4DWIA 3K5NA 1OZ2A 3QEWA 1OZ3A 4CIGA 2GV9A 1KVBA 1VSKA 1IO2A 3U3GA 4CJKA 3SYZA 4A4FA 1NK5A 3UWNA 1EX4A 5K14A 4IFYA 5C0MA 3CYMA 3ZT1A 2YRVA 2LCCA 2RF2A 4JS4A 3KLGA 4J2AA 4NCGA 4CJUA 4N4HA 4CK2A 2RJFA 4OGEA 3LAKA 2X4YA 4K8XA 3HSTB 1LAVA 2MWPA 1S9EA 1U48A 1HRHA 1CLQA 4YNQA 2HHVA 3C94A 4PUOA 3PX4A 2EQJA 1KVAA 4ELVA 3AA4A 4I9QA 3NDKA 3B6PA 2X6SA 4RG8A 1RTDA 3QEPA 3S3OA 3PMIA 2HHTA 4N4IA 3NGIA 1SKRA 1CZ9A 5HRNA 3I8DA 4BDZA 1I39A 5CYQA 2WACA 1HJRA 1RTJA 4KO0A 4CEQA 3V9XA 4IDKA 2EFIA 4FLUA 1OI1A 3AVHA 3AVGA 2HHSA 4B9XA 4FCYA 4Q0BA 1KLMA 3GOXA 3MEGA 3HPHA 1SSFA 2FBTA 4CEAA 2G8HA 4CK3A 1UA1A 1CZBA 2JGUA 4OJRA 3O3HA 2BDPA 4HCCA 4CJQA 2XY7A 1FKPA 4BE0A 2XY8A 1A5WA 1SL2A 2M16A 3LGFA 3MP8A 3HVTA 4DU4A 3DLEA 1TL3A 4KTQA 2RN2A 4L59A 4CJEA 3AA3A 3U3YA 5SWMA 1S1WA 1B9FA 2BANA 2DFHA 3KLFA 4DU1A 4F4KA 4M3WA 3FLGA 1S1XA 3JYTA 4CJ3A 3L42A 4J2DA 4OKKA 3HP6A 4E7KA 2B6AA
chains in the Genus database with same CATH superfamily
5F1RA 4JKGA 3RMBA 4JX5A 4FWRA 4D1QA 3UATA 1WNLA 1UGRB 1UUEA 3ELKA 3K1MA 1C1BA 1X3UA 4ELUA 2J06A 1OEBA 2ZAEA 2YX7A 2ZFWA 5AQMA 4DQPA 2QDYB 1M3BA 3ABMH 1W5CC 2DFIA 2LY2A 1SKWA 1EV7A 2DL7A 4I99C 4UHTA 4U0YA 1X6GA 2J6OA 2JHNA 3MO8A 4HSTA 3RUXA 1HW2A 1IV8A 3ASNH 2RGVA 4XR6A 3CG7A 1K4SA 2ASMA 1C0GA 1TK5A 2P9LB 1JLGA 1WSJA 2LH9A 1HBXG 3JRGA 2HQHA 1JXMA 4PNOA 2XAFA 1E4FT 2C0IA 1HW5A 3M8RA 2F2VA 5CR2A 5LL6Z 1USSA 1N9RA 4UVCA 3EGDB 4A2AA 1UWBA 5BQTA 4OMNA 4JI3K 2IPQX 4GO1A 1ULYA 5ICFA 1PRLC 4F14A 3VMFB 4M4ZA 4NHJA 2WUSA 1HK9A 2MPXC 3BR5A 2BZXA 2O8BB 4O3MA 3FDYA 2DTHA 3IQLA 3GYHX 2D4WA 1YF5L 1WXTA 4QWQA 1HW1A 3KKSA 1IGUA 1GLLO 2CP3A 1VQKQ 1V4SA 4JK1X 1ZKGA 3IUOA 1O3TA 4C5EA 4XU2A 2DL5A 3KP6A 3HRUA 2JSCA 3E5UA 4PLLA 5AYFA 2F8TA 4J9CA 2K57A 4I09A 4EZ9A 3TAQA 3P1GA 1QZEA 5CCAA 1ATRA 3A8YA 3C6TA 3HEFA 4YPRA 1DU0A 4QVZA 4DTNA 3QYEA 1NJIR 2CMPA 3IS9A 3MJXA 1RDBA 3ER0A 2ESNA 2ZPIB 3P9KA 3I9QA 1XCBA 2XF7A 3IAS2 3M59A 1O3RA 3SFZA 2FEZA 2V4JC 3OYAA 2RPIA 3DKYA 1E3MA 5ADXA 3H0DA 4LLLA 2W40A 3D1NI 2XHKA 4M3GA 2K3FA 1WZOA 3A01A 4JKDA 4KUMA 2XGDA 3I0TA 1TUYA 4AHVA 3M1EA 4EZ6A 4F3OA 4HNUA 2XSDC 3KK7A 2CH6A 2PVGB 2O8CB 1KYWA 3PUFA 3AY9A 2E2IJ 1U4BA 4MHGA 4G7ZF 5GJVB 1FYKA 3RTRA 2UXNA 3FF5A 4KFBA 3A0BC 3QBXA 4PY5A 2HKNA 4AM6A 2EB7A 1BC7C 1KG6A 3I4NJ 2JXBA 2QEXN 4IO9L 2DEQA 1WRJA 3VPRA 2VI6A 1D1BA 2DIQA 4DLGA 2KYMA 3AG1H 5M1PA 3M0TA 4R55A 1HYOA 2O8XA 3BFMA 1W9HA 2CW0F 1NEGA 4IOXA 2ZJQL 4PGGA 2KAFA 4BR7A 3ASMA 4MDWA 4ICLA 3J7ZI 3ZSRA 2OZSA 1ASWA 1CF7B 1LMZA 4WQ4C 3I56T 4ZC3A 3FXLA 1RTHA 2VQHA 2O9SA 3MN2A 2DBKA 2W82A 1S22A 2F2WA 3PFSA 1S7EA 2PN6A 5GANg 3KHYA 2PJRB 5J4YA 2D0CA 4V19S 2PX9A 2OI3A 3G4SQ 2HHXA 1KVCA 1XGSA 4J01A 1D5YA 2HBKA 2YRCA 4EW4A 1SPKA 4XU0A 2DDAA 4WF2A 2DQRA 2GFAA 4IO9F 3O3FA 1YTUA 4RGRA 3WNGA 3LL3A 4DLEA 3GWZA 3J7AY 3E9OA 1KAXA 3I0SA 5KYUA 2K9SA 3WG9A 4RTWA 2HKXA 4BDYA 5GADJ 1I4K1 2OTLT 2A3ZA 1VQPT 3LAMA 3GW2A 1H641 3QJ6A 3H1CA 4N5SA 3ZEUB 2ZJQF 1KGSA 1LJ9A 4B24A 1XC5A 1WWXA 1B72A 4CK1A 4DTMA 4CF8A 3ISPA 2L9SA 2QVOA 3EHQA 2NOGA 3THYB 5HDNA 3FXMA 1SRMA 3SB2A 2FX0A 1TAQA 2W00A 3E01A 2MW8A 4FM4B 4KITB 3CC7T 4I98B 5E84A 4BVOA 2F5VA 3ROUA 2R7WA 3D0SA 3A8MB 5CK9A 3IWFA 4WQ5C 2K2MA 2HU9A 2JTFA 5AONA 4O0JA 4ESFA 2A5WA 4LLNA 2K3XA 2YLCA 2FA5A 3M58A 3RMAA 2DA3A 1DGRM 5CZ2A 1GOBA 5DD8A 1X9JA 2H8HA 4KHQA 1B4AA 4CUGA 3L2QA 2G6FX 1APLC 5GAMj 2VG5A 1XNQK 3NPFA 1GBRA 2GA2A 4D0PA 1VQ7N 4GKJK 4CJWA 3NH1A 4CC4B 2PTKA 2W0ZA 5HODA 5GAGJ 2DI3A 3TANA 1BA5A 2ZGWA 3EUHC 3CPWA 1YHQQ 1GV5A 3BG3A 1WB9A 5HKCA 4JKFA 4FM0A 3CPWP 1ZH5A 2EKHA 3E0JB 3CWSA 1MW7A 1JKQC 5CVUA 4CZCA 1NWKA 2NLUA 1RDAA 2STTA 4OIOF 1K4TA 2Z2SB 3BW1A 1S72Q 4PKHA 2O4XA 2D0OA 4FVMA 4CC7A 3CCSA 4XORA 5B1AH 3M5RA 1YIOA 1TKTA 3JV3A 1VQMT 3GZNB 1NG9A 2QSFX 3KNTA 3OGDA 4LD9K 4BUGA 4B9SA 5M1QA 2MGQA 4LLGF 3LPTA 3I55N 2VC1A 2FSWA 5LLQA 4A3GJ 4I7HA 2A41A 1DPRA 5D3GA 2H1LA 4EPCA 3K4CA 3QKJA 3BLYA 3HHGA 1YW9A 4B3XA 1VQ4I 5GAN5 1BJAA 5GAN2 4ZGDB 1GCQC 5LJ5j 2WTEA 2R5ZA 2EWSA 3EH2A 2DAQA 2GXGA 5AJ3K 3SUPA 1VQ5I 5DK5A 4B9NA 2QWNA 3OB9A 1FBQA 4NQWB 1MPGA 1YW8A 2FZGB 2CSOA 