4E7JA

Pfv integrase target capture complex, apo form (tcc-apo), at 3.15 a resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 98
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7jA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7jA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7jA03
2IGIA 3MEGA 5DK5A 4FM2A 3RMDA 2RO0A 3T3FA 3OYMA 3S3OA 1OZ3A 2P5OA 3KJVA 3OS1A 3VQCA 3KTQA 1GOCA 2FBVA 4FLXA 1LWCA 3MEEA 5E41A 4CFBA 2DTUA 2XY8A 4CERA 3M8RA 2PQWA 4H4MA 3KLEA 1JLFA 1KVBA 2P51A 3PX0A 2P0KA 4N41A 3NBPA 2VWJA 4GW6A 3PX4A 3NTHA 1I3AA 2KW4A 3DLRA 2NUBA 2XY6A 2G3RA 3MP8A 1D9FA 4EP5A 3NH0A 2L3RA 1BCOA 2WOMA 1TKXA 3MP1A 5EU7A 2W42A 4FJGA 3OYLA 3L2VA 2R5MA 3PMIA 1X1PA 3P1GA 3P5JA 4JS5A 3ZSYA 1C1CA 5C42A 1OI1A 2M16A 2WACA 4I2PA 3WNFA 4DG1A 3RMCA 3MXMA 4E7HA 1QSLA 3PNWC 4IBNA 2RN2A 2YHBA 4AHRA 3PMTA 3G10A 4CESA 3TWHA 4EDUA 3QIOA 1NK9A 3ZSXA 4L8RB 4M3YA 3L2RA 4C5IA 1VSDA 3T1AA 3WNGA 4CGGA 5HRNA 4C8LA 2MWPA 4M3WA 2DIQA 1VSEA 2BKDN 2Z1JA 4A4GA 2XRIA 4LH4A 4UQGA 1QTMA 2HW3A 4BE0A 2XDPA 5D6YA 5C25A 3SPZA 2HHVA 3KLFA 3AA5X 3B6OA 3ITHA 4OVAA 3I0RA 1XHZA 1SKSA 1ASVA 4DS4A 1TK8A 4M3ZA 4K8XA 4ID5A 2HHWA 2OZSA 3OVNA 1SL1A 4NYFA 2Y1JA 2JZ2A 4DF4A 2PZSA 4LD6A 1ZBUA 1N27A 2BE2A 3OYHA 4CIGA 2M0OA 2B8AA 2RHIA 5T7BA 4F4KA 4FLZA 2VYTA 3SCXA 4E1NA 2RHYA 2F5KA 3K58A 3SNNA 1Y97A 3AO1A 4FJ9A 4Z4IA 4LSLA 2HHUA 3KKRA 4JLHA 4FK2A 3ZCMA 4CK2A 1RT4A 3CG7A 3LAMA 1WSFA 3I0SA 3NF6A 3O3HA 4CEAA 3LANA 4N5SA 4Z02A 4I2QA 4CHNA 1KRPA 4CGHA 2OZMA 2HHTA 4PLIA 3MECA 4M45A 4C8MA 3SPYA 4KB0A 3TAMA 3L2QA 1RTIA 3KUFA 1ZBHA 2E6NA 1C6VA 1KTQA 1VSMA 2DY4A 4QQDA 1KLNA 1BQMA 4CEEA 4BE1A 3MEWA 4HHTA 3ALYA 4CJ3A 4E89A 3K2PA 4OKEA 3ZT3A 4FM0A 4E19A 1L3TA 3AA3A 2X4YA 5D6WA 4KHWA 4C8OA 1NJYA 4FL6A 4NYNA 2YV0X 3NCIA 3PV8A 1SKRA 4N4HA 3PO5A 3CM5A 2BANA 1KFDA 4FCYA 3VQQA 2FBYA 3VA3A 1JLAA 4DFKA 2XY5A 3QBYA 2X35A 1LW0A 2RJDA 1VSJA 3RR7A 3LP2A 4CF8A 2HHXA 3DOKA 4OJRA 1Q9YA 2PY5A 3U6FA 4CIEA 4BE2A 3EY1A 1HYZA 1S1WA 5FRMA 1BI4A 5HBMA 4KHNA 3DRRA 4FW2A 4OVLA 4DSLA 1T8EA 4IG3A 3P83D 4M3XA 4Z0UA 2RF2A 4KV8A 2YNGA 4IKFA 2FBTA 2GV9A 4LD0A 5J39A 3V81A 3SV4A 3HP9A 3MXJA 5SWMA 3P8HA 4E7IA 4DU4A 4LSNA 4KB1A 3ZEHA 1LAVA 2B5JA 3C6TA 2RJCA 4OPKA 3NTKA 4IUVA 1RBSA 3C6UA 3VQAA 4KHQA 4N76A 1WJQA 1WSHA 3BGRA 3SQ4A 1KVAA 4FVMA 5HP1A 3NF7A 4DLGA 1C0TA 4CGIA 3S6WA 3META 2OYQA 3M8QA 1JLQA 1UA1A 3HPGA 2YKMA 4CHQA 3ASMA 4YNQA 1UAXA 5HRSA 4LY7A 2HVIA 1RT5A 4FJJA 3V1RA 3ZT4A 2E5QA 1HYVA 3ZT2A 4CFCA 1U47A 4O55A 2HNDA 4F2RA 1LWFA 4FJIA 3NH1A 2KTQA 4DF8A 1RT1A 4B08A 3ISNC 2FBXA 4CHYA 4DSFA 3DLMA 3Q1JA 1JL1A 1VSKA 2OPPA 4DU3A 2A1RA 1NK4A 3K59A 2RJEA 2EQKA 3LP0A 3VA0A 3DLGA 4NCBA 1VSFA 4PUOA 3S3NA 4W5QA 4FJHA 2R57A 4I9QA 1NJWA 1OYXA 4CGJA 2IDOA 3RMBA 1UA0A 1WNSA 4Q5VA 3I8DA 2QKBA 3K5NA 3G0ZA 1QE1A 4CJRA 1B9FA 4CJUA 1BISA 3HT3A 3OMGA 4FZZA 2ZE2A 3AO2A 3QEWA 4H4OA 4RW9A 5CYMA 1CXQA 1RT7A 4CJQA 3VQ9A 2RPIA 1NK6A 4DQRA 3LP3A 3QETA 4NCGA 4KPYA 3QINA 1WSEA 3DLKA 4OGEA 4CJFA 5KTQA 2IG0A 2JGUA 5I42A 1LV5A 5KGXA 2OA8A 4PWDA 3ME9A 4O4GA 1BGXT 1LAWA 3EYZA 1QSSA 3HPOA 3H08A 3LP1A 1NOYA 2HHQA 2GFAA 3BDLA 1YTUA 2LDMA 3SUNA 4I9LA 4Z4EA 2JTFA 2ATQA 1IKXA 2RHUA 1VSIA 2AJQA 2E6LA 3QO9A 1KLMA 3PY8A 4KAZA 3DOLA 1L3SA 1T7PA 5JS2A 5J2MA 3SQ0A 4ZHRA 3RRGA 4CJ5A 2QKKA 4Q0BA 2Z1HA 2BDPA 3O4QA 4R5PA 2K3YA 1KHCA 4QQGA 1NK7A 4FJ7A 4BACA 4DFPA 2G8WA 1S1VA 3QEPA 1U4BA 4O0JA 3AVLA 5C6SA 4E0DA 4HCCA 4BWMA 1LWEA 3TAEA 2P1JA 3LZIA 3QIPA 1BL3A 1RBVA 3UWNA 1XI1A 5KRTA 4C5GA 3FC3A 1G5VA 4GVMA 4NZGA 4IDKA 4CJSA 3V9XA 4RW6A 2KQ2A 1U48A 1NK0A 4O5BA 3QERA 3IRXA 3OY9A 4QW2A 4W5RA 3VN5A 4CF0A 5D6XA 4CF9A 1X9SA 1KSPA 3OJSA 3LWLA 3HYFA 4J2AA 4B9WA 1I39A 3AVFA 3SUOA 1RDCA 3VQ7A 4E1MA 3K5MA 2RHZA 1D5AA 3CEYA 4FJNA 3S9HA 1OZ2A 3KD1E 3KK1A 3OA6A 2F96A 4O0IA 2VG5A 1WSGA 2GBZA 4DTUA 1FKOA 1EX4A 4KI6A 3VQDA 4PQUA 3OYIA 3NGZA 1J53A 5C24A 3V1QA 4CJLA 2R58A 2RHXA 3UT1A 1RNHA 2OPRA 1X9WA 3MP6A 1REVA 4B8CA 3U3YA 3LLRA 4HCBA 3QKJA 4QVZA 1W0HA 3K57A 1R0AA 3IAYA 2HHSA 2X4WA 3H8ZA 1RBRA 2HMIA 1EP4A 2BUDA 2IS3A 1N5YA 1TKZA 5KE3A 3HVRA 4Z4FA 3OYDA 2D0CA 2F8TA 3HO1A 2A1SA 3ASKA 1TKTA 3ZSOA 3SUPA 4QAGA 3QNOA 4B3OA 4CCHA 1TAUA 3OYBA 2R5AA 4BD3A 4FW1A 3ZSZA 5SZTA 3QLHA 4CK3A 1B92A 4Z4GA 4UC4A 1JXBA 1J54A 2EHGA 4DQIA 4DS5A 3TABA 1S9GA 2MWOA 1VRUA 3SJJA 5KE2A 2RI5A 2DFFA 1TVRA 3CYMA 3VQ4A 2G8FA 3PUFA 2LTOA 2QXFA 4G1QA 5CIUA 3OYJA 1QHTA 3JSMA 1WJSA 3ZT1A 3DB3A 4RW4A 4E3SA 4K8ZA 2GF7A 3LAKA 3F70A 4KHYA 4JS4A 3DLHA 4A4EA 3A2FA 3E01A 4OKKA 3OS0A 1IO2A 4AHSA 3JYTA 2XY7A 3SUQA 4DWIA 3V9ZA 2EFIA 4FJKA 4DFMA 3MO8A 1RTHA 4CHPA 2G8VA 4B9NA 2DIGA 4HUEA 4FJLA 2RI2A 4IUUA 5CZ1A 4DU1A 4HUFA 4J2BA 4F3TA 4FXDA 1SSFA 2QK9A 1HNIA 1IKVA 1JLEA 3ZSQA 5KH6A 4HVJA 4II1A 1C0UA 2FC0A 3O3FA 4HTUA 3TAPA 1VSLA 3O4NA 4ELUA 4TSXA 3L2UA 3OJUA 4DTOA 5C0MA 2G8UA 4LH5A 4J2DA 4PY5A 1HNVA 4OPJA 1SL2A 2IC3A 4PL6A 2B6AA 4E7KA 3FFIA 4DSEA 3QEVA 1XNIA 3OYCA 2O4XA 1VK0A 5D3GA 2O4GA 2VWKA 3TI0A 1KVCA 1TL3A 3OYNA 3TR8A 3VQPA 3C4SA 1KFSA 4I7FA 2B4JA 1RDBA 4FM1A 4DFJA 1KCFA 4OGCA 