4E7JA

Pfv integrase target capture complex, apo form (tcc-apo), at 3.15 a resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Pro-Pol polyprotein
total genus 98
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7jA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7jA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7jA03
1VSKA 1T03A 4JS4A 1LV5A 3NF8A 5FRMA 2M1HA 1XI1A 1T7PA 4F2SA 2M16A 2RJEA 1W9HA 4FJ5A 4J2EA 3HPGA 3QINA 4AHRA 1JL1A 4IDKA 4HUFA 2EQUA 3MXJA 3OS2A 3PX4A 4L8RB 4KHSA 4B9MA 2O4IA 3SPYA 1HNIA 1NK5A 4FL6A 1RDDA 3DM2A 2L8DA 3L3VA 2E6NA 3OJUA 4IUQA 3LWMA 3TARA 4KB0A 4FM1A 3NH0A 1WNSA 4DFJA 3TAMA 2IGIA 3V1OA 2OPPA 4FJNA 4J2BA 2Q3SA 2BGGA 3LDSA 3OYCA 4FK0A 1SKSA 3NH1A 4QAGA 1SKWA 4CECA 3QEXA 1MU2A 3MEVA 1BQMA 1QHTA 4M3RA 5SWMA 1ASWA 1ZBFA 2I5JA 1ZYQA 4DSJA 4I9QA 3HT3A 4BDPA 3EYZA 3KJVA 3RRHA 3AV9A 5HRRA 3LALA 1RTDA 2ITGA 3VA0A 3V81A 3AO3A 3M8PA 3P8DA 4B8AB 2KFZA 5CZ2A 1LAVA 4IG3A 1S1UA 3C6TA 2AJQA 4DWIA 2RHUA 1BIUA 5D6YA 3NCIA 2R57A 1QE1A 3CQ8A 5KE2A 4ELUA 4N47A 1UA0A 3QLHA 3VA3A 3PO5A 4NS5A 4MFBA 4Y1DA 4CEBA 3U3GA 3KLEA 2E6MA 1NKCA 3ZT0A 3ZSWA 1HPZA 1VRTA 3AVGA 3C95A 3ZSZA 4KREA 5DMRA 2JTFA 4CGIA 5J39A 3KKRA 3SPZA 1OYXA 3RWUA 4B08A 4CJEA 4HCZA 1UWBA 3JSMA 4RG2A 4ZHRA 3AVJA 1VSLA 2X35A 4N4IA 1RBVA 4RW7A 1TK0A 1NKEA 3PY8A 4E0DA 4CK2A 1WAJA 2X78A 4PA1A 3D45A 3RTVA 1YT3A 4Z4CA 4B9SA 2HW3A 4GY5A 3OMGA 3RR7A 3C4SA 3QJ6A 1CZ9A 1HQEA 1S6QA 1RT3A 1A5XA 1B9FA 4OKKA 2O4XA 3HSTB 4NYNA 4LD0A 4IUVA 4CJKA 4FLVA 1VSMA 1QSSA 2X4YA 3OYAA 4LD6A 1S1VA 3LPUA 5C25A 3AVMA 1TKTA 1LW0A 4JS5A 4DTSA 1T8EA 3KLFA 4DTNA 1F21A 2DFHA 1U47A 4PWDA 3AVFA 1Q8IA 1FKOA 3B6PA 3TANA 4FVMA 2B4JA 3HXMA 2B8AA 3THVA 2IC3A 2F8SA 1L3UA 4BWMA 4CIGA 4KHUA 4E1NA 1XC9A 1IKWA 4CEFA 2L3RA 3T1AA 4W5RA 3PX6A 4KPYA 