2LK2A 1WI9A 4KGXB 2WB1A 4C5IA 1HKCA 4EM2A 2P8TA 4TSXA 4MQ9F 4CRIA 3TDZC 3GF5A 3SMSA 5LHIA 1SSHA 3M54A 1IW7F 2GF7A 3HM9A 2H3GX 2LFBA 1G59A 1YTYA 2VODA 3LZJA 1TP4A 2Q2EB 3Q0WA 4FJ9A 1H92A 2ZXWH 2AZSA 3K57A 1KAZA 2EA2A 4L5GA 1N32K 3THWB 1QBJA 3OA6A 1Y0MA 1NG2A 3SQ1A 2LSOA 4KFCA 3L2CA 3V9WA 2AK5A 3AVIA 2KZZA 2YKNA 4B3SK 3ABLH 4JI1K 2E1YA 1TUDA 4CGFA 1QVFS 2DK8A 5KYYA 3SDBA 3TGNA 5C2DA 2Y69H 4DF8A 1IREB 5FPNA 1QVFM 4ITVA 2CGKA 3I4MJ 4LD5A 1K78B 4E7HA 5F0HA 2HS5A 2X1CA 2HF4A 3GTMJ 2IAIA 4Z6YA 2X4HA 1RUNA 1TGOA 3OYEA 2YU9J 1Q81U 4JEPA 2E6MA 4FETA 4BC3A 4PL6A 5DLOA 4XOTA 4EMGA 5DM6L 3D5SC 4M7DA 2O03A 2L3DA 3CP8A 4N0AC 2BE9B 3VS3A 3TU4K 2JWTA 3LP0A 5KCMA 4M3YA 2BZYA 4A59A 2B7EA 4PWDA 5J3LA 5GAOq 2WY8Q 3M07A 2OPQA 3Q7CA 3C6UA 2PQWA 3B6CA 3TWHA 2OU2A 1VQNQ 1WX6A 1J6ZA 4C23A 1WJRA 3PIOA 4JLIA 3O9QA 3EE8A 1GLCG 4IKFA 1KK7A 3ZP5A 3VOVA 3HHTB 5HNFA 5FLXE 3RYRA 1WHUA 3DRRA 1TWHJ 3CMEN 2A6EF 4DMNA 2XHIA 2F4MB 4CCHA 1Y6IA 1FTZA 2CT3A 2EFWA 5AT1B 4XTUA 4BC2A 2Q2RA 1M3QA 3D2EB 3HSBA 1DP3A 3FIWA 3AVMA 2H27A 5IT9Z 4EGYA 2L3SA 2O31A 1NKBA 5KAFC 1WHLA 4BY1J 1KD1R 1S3JA 3O2PE 1R9TJ 4C3IJ 4JHDA 3MEUA 5DM6F 1N3CA 1UECA 3J7AO 2QI2A 1F1ZA 1N27A 3W6KB 1FNNA 1NLPC 1UGSB 4GMJB 1H3HA 7AT1B 2VGNA 3D5RC 4PZJA 2XF5A 1Q1VA 2XAGA 1FWZA 1JUMA 3HPGA 1IXDA 2DAOA 3TAPA 1KQ1A 4ESBA 2D45A 2EYYA 1XHZA 2XRLA 3FJPA 2FPEA 4I6MB 5KH6A 1YJ9A 2DOFA 3BWGA 4BG8A 4B3RK 3I59A 2WSEE 2G8WA 4QVDA 2W57A 3TSWA 3D7SB 1F43A 2WSCE 5DCMA 2FF3B 1QKWA 2NUBA 3REBB 1QHTA 2XF6A 2AA4A 3CCEI 1W2BP 4IUQA 3ZRGA 1L0OC 3VGLA 1MBGA 1ZHFA 2BZTA 4PHTX 4PJOA 1T98A 2HB5A 3RMSA 3A5ZB 2A69F 2K3BA 4RDUA 2MK5A 1VQ5A 1KU9A 5FLXZ 1X75C 3ULDA 2M51A 1JJ2S 3WU1B 2OTJI 1NK9A 3BR1A 3MXMA 3MAJA 3M57A 1W0HA 3OSVA 2VKDA 4JV5K 5E3OA 1NGAA 1JJ2M 3ZSWA 3AL0C 4XIUA 3KEQA 5D4RA 1QGPA 1ZG5A 2LYCA 5B3SH 3FKJA 2OD5A 2UUZA 1EH6A 3TO9A 2EYWA 3DMJA 2YDLA 3QRFF 3S2WA 1X1PA 3QYBA 3A5OC 1IUYA 3VTHA 2P9IA 3TDUC 1YJNQ 2DA5A 3CPFA 5IXBA 1ZHIA 4DKWA 4RLQA 2JRTA 5KAIC 5E1ZB 2RK1A 1TQMA 1YIJI 2VJ4A 1PSFA 2DN0A 1HA8A 3CQTA 4M77B 4B09A 3IHOA 3CI5A 2V7FA 1D1CA 4BRAA 1IXCA 5J1UA 4M78C 1VQKA 1SFOJ 1IXSB 4LFCK 4B9TA 2AJQA 2F5KA 2YNFA 4DV3K 3CCLI 1K73R 3ZQIA 1YN8A 2LNBA 4OFAA 2KDSA 3VEVA 3U1DA 2E41A 4BRHA 2LMJA 2FBKA 3R8EA 1RDCA 4U88A 4YIRX 1YITT 3VV0A 1HQCA 1NPRA 5FGMA 5LHGA 5EG0A 1G3WA 4LITA 1KO9A 3HVRA 3KP3A 4GFBA 3LSHA 1UTIA 5IHKA 5EF6A 3ZFJA 4CCKA 4KIGA 1MUYA 2W04A 2PBDA 3JRBA 2W6KA 3QINA 1M1KU 3ISNC 3TR8A 3FKIJ 1MDMB 1LPLA 4WXDA 3NTKA 1NJIU 4JZ3A 1I6XA 4M77G 4FSXA 3PNVA 4M75C 1MUDA 1OKRA 4J2BA 1S7OA 3CMAQ 1MJAA 1VQ6N 2DODA 3S3MA 4EHTA 3CZ6A 1ZELA 3CVSA 1WH7A 2B4JA 2FU4A 3MWPA 1RRQA 2E7WA 3VDXA 2QENA 1TWAJ 3RERA 2Y0SA 5LD2C 3JCMP 1D1AA 5E8GA 4DQRA 2RPNA 2Q8KA 3WTXC 4FISA 1H88C 1FMWA 3I54A 4C3HJ 4C92G 3BEXA 4HLYA 2CP7A 3A8HB 2RC4A 2XDDA 2EZLA 3QFUA 3OWTA 3BCBA 3CESA 4KNYA 2J7IA 2L54A 1JU5C 3H1VX 1QCNA 3RMCA 1ASVA 2ZXJA 1VQ9Q 5DCFA 3DXKB 3G71N 4OMMA 1NK7A 3TP0A 2OV7A 3C65A 4MNUA 4HPQA 5GINA 3JTGA 3SDGA 3V8LA 4J9IA 1WYXA 4MMKA 4Q5WA 4IZ9A 3G4SA 3DM2A 3PTAA 1W7PD 4F9OA 1TKXA 4A53A 4FLTA 5CJ9A 1LVKA 2GUIA 3ECOA 3VQ6A 3KEOA 3A03A 1O75A 3L2RA 1L3UA 4YOXA 3L2UA 5FKNA 1YJ9N 4FWSA 2E71A 3HOTA 1AVZC 1VQ8N 3RIRA 2OTJA 4B21A 3T5XA 4LF7K 5GAOm 2BYVE 4YHHK 1NHAA 5FFZA 3KP7A 1O13A 2HMAA 4BD3A 3RSEA 4MDAA 4C92F 1RL2A 3GIBA 3M1CA 3CBOA 1KQ0A 2P6TA 3HSCA 2DK3A 3FXRA 4CJ7A 1DTTA 3MQ0A 1WI3A 4XTXA 3K2PA 1ONVA 3L8BA 2QWOA 4PFZA 1MBKA 4UXNA 1OX8A 2DA1A 5DLQE 3FFKB 2QQAA 2KFDA 3BR3A 5IXFA 5FDLA 3ZEHA 1B07A 2O8EA 4ZTJA 1XNRK 2F4VK 2KNBB 2EIKH 1ETOA 2HOAA 2QLZA 3BJAA 1UJ0A 2R7RA 1LFPA 4GY5A 2UV1A 4JRQA 1M2OA 3CCLA 3GF2A 5AQJA 1HNVA 1U2WA 1JLAA 4F8RA 3QP5A 1YHQA 1WLJA 1A5VA 5GMKi 3MX5A 3CCUT 1F21A 4XMYA 3VQCA 4L5JA 1PU7A 3CLOA 1HMVA 1HOMA 2QKMB 2LC2A 2DFFA 3HRMA 3M4OJ 3K58A 2JMCA 1VQKN 1S72A 1HSJA 2EYZA 4YDUA 4IVNA 2TRTA 4CA0A 3UA7A 3KBGA 5C10A 2GGRA 4G1QA 1ASUA 4E7SA 4JYKA 1JXOA 5LMUK 1SG5A 3FZHA 4F91B 3MMYB 2YUPA 1N6QA 3EE9A 1IKVA 4W5QA 2DYSH 2EZKA 3S93A 3ZOBA 4CJPA 5F04A 5F0CA 1R0AA 3U6FA 3RDVA 3HUGB 1HUXA 3LP2A 3T19A 