4FJMA 1QS4A 1G15A 3DI6A 3KIOA 3DLBA 3EAEA 2G8IA 1J5OA 1U49A 2HB5A 4EZ6A 1U04A 3ULDA 5IN1A 3QEIA 2I5JA 2LCCA 4DSIA 4F8RA 1RTDA 1BHLA 3TAGA 1U45A 1N6QA 2YNHA 5J1EA 3LYIA 1MHNA 3HK2A 3NF9A 3NH2A 1T05A 1L3VA 4FYDA 4C5HA 2IOCA 2DFHA 2L89A 3AVIA 2QQRA 4Q5WA 2Z1IA 2G8HA 4FLUA 3OMCA 5J26A 4BDYA 5CZ2A 2WONA 3KD5E 5FROA 1RBTA 2VG7A 3RRHA 2ITGA 3L8BA 1EKEA 3HXMA 1TK0A 3LPTA 1NOZA 1F21A 1EETA 3DRSA 3HPHA 4KO0A 3TANA 3THVA 4B9MA 4J2EA 1WJRA 2KZZA 3AVNA 3AVGA 1A5XA 2Q3SA 1T03A 1HRHA 2OPSA 4W5TA 2LSNA 2BIVA 2EKOA 1TK5A 4CK1A 3WNHA 3P8DA 4CJTA 3V4IA 4C8KA 1CZ9A 4CFDA 3CFPA 2LRQA 3SD4A 1GOAA 1YT3A 2X6SA 3AVKA 3SQ2A 1JKHA 2P5GA 4ELVA 1ASUA 4DMNA 4CRIA 1TGOA 4IFYA 4KKOA 3IS9A 4B8AB 5M9OA 3ZSWA 1S1UA 4CEBA 1SL0A 2L8DA 3U3GA 4KTQA 3MEVA 1BIUA 2M1HA 1L3UA 3QIIA 4M42A 3CM6A 4AH9A 5J2QA 2HQXA 2YRVA 4CEQA 4FLTA 3SQ1A 1O1WA 3L42A 3D45A 3ZSRA 1BCMA 3HL8A 2PYJA 2IAJA 4DQPA 3AA2A 3OB9A 4CJKA 1IG9A 4FJ8A 4KREA 1SV5A 3OYEA 3AA4A 4CJWA 3MAQA 1HYSA 1ZYQA 3D0PA 1JXEA 3LPUA 3NGIA 4CJPA 2O4XB 1GOBA 3NNQA 1RTJA 3ZSVA 4MFBA 4IFVA 3DYAA 4RG8A 3KKSA 2YNIA 1S5JA 1IH7A 4FJXA 1FXXA 5HLFA 2X78A 5HRRA 3TAFA 3FLGA 4AHUA 2QQSA 5IAYA 4JRQA 1A5WA 2EQJA 1S9EA 1UWBA 1SUQA 4B9TA 4FLVA 4FZXC 1HQUA 3AVCA 4DTJA 4N4IA 4Z4HA 4MQ3A 4OKJA 3K5LA 1IKYA 4BWJA 1RT2A 1TAQA 3HSTB 4CF2A 5CY4A 5K14A 3CFRA 3V9UA 2BGGA 3WNEA 4CEFA 4O44A 2JLEA 1H3ZA 3L3VA 3H6ZA 3OYAA 1WAJA 3ZT0A 3M9QA 4B9LA 2YHAA 4CIFA 4XIUA 4NCAA 5HRPA 3AVBA 4DTPA 3PFSA 3K5OA 3RMAA 5HROA 3SZ2A 4ELTA 2O4IA 3OS2A 4CEDA 2E4LA 5KCOA 4HUGA 1TL1A 3B6PA 3E9GA 2OPQA 1JLGA 4CEZA 4BDPA 4GY5A 1CXUA 5CYQA 2XHBA 4FJ5A 4QOZB 3VQ5A 1RI0A 4H8KA 3F73A 4DQQA 2Y1IA 1X9MA 2X6NA 4IUTA 2Z1GA 1NKCA 1Z26A 1WAFA 4GMJB 4QQ6A 3NHGA 3FDRA 4B9UA 1VRTA 3AO4A 2FHDA 4Y1CA 5KI6A 2D5RA 4A4HA 4OLBA 2KZMA 3PX6A 2NLUA 1RCHA 3KK2A 2D0BA 1ZBIA 1Q8IA 2EX3A 2ZQBA 1DLOA 3VQBA 3LDSA 3TAQA 2DFEA 1Z25A 4AHVA 4FZYA 3NF8A 4IG0A 1XC9A 4ZTFA 4N56A 3SV3A 3QJ6A 3LGLA 4IUPA 3MEUA 3PO4A 4DSJA 4FK0A 1S6PA 3AVHA 1SKWA 3NTIA 1WLJA 4CJVA 1CZBA 1L5UA 1UOCA 4EP4A 3NE6A 1WSJA 4M3TA 4C5EA 3EZ5A 2X74A 1RDDA 2ETJA 4M3RA 3FEOA 4B9XA 1WSIA 4AHTA 1D8YA 1WGSA 1NKEA 4FLYA 1D9DA 3IG1A 4CE9A 2VG6A 3MEDA 4CHOA 4N4GA 3SYZA 3F9KA 1NKBA 3LH0A 3HP6A 3DB4A 1ZBFA 2GUIA 3OYKA 1TKDA 2RKIA 4F2SA 4X34A 2EQMA 3E9FA 5KCHA 4HCZA 3SI6A 3AVAA 3KLGA 3T19A 4W5OA 2XK0A 3NDKA 2D0AA 3V9SA 1HQEA 4CHZA 5J2NA 3NGYA 4DTNA 1RBUA 4M41A 3M8PA 4AHCA 3DM2A 4BDZA 4E7JA 1ASWA 2KFZA 1EXQA 1XHXA 2YNFA 3DLEA 3GOXA 3AVMA 1QSYA 1HJRA 4RG2A 1YVUA 2YKNA 1S1TA 4CGFA 1S1XA 3CQ8A 3C94A 4KFBA 1HPZA 1BI4B 4DLEA 1WN7A 4KI4A 3QEXA 3V6DA 1A5VA 2R7YA 2EQUA 3L3UA 3LALA 1NJZA 1DTTA 1NK5A 4E7LA 3BDPA 3UIQA 2HNZA 4CEOA 1S6QA 4DTRA 1RDAA 5FDLA 1XWLA 3M8SA 4JRPA 3LWMA 3V9WA 4B9SA 2HNYA 3VQ8A 2K3XA 4KHSA 3RR8A 3HJFA 2RJFA 2E6MA 4PLLA 5FRNA 2RI3A 1FK9A 3AV9A 3MXIA 2XO7A 3NAEA 5KGWA 2G8KA 1B9DA 4W5NA 3DMJA 3AO5A 2X4XA 4CJEA 3RTVA 1YTAA 5DMRA 4EZ9A 3AVJA 4B9VA 1FKPA 2KFNA 4AILC 2PYLA 5KRSA 3OYFA 4A4FA 1ZBLA 1BIZA 4KTZA 3O8VA 4IUQA 3NFAA 2CKKA 3HVTA 4CFAA 4FLWA 4IURA 3L2WA 1JLBA 1W9HA 1QQCA 1RT6A 4PA1A 4Y1DA 3VQ6A 3QESA 1Q9XA 3LGFA 3OYGA 1BQNA 3O3GA 3LZJA 4M3UA 1C0MA 1NJXA 4YFUA 5JS1A 2DAQA 3MEAA 3LX7A 4OLAA 3S3MA 2ZD1A 4FU6A 4ID1A 4N47A 4CECA 3CFOA 1DTQA 4DTMA 5I3UA 3V1OA 3HM9A 4DTXA 3TARA 2HQEA 2GFUA 1J9AA 1LW2A 4ICLA 4L59A 4NS5A 4WE1A 4Z4CA 3KLHA 4DTSA 1HMVA 4C8NA 4CGDA 2HVHA 4QCLA 1TV6A 5J2PA 1IKWA 1RILA 1JL2A 4ZTJA 3VQEA 1NK8A 4DSKA 3AO3A 2LVMA 1RT3A 4RW8A 3KLIA 3RWUA 4FK4A 3C95A 4KHUA 3KK3A 4F3OA 1CLQA 1K6YA 3OQ5A 3DRPA 4CJ4A 1MU2A 1ITGA 4KTWA 1C1AA 1C1BA 1VSHA 3QNNA 2F8SA 4CF1A 4KRFA 1JLCA 2D9TA 4RW7A 4DQSA
chains in the Genus database with same CATH superfamily
2Z33A 2H6BA 3HRUA 3PIOF 2DI3A 1I94K 1V1CA 1KU9A 2DXCA 3FJ5A 3TSZA 3CP8A 1HW1A 4P1WA 3MEEA 3BR2A 1N3CA 4ZGEB 5IP7J 2KW4A 4L0YB 2WUSA 2GXGA 2G3RA 2J6KA 4FWRA 1R00A 1YHQQ 1V4RA 1X1PA 2MSYA 4JS5A 1QBJA 2RV8A 4DB3A 1UJ8A 2RN2A 1Y96B 3VS2A 1NK9A 1UECA 2ZXIA 1VQPQ 2Q2EB 3WNGA 2MW8A 2BKDN 1I0CA 1X3MA 3LA2A 1YJ9N 4RMOA 2HHVA 2GNCA 4YOWA 5JVTA 4JI8K 5E3LA 2H94A 2XHCA 2DK8A 1OPKA 4NYFA 3BF3A 3JAMK 3J7AO 1FLIA 1UB4A 3EKSA 1FBSA 5IY5H 1BIAA 2JT1A 2WAEA 3NF6A 3CCSA 2MPXC 4FT2A 3U4LA 5DUIA 2EGAA 3NGPA 1K8AU 1VQLN 1YUWA 4M7AA 4O8KA 4JKHA 2K9NA 4CJ3A 4E89A 2JJ9A 3X2QH 1NJYA 2FMYA 2ELHA 2M45A 1JLAA 3FHGA 1LW0A 2W00A 3M0RA 1VYTA 1K76A 3U6FA 5EZGA 2DE0X 4OVLA 2RF2A 3AG2H 3Q0UA 1E4FT 1FTTA 4JAXA 1Y1VJ 3P8HA 1VQ4I 4IUVA 1XOVA 2BBYA 3JRDA 2BY3A 3ML6A 4LUEA 3ZP5A 2R7XA 3NF7A 2CT3A 1K73U 4FX0A 2OYQA 4A6EA 4NO7A 2JA8J 2LY2A 2IPQX 2JQ7A 4F2RA 2V4JC 2KJBA 3FXLA 2VE8A 4G6DA 2RQRA 1VQ8T 1NK4A 4PUOA 4CZJA 1OYWA 2WTEA 3RMBA 4CC2A 4KBOA 3K5NA 2BH1A 4LB5A 1BISA 2CZ6B 5GIOA 4M75D 1M30A 1A04A 3C2HA 4II3A 3A8YA 2LVSA 2IGMA 1H8AC 1VQ6N 4BY1J 2ABLA 3EE8A 1FX7A 2E6LA 4XOPA 1L3SA 1DGWY 3U1DA 4ISFA 1R5GA 4Q0BA 1JUMA 5H6RA 4KGZB 4BY6B 2BDPA 3S2DJ 3EUKL 1YFNA 1U4BA 3DLAA 3CCVN 3JB9D 4DV3K 4H0PA 3O9SA 4NZGA 5IOZA 4A4KA 3QJYA 4O5BA 3RSNA 1WFXA 3CUQA 1M8VA 5D6XA 4DOVA 1JCFA 4KH5A 3IRQA 3AG3H 