2D5RA 5KGXA 3CG7A 3KK2A 2CKKA 3T3FA 4CFAA 1RT6A 1NK0A 2RF2A 2BANA 3VQ4A 2QQSA 1A5WA 2D0AA 2VG6A 2RJFA 3O8VA 2RI3A 1RI0A 4M45A 2LRQA 3GOXA 3NTKA 3O3FA 4KI4A 4M3TA 2GBZA 4F3TA 4E89A 3V9SA 2FBXA 3LLRA 4C5IA 1SV5A 3AA4A 3VQ5A 3OYKA 3NGZA 3SV4A 1KRPA 1EKEA 4DFPA 4DFKA 4QCLA 3LP1A 3V9UA 3MXIA 3VQDA 3ITHA 4KV8A 3DLHA 4FJMA 3KLIA 1KTQA 3ASMA 4ID5A 1HYZA 2DTUA 3KK3A 1RBTA 4IURA 4LY7A 4CHZA 2PZSA 2MWOA 3RRGA 2MWPA 2QQRA 1KFDA 2NLUA 1A5VA 4CGHA 2L89A 1IO2A 3V1RA 1LW2A 2K3YA 4BDZA 2GFUA 4E7KA 4N4GA 3DI6A 2OPQA 2HHXA 3KIOA 1TAUA 3HYFA 3RMAA 3HVTA 4AHSA 4II1A 2IG0A 2YNGA 3RR8A 4CHOA 3LWLA 2X4XA 3WNGA 4FM2A 3DLBA 4FZXC 4C8LA 3F73A 1RTIA 1JXEA 2QKKA 4ZTFA 2HVIA 2OA8A 4BDYA 1RT2A 1S9EA 4Q0BA 2LSNA 1WN7A 4DTOA 4CRIA 4CJLA 4DSIA 3DLMA 4DTRA 1BL3A 1JLEA 2Z1HA 1LAWA 3ZT2A 3QIPA 4QW2A 1WJSA 4IFYA 3ZSRA 3QNOA 3SQ2A 3PO4A 4KFBA 3LH0A 3LYIA 2ZQBA 2W42A 1KLMA 3HP6A 2FC0A 3ZSYA 2HB5A 2RN2A 1RT1A 1NJWA 4A4FA 4F2RA 1Q9XA 3OS0A 5CYMA 5KRSA 2HHWA 2GUIA 4CJ4A 1RTJA 4E1MA 3QEWA 4FJKA 3O4NA 1FK9A 4ID1A 1EXQA 1B9DA 1JLAA 2P1JA 1EX4A 4DG1A 4EZ6A 3OYIA 3S3OA 3DB3A 5J26A 1X1PA 4ICLA 4TSXA 2FHDA 3V1QA 1N5YA 1D9FA 2HMIA 3OYHA 1ASVA 4KB1A 3LX7A 2VWJA 3MO8A 3K5NA 4FZZA 5C6SA 4G1QA 3TAPA 3DYAA 4FJGA 4CHYA 4B9XA 4BWJA 4PY5A 1LWEA 1KFSA 4DU1A 2A1SA 4FJLA 1QTMA 3B6OA 4DSEA 3RMBA 4KHWA 4I2PA 4FJXA 3MXMA 1BIZA 1Z26A 4CERA 1C1AA 4CHPA 2VG5A 1NJYA 1C0MA 1J54A 4ELTA 4NZGA 3C6UA 1CZBA 3OYLA 3EAEA 4O55A 1HMVA 1U48A 2XO7A 1GOBA 3A2FA 3NF7A 3VQQA 3IS9A 4CK3A 1KVBA 3UT1A 1TV6A 4AHTA 1WSHA 1QSLA 4DS4A 3MP8A 3OB9A 2R58A 4EP5A 4CGGA 2EQJA 2Z1IA 4KHYA 1CXQA 3ISNC 3T19A 4CGJA 4CJSA 4Q5VA 3O3GA 1RBUA 1C0TA 3JYTA 1WGSA 1NK8A 4A4GA 1GOCA 2IS3A 2YKMA 3NAEA 4E3SA 2OZMA 2HVHA 4ZTJA 3MEWA 3DLGA 4CGFA 1G15A 3SQ0A 3AVNA 4DQSA 1JLFA 4B9LA 3WNEA 2R5MA 