2LTPA 2HYJA 1IJJA 2VQLA 1TZLA 3VOEA 1ACMB 4K41A 4MO5A 5HROA 3OYYA 1V29B 3J80O 3NHGA 3TOBA 1U8RA 3M8QA 1WJAA 5KN9A 2A6HF 3VERA 2ED1A 2DILA 5ICCA 1ZA1B 4P96A 3CMMA 2RD1A 1GOCA 2Y48A 2GX9A 2GXBA 3SQ4A 4U87A 4BDPA 2LP5A 4LD6A 4DSLA 3ALYA 3O8MA 5E20A 4A63B 2X3XD 4DTJA 4RMOA 3MKWB 2QA4T 1CZAN 1IH7A 1VSEA 2JMAA 4S04A 2M02A 1HYZA 3CUQC 2MF2A 2XO7A 4ZHRA 2JJ9A 2FBIA 1BQMA 1I8FA 2ICWG 3OYFA 3V9SA 2YHTA 2Q0UA 4DQQA 2LVSA 4BR0A 2XI9A 4L6V5 1SUQA 1ZQ3P 5GMKe 1NNEA 4AFZC 3FXKA 2KW4A 4LSLA 5AZJB 2EFOA 3KXTA 3VRYA 3J8AA 1J0RA 1M5Q1 2XAJA 4HF1A 1V54H 3ENHA 3TREA 1Q86U 2RI5A 3ULQB 4KN7X 3VYUB 3JTHA 4K11A 2G0EA 4W5OA 1YBYA 3LSGA 3VQEA 1GL5A 1IBLK 5GAMf 3KP5A 3KKRA 4AQYK 2QEXT 3LQRA 3ZQGA 3DFGA 3S8PA 2LRQA 1TNSA 1T33A 3WT0A 2CGPA 3HC7A 3G73A 2VUMJ 2ZXIA 1X3NA 4BB7A 4E1MA 3M9QA 3H8ZA 4N56A 1IO6A 1QVTA 3PFYA 3I9V2 5GAN7 2HVQA 2DDBA 2VOPA 4A3FJ 3PSIA 3FK7A 3WXKA 2P5LC 2BXZA 2EGEA 1EZZB 4CEDA 4BRDA 4JJDA 3CJNA 5JLWA 5J1EA 3CCRQ 1BU6O 2ZPHB 3JB9I 1SZ2A 2QUFA 1JLQA 3E97A 3W6VA 2K79A 4JK9A 2I8DA 3R2XC 3CC2Q 1D8KA 2KTQA 3FMSA 1D5VA 1MUNA 2COBA 1VIFA 2HD0A 5CQGA 1C0FA 1OH6A 4XH4A 3RBBB 4IXAA 2HZTA 3NF9A 3OR1C 5K7FA 1BCMA 3MD2A 4BACA 3MECA 1RESA 1XMOK 4X9DA 1LE8B 5GPAA 3WGHA 3AO2A 2XV4S 5DTDA 3ID6A 2UYTA 2ACJA 3FHNA 1QNTA 3EETA 2EJRA 4UUSA 1AOJA 3NVKA 5LJ5f 2YG8A 3TAEA 2P4TA 4IL6C 4FIBA 2VC8A 4YTLA 3IKVA 1NKEA 3HOXJ 3VQAA 3ZX2A 4CBWA 2JUGA 1N8RR 4BE1A 2HBJA 2LBFB 2RQUA 3JCMh 4N9IA 2FSNA 5LRSA 1WAJA 4CFBA 2KQWA 2NNWA 4RA2A 1GDTA 3X25B 1YHQN 1FP2A 2L9VA 2BHYA 2BUDA 2CUBA 3DLRA 4KMFA 4I7FA 4KN4X 2UU9K 4RTFD 3OYIA 3GVAA 1ZBIA 4IHTA 5I2MA 2P7CB 1LDKB 1ZLKA 2CT4A 2ZSHB 4AH9A 1QRYA 1UAAA 4FZYA 4RTTA 3FBNB 2DFUA 4A0ZA 2YNHA 2DTZA 2JLEA 2B9SA 2LLKA 5HY6A 1GLDG 2VOOA 2VQEK 4QW2A 5HNHA 2XGEA 4Z02A 1DJ7B 4FOEA 2F8SA 4CF1A 3C2HA 5HLHA 5GAHJ 4CZGA 5JR3A 4RG2A 3R6MA 1JHHA 4UUVA 4OVAA 2XKOA 2LQWA 2YNIA 3RESA 1HPMA 1MMAA 3SQ0A 4ZDOA 3CJRB 4YOQA 4X9CA 3LSPA 1HYVA 2Y30A 4H0PA 4BE2A 4CZHA 1I27A 3H3OB 3OH9A 3H46O 1PD1A 1K8KA 2NYXA 2EHGA 3I0RA 1P59A 3MEAA 3EUAA 1R8OB 4KGZB 1RT3A 3HPWA 3P8HA 1I5LA 2J6FA 5KGXA 1YJNA 4BGBA 1V3FA 3EZWA 2WWYA 4NBQA 2ENMA 1N9SA 1VSIA 1IXRC 1HDDC 5M1FA 3SXYA 3HP9A 5KVRA 3EO3A 2KRNA 1EWRA 3QOEA 2KL4A 3JCMX 3WEEB 3MCZA 2V8IA 4XKBA 2COWA 3SYTA 3V6DA 1D3YA 2ME0A 3AARA 5AQTA 1M90C 1WFWA 1AOYA 3EG0A 4RGXA 4KBOA 4IOAL 4EP4A 1A0NB 4OLBA 3J80K 5CLSA 2JA8J 3I35A 1SANA 3CLQA 4L9VA 5A0DA 1S7AA 1B6AA 1FOWA 1G15A 4JOMA 3I56I 2AKLA 3CCVI 3PVQA 2F5CA 2L7MP 3G0ZA 1IBMK 2BOLA 3NGPA 2DA7A 1YG2A 3I5SA 4XRSA 4AU7A 3O5ZA 1RBVA 3EDPA 1R5GA 2YHWA 3U9DA 2XAHA 4IJNA 3VW4A 3KLHA 2GQQA 5KCHA 3NEUA 4A62A 2IC3A 1NLOC 2IA1A 4EIKA 1YI2I 1WSEA 5HDGA 3CD6Q 2EGAA 5I9EB 5AQKA 4F92B 3I53A 4U0WA 4B9QA 5IH2A 4N4NB 1ETQA 2Q2EA 2QQBA 3U23A 1OZ3A 4CIGA 1RRJA 1VSKA 4LJZF 4XU3A 2OTLI 1VQPI 1IO2A 4J9DA 2A6TA 4DOWA 5I2SA 4CJKA 2L5QA 1B9MA 3TTCA 2EV5A 2CYYA 4IOAF 3LSIA 1VQNN 3F10A 5BS6A 4I0BA 1S8NA 2YRVA 1GXIE 3D2FB 2RF2A 3CMAA 4J2AA 2KLAA 2H8WA 4N4HA 4CK2A 3CC7I 2RJFA 4PSXA 2IS2A 2X4YA 3HSTB 1JGSA 4ILJA 2FF6A 4M7AB 2HHVA 3JB9H 1B8IA 4H5VA 4G6QA 3LA2A 4DR5K 2EQJA 1KC8U 4ELVA 1ETWA 4I9QA 1QP2A 3TTDA 2AQEA 4KUIA 3NDKA 2CWEA 5CO7A 2MD0A 2X6SA 2MLKA 5BMZA 2P9UB 2FL7A 4RG8A 1ILYA 1Z7LA 3QEPA 3S3OA 3PMIA 3CC4Q 2J5OA 2FEIA 3M53A 1CZ9A 1I39A 1X3WB 1ZSZB 3AAPA 4OMLA 1VQ9A 4MO4A 2EFIA 3AVHA 4XH1A 4Q0BA 1JCGA 2Q0OA 1WI7A 4IDHA 4D5FA 3HPHA 1SSFA 1R0BG 3OTOK 4DCHA 1X1CA 3GTGJ 2P0QA 4K0KK 1ZQ1A 3PVLA 3QG1A 4CK3A 2JA5J 2EIFA 5AQYA 5J40A 1CZBA 3TOAA 5FLMJ 2JHJA 2BDPA 3K4LA 3OIQA 1XG7A 5H20A 4J00A 4C92D 4ELZC 1DP7P 2CQ7A 1V76A 1SL2A 3MP8A 3HVTA 4DU4A 3DLEA 2OFKA 3T7ZA 2XPVA 2RQWA 1MMDA 4L59A 3E5XA 2JPBA 3VODA 4FE4A 4M7AG 3U3YA 1MKMA 2BANA 4DQ8A 3EGXA 4F4KA 2H8RA 1I94K 1M90O 2UXBK 3R4KA 4BY6B 1JQQA 4XIDA 5C4XJ 1CQTA 2BGCA 3DF8A 2CP2A 2KI7A 3A0IX 1XTDA 3HP6A 4E7KA 2W03A 1I0CA 1ZUKA 4M71A 5DM7L 4FSSA 4MFEA 3DBHB 2QBYA 4A12A 2OJED 3LM2A 2JJ7A 2XAUA 1VYUA 4J6WA 3TQ7P 1CKAA 3CCST 1SEMA 3WHCA 3S2HJ 1QMCA 4YG2F 4Y4RA 2GWKA 2NRRA 3LNQA 3LP1A 3UKRA 1WQWA 4XL9A 3ZQLA 2F1LA 3RMQA 