2E64A 5GANh 4OFAA 5BPMA 4Q5SF 2N8GA 2VG5A 3E3VA 3ZGKA 2VC8A 2RHXA 1WUAA 3H9QA 3U3YA 4L5JA 4OIQF 4Y33A 3K4CA 2OBPA 1WGXA 4FE7A 5JS1A 2X9DA 1CGPA 4CK3A 4ZGDB 3JCMf 3PUBA 2L5QA 4C2MJ 4ETSA 3I33A 3OYJA 1IGNA 2HOEA 3DTKA 4ITVA 2NOLA 1UGRB 4A4EA 4DWIA 1WXUA 2DOAA 1BC8C 3PTAA 2GAUA 2COZA 3EPZA 3ZSQA 3CCMQ 5BOXA 4EATA 4ELUA 4CC4B 1C0WA 2I7PA 1GDTA 4JKCA 4XKVA 3C4SA 4DBQA 4BYYA 3DLBA 3B02A 3BZKA 2C06A 2A6TA 1KQJA 2IVNA 1J5OA 1YIJQ 2K9LA 2LG4A 4XICA 3J7ZO 4DSIA 2H3JA 2HPMA 3LYIA 4IHTA 5D8LB 5IHKA 4FLUA 3SQNA 1LPLA 3EH1A 1JHHA 1I07A 2X1DA 3HPHA 4BG8A 1M1KO 2BHYA 1HRHA 1D5VA 2LSNA 3V4IA 2A7YA 3CFPA 1GOAA 1NPPA 2QUFA 1ASUA 2CG4A 1YX3A 4RM2A 1H0MA 4CEBA 3JB9I 3I56T 2L8DA 4CCJA 3CM6A 3T5XA 1IG7A 1KQ1A 2KHOA 3AA2A 3ENHA 3MAQA 4GLMA 2GOMA 2XF6A 5A0DA 4IFVA 2NOHA 2F2XA 1FXXA 1ERDA 2GQQA 3F5TA 1AKHB 2G0EA 2X4HA 1RT2A 2GXBA 3CC2I 1U1TA 3DTIA 4XTXA 3L00A 4XTWA 3ULEB 3OYAA 3ZT0A 1SD7A 3I0TA 2LFBA 3PFSA 1SD6A 3C0BA 1MBGA 4DYCA 2E4LA 4HUGA 2FX0A 4C0ZA 3F8BA 3ZCOA 4J00A 1H92A 4CEZA 1G3SA 1XDUA 2Y1IA 1KA8A 2HXOA 2IGNA 3NHGA 4LIVA 3I5RA 2D5RA 3O4WA 2NLUA 1I6XA 1NGHA 3G71Q 4CZFA 5FU7C 1X1DA 3ZQ7A 4EIAA 2KEAA 4WX9A 2LLKA 4DSJA 1YN8A 2D1XA 1P59A 1YW7A 3NE6A 3N5NX 3KE2A 2QM1A 2KROA 4Z89A 1RADB 1QWEA 1YFHA 3M57A 3CWTA 5ILUA 1FP1D 4M3GA 1VQ7A 1X2NA 2KT0A 6AT1B 2DLLA 4O3MA 4RG2A 4DHYA 1R58A 2IVMA 3KEOA 4DLEA 2P9KB 4J9CA 3L3UA 1LB2A 1JUPA 1OYYA 2FRYA 4KT0E 5C0YA 2Y0SA 3ZOBA 5FRNA 1PVSA 3ABTA 3RTVA 4XAXB 3GNGA 2ZB9A 1AOYA 1BIZA 2STWA 3OW2S 4B3AA 4FLWA 1YP5A 1N9RA 3ECHA 3OYGA 3L09A 3D5SC 4DYQA 3SWNC 3HSCA 4OLAA 2YLBA 4DTMA 2DU9A 1SZ2A 3DPTA 2L0KA 3FKIJ 3D7SB 4L5GA 2J4RA 2FSNA 1HKBA 1JKQC 4MGRA 1RILA 2JTEA 3CCLQ 4NC7A 3D5RC 2MYSA 2R7OA 3ZBDA 1K6YA 3PIPF 4X1VA 1WX6A 3FGUA 3TMOA 2DA3A 4NHJA 2HYGD 4FYXB 3L4IA 3J81Z 1VQPA 1GOCA 3CF5L 4LC9B 2KPMA 2IRFG 4H4MA 3RKYA 1SRLA 2EFWA 3DP7A 2QA4I 2Q2EA 2CH5A 3OYLA 4C2UA 3PMIA 1EWQA 3ZSYA 2L4AA 3HFNA 3RCOA 4AHRA 1MBFA 3CBOA 4F04B 4XEIA 1O3TA 4ZDPA 1AVZC 2YR2A 5F6FA 4JNEA 1M3CA 2K2VA 2PTKA 1R1UA 2LTPA 3TDUC 1H1VA 1U2WA 2NRRA 4M7AB 1V76A 3FF5A 2RHIA 2VQEK 4F4KA 3PQJA 3QPTA 2K3BA 1YHQA 4LNPA 3SCXA 2CZ1B 3ABKH 3WODF 1GHCA 2ZFWA 1XNRK 3G4SQ 3EYYA 1FN7A 3LA7A 3SPYA 1RTIA 3KUFA 1NG6A 2DBKA 2MD0A 2CV0A 3EUAA 2EILH 3Q9SA 3W2VA 3ZR8X 4LGWA 2RM4A 1QNTA 2QXLA 2M51A 1PP7U 5IT9K 1VQ4A 1BI4A 4XBFA 2BY1A 4IG3A 2FBTA 3SV4A 2HQHA 3H36A 5KN8A 4C8QF 1VQNQ 3CCYA 2XI9A 3VQAA 2HYJA 5HS8A 2VYPA 1M90R 1JT0A 3KLNA 5JMVA 3QOPA 3CVTA 3AL0C 2W1OA 3MWTA 5KPRA 2FYKA 2KDSA 3WHCA 2MGQA 4CFCA 2DD4A 2NRZA 4CHYA 4BQAA 1VSKA 2A1RA 5DTDA 2HHHK 3CCUQ 2WAQA 1E3HA 2LCLA 1VNDA 1UMQA 2R7UA 2GTJA 2AXTC 1B9FA 3OMGA 1W36D 4BR7A 1SANA 5FB2A 2RQPA 1CZAN 4PWDA 2QG9B 5M1PA 3GYHX 4PJNA 2P6SA 2Q31A 4X64K 2DL4A 2OPTA 1IKXA 4M7AC 4D1QA 3AT1B 4ZHRA 3ID8A 2QKKA 4DCHA 4LG3A 4R5PA 1NK7A 4JLIA 2FE3A 4BACA 1JO8A 3QEPA 4KJZA 1JJ8C 3AVLA 4O0JA 1EV7A 3C12A 1TH7A 2ELJA 4LJZF 2IXSA 4OPAA 5KRTA 3V9XA 3G71T 3QRFF 2EV5A 4CF9A 3K0LA 1D5AA 5C3EJ 4PFZA 3S9HA 4IZZA 2EW3A 4FWOA 2GBZA 1J59A 2WBNA 2HZDA 1I27A 1HDDC 3NGZA 1N8RO 1FIAA 1X9WA 2EB7A 1UZCA 5K1YA 2DK5A 1R0BG 1NM7A 1WCMJ 4C30A 3TSQA 2A1SA 2FBIA 2HKQB 1WRJA 3K4LA 2CW8A 3TABA 2RI5A 3FMSA 5KE2A 1X1AA 3U9ZA 2E12A 2QXFA 4PSXA 1VQ9A 3DXKA 3E01A 2XRLA 2UYTA 2EFIA 4FJKA 1S72T 3T8TA 2DX1A 4XRSA 1VQKA 4BY9C 1B34A 3M1FA 4E9GA 2HKXA 1ZGWA 1C0FA 3DU6A 5K7FA 3GLXA 1LJ9A 5EGOA 2BZXA 2M7BA 3FFIA 2IA2A 2O4GA 3GIBA 3ZRGA 2LY1A 1ZA2B 5C15A 3K1NA 1IF1A 2NRVA 1Y64A 3HI0A 3HKSA 2CP3A 1GV5A 2YPRA 1UGPB 1BKBA 2ID3A 2EZIA 1P4WA 2NRXA 2NUZA 2ITGA 2ZO4A 1I5LA 4M7DB 1MGTA 3EZWA 3CCET 3AVGA 4DBRA 2OPSA 4LFBK 4A2BA 2EZKA 2LBFA 2EKOA 3WNHA 4ASNA 1BG3A 4RCBA 2JVHA 2ACJA 1V55H 3VKIA 3A8LB 1ZSZB 4L3QA 1P4AA 5FU7B 1E6GA 3A5LC 4YELA 4GDFA 2PYJA 4DQPA 3OB9A 3RQIA 1K73C 2L4MA 3DPUA 3PIPA 3VV0A 1IH7A 5HLHA 4A5MA 4F14A 2E2IJ 3FLGA 4AM3A 4JKGB 4FLVA 4AU7A 4Z4HA 2PUOB 4CF2A 3IP4B 5CVJA 3V9UA 3WNEA 4O44A 3KCCA 3H6ZA 5AQRA 2YHAA 4XIUA 3AVBA 4O5VA 2EFNA 3OS2A 1WEGA 3M1EA 4RTWA 1YJWI 5CO7A 1TUUA 2FBHA 4Q48A 2Z1GA 3BE3A 3AO4A 2DBMA 2ZQBA 2IIMA 2DFEA 1N6AA 3NF8A 3MVPA 4H0EA 4J6YA 4LUDA 4CBXA 1YI2A 1WLJA 5EG0B 1L5UA 1UOCA 4RCCA 3EZ5A 3KP2A 2HPIA 3EFOA 2ZJPF 1VQNN 3OYKA 3EG1A 3E9FA 4HCZA 4WQ4C 2VQCA 3CCMT 2NVXJ 1C6VX 5A2QE 3J81O 4XH4A 2HBJA 2EWSA 2RF0A 4DUYK 3CQYA 4PJOD 2P9UB 4KFBA 2NOBA 2ZAEA 1HPZA 2GBQA 2CW0F 2E41A 3AGKA 3VYGA 3GBGA 4ON0A 3M1CA 2CGJA 3MXIA 3S15J 4KT5C 5CYVA 3AO5A 1ORPA 4ENNA 2QTVA 1T38A 4IURA 1QQCA 1X9JA 4ESBA 1MNMC 3G25A 2E5KA 2PI0A 1NJXA 2KR3A 3VS0A 4N47A 1BO5O 3GTJJ 3K7AJ 2W03A 3V1OA 2CREA 4DTXA 4B3RK 3M0UA 2JOYA 2GFUA 1LW2A 2KLAA 2EH3A 1GT0C 2LT4A 2D8HA 2DFUA 4XTUA 2LVMA 2M5WA 5IHIA 3RYRA 4C2TA 4RW8A 4Z94A 5HOOA 3C95A 4NOYA 3H1CA 4F52A 1YHQT 5FFZA 1MU2A 1K73O 3RESA 1V5FA 3CJQB 2O8XA 3CC2N 4B22A 3LWFA 2DTUA 4BRPA 3UKUB 4CFBA 5BRFA 2P51A 2V26A 3PE0A 1TQPA 1D9FA 3VA0A 3L2VA 4FK0A 1KG7A 4HTLA 1X69A 2R7FA 1MD0A 1T0JA 3MXMA 3VSKA 2R5YB 1HKTA 2XRNA 1VSEA 5M1FA 4A4GA 5AQJA 4XK8E 4HDUA 4OFEA 4RTVA 1IRXA 4OVAA 3I0RA 3AG1H 1TK8A 2JRMA 4PK4A 