5C24A 4CFCA 4N5SA 4KTQA 5FRNA 2ZE2A 3QETA 3H6ZA 3NTIA 4DQPA 3VQEA 3BDPA 1XNIA 4OJRA 4HCBA 4W5TA 2PQWA 2LVMA 5KE3A 1C1CA 2F96A 4NCGA 4O44A 3FDRA 3AVKA 3LZIA 4J2AA 2HHTA 2FBTA 4BE1A 4FJJA 3RMCA 5KGWA 5HRNA 1L5UA 1DTTA 2HHSA 3F9KA 3L2VA 3SI6A 1BCMA 4ELVA 4UC4A 2XY7A 1R0AA 1IKVA 4C5GA 2DIQA 4DQQA 1X9MA 4AILC 4W5NA 1NOYA 4W5OA 3QIOA 4DQRA 1TK8A 5JS1A 3K5OA 2OYQA 4FJHA 4H8KA 2QK9A 1D8YA 4AHVA 4DSFA 3LP3A 3TAFA 1VSHA 4CEQA 4BACA 5J1EA 1QS4A 2XY6A 4DTJA 4PQUA 4DU4A 4FW2A 1CXUA 3OYBA 5KI6A 1KCFA 4CFDA 2G8WA 3ZEHA 5HP1A 4I7FA 1WJRA 3QNNA 2EQMA 3I8DA 3VQ8A 2Y1IA 4OGEA 3MP6A 4K8ZA 5HROA 1FKPA 4C5EA 3MEEA 3K58A 3P1GA 1JL2A 4CIEA 1B92A 2P0KA 3KLHA 4I2QA 4FLTA 1RT4A 3NNQA 1VSIA 2GF7A 1TVRA 2BE2A 4RW9A 4YNQA 3HL8A 3L3UA 3IAYA 4CJRA 1WSFA 1RDCA 3VQCA 4DU3A 3TAEA 3ZSOA 3SNNA 2P5GA 3KD5E 1TK5A 1WSIA 3OY9A 1TKZA 1BQNA 4FJ8A 4BE2A 1U04A 2F5KA 4FJ9A 1DLOA 1GOAA 4NCBA 1C1BA 4DTXA 1RBRA 3QEPA 3HJFA 1CLQA 3KUFA 2R5AA 4KHQA 4CF9A 1NK4A 3AO2A 4QOZB 1OZ3A 4QQGA 2A1RA 2HNYA 5FDLA 2YRVA 1N6QA 3MECA 4H4OA 1L3SA 5M9OA 1BGXT 2EX3A 4HVJA 4DSLA 3DMJA 3V9ZA 3OVNA 1KLNA 3FC3A 2JZ2A 4DTMA 2B5JA 1JKHA 4OPKA 1SL0A 2X74A 2P51A 5HLFA 3OMCA 3SZ2A 4N41A 4OVLA 1C6VA 3BDLA 3META 1TL3A 2XY8A 4X34A 4N56A 2K3XA 4RW8A 3OQ5A 3QBYA 4KTWA 3LZJA 4HHTA 2PY5A 1VSJA 3DRPA 3TR8A 2YV0X 2IOCA 1J5OA 3PFSA 5DK5A 3HP9A 3TAQA 4FJIA 4K8XA 2D9TA 2OPRA 4EDUA 3DOLA 3ZSXA 1IKYA 1JLCA 5SZTA 5T7BA 2R7YA 1TL1A 4B9TA 1RNHA 4M3WA 4CF1A 4CIFA 1VSEA 1HYSA 4R5PA 3NGYA 2XHBA 2O4GA 3IG1A 4DTPA 2E5QA 1KVAA 4O4GA 1C0UA 4B9WA 3C94A 3DRSA 4B9UA 4JRQA 2HNZA 3FFIA 3O3HA 3M8SA 4FJ7A 3L2UA 3E9FA 4OLAA 3PMIA 2HHUA 3OS1A 3K57A 4B8CA 3CEYA 3CM6A 1ZBHA 1TKXA 1S5JA 4DF4A 2NUBA 2RI5A 2WACA 1I39A 3G0ZA 2WOMA 1VSFA 4N76A 4Y1CA 3HK2A 1NOZA 2XK0A 3AVHA 4AHUA 1VK0A 3SJJA 2KZZA 