2HOSA 2V9VA 1MBEA 2HNZA 1YJNN 3L00A 2BY2A 1DEJA 2HFHA 1T3VA 5AQXA 3U9ZA 2KZGA 2O7OA 4DQ2A 5JHFA 3URGA 1YWPA 1PKTA 2NUTB 3JSCA 3QIIA 3SFIA 3CCVA 3FMRA 4A0YA 1X2MA 1X01A 1ZLJA 1IJWC 1Q8IA 4AHTA 3AA5X 1RT1A 4M7AF 5GANh 4N4GA 1H8AC 3AVAA 4QOZB 2RJEA 5TKWA 2HVSA 3HKSA 1XNIA 5LJ3g 4D5CA 4NCBA 2NWMA 3VS0A 5DM7F 4A2UA 1RKTA 4ZNXA 1YI2A 5IYDJ 4DK9A 4RS8A 1VFCA 2RQPA 4RW6A 4C30A 4OIRF 3ZMZA 3E9FA 4DIQA 3L1AA 1G4DA 2E1MC 1K7AA 3Q5FA 1ORPA 1Y39A 4C8QC 2V8KA 2CRGA 2VBXA 5D6EA 4YORA 2DL8A 1I3QJ 1ERDA 2PU9B 5CKBA 2P5GA 1NJZA 1U5TC 2QGFB 3ZSVA 1J9AA 3ZN0A 3CXCA 3ABTA 3LDQA 4DR2K 2X1EA 2HHUA 3T8RA 4D7MA 3CXCP 1V55H 2GUPA 3CCJQ 3G3ZA 2VJJA 3IFRA 4BQNA 2A36A 2DMPA 2L9RA 5J39A 2A5XA 4ELTA 4GKKK 4KH0B 4ABZA 5JMVA 4RCHA 3J7YJ 4BBSJ 5L8RE 1ZBHA 2LF7A 4M75B 1XG1A 4AFUC 3ZMVA 3F5TA 3LDNA 4Z4CA 3UE5A 3O9SA 4NL3A 3NNQA 2CZ0B 4A57A 1PWTA 3TCJA 2EJGA 4NL2A 2J4RA 4OVLA 3MN9A 4DV6K 4BI8B 2JTMA 1RAIB 1XN7A 3IAYA 2DJIA 1RGIA 1ZLMA 1WUAA 3DEUA 2QXFA 4PIIA 2PNIA 4B22A 1M1GA 3UIQA 2F7TA 2O4IA 2DTRA 5KPTA 1JUPA 3O1BA 2R3SA 3FJ5A 1UHFA 5D5VB 1VQ9N 1UGVA 4KMUX 5FKOA 3ATVA 1NOZA 3SWNC 2Z1GA 4FSVA 4B1YB 3ZSQA 4LF5K 3AVLA 1X9MA 4BREA 2XY6A 2YU3A 2GBZA 1G5VA 5BRFA 4H4MA 3CJTB 4Z4EA 2FRYA 4DBQA 3R60A 5M3MJ 1J5EK 2ADUA 4LD0A 4E7IA 2LD5A 5HS7A 1UGPB 4IBNA 3A01B 2DLPA 4EMKA 3F70A 3CCRA 4Y15A 4EQQA 2HBPA 1W4SA 1ZBUA 5C25A 4HAMA 4ISGA 4GXOA 1T0FC 2NS8A 5GTIC 3ZETA 3VS5A 1NYFA 2EQUA 2EWNA 3DLAA 2D9TA 4OMOA 4J9BA 2YPRA 2HDCA 5J2NA 2F4OB 2XDBA 1X27A 4XLHA 4HEA2 4MGRA 4IIOA 1YJ9T 2RHZA 5HLGA 4M78E 2DZCA 1JXSA 1YS6A 1QU3A 3N0UA 1ZX6A 1U0JA 2Y31A 2QKKA 4L8RB 2GTJA 2OPTA 2F2XA 3HTSB 4IPAA 4YRVA 3WTYC 4YOTA 3IP4B 3G6EQ 3H9NA 3V7CA 4A0XA 1BU1A 4FJIA 1YOVB 4RWTA 5FFXA 3CPWS 1VSLA 1TSFA 3LH0A 3DJCA 4UUTA 3A5NC 3F22A 4XKWA 1VQ5T 1D0YA 4BXXJ 5KI6A 2NOFA 2QK0A 1NJXA 2N8GA 3WNFA 1TH7A 3CPWM 5GAMe 2PZSA 4Z89A 1S1UA 5HLIA 1VQLQ 2FVUA 3K59A 3QPSA 2FG0A 4F16A 5FW9A 3WTWC 1H3ZA 4FJKA 1XGMA 1S9GA 2Y75A 2CQNA 4NNJA 4RM3A 1CXUA 1N8RU 3L7WA 3BTJA 4DTPA 4N41A 4TV7A 2KE9A 4KI4A 5KYUB 1TBXA 3T1BA 1OCTC 1YITI 2LQKA 4HNVA 4JN4A 3LAJA 5C4JJ 2V1RA 3FHFA 1PG5B 3QERA 1B72B 2HHQA 1Q81C 1T08B 5FU7C 3IH4A 4EA5A 2RNJA 2Q1NA 3MKDA 4MIMA 5C0YA 1VQKT 2OBPA 1OCRH 2O61A 3WNHA 4PL8A 3E1YA 3RRGA 4O5FA 3G1LA 1VQ4N 3RQIA 2JMWA 2V8JA 4BRFA 4A93J 4JD2A 5LMNK 4HBLA 5DYMA 4FWMA 3J80E 2PMZN 4JQFA 4HCZA 2P7VB 4RTZA 4M3DA 4N9HA 3VRZA 1XMAA 2R7YA 5E17F 3COAC 2KBTA 4ORZA 3GDQA 4FJXA 4E47A 5LJ5e 1XGNA 2ATCB 2W41A 1BOAA 2HSPA 3AO4A 3U1KA 4HW0A 1BISA 4MMLA 3TO6A 1JLBA 2PYJA 1Q18A 3DLBA 1U06A 2XICA 4BRLA 5IP7J 3KZBA 2EA4A 5GAN6 4CIFA 5IOZA 3HUGA 1NM1A 3I71A 2QTDA 2E10A 1A5JA 1VIEA 5F6FA 4C92E 2OQGA 2XIGA 2OYQA 1HSTA 3PO2J 1EH7A 2M7AA 1B3QA 4FYWB 4F55A 3WODF 4ISEA 4WXHA 4BEHB 5C44J 2O4XB 3UNGC 1J5OA 1S6LA 1ZN2A 2JN6A 2HQ5A 3MDQA 3WVDB 4IQ4A 1XWLA 2L0KA 2FBXA 5LGUA 2NXNB 3KTQA 1HNIA 3M8EA 1E2XA 5CHZA 3C6AA 4KBMB 2K4YA 4EP5A 4A2BA 5LEJA 1PDNC 5E41A 1Q9YA 6AT1B 2E34A 2L0AA 2X4XA 1MBHA 3L2ZA 1FKOA 4HNTA 4A3DJ 3DWLA 1N33K 1BW5A 4OINF 5J8FA 1PU6A 3CWTA 2KVQG 3EG2A 1GFDA 3N5NX 2M1BA 5ERIA 4IURA 4HTLA 4HRIA 4E7JA 1C6VX 4MLHA 2E2NA 3I33A 4OMQA 5ILUA 3J80Z 1WEGA 3IUCA 2R5ZB 5JS2A 1ZG1A 3AKZA 3CCRN 4FJGA 4KREA 1MMSA 4EA4A 1R7JA 3OSSC 3NF7A 3QU6A 3SK3A 3BQYA 5AR0A 5FU6C 3C95A 3NQOA 2FPDA 1TL1A 4Z4HA 3CC2N 1KTQA 3G4ST 4WQ4A 3EYIA 4VUBA 2DT6A 1XQPA 1RAGB 3I55Q 2DPDA 1P92A 2Q1ZB 2TDXA 1FOKA 4FW1A 1SC7A 2AIRB 3SCXA 5GANf 2NOJB 1W7PA 5DEQA 3TAGA 4G6DA 3EFOA 3ZT2A 3DLGA 1BCOA 1K83J 1I50J 3F21A 4KI6A 4JS5A 1HKGA 1K9AA 5F64A 3CC4A 1Q81O 5M1OA 4IO8A 5MLCQ 2VG6A 4NO7A 3ONQA 2IAJA 5HL7L 3LWFA 1PVEA 3BDDA 5KYYB 1S1NA 3TAFA 2H1KA 1T39A 1LNWA 3KJVA 3E7LA 3I64A 4HV6A 1RETA 3TU5A 1X69A 3QDRB 3CCUI 5IN1A 3RKWA 4PUSA 4CHNA 3IRQA 2V79A 4X66K 3B6AA 3GL1A 2DT7B 4JRPA 1WN7A 1PRMC 2RNAA 2HNDA 3W0LA 1RTIA 3HBLA 2RHYA 4N47A 4DG1A 5D6XA 2ZWHA 4LOCA 4M7DB 3AV9A 4OIQF 1VQMQ 1CSKA 2LJ0A 3H1QA 2KZVA 4ASNA 4WQ5A 3L1PA 1B59A 2IGIA 5M5XJ 3J81O 4ETSA 4DR6K 1MMNA 1FJGK 1JB0E 1TWGJ 5FB2A 3CCLT 1BA1A 3LCNA 1Y8QB 3KP4A 2CP5A 3RCOA 1EP4A 1YHQT 