2OZSA 3OVNA 2YX7A 2RA2A 1ZBUA 2BEOA 3IAM2 1NJIO 3GPLA 3HHHA 3K58A 4YFKF 1M90C 2A5YB 3HYIA 2VKVA 4JI4K 3MCPA 1DU0A 1EO1A 2HBLA 1IC8A 1KYZA 2RGVA 5AQMA 3THKA 1NU0A 4B1YB 5FKNA 4OKEA 4MZTA 1U9NA 3OYYA 1KK7A 3PV8A 3CCRQ 2V6CA 2BTFA 1YIJT 4M3XA 3ELKA 2ZF5O 1HKGA 3HBTA 1BR1A 2R7ZJ 5HDNA 3S8PA 4KH4A 3N97A 4CZCA 2IIRA 1RBSA 2LJ1A 3MKDA 1K6OA 4DLGA 1VQ6I 3KWGA 1UA1A 1X75C 1O3SA 4BY7J 1A0NB 2F5DA 1DUXC 2LQKA 3IHUA 5KYWB 3Q1JA 2Y48A 2P9NA 4NCBA 1UA0A 3I8DA 2QKBA 1QE1A 2ID6A 1S3XA 5DM7F 2LT1A 2RC4A 1NK6A 2M8EA 2OTLN 5KTQA 4LB6B 3F3XA 1KC8U 2ROLA 1QSSA 1YTUA 2OTJI 3GNFB 3ENOA 4E1JA 1XGNA 4BHBA 3WTSC 2YS9A 1FWZA 5FFXA 1K8KA 1WFWA 3D5LA 2LZ6B 5ERIA 1HYOA 1KONA 2CGKA 3ABUA 2TDXA 3FC3A 1NK0A 1FJGK 1GCPA 2IAIA 4QW2A 3U2RA 5FLVA 2CQXA 1VZ0A 5FD6A 2E2PA 3KK1A 1P7JA 1EX4A 2LJ0A 4DIQA 1I8FA 2GCXA 1K61A 3I59A 1YITA 3C7JA 3R61A 1ZUKA 3HJEA 3GTGJ 3CCEN 3CJAA 3E6MA 2JWTA 2MLKA 5E8IA 3QYFA 2FEIA 2DQLA 1KD1R 2V1DA 3CYMA 4H0VB 1NEGA 5GANg 3IMXA 1WJSA 2GIZA 5J8CA 1I1JA 3JYTA 2K40A 1U5TC 2LRDA 1YJ9I 4IVNA 3PJRA 3SUQA 2HEQA 1YI2T 2GOXB 3J80Z 4Y17A 4IX7A 4A0YA 4HVJA 4DGWB 3A0HC 1VQLQ 5C0MA 4OPJA 3VEOA 2AO9A 2GGRA 1UHWA 3I53A 4FOEA 3SZGA 4YIFA 2QBYB 4JI1K 2B4JA 1KCFA 2XSJC 1SAXA 1MW7A 2CZ0B 2I5JA 1U45A 4RTUA 5AQGA 3NH2A 1T05A 4OMPA 2RMOA 4X9DA 4BI3A 4CCLA 1KG3A 4AG2C 4HQEA 4BDYA 1IN7A 2CU7A 5ILVA 1EKEA 4FWPA 1TK0A 4B9MA 3AVNA 1SSHA 2JS0A 1RRJA 4E9EA 3LMMA 2KFDA 2LX9A 3FM3A 3EG9B 3I35A 5J1RA 2X6SA 3GXOA 1D8JA 2RREA 3CPWA 3ZMSA 5GAOq 4CGZA 2O8EB 1A6QA 3HZ6A 3SAGA 4CJWA 3OTOK 3DQVC 2A6HF 5IHNA 1DIZA 5FLXO 1MUDA 1FMKA 3CCEA 5GAEP 3FXOA 2P9SB 4FJXA 3JCMJ 3QICA 3CMAA 2DEQA 2BGGA 1HCRA 4CEFA 2K7AA 3ZQCA 1RRSA 1XG1A 3O6BB 1SEMA 1TNSA 2P84A 5KCOA 2HOAA 5A0LA 5BREA 2QDYB 5KCMA 4QOZB 3VQ5A 1X9MA 1J0RA 5KI6A 1QVGM 2KZMA 2XKOC 4N0AC 4XKCA 1K7AA 2ZGZA 4IG0A 1B8IA 2QA4T 1TTHB 1TWHJ 5I22A 3QJ6A 4IUPA 2KE9A 3K4NA 4EMKA 1OU8A 3WEEB 1QW1A 3I0WA 3GTKJ 4PCQA 2JUFA 1VQ8A 4XLNF 1P7MA 2QA4A 3LH0A 2JNGA 1TKDA 2FBKA 3T9NA 1UHMA 3QWXX 3RYPA 3AAPA 3Q9VA 1MSFC 1ZHFA 2KRNA 3HSEA 1XHXA 4EJWA 3C7NB 3CC7I 1ZAOA 1WN7A 1RFQA 4DEYA 3MMVA 4CICA 1S6QA 1P7IA 3P9IA 1RDAA 3M0TA 1ETOA 4LF4K 1QVFP 3JCUC 2JM8A 2ZGWA 4G6QA 5FWCA 2G6FX 5HLGA 1YTAA 2OA4A 3N5BB 3V8JA 4AILC 5KRSA 2DERA 3W6JB 1IDZA 5LEKA 1HW5A 1BQNA 2JT4A 1TSFA 4JQFA 4YFXF 5GAMd 1OCRH 3JCMc 1QZ5A 4AG1C 1VFCA 3A1YA 5L3EA 1S9HA 1TV6A 5J2PA 1X3NA 1VA7A 1FC3A 3G71A 5AQZA 4FK4A 4KHUA 4DR6K 4OIRF 1ACMB 2DRKA 1C1BA 5EX5A 2IVWA 2WTUA 2HSTA 4RW7A 5LJ5g 3OYMA 1AU7A 1OZ3A 3BG3A 4BG9A 1YOVB 1XSXA 2ZFUA 4M75A 1LWCA 4FWMA 3CDIA 3PO2J 3NTHA 2F4MB 3HTRA 3CMET 3FK6A 1WSUA 1YJNA 2DF6A 3KZBA 4E7HA 1NGCA 5C10A 1VQMN 3ZETB 1S29A 4EDUA 1IN6A 4O6JA 2MWPA 2CP6A 2Z1JA 1R0CB 1VQNT 1EQYA 4JHDA 4E7SA 2R93J 2ZPIB 4DV4K 1QQMA 2KXDA 1W2BS 4OPHA 3T7ZA 4IHXA 4BGAA 1K4US 3TBIA 4M9SA 2M0OA 3WE2A 2JSPA 5A2QK 4FM4B 2L54A 4Z4IA 4D5FA 5EY4A 4L9NA 4ILJA 2LX7A 3MQ0A 3O3HA 1H88C 1AZGB 1KRPA 2A36A 3GE1A 3UE5A 1AHDP 4YEJA 2E6NA 5GAN5 1QZ6A 2NNNA 5HS7A 4RB0A 1BU6O 2DA6A 3I55N 1ON2A 2X4YA 2HD0A 5LJ5j 2CSIA 3PO5A 3ECOA 3I64A 5J1UA 4EVIA 3E0JB 2XY5A 1JUSA 4M78G 2GA1A 1D1BA 2FBYA 3O9UA 2XICA 4JK9A 3GL1A 4EHUA 4KBMB 4R8HA 3HZJA 5KN9A 4GVEA 3CERA 4AVPA 2M0MA 4KV8A 2KYBA 1BA5A 1REPC 1ORNA 2RNJA 3CCLN 3G6EA 1IN4A 3AKZA 1PU8A 2UXCK 1WSHA 2PFBA 3BC8A 3IQLA 5CR4A 1VQLT 3LQRA 2KNBB 2EK5A 2XPWA 1LFPA 2HEOA 3J7AY 2W10A 2VT3A 2MC3A 3WVEB 3JAMO 1Q81R 2UUCK 1UGQB 1RT5A 5B66C 1U0JA 1U47A 2LKPA 2JW4A 1E2XA 1X27A 3LDPA 1A36A 4M7AE 2VPRA 2PZ1A 1WNSA 4Q5VA 2EPFA 3I9QA 1D3BB 3BPVA 5CVUA 4CJQA 3G7ZA 2H3EB 4CJFA 5GMKl 3CCJI 5AN4A 1KG6A 2VBYA 3BZ6A 3ME9A 2O0YA 3A5ZB 5B8HA 2YG8A 1KG2A 4N9HA 3FZMA 2JTFA 2LP0A 2BHZA 4M4ZA 3CCLI 2PX9A 3BPXA 2OI3A 2F1LA 3J80O 4OOIA 4AYBN 2E5ZA 1WJBA 3HOXJ 1H89C 2P1JA 1QP3A 2OUMA 3F22A 1KAXA 2LSOA 8AT1B 3G1MA 4A54A 4PFPA 4WXCA 2FZCB 4DV5K 2Z1DA 2EKHA 2J7IA 2WC2A 3GZ5A 5JLHA 3H3NO 2QYOA 3L9FA 4CC7A 3D4VA 5GAMg 2OPRA 4X65K 1USTA 5LFAA 5IYDJ 3CC7A 1Y6IA 2NNYA 4BEHB 3SBGA 1IZ1A 4A3LJ 2H3GX 3C0CA 2CQNA 2H8HA 2EJGA 2JA7J 3HRSA 4U88A 1B6AA 2YUQA 3OYBA 1OKJA 4EJZA 2EQIA 1W97L 3GP8A 2MWOA 1YQRA 2MH2A 3FZFA 4LK1F 4LOCA 1B07A 3ZT1A 1RAHB 4JS4A 3Q3SA 4OKKA 2Q36A 4CHPA 1RTHA 1YITQ 3M54A 2BUPA 1LVKA 1WHGA 1LFUP 1XQPA 4HT8A 1PDNC 1HNWK 3S32A 3GMEA 1G3TA 4A0ZA 3CPFA 3ESWB 5IXBA 2P5VA 5DYMA 3MEXA 3HTSB 4KN7X 1MBHA 2W84A 1KC8R 2EIFA 4KYWA 1VQ5I 1HKQA 3I55A 4JKFA 4RCHA 2QSHX 1B3QA 4PNOA 1RTDA 4E9HA 3DBLB 1LWWA 1PKSA 3CQZJ 1ZGJA 3QZ5B 2E70A 3SMPA 4A63B 1OCPA 2PLYA 4CCOA 4JI0K 1E3PA 1HNXK 1MUNA 4KKOA 4MO4A 2P4WA 4XN3A 5GANj 4QLCU 1HBXG 1X1CA 3OYEA 3VWBA 4M72A 1JXEA 3D0PA 4CD1A 2DA4A 1TLHB 2V1UA 1VOMA 4ZYHA 2YNIA 5GAHJ 2QQSA 2EQJA 2I10A 4PSWA 4BUPA 1SUQA 2DDAA 4OKJA 2Y2ZA 4H0XB 4Z6YA 2OZ6A 4KUDK 4DV7K 4DUZK 4HPQA 1X1BA 1AHJB 1CXUA 3FHNA 4MZPA 2EV6A 3CCQT 1NGGA 4X1EA 4A4HA 1BW6A 3A8OB 2OX7A 2GLOA 1ZBIA 3G6EI 1Z25A 4ANJA 3I4MJ 5I2MA 2DT6A 3FBIB 3FEOA 1ESVA 4IHYA 1TL8A 4CE9A 4CHOA 3MN5A 3DB4A 2W0ZA 2YLCA 1OQYA 3T19A 1E3MA 2UXXA 4ABZA 3GWZA 3AVMA 3FK7A 5KYUA 1QSYA 1DDNA 