3VQ6A 3S3NA 3VQAA 2KTQA 1VSDA 2EKOA 3DLRA 3M9QA 3UWNA 4KHNA 3OJSA 4M42A 5D6XA 2FBYA 3QESA 4Z4HA 1TKDA 3F70A 3Q1JA 5CIUA 3ASKA 4IG0A 2RHXA 1REVA 5J2NA 3HPHA 3VQPA 3AVLA 2Z1GA 3AO1A 1IG9A 3SUQA 4CHQA 3LAMA 3IRXA 1YTUA 3V9XA 4B9NA 3KLGA 2ETJA 4WE1A 2BUDA 4OGCA 1HYVA 5EU7A 1NJXA 3MAQA 2BKDN 1BI4B 1BCOA 1SUQA 1WSGA 5CZ1A 3EY1A 4KI6A 4JLHA 4M3UA 2KZMA 1MHNA 3OYFA 4C8NA 5KRTA 3HVRA 2BDPA 4I9LA 2VG7A 4PL6A 2DFFA 4FCYA 4OKEA 3SQ4A 4IUTA 4FLUA 1IH7A 4FU6A 3K5LA 4EZ9A 3P83D 1NKBA 1YTAA 4MQ3A 1JLBA 4LSNA 4DS5A 5HRPA 3LANA 4PLIA 4UQGA 4C8KA 2RPIA 4KAZA 4CF2A 4KO0A 1S1WA 4Z4GA 4O0IA 3E01A 3E9GA 4N4HA 1DTQA 1HRHA 1I3AA 2X6NA 3M8RA 1ZBUA 2LTOA 3NTHA 4H4MA 3SQ1A 2DAQA 2E6LA 4FW1A 1NJZA 2O4XB 2PYJA 3P5JA 4M3YA 4B9VA 4NCAA 1HQUA 1U4BA 3V4IA 2X4WA 4CJPA 4E19A 4HCCA 3U3YA 3HPOA 3CFPA 3HO1A 4QVZA 5KCHA 3OA6A 3ZT4A 4E7IA 4OPJA 1RCHA 3VQ7A 1RILA 1H3ZA 1WLJA 3NE6A 2Y1JA 4CCHA 3PUFA 2RJDA 2IAJA 3LGFA 1SSFA 3L8BA 2WONA 4QQDA 1ZBLA 4IBNA 1L3VA 1RBSA 1NK7A 3MEGA 5JS2A 1D5AA 2M0OA 2XDPA 2VWKA 2BIVA 3M8QA 4AHCA 3TAGA 5E41A 2YHBA 4BE0A 1WSEA 4DMNA 3SUNA 3PX0A 3QEIA 1Q9YA 2G8FA 1S6PA 3SYZA 1JXBA 2HHVA 2QKBA 3S9HA 3NF9A 1S9GA 4EP4A 2XRIA 3MEDA 3QO9A 4Z4FA 2YNIA 3VQ9A 1HJRA 4F3OA 2DFEA 1IKXA 3DOKA 4IUUA 5KTQA 4FLYA 2KQ2A 2QXFA 4FK2A 5D3GA 1WSJA 3S3MA 4L59A 3KKSA 3CYMA 3I0SA 3KK1A 1SKRA 1ZBIA 4IFVA 4E7JA 3ULDA 4OVAA 2G8UA 1FXXA 1UAXA 2GFAA 4C5HA 1K6YA 4RW6A 3AO5A 1J53A 4DQIA 2F8TA 2G8HA 2DIGA 3OYEA 3VN5A 4FM0A 3DB4A 3SUOA 3TI0A 3ME9A 3QIIA 3AA2A 3DLEA 4O5BA 2ZD1A 4OKJA 2FBVA 4CHNA 3OYDA 2G3RA 2G8IA 3WNHA 2IDOA 4KTZA 1EP4A 5FROA 1LWCA 2KFNA 5I3UA 4Z4EA 4PUOA 3MP1A 3AO4A 2YNFA 1W0HA 3H8ZA 2LDMA 4CEOA 1JLQA 2PYLA 1RT7A 4DF8A 2HQEA 3FLGA 3PMTA 1TAQA 2E4LA 4CFBA 1L3TA 1QSYA 3VQBA 1KSPA 2RHZA 5CY4A 4Z4IA 3NF6A 2P5OA 4DLGA 