3RPUD 1A36A 3CPEA 2VXDA 5CKDA 3ULRB 2Y9YA 2DYBA 3KWGA 1RILA 4KIBA 4KISA 1OCZH 1M1KC 4V2SA 3IDHA 2F96A 3U21A 2P9SA 3MN6A 1ZBLA 3HIFA 1S72T 1S6PA 2E1OA 1BBYA 2YUQA 3EUHA 4C5GA 4UY8I 4RTYA 2HHHK 5BN8A 1ZGWA 4M7AD 1VSHA 1BIBA 2JZ2A 3LYIA 4QS7A 5LL6S 2RHKA 3V9UA 4GYGA 1IRGA 3Q7BA 4JHDB 4AD9A 1P4AA 3R6OA 3AAQA 1LWVA 4EFHA 3BGRA 2HSEB 3GLLA 2BH1A 1JTYA 3LPUA 5BPNA 1X9WA 1TV6A 3DTIA 1MV3A 4M7DG 1BOBA 3ZQHA 2IIRA 1SD7A 3JB9J 2KIUA 2XDPA 3PX6A 2DJZA 4MZMA 2CKKA 4ON0A 3CCMQ 1TAUA 4CHOA 1QO0D 4KJZA 2E7XA 4O8KA 3CMEQ 4FHTA 2FSJA 2PVDB 1VSMA 3I59B 3PIOL 1M2VA 4L5EA 3RTVA 3J7AP 5DCMB 2E35A 4RTVA 4CIEA 2FLOA 2L4MA 2BW3A 1GCQA 2QEXI 1Y64A 4WFBL 1XDSA 2NYSA 4C5HA 5LBQA 2JZYA 4PJOB 3FHZA 1AWCA 1HX1A 5CVRA 3WE3A 5L3EA 3LW5E 1R1UA 4OB3B 1Z25A 1R77A 4IHVA 1TUUA 5CKHA 3X26B 2XD0A 1TT5B 3CD6N 4JKEA 2NRHA 5K1YA 2P0KA 2O6GE 3MX2A 1TU0B 5HBMA 3V8KA 3CCJA 1RT4A 2CYZB 4XNFA 3S1MJ 4AI5A 2QGUA 3QQAA 4M7DF 3ZT3A 4C8KA 3FM3A 1EF4A 4OKEA 1B7TA 2K27A 4BC4A 2CH4A 2W10A 2Z1HA 2LQNA 4BL0B 2NNYA 5GJWB 2OX7A 2VXFA 3MZ8A 3HRGA 2P9IB 2CP0A 4M6VA 4WK8F 2AZVA 4NDLA 1IZ1A 2LKSA 4ZDPA 1KA8A 1LQ1A 4EMHA 3K69A 3WTZA 2VE9A 3KIOA 2Q31A 4IUTA 4UV8A 1JJ8C 2M9HA 4EATA 5CE3A 3V1OA 1DIZA 1NGHA 2HEOA 4IEEA 1JJ6C 4PJOG 3H0IA 2H09A 1LW2A 2DLLA 1QPMA 4BGDA 4LDYA 3HZ6A 3ZT4A 1L3TA 4BQZA 1B9NA 1VQNT 1EIFA 3E1SA 3DQVC 2KXCA 4N0AA 4DR3K 2LRDA 1D3BA 2V9KA 3IV5A 1W0UA 3UT1A 4CJSA 4A3JJ 2P1JA 4CGHA 2R7OA 4KH1B 1M1KO 1KSPA 1KZHA 2QQSA 3A1YA 5EG0B 4E9EA 3WGIA 2MSYA 2K86A 1GT0C 4ESJA 2HZDA 5HRRA 4Y33A 2VONA 5I3UA 1XCVA 1D09B 2RE2A 2VASA 3M9AA 2DA6A 1REVA 2Q36A 2OA4A 4CEFA 3DRSA 4H5WA 3ECHA 1W7AA 2ISYA 4BROA 4B8AB 4RTUA 3HOVJ 1YLFA 1VQ7I 3MEDA 3TAMA 3F8NA 2A07F 2RNGA 5EEHA 3JCMg 4YEJA 1JL2A 5FPEA 4OPHA 2LX7A 4AIAA 1R71A 4PJOF 4DOZA 2L8DA 1BL3A 1Z9QA 4FO0A 4NXMK 2VBWA 1O7LA 4NB4A 4XLAA 3P31A 1HNXK 2OA8A 1FOXA 2KIQA 1ACIA 1Z3YA 4KTZA 2JA6J 2BVLA 2EK5A 3MEXA 3UKGA 2FZCB 3NWTA 3QZ5B 3S15J 1VRTA 1NBEB 4OOIA 3BPXA 4DBFA 3HDDA 3G1OA 4UOBA 1VQON 1BB9A 3O9TA 2OPSA 4J8FA 4P1WA 2RHIA 2DERA 3H6EA 2NOEA 4EAHD 3HSFA 1M3CA 2DJNA 4CDGA 5AFUH 4NYFA 1EH8A 4KHPK 5JS1A 2IT0A 1RNHA 3A1PA 3L6QA 2W48A 1Z9CA 2HQNA 1IRFA 1R5HA 4QCLA 2K2VA 1X1AA 3BG7A 2M5WA 1NK8A 5EG2A 2RK2A 2Y4XA 2P0WA 4WYBA 3IAM2 2J5PA 2E65A 1PC0A 2ZPFB 1Q7YC 3JRHA 1NG6A 1VQLA 2NRZA 4LE9A 3WTTC 1R00A 1Q86C 1ENHA 5D6YA 4B9MA 1YJWQ 1OYXA 2IW5A 2LP0A 3FRNA 4KGVB 3H0HA 2HVRA 1BI2A 1D8YA 1YJNT 4XLFA 2E36A 3O8VA 1ITGA 4BHPA 4JI8K 1UAXA 2JSPA 2Z16A 2FBYA 4EM0B 4UQGA 1UHCA 2V6CA 3QEIA 2E1MB 3CVTA 2NOLA 3RSEB 2E4HA 2E1CA 2BBYA 1Y97A 1SVLA 4FTHA 5GAMd 2FD5A 1W5TA 3WG7H 2PI0A 3QYFA 2M0CA 3OL4A 4E1NA 3RMDA 1IZ6A 3HI0A 3SPZA 2KJBA 4X1EA 4IEIA 2VWKA 2YJFA 5FD6A 4BRGA 2H3EB 3CCJN 3K10A 3QDKA 2E5NA 1BW6A 5KE2A 1SVOA 4PFPA 4B48A 1UJ8A 4M78A 4DFMA 1XQHA 4H0VB 2D0AA 2E6LA 2BZ8A 4DSJA 3FHGA 1JHFA 3VEPA 4LH5A 2O8EB 2FOKA 3UR3C 3DI6A 2YCHA 3GFMA 1VQ8Q 3PV8A 3MP1A 4A69C 1RPWA 3R0AA 2GFUA 3BY6A 3SJJA 2O8FA 3DLLA 3DXMA 2AO9A 3V4IA 4M41A 1TYQA 4YELA 5BRDA 4DTRA 3F72A 1M8VA 2GWRA 2XROA 4O5VA 1JCEA 3DV8A 1TT0A 1U78A 1NK2P 5GAN3 3L4QA 4G6TB 2CFXA 1QA6A 5IYCJ 5FLVA 3PO5A 2CGLA 3E6BA 3TPQA 2LVMA 3D0PA 5EVZA 3KX2A 2VKVA 2ZCWA 1UZCA 3CMAT 2EH3A 5LJ5d 3W2VA 1BIUA 1ON2A 4LIUA 2ZKZA 4DNCA 3P4IA 3V42A 2P5KA 1ZSGA 2AQFA 3PO3J 1X58A 4JKHA 4JK7A 4M75A 1VQ7A 1YO5C 1O1WA 3W3DA 1SD4A 3K70C 1Q82U 4F17A 5BREA 2FBVA 2JN0A 3GE1A 4IFEA 4NYNA 3ML6A 4CJ5A 1PUFB 3BE3A 1IKXA 2Z0WA 1JKHA 4CCOA 1G3SA 2R7TA 3O6BB 3LGLA 1DPUA 2LDMA 2ZGZA 2P0PA 1YW7A 3OIOA 2WA0A 5J4VA 3O08A 2QASA 2WSFE 4FYDA 2NUPB 2L01A 4MEXF 1HKBA 4X0GA 2DJQA 1VQ9T 3CQXA 1R49A 4RAFA 3SZPA 4F7UE 5CQXA 3IH3A 4CJVA 4FM2A 1Q7YO 4JYAK 1EWQA 1Q86O 5IPAA 1FT9A 4CGGA 3VYSB 3O3KA 2V7YA 1WEFA 4QAGA 1HCRA 3G10A 3DKXA 3JAME 2O9VA 3I55A 1FTTA 2DXCA 2FUG2 3AO3A 4LFUA 3EKUA 3H6ZA 2AT1B 4MTDA 3QYHB 2A40A 4JI0K 5BR9A 2HYGD 2FXAA 1XUPO 2CU7A 5GAEP 3CCSI 3OIPA 2F69A 4AVZA 1NU0A 2M34A 3NBPA 3AG4H 2X35A 3VENA 2YUSA 2CUDA 3M3YJ 3GUDA 3H0GJ 3LSRA 2OZ6A 2HTSA 4ZDLA 3G6EN 4FT2A 2WTUA 2IS3A 3SMPA 2E3HA 4CYCA 3OR2C 2DTOA 