1TYQA 3P39A 2LC4A 5FLXK 2CUEA 3K4KA 1NK5A 4DTRA 2QWQA 4H5VA 3HJFA 5CPRB 2XO7A 1F43A 4J5YA 2EYZA 2JPSA 3HGYA 3CC2T 4M73A 1UUEA 1DP7P 1RT6A 1Z7LA 3THXB 5LJ5h 3SK3A 1C0MA 1LNWA 4FU6A 3CCQA 4U7DA 5K7HA 2NRAC 2NOZA 1J9IA 3BTLA 3G4SA 2P9NB 4KGXB 1P92A 4ESRA 5E79C 3T69A 4F91B 2E6ZA 5GAMj 2HU9A 4XONA 1RNLA 4CH7A 5K7ZA 3TCJA 1NGBA 2JTMA 1F5TA 1JLCA 1QRYA 2HQ5A 4CCKA 4ZZDA 1QHHD 2JVVA 1KQSM 3RPUA 2P5OA 2FBVA 1YWPA 1YBYA 1PRLC 4XORA 2V1NA 4B1XB 2PQWA 1KVBA 3BTIA 3MP8A 3ULQB 2VBWA 4AFZC 3G4ST 4YPHA 1R5ID 1MNDA 1WEFA 1QSLA 3QG1A 3G10A 2QF7A 2E2QA 4EPCA 3M5AA 1M4ZA 1YJNI 3E66A 2XDDA 3MX5A 2XAUA 4C8QG 4BY6C 3CC2A 3BQYA 4IRIA 3M55A 1BL0A 3CP2A 2BZ8A 4G8XA 4JLHA 3LAMA 2L0AA 3MKWB 1RAGB 2DMUA 2ZPHB 1GBRA 1HX1A 4A5BA 4QQDA 3QBXA 3FB9A 2KAFA 1MGQA 4QKUA 2D45A 3VRZA 2V8KA 3TO7A 3FHFA 3QBYA 3CJ1A 5FLMJ 2NVUB 3LL7A 1YX5A 1LAVA 3DXMA 5JICA 4CZKA 4I0AA 5ICFA 1GFDA 2OTLA 2Y90A 1X6BA 5C4JJ 2HWVA 2KIUA 1O3QA 4QVCA 3O9TA 5DCFA 2VXFA 3ZT4A 1RI9A 2KTQA 5HKCA 4B08A 2JUGA 4WK8F 4DU3A 4LDYA 3NVKA 4CGJA 3A1PA 2DXIA 2HKNA 4PJOF 4UV9A 1NWKA 2AKLA 4CJUA 4AI5A 3AO2A 4M7YA 2QSFX 1NNEA 3BCBA 3OOPA 4RGRA 4KPYA 2GWJA 3ZN1A 2DVEA 5KGXA 2PAVA 4EJTA 1OR7C 4A3GJ 2GFAA 4GBQA 2RHUA 1VSIA 1H3HA 5EG0A 3Q0VA 2P9IB 2ECBA 2JS2A 1X3UA 2ASMA 4M7DA 2PG4A 2E5LK 3E1SA 1Z6TA 5A0GA 1DEJA 1OH5A 2O9SA 4BWMA 2DA1A 2EA2A 4UUSB 4H5NA 4FWSA 1VQKN 5LHHA 1XGMA 1Z05A 2M4KA 1W2BP 3H3VK 1ZTRA 3EETA 3K5MA 5EXWA 2RD1A 2ZXJA 1UJYA 2P4TA 4KI6A 3W6VA 5GJVB 2WC9A 5JHUA 4H03B 4V19S 3DLLA 2R58A 2UXNA 3O5ZA 1EBMA 2ME0A 2CZ7B 3C7NA 5F0FA 1KFZA 1N32K 1Z6RA 3ASKA 2QTXA 1TKTA 1AWWA 2FG0A 4XKBA 4BC5A 5KNLA 3G1LA 3I3LA 4RWTA 3HOTA 3V9ZA 2IVOA 2PVOB 3K6GA 2RI2A 4RGUA 5E84A 3CCSI 3VERA 3K4BA 3H9JA 3CMAQ 1JLEA 2MBFA 1YI2I 5CVRA 4PL6A 5M1QA 4Q4ZF 4E7KA 1K1ZA 1VK0A 2ME6A 2XIDA 5J4VA 1BOBA 4OGCA 1Z91A 3KIOA 4C92G 1IV6A 4TV7A 1KQ9A 2BY2A 2KZVA 3ULDA 3CC4T 3H5AA 1ZRCA 2YNHA 1Q95G 3HDDA 2IOCA 1O57A 3SWNB 5FROA 3RRHA 3M8JA 3HXMA 4M78B 3I71A 2KZZA 3X24B 2A0FB 1XQSC 1O75A 1CZ9A 4KIFA 4UVCA 4GLKA 1YT3A 4BRFA 4HF1A 2R7WA 3KP3A 4GYIA 1S1UA 3MEVA 1BIUA 1YITI 4D5CA 1F1BB 3TVTA 3UDCA 2IAJA 3PO3J 3LPUA 3A0IX 3VEYA 1PSFA 1B59A 1QLYA 4MFBA 3MKYB 4MFDA 3UKGA 3TGNA 4BQLA 4CC3A 1JRIA 3KP7A 2JLEA 2K9GA 3ZQGA 4ELTA 1G83A 2WV0A 3FXMA 3RBBB 3WTZA 1JLGA 1BOTO 5L3DA 1NLPC 3DJCA 1AEYA 1WDXA 4A5NA 1RCHA 2F6CA 3E1YA 1N9SA 1Q8IA 1DLOA 1SMYF 3JR9A 3CMEI 2A6AA 1OCCH 1GXQA 1ATNA 1WSIA 1CKBA 1FMVA 3ZQHA 1MJAA 1A6IA 1MBJA 1YW9A 2X85A 1JQQA 1V3FA 1MPGA 4NLCA 5LHGA 1QCFA 1ON1A 2JZYA 4EM0B 3FSPA 4EW0A 4HSBA 2GWKA 1EXQA 4Y13A 2YUOA 2VGMA 2RK2A 1PUFA 1BI0A 2BY0A 4HRIA 3GFMA 3UIQA 4M9XA 4JI3K 4BRMA 2O8CB 3EN9A 4KHSA 2VB6A 1YHQN 3SWNA 5GP9A 5CLSA 3RVCA 2IJLA 4M3FA 3TOBA 1P90A 4CJEA 5DMRA 4BKXA 1IRZA 3AVJA 4DBHA 3G1OA 3QSUA 2FZKB 4CFAA 3WXIA 3FKJA 1D1CA 1UHSA 3LGFA 4S05A 1W0UA 1N33K 2ZNZA 4IQJA 3I5SA 4OMYA 2AKKA 3A0BC 5I3UA 3QWLA 3O08A 3HM9A 1VQOI 1ODDA 3CMEA 4DSKA 2CUFA 2C0IA 1R6RA 3M8FA 3KK3A 2VODA 4YIRX 4JBAA 4XH1A 4CBUA 1ETKA 2Z0WA 2MFZA 5LJ3g 1ZLKA 2K9MA 4MO7A 1YJ9T 4YOXA 2Y4XA 1KIKA 2Z5UA 3S2WA 4J83A 2NRHA 1LQ1A 1TKXA 4HCCA 1OH8A 1OVQA 5E3OA 2M16A 1IG8A 4HNVA 1E0EA 1UELB 1VSDA 4M3WA 2ZPFB 1WJEA 1Y8RB 1GCQA 2HW3A 5EVZA 2Q0UA 1G99A 2C6YA 3BJOA 4KIGA 2M1BA 2XAJA 3ITHA 3WGIA 1YHQI 5K5QA 3RDVA 2ADUA 4YDUA 1BDGA 2JHNA 3FWEA 1LDDA 3CG7A 5CVVA 3H0HA 2XDVA 2WSFE 1PUFB 3M56A 1J2XA 3OW2A 3JCMP 1BQMA 5AQNA 4MHGA 2LNHB 3AA3A 1M9SA 3NCIA 1JBMA 1EH7A 4N4HA 1X2QA 4ZH4F 5BPDA 3LP2A 4CF8A 3JXUA 2DO7A 4HX7A 2EZHA 5HBMA 3DRRA 5FPNA 1D3YA 2E1HA 1M90O 4BVOA 4PJOG 2E4HA 4LG0A 2PMHA 3E5UA 3P38A 2XKOA 2O5RA 1JU5C 1E17A 1G59A 1LNXA 5HP1A 1GL5A 3VUBA 3ERED 5GAOp 2HTJA 1U5TB 1VQ7N 3NHNA 5HRSA 5LHIA 4BROA 3ZT2A 4O55A 4XMYA 2HYFA 5FO5A 4LDVA 1Q86C 4BGDA 2P9UA 1D09B 2R57A 1NJWA 2ESNA 3G0ZA 3KXTA 5ADXA 4R0KA 1MH4A 3LP3A 4U67L 1WSEA 3DLKA 2JXBA 3AAQA 3LDLA 4HVWA 2VXZA 2E1ZA 4A61A 2EA4A 4J6WA 3IKVA 4DV1K 1NK2P 4BH9A 5KYXA 4I99C 2FOWA 3AG4H 3SB2A 2F2VA 4L9VA 3IHOA 3UPUA 3WE3A 2C0TA 1WVRA 1ZSZC 2LD5A 3CCVQ 3ASOH 3M6GA 1MJBA 1G5VA 3I5UA 2KYMA 2JWKA 2OTLQ 4W5RA 1SEUA 3OJSA 3HOZJ 3AVFA 3VQ7A 2RK1A 1AA7A 2LQWA 5JVGF 2XIGA 2VV5A 4O0IA 5JLXA 1NZ9A 1FKOA 1TUDA 1SHGA 4KNYA 4P9UA 1GLCG 2DL3A 3BR3A 4IFEA 4B8CA 1N39A 5HY6A 1VQ7I 5ADXH 3CF5F 5FPEA 5CKTA 4MDAA 3HM5A 1QKWA 1NJIR 1TK5A 5M1NA 2G8FA 3PUFA 1Z9CA 4E3SA 2VPLA 3DB3A 4J7FA 1QHGA 1UAAA 1QQNA 1MV3A 3CHWA 1FYKA 4M3EA 3SFIA 2DIGA 1OLTA 4DR2K 1SSFA 3W0LA 2E60A 4HTUA 4B48A 3O4NA 2VGNA 4DTOA 4OFHA 2L7ZA 2B6AA 5D4RA 3CUOA 1IGQA 2VWKA 5J6XA 4E6RA 3DKMA 1IXRC 4Y28E 1KFSA 3M53A 3GUDA 4DV6K 1X3WB 1YVNA 3JB9H 1Q86O 4BC4A 2W4SA 2VXDA 4C5HA 5LRSA 2QQRA 4OINF 4HVVA 1PYVA 3OMCA 5CZ2A 2WONA 2D0NA 2E2JJ 4ZYAA 1NBEB 3W3DA 1TWBA 3THVA 2GIVA 3KEQA 1W6XA 2DFIA 4GO1A 3IL2A 5A2QO 4HSRA 3AVKA 1WLPB 4J7IA 3K10A 4JLGA 2NWMA 2FJ1A 4KREA 3AA4A 1W4MA 2Y9YA 4IOXA 1QVGP 3EDPA 4HNTA 2WWYA 4XRFA 2X1CA 3RMQA 1I50J 2IS1A 1Z7UA 3CCVA 4B9TA 1XN7A 4M6XA 4FZXC 3G6ET 4DTJA 1DJ7B 4M75G 3MN9A 3CFRA 1ZRDA 4BXXJ 2VCPA 4MLHA 3FXUA 3AAFA 2W25A 2YUNA 