4LH4A 3PV8A 5J2MA 4HUGA 3ZSQA 2HHQA 3PNWC 4FZYA 2HNDA 4CJWA 3NH2A 4HUEA 3NFAA 4CESA 4A4HA 4CF8A 3NGIA 3FEOA 4BD3A 1JLGA 3SV3A 1U45A 3UIQA 4IKFA 1TGOA 1XWLA 2ATQA 3NDKA 3RMDA 5D6WA 3BGRA 1WJQA 1OI1A 3EZ5A 2OPSA 4CEDA 1X9SA 5KH6A 3DRRA 2YHAA 1BISA 1N27A 2OZSA 1QQCA 1RDBA 1X9WA 4GVMA 4W5QA 5K14A 4RG8A 3QERA 1KHCA 2GV9A 4IUPA 4E7HA 3CM5A 3DLKA 2XY5A 4DSKA 4CJVA 1J9AA 4CJTA 3LP2A 4CGDA 3NBPA 1YVUA 1UA1A 4OLBA 3TWHA 4QQ6A 2EHGA 3AVCA 3H08A 5KCOA 1G5VA 4E7LA 4AH9A 3K59A 4JRPA 3CFRA 4J2DA 4C8MA 4FLZA 3D0PA 3ALYA 4A4EA 4CJUA 2EFIA 3CFOA 4CEAA 4FLWA 5I42A 3V9WA 4M3ZA 2Z1JA 3S6WA 3AVIA 3LPTA 4XIUA 1OZ2A 3V6DA 1Z25A 2D0BA 1WAFA 3I0RA 1SL1A 1HNVA 4CK1A 3TABA 2RI2A 3OYMA 1RT5A 3U6FA 3G10A 4KRFA 5J2QA 4PLLA 1ITGA 1BHLA 4GW6A 4M41A 3QKJA 4LSLA 2DY4A 3AVAA 4DLEA 1RTHA 4KKOA 2RKIA 3ZCMA 4DFMA 5C42A 3O4QA 3OYJA 1VRUA 3ZT1A 4FLXA 3NHGA 4DTUA 3QEVA 2RO0A 1XHXA 3LP0A 4Z0UA 2YNHA 4CJ3A 3SCXA 4B3OA 1NK6A 1SL2A 4RW4A 4F4KA 2YKNA 3L2WA 5CYQA 4HTUA 4Z02A 3ZSVA 1Y97A 2EQKA 2JLEA 4O0JA 3WNFA 4F8RA 2RHYA 4CEEA 3AA5X 3LAKA 4CF0A 2JGUA 2G8KA 4CJQA 2G8VA 2HQXA 3AVBA 1EETA 3L2QA 1UOCA 5IN1A 3AA3A 4Q5WA 5HBMA 1ASUA 3HM9A 3KTQA 1LWFA 3KD1E 3P8HA 4FYDA 1RDAA 5HRSA 1XHZA 4LH5A 2VYTA 1KVCA 5IAYA 3ZT3A 1D9DA 5J2PA 3SD4A 4FXDA 1S1XA 4CJFA 4YFUA 3MEUA 2RHIA 4CJ5A 4CEZA 1NK9A 2B6AA 4GMJB 5C0MA 2KW4A 4CE9A 3K5MA 4C8OA 3L2RA 2X6SA 4M3XA 3MEAA 1O1WA 3L42A 3SUPA 1S1TA 3K2PA 3OYNA 3LGLA 2D0CA 1U49A 4NYFA 1BI4A 2LCCA 3OYGA 2RJCA 4FK4A 1T05A
chains in the Genus database with same CATH superfamily