2ESWA 1OQKA 2AS5F 2ZF5O 3N97A 2L7KA 4C8QE 2OZMA 2LSNA 3K6GA 2HBWA 3A8OB 2OZUA 4A3KJ 2GLOA 1LW0A 4BGAA 1EBMA 1NMNA 2GOXB 1H1VA 3VQBA 3R9PA 1Q9XA 3QWYA 1ABQA 3H5RA 4BQLA 1VQLN 1JEGA 2VIXA 2JVHA 4AF1A 4BJ5C 5EX5A 1OPCA 1KQ2A 1X43A 4H8KA 4DW6A 3CJAA 3SQ2A 1V4TA 1HKSA 1JGGA 1IUFA 1BUPA 2DPPB 3VTIA 4AG1C 5ADXH 3VS1A 3K2AA 5I11A 3CCYA 1PCXA 4EIAA 1ZRCA 3X24B 1RABB 1UHSA 2A3SA 3K4JA 2FHDA 2MMPA 2CREA 1ATNA 3NCIA 3CCVT 5J3BA 3ZX3A 3RDIA 2DYIA 2MG4A 5FKMA 4E7LA 3RRHA 5CVIA 4BUPA 4JPBW 4I9LA 2WOMA 3OYDA 4F2SA 3EQLF 3SLCA 1FK9A 2FNAA 1ZYRF 1LFUP 3LSKA 1OU9A 3LDSA 2VQGA 5ED4A 4F3QA 1IB8A 4DBRA 5EDNA 5ECAA 4UUSB 2WY7Q 1YI2T 2QA4Q 5KGWA 4HF2A 5D7UA 3QIPA 1LEAA 3F6VA 4X6AJ 1WJEA 4E4HA 3CJ7A 3IMXA 2G8IA 2KRSA 1VA7A 2CW7A 4CEEA 3KP2A 4I01A 3DOLA 1DU6A 4QTRA 2EPFA 1VF9A 3IH7A 4CJRA 3E3VA 3NH2A 2L89A 1ZC6A 2LREA 3PT9A 1S29A 3LOCA 2MC3A 1TNTA 1KC8C 5DUIA 2TCTA 1V4RA 1WAFA 3Q0VA 2YHAA 3MXIA 4AIKA 3CCMA 4QLCU 3ZSYA 5GP9A 5A2QE 3AHUA 1E3PA 2CH5A 3CMEA 1ETKA 3FBIB 2JW4A 1FBUA 1RAFB 1YTAA 3G1MA 1TWCJ 4Z94A 1M90R 1YQRA 2PFBA 2ME6A 1LEBA 3I56N 1G83A 4B47A 2ZMEC 1JI8A 5AQNA 3BP8A 5HLTA 2COYA 4J9EA 2KHMA 1OJLA 3LFKA 3PJRA 4JKAA 4DFJA 1FY7A 1VQ6I 2ZXHA 5KN8A 1T3SA 4M7DD 4OB0B 3HXMA 2OFIA 2HL3A 2E19A 4B3TK 1QSSA 1XSVA 3ZR8X 3CUQA 5J26A 1R6RA 1WQ2A 2NS7A 1Z91A 1MZBA 3GLXA 1QWFA 4J9GA 3JREA 3C0CA 3SD4A 2EGCA 2E20A 2OTLN 2Q0RA 4DV1K 1K0SA 4FLZA 3IHUA 1K8KB 1P90A 3G71I 3ZQFA 5KTQA 3THVA 1JT0A 5C42A 4KKOA 4CW7B 2CQQA 3DAWA 3EYYA 4DV4K 4BEHA 2RM4A 5AQWA 5E3MA 1KG7A 2CG4A 2XGCA 3OMYA 2KIMA 2EILH 1RFQA 4MTEA 2GV9A 2KRMA 2IGOA 5TRDA 3H35A 2QF7A 1EO1A 4XLPF 3REOA 1NK5A 1ZG3A 1YJ9I 5A0GA 2YI1A 4CZZA 2HDWA 1KHIA 1R1TA 5C0MA 2LX9A 3CCQQ 3ZT1A 2ASPA 2LCCA 1U2VA 1HKTA 1EA3A 2QM3A 3CCRT 4JP0A 4OMYA 2CZ7B 1S9EA 2JPCA 1U48A 4RGUA 3PX4A 5LJ3h 4FWLA 5L23A 4Q47A 3AA4A 2E5KA 4BVPA 3LQQA 1QLYA 2XC7A 2HBLA 1HJDA 4BJTA 2HHTA 1I1GA 3KZZA 4BRCA 3NGIA 1SKRA 4EVVA 2Z33A 5HRNA 3I8DA 3MKZA 1S5LC 2ABKA 1HJRA 1N34K 2EFQA 4CEQA 4OB1B 3HGYA 2HNHA 4IDKA 2E2PA 1FZPB 3DBRB 1HLUA 3MEGA 3FZFA 3BG6A 4F52A 1P7MA 1R22A 5GADP 1VQMN 3CWUA 2G8HA 2R0QC 2BTTA 3BG9A 2DVEA 2IRFG 2JS0A 1HD3A 1UA1A 1ZBSA 1KC8O 5H6QA 2JGUA 1W1FA 2KKZA 2E2QA 4HCCA 2LNHB 4CJQA 2QZ8A 2XY7A 2KHOA 1AA7A 1UHMA 4EMSA 3GTOJ 4BE0A 1A5WA 1IN4A 4JI4K 3KZYA 1TL3A 4Y92A 3J81E 1ZUYA 1MBFA 3A98A 2WV0A 1VQKI 3Q0UA 1GLAG 2COZA 1DKGD 1T0HA 1DDNA 1B8IB 4IHSA 2O2OA 1SEUA 4XRSG 2EV0A 4M3WA 5CR4A 4MDBA 4YPHA 2P9PA 2IGKA 3MK6A 3L42A 2ROTA 2NNNA 2GWJA 4OP0A 3JB9G 2DEUA 3WQTA 5CAIA 2D6FA 3KVGA 1ZBJA 2VXZA 3O3GA 2DYRH 1XGOA 2IXSA 4DSFA 5GAGP 1QSYA 4OAZA 1RRSA 4C8MA 2HOTA 2EKOA 2GEMA 3WXLA 3AVKA 2R7XA 3ITHA 3HTVA 1U45A 2LQ8A 1TL8A 2P9NA 3FISA 2RH2A 3BDLA 5FWCA 4IG0A 5KYWA 1VQ6A 1Y71A 5IHNA 1WNSA 3CCMN 4EV0A 2A6AA 3EG9A 3U8XA 1YJWA 2O8DA 2DXTA 4CBXA 2VC0A 3VS4A 3MMVA 2F5EA 1R4MB 3SEMA 5GAOn 2IA0A 4FJ5A 4II3A 5J6XA 4FT4A 4BI3A 2LY9A 5IT9O 2XASA 4O44A 3HYFA 2P5OA 4CJFA 1LVAA 3BTCA 3I4PA 2HKOA 4XQ3A 5J8CA 3GNGA 3CXCS 2HCKA 2RVCA 4ZZDA 5HK3A 3EGXB 3F9KA 2WFBA 1SS6A 4I2OA 4FJ7A 1PP8F 1WEIA 1RUWA 3G71A 5KRTA 2E8AA 3MFKA 3CXCM 1JTXA 3ABKH 3J81Z 3JB9F 1RR7A 2CV2A 5LRRA 3KK1A 4FX4A 4N76A 2QBYB 3QO9A 4HUEA 4JX6A 4C1NK 3HM5A 5CHIA 5D5WB 1IGQA 3S1RJ 2LKXA 4CZLA 3JXUA 1MSEC 1SMYF 5E1XA 1W2BA 3UKRB 1VQ8A 3G4SI 2HGCA 1RI7A 1RC9A 4GRIA 5EGOA 1K8AC 4R5PA 1X4OA 5EJCA 1WGXA 4OLAA 3CD6T 1NTCA 2ZQBA 4AC0A 1XQOA 4S0HB 3TBIA 3EG3A 3K5OA 3RKQA 5EC7A 4BYYA 4FWPA 5TGTA 4FWOA 5CKTA 4H4KC 3NH0A 3C6HA 3HM8A 1U04A 1O3SA 4LY7A 3T1AA 4E3SA 4FW2A 1WXUA 5E3LA 3O8HA 4S05A 2DPNA 2XUBA 3MKYB 1JLEA 4JNEA 1OFCX 3KTUA 1N25A 3H3UA 3M4YA 1R5ID 3WUHA 3KK2A 2FMLA 3ESWB 2EYXA 2HVHA 4KICA 1YX5A 2G8KA 5JLXA 1TTYA 4BAYA 5IT3A 2JT4A 3A2KA 3LM9A 3SNNA 3OH6A 2CUJA 2LR8A 1FYLA 2IP2A 3HKZN 3PQJA 4E6RA 4F2RA 1JT6A 4BR4A 4D6WA 3AG3H 4G7OF 3SI6A 2JNGA 3K70D 1N8RC 1A31A 4E6KG 4FM1A 2PAVA 4BKXA 4ISFA 1SQKA 4CHYA 2Q97A 1T95A 1OULA 2PBIA 1WHJA 3HSRA 3CC4T 3OV8A 1GCPA 3BOQA 3RR8A 4W5NA 4CGZA 2WONA 1C0WA 2DMQA 3K1PA 4D8DA 2YUNA 2HPIA 2M1HA 3TTFA 3H9QA 4M42A 3V1RA 1YHQI 