4BRQA 1E4GT 1IHVA 2CGHA 5GANf 5KVRA 5CAIA 1Z26A 1R77A 4GMJB 3J8AA 4F7UG 1JXMA 2ZGYA 5LGNA 3JB9F 2YDLA 3CC7T 2EX3A 2ZJQF 2DTZA 5AQKA 1YS7A 4HT9A 3IFRA 2KISA 4EP4A 2ETJA 3SAFA 3K2AA 1U5TA 2QZ8A 2GUIA 2JG6A 2A6EF 4H5WA 3SI6A 2HF3A 4C1NI 4DTNA 4AHCA 1R22A 4M75F 2YJEA 3OSSC 4Z8AA 3C94A 2EBIA 4BI8B 4E7LA 1NJIC 3FJPA 4B9SA 2JA2A 4M78E 1Q86R 3TEEA 2XAHA 5BMZA 4DOZA 1K9MU 4WQ5C 5KYNA 1JKRC 3M4YA 1FKPA 4KIBA 4RAFA 1WPKA 3EG2A 2HI3A 3SFMA 4IUQA 3HTUA 4AT1B 4Y1DA 4B1VA 1NGJA 4C8QD 3JSPA 2ZXWH 1UGSB 4YFUA 2P9LB 1DKGD 2ZD1A 3CFOA 3RERA 1J9AA 3D2FB 1FSEA 2HVHA 4C0GA 1R8OB 1RT3A 1CLQA 4CJ4A 3CWUA 2XF7A 3REAB 1UG2A 4CF1A 1S1NA 2F5FA 3RMDA 2R7VA 3V8KA 4FLXA 4FASD 2CFOA 1QGPA 4E9FA 3NBPA 4J9HA 1XJWB 1VAZA 1M3HA 1VQ6Q 5BQTA 4PKHA 2Y69H 2XAFA 5ILSA 4C5IA 1XSDA 4JRIA 4G6TB 2XRIA 3O1BA 4LH4A 2O9LA 2E19A 1B72A 5EYRA 3HOSA 3AA5X 5J47A 1XHZA 1WZOA 2P5LC 1VQ6T 2Y1JA 2B8AA 3H0FA 3SNNA 2G7UA 2B9SA 3AO1A 2FSWA 2LR8A 3LANA 3VW4A 1SF9A 1NH3A 1ZBHA 2QQ8A 1HK9A 1X2MA 1Y8QB 1FMWA 2YT6A 4NYNA 3C65A 4JI2K 5FKOA 3GFIA 3S41A 2PFUA 4Y7NJ 5DPKA 2MK5A 4B3TK 3HKZN 1MIJA 4FW2A 2JSCA 4HEA2 1TZLA 2H1LA 3KYLA 3NFCA 3ZX2A 4E7IA 4B4CA 1QVFA 2WFBA 2LC2A 1JI8A 3MAJA 3L4QA 3CTAA 1Z21A 1ZSGA 1M2VA 5BPLA 4HW0A 5HNHA 1F1ZA 3K4JA 1I81A 4I76A 3M59A 3E5QA 4DV0K 2M2EA 4BR9A 2QKMB 4F7UE 3LCNA 2LKXA 1TXQA 2FLOA 3QEWA 4RW9A 4KN4X 1N75A 1X3ZB 2NUTB 3KHYA 3QBWA 3MMYB 4FQGA 4EGZA 2E7WA 3R6OA 4MMLA 2L9SA 3HPOA 2VC1A 4M6YA 4DKWA 5IT9Z 4Z4EA 1CSKA 3TO9A 2RHKA 4V2GA 1QVGA 1BJAA 3RRGA 1PRMC 2QWOA 3IRRA 1QPMA 2G8WA 2PVGB 2L02A 5BS6A 4LN2A 1LJOA 4BQZA 2G9WA 5ELZA 4C5GA 3J7AF 3HL2A 1SVMA 1FBQA 3OY9A 1W5CC 4CF0A 4QS9A 3JAMZ 1HDPA 3LWLA 4B9WA 3G6EQ 1DGRM 5C4XJ 5D4SA 2HNIA 4AUXA 1SFOJ 2LDUA 1O7FA 3QQAA 1EF4A 1QWFA 4B3MK 3K57A 2GEMA 2LH9A 2K5FA 3G1JA 1U6ZA 4IZ9A 2AXLA 3LDOA 4Z4FA 2CUJA 5CE3A 4UVBA 4X0GA 4CCHA 3RKWA 4UC4A 5FLXE 1J54A 5A2QZ 1TVRA 2CYZB 2K3FA 1QHTA 5M5WJ 3MJXA 5D6FA 4NUBA 1NKUA 4AHSA 3ZQFA 3OS0A 4GNIA 3R6NA 2VJ5A 2LOOA 4RB2C 2QASA 3BDUA 2E1NA 2FUG2 1ZBJA 4FJLA 4DU1A 4HX4A 2A07F 2LKSA 5KH6A 4EM1A 1QPIA 1X2KA 2WY7Q 2UU9K 2FB7A 4HLYA 4F7ZA 2P81A 3TTFA 1VIEA 3I8BA 3VQPA 2QQAA 4DFJA 3RR6A 1U49A 5AZIB 4RS8A 4BHPA 3A8MB 1KU7A 1PU7A 4Q5WA 4QS8A 1S72Q 2DL7A 1MMGA 2VG7A 2W40A 3HXLA 3QDKA 4A3BJ 4KFCA 1F21A 1FYLA 4KO0A 1NJIU 3GW2A 3H9GA 3M4OJ 2K4BA 5HS9A 2QLZA 2ETHA 5AR0A 3KPHA 3RNJA 4C8KA 2NS8A 1BR4A 2V1QA 1G3WA 1AWXA 2LRQA 3CCMI 1JKHA 1R4MB 2QGUA 4LLLA 3ISPA 4XU2A 4WCIA 2VKEA 5E3NA 2ZSIB 3H3UA 2O4XB 1ETXA 3E9LA 2V7FA 1FW6A 5HRRA 4XLEA 3KFWX 3A5MC 4LLGF 2K3PA 2OCCH 1HQUA 3K5LA 3FM5A 3C1DA 4XNFA 2Q8KA 2CP2A 3TEDA 2O4IA 3WU2C 5HROA 2DMOA 3CMAI 4BDPA 4IPAA 5HNFA 4C23A 3QFUA 3WXLA 3HIFA 4F93B 1XX5A 1X4OA 4ZTFA 3VYHB 4CI0C 4A3IJ 5EGOB 3COAC 1LEBA 3AVHA 2JTVA 5E1XA 3B8AX 3G6EN 4M3RA 2HMAA 3F9KA 5CHZA 2RKIA 5KCHA 2XK0A 5I21A 4LD9K 1OJLA 5E17F 2L9VA 3HFOA 3DXMB 3QB0A 4A0XA 5E26A 1HJRA 1YVUA 4F7UF 3BY5A 3N4MA 3GLLA 4OO1J 1DTTA 2E3HA 1MV0B 1K0XA 1B7TA 1R49A 1BUPA 3VQ8A 1BI3A 2LK2A 3SHWA 3CBMA 2RH2A 3HBLA 3VETA 4YOQA 2AA4A 2DM1A 3LDNA 1EFNA 4K43A 4PA1A 3DFGA 3V4GA 1Q1VA 2FF6A 2Y0MA 4A6DA 3V42A 1VQKI 4BBRJ 2KKZA 2E2OA 2E65A 4ICLA 3KLHA 1OU9A 4Z4CA 4DTSA 5AQUA 4YIIA 4B8XA 2XV4S 1VQLA 4Y4RA 2DA9A 4EA4A 2SEMA 1WQ2A 3Q5FA 4J9GA 2IGIA 4FM2A 2CYYA 3CETA 1R1TA 3VQCA 2EINH 4MDXA 3BF1A 3U8XA 5BPNA 4BRDA 1TQMA 3CPWS 3CCJQ 2VWJA 2XY6A 2KQWA 4JRKA 4OIPF 4HAMA 1FTZA 1ZA1B 3RMCA 1FNNA 5FKKA 4A3EJ 2OFIA 2Z99A 4CGGA 2LJ3A 1AWJA 1BR2A 5IXFA 5AQWA 2CT4A 2OTJA 1SKSA 4JN4A 2R5ZB 1W7PB 4ID5A 2DJZA 2JZ2A 4Y92A 2XU8A 1WH5A 1VQMT 2FRHA 3ZXSA 4K25A 4LSLA 2ELKA 3SMSA 4PKGA 2GA2A 4C8MA 1K8KB 4KB0A 4PZJA 3L2QA 1VQNA 2Q0OA 1KTQA 2DT5A 3F8FA 1VSMA 3SEZA 2D2WA 4M75E 5GAN8 1R9TJ 2JN0A 5D6WA 2E34A 4KHWA 4A93J 2RB6A 1KFDA 3RR7A 1VSJA 2RJDA 1K73R 2HHXA 5IT9O 3EGXA 1QQIA 1XC3A 2PY5A 4F3QA 4BE2A 3P4IA 2QGFB 3R0JA 2HDWA 5M3MJ 1HJOA 2VOOA 3VF4A 4B24A 2QEXT 3MXJA 3SDGA 3CD6I 2P9PB 2MMPA 1VQ6A 1ZLJA 2B5JA 3C6TA 5DD8A 3CCRI 2YRDA 4ORZA 2BTTA 2L3DA 2VLAA 1MKMA 2JN6A 3TOAA 1HSQA 5CCAA 4CGIA 5TGTA 3MHXA 1JLQA 3CZ6A 1W5SA 1Y96A 1YJNN 3WGHA 3ZQQA 3V7SA 4HWIA 2K5LA 5C2FA 1CF7A 2DPPB 4CBWA 4FPBA 2UXBK 4J8OA 4FETA 1POGA 1FOXA 4BBSJ 1IHWA 1Q81O 2UUBK 4AF1A 3ZQLA 3CQXA 3HT3A 2ABKA 2ZKZA 5CYMA 3VQ9A 3QINA 1HJDA 5GAGJ 2LDMA 4RLFA 3SQ0A 2GWRA 2EJ9A 1T6CA 2R7SA 2CGLA 4R79A 3EUHA 5M5YJ 2K3YA 5C6SA 4G94A 4BAYA 4GY2B 3LZIA 2P0WA 1Z3XA 4GVMA 1X6OA 1U48A 3QERA 2H09A 4EJUA 3BR6A 3ONQA 2X48A 1KQ8A 2ZJRL 2L7FP 4MQ9F 4KMUX 4DYRA 2HS5A 1HPMA 5DLOA 4IJNA 3WQTA 2MF2A 4XU3A 3HOVJ 1IV8A 1MDUB 3TU4K 4K2EA 5DDGA 2EBPA 1RBRA 1YRNB 3H8ZA 1VQKT 1EP4A 1XD7A 1SFXA 1LWYA 1LFBA 3SUPA 3URGA 1Y0MA 1B92A 3O8MA 3BG9A 4JPBW 3H41A 4UXNA 1WJFA 4JEPA 5LL6S 4OMFB 3B73A 4Y0WA 4B47A 2G8VA 2E35A 4M6VA 1WJCA 2HDAA 4OWRB 2DXBA 1MNEA 1XMXA 4AD9A 1ZH5A 2ECZA 2P9LA 2GTOA 4AQYK 3VOEA 1EA3A 4CO8A 3H3OB 3O8GA 5AQPA 1TL3A 2KP6A 3CCQN 1UHCA 2PBIA 3I0XA 3TAGA 1N6QA 3E2UA 4FYDA 2L01A 2XKPA 3ENBA 2G8HA 9ATCB 2EIMH 4KHPK 3DRSA 1EETA 3FX3A 3ABMH 4CA0A 5B3SH 5D5VB 3P8DA 3SD4A 5GAHP 5JHFA 3OR2C 5EDNA 3ZSWA 1L3UA 4AIKA 2YRVA 3QYGB 1QZZA 3HL8A 1MUZA 3LSGA 1HYSA 4GKKK 4JYKA 1GOBA 4PGGA 5IPAA 2Y30A 3DKWA 2D0QB 4AVZA 4YRVA 3LSTA 1ETYA 1LDJA 3FR0A 2K9QA 4K11A 1GUUA 1Q86U 2YXYA 3B6AA 3VS5A 1SPKA 3RMAA 3CJ9A 1Q82C 3CCJT 4CCNA 4ZYDA 4A2UA 2XHBA 4IXAA 4J01A 2X6NA 3SBTA 1YITT 3KK2A 3WTUC 4HOBA 1GLFO 2M4GA 1KHIA 1Z1DA 4JX6A 3CDHA 2A61A 4AHVA 2K85A 2XAQA 2EZLA 1S6LA 2O9VA 2P4RA 4YDUC 3QFPA 1E3OC 4FLYA 4AM7A 4JJNK 2VG6A 2FQ4A 3MZ8A 1FOYA 4KUMA 2PQ8A 3W6KB 1FT9A 2DO3A 2VKNA 1L0OC 1TU0B 1Q82O 4CHZA 2CS3A 2OQRA 1XTDA 5KYYA 4MMKA 2W6LA 3SJHA 2TRTA 3F72A 1BBZA 1GV2A 3CJTB 2D4WA 4IO8A 1AWCA 4C8QB 2PMUA 2F4VK 1PSEA 3LWMA 3DBHB 5LJWA 2RJFA 2ED1A 5AFUA 2STTA 4BXUA 1M3QA 4FWKA 1ZXOA 4EZ9A 4ZYEA 3Q7CA 4PJOA 4A4FA 1VQ9I 5BNGA 3OIPA 4OMOA 5KHDA 2QEXQ 4HQMA 2XVCA 1ZREA 3GZ6A 1DTQA 3E7LA 4D8KA 1KQ0A 4LDXA 3L7WA 2FNPA 1B34B 4LF8K 4A3KJ 2DL5A 2FXUA 4WWCA 2LREA 1ITGA 4BQOA 5TKWA 4DQSA 4YTLA 1IN5A 4XLAA 3S3OA 2XD0A 5LJVA 2KIMA 5LGUA 2HL3A 4CERA 3CC4A 3PX0A 3FDYA 2YU9J 3E19A 2NNWA 4NL3A 1Z67A 4W1UA 1W0TA 1OI1A 1WQ7A 3ZSXA 3T1AA 5LJ3e 3JV3A 4KULA 1ZGAA 4B09A 1O3RA 4XOTA 3FRNA 2A05A 3D7EO 2OANA 2IW5A 3CMMA 1XCVA 1F9NA 2F4IA 1M1GA 5AT1B 2DNUA 3QDRB 4XQFA 2AK5A 1ZQ3P 3ASNH 5T7BA 2O8BA 4H0YB 1BI2A 2LQ8A 3NEUA 4QS7A 1WSFA 2VVKA 1WA7A 2QK0A 1QVGS 2NVQJ 1QZYA 3SZTA 2W41A 3TAMA 4EJVA 3G71N 4GV9A 1QA6A 4C8QE 1SQKA 2JPBA 4PJJA 1K78A 3FFKB 3BT9A 2YX6A 4ENMA 3IC7A 4D7MA 4KISA 1W4SA 1UDLA 1RABB 4B6MA 5J39A 5F1XA 2FO0A 4PGHA 5SWMA 3M9AA 4DU4A 2VJIA 2RJCA 4E7ZA 3ZN0A 4G7ZF 4C9YA 3DXJF 3CVSA 4RAGA 4DZJA 3X20B 3H45C 1BM9A 3J7YJ 1SHFA 2GQVA 5IH2A 4CHQA 2ZPBB 1KGSA 1GCQC 2H8WA 3DV8A 4DQ2A 3NH1A 3CI5A 2YCHA 2OPPA 2R4GA 2BYVE 2RJEA 1J3TA 1S7OA 3DLGA 3CJRB 2M3AA 3S3NA 4FJHA 2EYWA 1YJ9A 1GBQA 3UKRB 4CJRA 2RE2A 2OZUA 1WIEA 3EFRA 3H0IA 1MMAA 4OF1A 2QW9A 2KHMA 3EYZA 3H08A 4GCVA 2LMDA 5GAN4 1QO0D 1OKRA 1HA8A 1MDMA 4I02A 3AY9A 2AJQA 3KZZA 4EMKB 3QO9A 1IUYA 4FL9A 4HKEA 4XK4A 1XDSA 4CJ5A 3ZEUB 1YCYA 4AMCA 5BN8A 4QQGA 4FJ7A 4OAYA 4IO9F 4NB4A 1Q81C 3M7GA 5DCMA 3J80K 2M0CA 4NLBA 2VBZA 3UWNA 1U2VA 2W82A 4JKAA 2KQ2A 4RW6A 4CXFA 1NMDA 3BR5A 4CCMA 2EFPA 3LAPA 4A12A 1X9SA 3MCAB 3SUOA 2ZNYA 4TVRA 3KD1E 3OA6A 2F96A 1MMNA 4DTUA 2VT2A 3VQDA 4XLCA 3T0YA 1RDUA 1RNHA 2BVLA 3KEYA 1VQPI 1R0AA 3VRYA 2X4WA 2QEXN 2CW7A 4RBOA 3F8MA 2DPNA 1TKZA 3HVRA 3TW7A 2F8TA 4F7UA 1PWTA 3HGGA 4M7DG 3S17J 3CCRA 1DGKN 1RESA 2FPEA 5FU6C 3FMQA 3TP3A 3GTOJ 3JCMX 4G1QA 3JSMA 2O8FB 5AJ3K 5BR9A 1RI7A 1TWCJ 3I55T 3A2FA 2NVTJ 1VHXA 3HUGB 1JE8A 4GYGA 2VN2A 3KX2A 4AI4A 3F10A 3ZLJA 1HNIA 4M7AF 5L3GA 3TAPA 1C0UA 5J8FA 3E6BA 3CCLA 1K0SA 4PY5A 4LH5A 1VRLA 4JK7A 2AZVA 4QSHA 2RN8A 2KZGA 2DXTA 3ZFJA 3J80E 1H9TA 4L18B 1K8AO 4BC3A 5F0HA 1YWOA 2BE9B 2DZ9A 2XG8D 1RBTA 1WHMA 3LPTA 1YJ9Q 2J05A 3RZDJ 5I11A 1A5XA 3BDDA 1NG2A 2Q0RA 3OBYA 4JI6K 4EIKA 5GTHC 1NLOC 2V7YA 3CC4I 3VYRB 4P9FA 1RL2A 1KYWA 1TUCA 4QT7A 4FLTA 2RAEA 3D45A 2HKOA 2LNVA 4HV6A 3CCMN 3LSKA 3K9KA 5IWAK 3A02A 1EH8A 5FW9A 2IBDA 3CWAA 1S9EA 3GFLA 4EAHD 1TAQA 3HSTB 4E2FB 5K14A 4S04A 1KQ2A 1X19A 3R1XA 2R5ZA 1R59O 3C6AA 5DY9A 4CIFA 1WBDA 1Z3YA 2TCTA 4KRTA 4CEDA 3K2ZA 1SC7A 3REOA 5KK1A 4GY5A 2O8FA 1RI0A 4PJ0C 4IUTA 4I98B 1NKCA 4Y1CA 4DZPA 1WHJA 3TAQA 1KAYA 1XC9A 3A4CA 1BN5A 1LEAA 3NTIA 2X74A 4CZMA 2ROTA 2XUBA 1D9DA 3WTWC 1GLAG 1S72I 1JEGA 3HP6A 4ZNXA 1RUWA 3ZX0A 1RC9A 1AD5A 4GV6A 4E7JA 3FIFA 1ASWA 2KFZA 2R7DA 1DPUA 3R8EA 2KDOA 4PJOE 2DZCA 2L9NA 1D0YA 5EJCA 2QDLA 3L1AA 3BDPA 2HNZA 3JCMQ 4CEOA 3CW7A 2DODA 1N3AA 2HNYA 3GBQA 2PN6A 4FHTA 4PLLA 3UKUA 4L5EA 1K8AC 5KGWA 1B9DA 4KA4A 1KZHA 2E88A 1M2OA 3DMJA 2X4XA 1IXSB 5GMKj 2KFNA 4S0HB 3OYFA 1X43A 2ED0A 1K78B 4Z88A 3SYTA 3CXCS 5ED4A 1ZELA 5M1KA 3FISA 1NGFA 2NVYJ 4ID1A 2CDTA 3DWLE 4ISEA 3H0GJ 2HQEA 1NGEA 4X9CA 3M0SA 4UHTA 1OCOH 3NQOA 3VQEA 2XPVA 3KYDB 2HQRA 3PL8A 2CWEA 1LCUA 4KH0B 3NVMA 3OQ5A 4KRFA 5IP9J 3ZMDA 2RO0A 2Z3YA 3ZX3A 1V5EA 4FWNA 4BJ5C 1JLFA 3QZ9B 3NH0A 2W42A 1IW7F 3T8RA 1VTNC 4UB8C 3QIOA 2HHWA 1WHHA 5GMKm 1FPQA 4JD2A 2HGCA 3EH2A 4EQQA 1ASVA 1FYMA 3CUQB 2VIXA 2ZM6K 3H46O 2PZSA 1XTAA 5KQ8A 2BE2A 1FYNA 2J6FA 2D5VA 3ROUA 2FF4A 1YJNQ 1VF9A 3KKRA 2BGCA 3BLYA 4H4KC 1ABQA 3ZCMA 4CEAA 3PIPL 3G4SN 2WY8Q 5F04A 1YIJN 3QYBA 2R7TA 1JCGA 3TQ7P 2GUPA 1NBWA 5LJ3j 4RTXA 4C8OA 4HYEA 3NWTA 3VQQA 2EIJH 2X35A 3LSPA 4CYCA 5TKYA 4CIEA 4LG0B 3CMEN 1HXDA 4GKJK 5FRMA 3A98A 3I58A 6PAXA 1I6HJ 3P83D 3M3ZA 2R92J 4XLHA 1M1FA 3QPLA 4KHQA 2VWBA 2K57A 2I2LA 2UWMA 3META 1ZK8A 1I1SA 5LJ5f 5HL7L 1RPWA 2YKMA 3F21A 1X58A 4JDSA 3IDHA 1TT0A 1OH7A 2HVIA 3V1RA 2E5QA 4NC8A 1Y56A 1LWFA 1YXQA 4MDWA 3ISNC 1BU1A 3V7RA 1JL1A 2FRWA 2HAXA 3UA7A 4C92E 3OWTA 4I9QA 1MWMA 1OYXA 2F5CA 2EIKH 4E6KG 3QETA 4NCGA 2VKHA 2M0YA 1BGXT 3HSRA 2FA5A 3K0SA 4MTEA 3CCUT 1J7KA 3LWIA 3PY8A 4WFAL 2DMQA 2QWMA 5JS2A 2Z1HA 2FSKA 4BR2A 2DPUA 3O4QA 2KIFA 5CKDA 2L7KA 1VQOT 4DR1K 4E0DA 1VYUA 3F6OA 1N77A 3ZQIA 4FYYB 5AZJB 2YHWA 3OSGA 4V2SA 3IRXA 2A5WA 2IS6A 3EGDA 4HCKA 3THWA 4DR5K 4UUTA 1PD1A 2JJ7A 2YWWA 1V5GA 1KSWA 4BI4A 4PQUA 4WFNL 2QWWA 4CJLA 2P6TA 