4LF6K 3FXUA 2L2PA 1L5UA 4ZH4F 2ZD1A 4RTXA 2FJ1A 3BZKA 2E5LK 2YG9A 3THKA 2QWMA 4CO8A 2E1NA 4EGZA 4JZ4A 1S72I 2RREA 3K9JA 3WQUA 1XPXA 4ILGB 2LC4A 4X65K 2AXTC 4XRFA 4CHQA 3T8TA 3UA6A 4CESA 1POGA 1UG0A 3HZJA 2R92J 5FKLA 4ZGEB 4HVJA 3HG9A 5IAYA 4PJ0C 1ZA2B 1IKYA 1WH5A 4KRFA 2UUCK 3NAUA 4C8LA 3F6OA 4M7DE 3BPVA 5IWAK 3VYHB 4JLHA 5L3BA 2EIJH 4XSXF 2ABLA 5T7BA 3TP3A 2IGMA 5IP6A 1T3LA 4U7DA 3QDFA 2ISZA 1OCCH 1QCFA 1VYVA 1YAGA 2JRMA 3FX3A 1FYNA 2RB6A 3P38A 3WTUC 5CYVA 2RQQA 4NLBA 1FOYA 2XRNA 3RPUA 4PDKA 1JKOC 3VQ8A 3SEQA 3MPUB 4C0ZA 2IVWA 2NRTA 4DTSA 5FD5A 4B6MA 1AWXA 1YJWN 5LHHA 2YRDA 2O9LA 2E6ZA 3DP7A 3BROA 1FIAA 4EMKB 2RKIA 4GVEA 1K8AO 2IVMA 1RACB 2E2JJ 1REPC 4M77C 2D1HA 1UG2A 1XD7A 4QS9A 2HF3A 5KQ8A 3HTRA 4XH5A 3ATUA 3BR6A 4XQFA 3FDRA 3X28B 2O5RA 4IHYA 3ZETB 2WBMA 4UNOA 1JLFA 5AQGA 3SAFA 4F7UA 4CZMA 1HR0K 1WFXA 3AGKA 3FXQA 3NGZA 1M3AA 3V8JA 2O8KA 3GFJA 4LGWA 2E1ZA 5LGNA 3LWHA 1KFSA 2LTOA 4YIFA 1X19A 1U3OA 4M3UA 2KEAA 1NG7A 5GIOA 4M77F 5GMKh 3KFWX 4YFKF 2NRVA 4C92C 4RB0A 2HZYA 2I7PA 2QKBA 4FLXA 4CFAA 2BE7D 1MIJA 1V5GA 4BRPA 2KGTA 1RT7A 1OR7C 4KHSA 1LUJB 1MGQA 1XB4A 3BUZB 4Y1DA 2DL3A 5LJ3f 2G8VA 2E2HJ 1N8RO 3TABA 1FMKA 1WSUA 3V1QA 3OOPA 2UUAK 3ZT0A 4JI7K 5F2RA 4Z4IA 3VPZA 4RM2A 1SF9A 4C8QA 3CCJT 3PX0A 3VSLA 2KDOA 4LF9K 4A3CJ 5K7ZA 1FPQA 3D45A 1HSQA 3AVJA 1UB9A 4HTUA 1U5TA 3KLEA 4LIVA 3ERED 4EEFG 1VQNI 4J8OA 2XY5A 4L0YB 4QVCA 5C6SA 3H5NA 4BY9C 4KULA 3K5LA 4B9VA 3T69A 4QKUA 2GQIA 5GANd 4FK2A 2NRXA 1RBSA 1DUXC 4KPYA 1TK0A 2XVCA 1T56A 3TQNA 2VKNA 5H6RA 1LKXA 1IN5A 1N78A 1KQSS 2K9LA 1RLQC 1J2XA 2E5QA 2DETA 2GA1A 1N5YA 4R79A 2FNPA 4H5TA 1T8EA 2HI3A 3B8AX 3GG4A 3LX7A 4YY3K 4E1JA 3VQ4A 2P4RA 1ZGAA 3SJMA 1KQSM 1Y1WJ 2K9NA 4UB6C 4PSWA 4FPAA 4LF8K 3EY1A 4BXFA 3N4QA 3DKMA 4XM3A 2MIOA 1Y7XA 1K9MR 1XX5A 2EQKA 3WNEA 3VA3A 4I2QA 2XRIA 1TVRA 1Z3XA 4JD2B 5C15A 1GV2A 4NC6A 2LT4A 4Z4GA 1HU0A 1J54A 3OW2A 2VPRA 4JUVA 4BH9A 4JJNK 3DEEA 3OW2P 4V19K 1RNLA 2ECZA 4O8UA 1FYMA 2RN8A 4XBFA 1ZRFA 5L3DA 1NLVA 2W42A 5D6FA 8ATCB 4XN0A 4L9TA 4H0TB 1L3VA 2WAQN 1I1JA 3M6GA 2QQRA 3H3NO 3CCQA 3E19A 1QS4A 3SWNA 1QSLA 1XC3A 4IZZA 4G12A 4Z88A 1Y1VJ 2M30A 1VQ4Q 1BA0A 2CS3A 1PUFA 4MQVA 1W36C 4ZZLA 2CW8A 3TSUA 3SAHA 4CCNA 4ID5A 4OIPF 1WBBA 1HNZK 4JI2K 2DBBA 1VQ5Q 4PQUA 2X6WA 1RT2A 3CQ8A 2D1XA 1VYTA 3DU6A 4A5NA 2NUPA 3RWUA 3MEWA 4IQJA 3CCUN 4K2EA 3R3LA 1IKWA 1T0FA 2JQ7A 4EVIA 1C0TA 2KISA 3P5JA 2JTVA 2P51A 2OANA 3K0SA 2QWPA 1NZ9A 3VQ5A 4Z2YA 3CWAA 1H8KA 3EYZA 3VUBA 4CEZA 4KH5A 4CZIA 2HDDA 3JCMW 2X6XA 3VS6A 1YJNI 3G6ET 2QQ8A 1U5SA 2L3RA 2XIDA 4KIFA 1Z7UA 3LA7A 1D5AA 1BQNA 4KB0A 1IC8A 2CZ6B 3R61A 2LF8A 2M4GA 3OQ5A 2NOBA 2R4GA 4M45A 1Z67A 3EEQA 2PFUA 1VQLT 3SJHA 1W70A 5LY3A 1BBZA 2DA2A 1YQMA 3L09A 4L0ZB 2Y90A 3JCMV 1HLVA 2DIGA 3FFIA 4ME7A 3F0ZA 1SHFA 1M1KR 4CYDA 3ZSOA 1SVMA 1W7PB 4CH7A 3VEZA 3OYLA 3D5LA 2FOWA 4PKGA 3O8GA 1HKQA 2M8GX 3EFOB 5EEGA 1KHCA 1WQ7A 3S32A 3KPHA 2E3IA 3C7NA 2QA4N 4E9GA 2DMOA 2K9MA 1R4NB 5HRPA 3H5AA 2ATQA 1U3EM 4A4KA 5SZTA 4IX7A 2FRWA 3CBMA 4HQEA 3GXOA 1T6CA 4CJ4A 3MWTA 3MEVA 1VQNA 1NM7A 4PJNA 1X2NA 4PK4A 3OSGA 4WFNL 4RCCA 1U47A 4HT9A 4LG0A 4H03B 2FXUA 3RZOJ 3G1JA 3S1NJ 2GZWA 4OMFB 1SRLA 2UXXA 4BC5A 3HXLA 3DYAA 1SD5A 2P4WA 3EAEA 2R7SA 3LWLA 3REAB 3M8SA 3BDPA 1IBKK 2KYBA 2R7QA 4G9ZA 1WHKA 3JB9D 4B23A 1XI1A 1NGJA 2UZKA 1G2HA 2R5YA 1SAUA 4I02A 2C06A 2ZMEB 3TEEA 4LDXA 3CMAI 1WJQA 4HQMA 3C2GA 3HRSA 3WTSC 2EZIA 2R7VA 3JCMQ 4K8ZA 2O01E 5JHUA 3QWXX 4LH4A 2CS7A 2MC4A 4OMPA 1R1VA 1IDYA 4O0IA 4FLWA 1XTAA 2M87A 3LDOA 1TUGB 4ZTFA 4DTUA 2ZNYA 3P9IA 1KFDA 4II1A 4JKBA 1T7PA 2BV6A 1WSFA 4OPJA 4U67L 2NAZA 5GPCA 4KTWA 1TC3C 3PNTA 4LB5A 3DB3A 4IRHA 1RDDA 2HSTA 2K5FA 4C0GA 2P9SB 2DTIA 5AQZA 5D8KB 3VF6A 1HXDA 3K1NA 1YNZA 3K4MA 2RQTA 3T1YK 2BY1A 5FRNA 3MXJA 4XOPA 1QHAA 2MA3A 1ETXA 1VQ9I 1PJRA 4DV5K 2KRHA 2QCOA 4B43A 1KD1U 2DKGA 3HGGA 4DTXA 3CCEQ 5CKEA 5JFRA 3BR0A 1MSFC 2KSSA 1KONA 3FK6A 1FLIA 4D8KA 3CQYA 1IF1A 2H56A 1HQEA 1VQ7T 1BR2A 2VVKA 2OCEA 1IGNA 3QIOA 3I0XA 1X1BA 1GVDA 3W3CA 4ZYEA 2X3WD 2ZE2A 1Y07A 2ELJA 1IG7A 2E1HA 4CEBA 2DXIA 3DXJF 3V4GA 