1ARKA 3QKJA 3G3ZA 3TKYA 1T33A 3HSBA 1T6DA 2YUPA 3RKXA 3ULRB 3CBPA 4FO0A 3JRAA 3NARA 3O8HA 2DILA 5SZTA 1SFEA 2CGPA 2CQQA 1DQUA 4OB0B 2CSQA 2J5OA 3H1VX 5CIUA 4HX8A 3VF2A 4RW4A 2NLXA 2OU2A 4OX9K 3HRGA 4KGVB 2ASOA 1GXIE 2J6OA 3EL2A 2CH0A 4HUEA 5CZ1A 1QQJA 4F3TA 3IKMA 2LF7A 3VTIA 2G7HA 2UUAK 2KVQG 2K79A 2YU3A 2YHYA 5LY3A 3OJUA 4J2DA 2HQNA 3QU6A 3JRZA 1SL2A 2EYYA 3H0DA 3OYCA 3PVQA 3VYSB 1T0FA 1KVCA 1XPXA 3EG9A 4M9ZA 4M78F 3CCSQ 4FJMA 1G15A 3K70D 4YOUA 3DEWA 4HXJA 1RRQA 1BHLA 3PNYA 1L3VA 2L89A 1M1KU 3BCAA 1NOZA 3TANA 4NBQA 1WJRA 5HLIA 2OF7A 4DQ8A 3S1RJ 3KYCB 3DXKB 4CFDA 4V19K 4FSVA 4L9JA 1TGOA 4AH9A 2BW3A 1WHLA 1BCMA 4ENKA 4CJKA 1YQAA 2K9SA 2B7EA 2J5PA 1ZYQA 2QA4N 5GAMe 1RTJA 3SZPA 4RG8A 1S5JA 3WG9A 5IAYA 5JVHL 1A5WA 1U1SA 4RMNA 5TJJA 2ZBKA 3C2BA 4UB6C 1M27C 1GFCA 3A8HB 3MDQA 4CI6A 4FJ5A 1VQ4Q 1RR8C 2ZJPL 3O2PE 2L3PA 4DA4A 5CKFA 1RLPC 2DJQA 3LFUA 1QVFM 1D8YA 1XB4A 4A2AA 4N4GA 1YQLA 1HLUA 4PHTX 1QKXA 1RAEB 4HF2A 3V9SA 2PBDA 5L23A 5J2NA 3RZOJ 2BE7D 1GLJO 3O3KA 3GOXA 5EOYA 2RQWA 1YS6A 1S8NA 1KXPA 3TP0A 1VQMA 4DOWA 3I55Q 4KMFA 4RDUA 2KMTA 5EEGA 3T1YK 2DMNA 2OTJT 2DQRA 1UEBA 5AQIA 1G4DA 2F9TA 3O8VA 5EG2A 4O5FA 3Q0WA 1F36A 1Q82R 1WI3A 3LZJA 2XGCA 4M3UA 3CC4N 3S93A 3MEAA 3LX7A 1ONVA 3CJ7A 1SVOA 4JX5A 4WE1A 2X9HA 4A3FJ 1BW5A 4QCLA 2HOTA 1B1BA 1E7OA 4BQQA 2HOSA 1Q18A 1VSHA 3QNNA 3SV3A 4A62A 1XMQK 4FYVB 3T1BA 4LF5K 1PG5B 1VQOQ 2KMUA 3KTQA 2XB5A 4OMZA 1LPQA 2VXEA 2L2PA 1VQ5Q 2P0KA 3IUOA 1D5YA 5JVGL 3PX4A 2CRGA 3LH5A 1VUBA 3MP1A 4FSSA 3H5RA 1R5HA 5GADP 5C42A 2KT1A 2X4JA 2WACA 2YSQA 2GZWA 2P0QA 2AHJB 3PMTA 5LJ5e 1W7AA 4IIMA 3FXQA 3VTHA 4CZZA 1HKCA 4HA8A 1RGIA 4IOCL 3RKQA 2GTDA 1ABOA 4EMKC 4M77D 2KGTA 2X1EA 3HHGA 4DW6A 4XQ3A 3FZKA 4BREA 1W7PD 2FL7A 2HHUA 3CLQA 2QEXI 3VF6A 4CGHA 1EJ9A 3A2KA 2XAGA 4IHWA 2NOEA 2WAFA 2DJIA 1R4NB 1YJWA 1L3TA 1AOJA 3P9CA 2OQGA 4RTFD 2Y4YA 1NYFA 3PFYA 4J6XA 3CD6A 1S1WA 2KL4A 3MKZA 2X6YA 4IKFA 1J5YA 2A5XA 4K41A 1EIFA 4IF4A 2Q97A 2DLPA 5JLFA 3ZEHA 2IGKA 4I0BA 2CQKA 3UATA 4OPKA 3DPLC 3D1NI 5DM7R 1C0GA 4NXNK 2MH9A 1YG2A 2W6KA 4JJBA 1G8XA 3CJNA 4A3MJ 4EA5A 3ASMA 2DOEA 1QCOA 3I56Q 5JLWA 3UA6A 4DF8A 4N4OB 1PVEA 3AHUA 1ZX6A 4W5QA 3RQ4A 3CCVT 3P9KA 2I7NA 2W48A 4OMLA 3GZNB 2FNAA 2HL5C 2IG0A 2IP2A 2OA8A 4Z2YA 4L9TA 3CCVI 3SUNA 3BQZA 4BRLA 4FTHA 1U8BA 1B4AA 4M71A 1KLMA 5DD4A 1N36K 1WEIA 1RAFB 2IGOA 4LIUA 2LMJA 4HVUA 1YNZA 5DLQE 2EAYA 2CH4A 2ZMEA 1O4XA 3JSOA 3CJBA 1N8RU 3QOEA 2QWPA 1TW3A 3QIPA 5IYCJ 3ATUA 3H5NA 5KYYB 3VPZA 1VQ5N 2KBTA 2YHXA 5F0XA 2KQRA 1YIJA 2KRSA 2ICWG 2XF5A 2CO5A 1RDCA 4DBFA 3MK6A 3PM1A 5CJ9A 4AM6A 3M4GA 2FEZA 3UT1A 1T39A 1JGSA 3L2CA 3VGMA 4FYWB 1Z77A 1V4TA 1ILYA 2IS3A 3WHBA 5KE3A 2DD5A 1B8IB 2D0CA 4HNUA 1YYVA 4YHHK 2VONA 2H56A 4DQIA 3CO7C 1VRUA 2E7XA 4M75B 3MN7A 4J8FA 1APLC 2D8JA 2VJJA 5L3FA 1H9GA 2R7QA 4K8ZA 3CESA 3OIQA 1VQ4N 3DLLF 4BU2A 5FKMA 4LFAK 3VB2A 3SEQA 3CLOA 4IUUA 4HUFA 4FXDA 5I2SA 4IOCF 4B43A 4BRAA 4QIWN 2V51B 4II1A 4XKWA 1O13A 1A35A 2O8DA 3OIOA 2XGXA 3NMZC 1HNVA 3EEQA 5AQYA 3E5XA 5GANe 2OAWA 4JK1X 2O4XA 2X3XD 1G2HA 5CKHA 1LE8B 2O8EA 2RNGA 2LBFB 1QS4A 1OEBA 2NOJB 2G8IA 2QENA 5AIPA 3EQLF 4BB7A 2LCCA 3CMAT 3M3YJ 5LL6Z 1OX9A 3ZMUA 2EGCA 1V4SA 3GO5A 1ATSA 2GBYA 3A01A 3L8BA 2HHSA 2RVCA 2Z2SB 2PJRB 4R55A 2NRTA 3K9JA 4C1NK 4RAYA 4CUGA 2X6OA 2P5GA 2WB1A 2LNBA 3DU5A 1SL0A 1YQMA 1ZG1A 3U3GA 1TWGJ 4M77C 4ZYGA 1HW2A 1IG9A 3HOWJ 4G7OF 2A40A 4CZIA 4I2OA 5DV5A 4YORA 3WEEA 3RUXA 4AHUA 3MN2A 3VSLA 3ABLH 3OSVA 1HSTA 5FPMA 4YOYA 5GANd 1H3ZA 4NCAA 3KNTA 3INZA 3IUCA 7AT1B 2FXAA 4ILHA 3E9GA 5CYQA 2O03A 3CD6Q 1BBYA 4M7DF 4QQ6A 3FDRA 1PNJA 2FHDA 1IXCA 3OOUA 1JB0E 2IA1A 1KD1O 2K4JA 1T8IA 1M1KR 3WG7H 1VQ8I 3ERMA 3EO3A 3MFKA 4XRMA 3O9QA 3PO4A 3UF4A 3Q7BA 5FGMA 3L1PA 4JUVA 2I8DA 1ZHIA 3CCSN 1RDDA 4DR4K 4AHTA 1NKEA 4XRSG 2H1KA 1JCEA 1KU2A 1BI1A 4M7DC 4I7HA 1G6NA 3FHZA 3KLGA 2DCEA 3TSPA 1SD5A 1K9MO 3NGYA 1IZ6A 3TU5A 3DLEA 3HHTB 4JZ3A 5F0CA 1IBKK 4B44A 1ULYA 2WSEE 1BI4B 3BG7A 1TQIA 1JKPC 2B0LA 4O8UA 1GLEG 2VQHA 2L3SA 4C92A 4D6WA 5AFUH 4JRPA 2MABA 3RR8A 3QP6A 2DTIA 1V54H 1P2FA 5GAOn 2KXCA 3A5OC 1TTYA 1FBUA 2H8RA 3S6IA 4EJYA 3VQ6A 3F8NA 1Q81U 3S16J 1SD4A 2NUTA 3S3MA 1DP3A 1BC7C 1IREB 4XTVA 3TARA 4JKBA 3KK7A 1R1VA 5LMUK 3CXCP 3KLIA 4LMYA 4DJAA 3F6VA 3QYEA 3DRPA 3THXA 2ASPA 2I0NA 1PKTA 4LDUA 2EV0A 3OS1A 3UKRA 3TQNA 2VWFA 2LF8A 5E41A 3M8RA 1VI0A 1ETQA 3KLEA 4FX4A 4EJOA 2Z9OA 2RQUA 3GOIA 2D0OA 3M07A 2MC4A 2P9PA 2DN0A 5KAFC 4EP5A 4FJGA 1BCOA 2HVSA 1SVLA 3P5JA 4M63C 2E3IA 5CR2A 1N34K 3J7YP 1OPCA 5KYUB 3FE1A 5IP6A 5FKLA 4M75C 1M1EB 4OP0A 1TP4A 5HVQC 1UJ0A 3DLLL 2D6FA 3LSJA 1DU6A 2XDPA 2D1HA 1VQPT 1TW2A 4BR0A 3QAHA 3WUHA 2A3LA 1T2KA 2DOFA 2DVJA 4M77G 3N05A 5IT3A 4A3JJ 1Z0XA 2MIOA 4DEXA 2RQVA 3S2HJ 1N78A 2KSSA 4E1NA 2PEXA 2RHYA 4FJ9A 2X6WA 5M1OA 3QDFA 1XMOK 1RKTA 9ANTA 1S5LC 4L6V5 4I6ZA 1S22A 4PLIA 4RTZA 4RAZA 4M45A 5M3FJ 1M8MA 4M78C 2CQ7A 2ZC2A 3VMFB 5GAEJ 5C12A 4BE1A 4JV5K 4HHTA 4U0WA 1Q7YU 5AQLA 2JMCA 3R6MA 3HC7A 1M1KC 1ZLMA 3CM5A 2BANA 4FCYA 3O9RA 3VA3A 4DFKA 3WXKA 1I4K1 2KI7A 2XROA 4IHSA 1P8ZA 2YNGA