1XSDA 2JM8A 2OTJQ 2LOOA 3CCQN 4PFOA 1ZR2A 2MH9A 3K5MA 3DB4A 1MNMC 3H08A 4Q48A 2RJDA 4BJ6C 1YRNA 2CV1A 3NF8A 1DGWY 2K7AA 4ESRA 5GANj 4BNCA 2ZGYA 1M2VB 3AO1A 4KHWA 2G8FA 1QVGS 2DOAA 3CBPA 1OQYA 2BW3B 5CYMA 2WAFA 4XONA 4GV9A 3E2UA 5ICGA 2HVIA 3WHBA 1WSIA 4AHCA 1QVGM 2P9KA 3I55T 3P83D 2X78A 4BHBA 4ZGJB 1HDPA 4CC3A 2GXAA 3CFPA 4EJUA 1LCKA 1YIJQ 2F2EA 3FXOA 4DHYA 5CKFA 1GXQA 1H9GA 2D0BA 2L7FP 2X6NA 4ZYAA 2EZHA 1NBWA 5KE3A 1XQSC 4AM7A 3KYCB 4J83A 5K5OA 2LJ1A 1VHXA 5EOYA 1WPYA 4CZKA 2M7BA 1HF0A 4UV9A 2A3LA 2QG9B 4D7NA 1FMVA 3CCLQ 4EJTA 4DEYA 4F7ZA 4EM1A 1T6DA 2KR3A 3QLHA 1B92A 4HYEA 1F9NA 1UA0A 4XTYA 2R58A 4MFDA 1Y96A 2GAUA 2H94A 4YFNF 1LCUA 3M8PA 5CVJA 4FYYB 4EJVA 2EBPA 1JXBA 3ZX0A 1QPIA 2LKPA 3BTIA 3D6RA 1ARKA 1ZGJA 3UKUA 2HDAA 4WF9L 2OCCH 3CM5A 3JRIA 4KHUA 2L3QA 2MAMA 2F9WA 3GZ5A 1G6NA 2I10A 4NC7A 2G9WA 1ON1A 1AT1B 5J2PA 1N75A 5M5WJ 1A6QA 4RBOA 4ZJZA 4AYBA 1K73U 4DJAA 3HJEA 2R7DA 2LNVA 1UG1A 4XRMA 3BCAA 4BRKA 3NTIA 2Z3YA 4TVRA 3C2BA 1D3BB 3KWIA 1VUBA 2QDLA 2Z1IA 3FZKA 2MI6A 2ECCA 1BN5A 2X1DA 2YX6A 3JRAA 3AT1B 3HT3A 1P6RA 4K43A 2BGGA 1XC9A 2G3RA 4N0BA 2BXYA 3VJPA 3T3FA 2KMTA 1Q7YR 4PGHA 1Q86R 3HTUA 5LJWA 1LWFA 3K4NA 3J7AF 1WXBA 3OYBA 3QESA 2R7ZJ 5BPLA 2VT2A 2EW3A 1C1AA 1UFFA 1R23A 2FRHA 2F9TA 1DT9A 2QYZA 3QXEB 4M77D 4X1VA 3QNNA 5GAHP 2V9PA 1QTMA 3TVTA 1Q82C 4P5OA 1RLPC 5IT9E 4GV6A 2RN7A 1B34A 5AQQA 3CCMT 1NK4A 2QSHX 2KROA 2VLAA 4OKJA 2DL4A 3CMET 2GELA 1D8JA 2PJPA 4XEIA 3JW4A 1WZ2A 2VB6A 2HL5C 5JVHL 2VXEA 5B66C 4FYXB 1XMKA 3OYNA 3M8JA 3E6MA 4KH4A 2QQ9A 3C0BA 2QWWA 4G7HF 1RR8C 1LAWA 1FJLA 2YT6A 2COMA 2HNIA 1PP7U 3HL8A 2RA2A 2XMFA 4UVBA 3O4NA 5LJVA 1C1CA 2I0NA 1FC3A 4F04B 4DOVA 2I5UA 3M0UA 1WJBA 4WWCA 5KQDA 3QHSA 1TW2A 2DZ9A 2O88A 1AKHA 2DU9A 3KCCA 5AQFA 2YNGA 4PA1A 2EYQA 2E4LA 4BRQA 4CVNE 1ORKA 3E9GA 4UC4A 2KRFA 2OAUA 5BNGA 5AQHA 1WJ5A 1M9SA 2ECBA 4LF4K 5I22A 3F23A 1W5SA 1YX3A 2CSQA 3B73A 3P7NA 2YHXA 4YFUA 3VQQA 3KK3A 3GMEA 4HZFA 3DPTA 1WGSA 2ELHA 3CCRI 4CHPA 4FX0A 2IBDA 3E5QA 1BI4A 2VWJA 4DGWB 9ATCB 2NRWA 2Y0MA 2HEQA 3L0QA 1CKBA 2HQXA 4B9UA 1LWYA 3CC2I 1P4XA 1VQOQ 1AWWA 2QWLA 5FWBA 3CP2A 4M7AC 3AL0B 3MZHA 1R59O 1M1EB 5FKKA 2YS9A 1EQYA 2EIMH 3HOWJ 3PUBA 1I07A 2M0OA 4HVWA 2D0QB 1T03A 2XKPA 2YX4A 1S6QA 4Z4FA 4B3OA 5JLFA 3ULEA 2OAWA 4MZPA 1K1ZA 4B1UB 1TKDA 4Y3OA 2H3JA 1ZSZC 4K25A 1S1VA 3VQ7A 4CF2A 3NWSA 2VE8A 4LFAK 1CGPA 3HSEA 1RDUA 1KU2A 3LA3A 2DA4A 3I3LA 2R7UA 4DEXA 4E9FA 4P9UA 2C6YA 3ZMDA 4DZPA 2RAEA 1E4GT 1W4MA 4YOYA 4M78B 3QEXA 3PQKA 5CVVA 1B9DA 2I2LA 5AQLA 4A6DA 2KLOA 5HK0A 1KG4A 4YOUA 2W6LA 3N5BB 1YS7A 2IS4A 4NXNK 3CETA 2DF6A 2RI3A 3S3NA 3N05A 4DR1K 4DBHA 2O8FB 1MDUB 5LJ3e 1K9MU 3DOKA 3KLNA 1IN7A 5BN9A 3DXMB 2A05A 3I5RA 1ZREA 5J1RA 3TW6A 1TYQB 4XU1A 2DBMA 3CCSN 1VOMA 3CIPA 1WOQA 3JRDA 3TMOA 3JCMJ 1VK0A 3QSUA 1NK6A 5GAMh 3OS0A 2JOYA 4UNFA 1E6HA 4IG3A 1VQ4A 2KDZA 4J7FA 3CTAA 4DS5A 4BY6C 2W7NA 1Q82O 2A7YA 1W36D 4AYBN 3VWBA 2ITGA 2VJIA 4XTVA 3EN9A 2PMZA 1BHLA 4AI4A 2JS2A 2IG0A 2WC2A 3QB0A 3A5LC 3OOUA 2GBQA 5C24A 3MZYA 3KD5E 1W97L 1HQUA 4GYIA 2PUKB 2JPSA 2ETHA 1X3ZB 4KAZA 4CZJA 5C12A 4L5IA 1SKSA 4OPAA 5AQSA 2V1XA 3CHWA 1STZA 3JCMf 5FJ8J 3SAGA 3C3WA 4HXJA 5DDGA 4M78G 2JUCA 3FC3A 2QTVA 5KYXA 4C2UA 3AVFA 4C1NI 3DCFA 4AIDA 3KEYA 2HKQB 4HDUA 1JXEA 4E19A 5HP1A 5FPMA 2X48A 1FSEA 3LSJA 2WB1N 3BTLA 4WCIA 4DV7K 1YCSB 1BM9A 1OPLA 2FBHA 4CCLA 2YJEA 4RW4A 3DLLL 5D5UB 5CIUA 1KLNA 3RNJA 5JLHA 4Z8AA 1XHXA 1PVSA 2QWRA 3CDHA 1VQ6T 4Y7NJ 3VA0A 5LJ5h 4MEYF 5I21A 4J19A 1T0JA 1BI1A 4CGIA 4OF1A 1YJWT 3L9FA 3DPLC 2IOCA 3TARA 2KT0A 4ENNA 1Y0NA 2ZBKA 4M3BA 1A6IA 5BOXA 4OB2B 1AD5A 4MLOA 4A5BA 1MU2A 3M0PA 1GBQA 3KUFA 2B63J 1RT6A 2V1QA 1UE9A 4KV8A 3GEZA 5J47A 2MH2A 4ID1A 4C92B 4M78F 2BVMA 4M73A 1OYYA 4M75G 4KHNA 3O9UA 5E1WA 2F5FA 3VEOA 1ZR4A 4CYCB 3F0CA 3C18A 1SAXA 3G71T 4UY8O 3CD6I 2OAZA 3CEYA 5CY4A 3FZVA 3JAMO 2UWMA 4HUGA 2NVYJ 3CC2A 1Z1DA 3NMZC 3TSPA 2VPLA 4AHUA 3DLLF 1KC8R 2E64A 2GTOA 4O4GA 4BR9A 1JKPC 2HPMA 4NS5A 3PIPA 6PAXA 3TSQA 3SZ2A 1BI3A 1ZBFA 2QTXA 3BZ6A 3M0QA 3RQ4A 2A37A 4A5MA 3NF6A 1EKEA 1WCMJ 2DRKA 3EGUA