2DETA 1VSKA 3BCAA 2BV6A 1MGTA 2CP0A 2BY1A 3GIBA 4IDKA 1R22A 2QWWA 3JCMd 3EGXB 2WB1A 2NUTA 2RKHA 2IGIA 3M1FA 4A53A 3R3LA 1QPIA 2E1MB 3BPVA 2OTLQ 3CZ6A 1ASWA 5GPAA 1O13A 1WI9A 4M7AE 1RTDA 2P84A 4HF1A 1WHHA 2P9IA 3M1EA 1PSFA 5KE2A 4CDGA 2KLOA 3GF5A 3AVGA 3JCUC 1VZ0A 6AT1B 5KPZA 4A0ZA 1JJ8C 3MZYA 1QVFS 4WCGA 5LMUK 2RAEA 3F23A 4JKAA 4D7MA 5I9EB 4GY5A 1BA1A 2HQNA 1M3HA 4CCLA 1B9FA 3J80O 1GCQA 1S1VA 3RRGA 4WF2A 5CQYA 5GANj 2HOSA 3AG2H 4PWDA 2E2QA 2E71A 3AVFA 4EIKA 2QGGA 4DOVA 1MBJA 3VYGA 1D0XA 1ERDA 2EKHA 1RADB 4M78E 3CMAN 3CETA 3DU6A 4CFAA 4JJBA 3R8EA 2RF2A 3ULQB 2D0AA 3EDPA 3QP6A 3O3FA 5GMKj 2RD1A 3EG9A 1M2OA 3LP1A 3THWA 2QQAA 4MTEA 2MK5A 1Q81C 4HF0A 4PJOB 5TJJA 3SJMA 3ASMA 4ID5A 1RBTA 2FBHA 1FYNA 2KKOA 1JJ2M 3SDZA 3EUKL 1K8AO 2UXNA 3D2FB 2B86A 5FD5A 3DLBA 1ZSGA 2CREA 1PKTA 1W7PB 2LSNA 5JHFA 1NGFA 2HQAA 3GFJA 4IFYA 2UU9K 2WB1N 2IIMA 2F6CA 3JCMQ 3K4CA 1UB4A 3OS0A 4CJ4A 3ULEA 3QEWA 4DA4A 2MH2A 2PUKB 2NRHA 4DHYA 4Z2YA 3GNFB 4Y13A 5IYDJ 2CS7A 3OYHA 3SBTA 4CHYA 1W7AA 4OB0B 4M77C 2DODA 4J7FA 1X1CA 2JWTA 1Z26A 1OCRH 4A3EJ 3F22A 3FKJA 5BRDA 3A2FA 4HSTA 3VQQA 1OLTA 2Q2RA 1N5ZA 4M4ZA 2HOTA 2YRCA 5LJ5f 2ECBA 4Q48A 5LJ5g 5M1NA 1ZELA 3SQ0A 2E1OA 2QM3A 1N3AA 2VOPA 5FRNA 4LUEA 1J2XA 4O44A 1P90A 3LDLA 3N05A 3BTCA 3BQZA 2XKOC 4KUMA 3I59A 4KIFA 1IKVA 1XC3A 3FXQA 3CC7Q 1VYUA 2L2OA 1YIJA 2H94A 4FW2A 2W24A 4XRFA 2VLAA 1RRSA 4MLHA 3ZEHA 4BR9A 3HC7A 2GTOA 1NGHA 2BE2A 4M75G 1P7MA 3O1WA 2OAZA 2FZKB 3TAEA 2DBMA 3I4MJ 2FE3A 4MMLA 1BQNA 4BBRJ 1UG2A 4I09A 2MD0A 4B1WB 4UOBA 3MECA 4J2EA 4OWRB 1TQPA 1RAHB 3S8PA 4F7ZA 1MV3A 1RABB 3ABLH 2ZXJA 3BDLA 3CC4A 3S1MJ 3OQ5A 2VE8A 1J5OA 2XB5A 3JCMc 4EDUA 2W82A 5T7BA 4CZGA 1ODDA 1SFOJ 4BH9A 3CWTA 5GP9A 4OB3B 4AI5A 2NYXA 2KIQA 4DF4A 3LQQA 1UECA 1BJZA 3EFOA 2A3LA 3HK2A 3EUHA 2GTJA 3KLNA 2FBYA 4Z4HA 4JJNK 3WU1B 3HPHA 4BGBA 2IVNA 3LSKA 3LAMA 3U21A 4PSWA 1NJXA 3OS5A 2O01E 4FCYA 1I07A 5BRFA 2UUAK 4DV6K 2E2NA 1YTAA 1QHGA 1JLBA 4DS5A 4CD3A 5FB2A 4A3MJ 3TTCA 3GBQA 2QWMA 1ZBUA 4KRFA 1NJZA 3VGKA 5KYUA 3K70C 3ZMTA 4B9VA 3OA6A 1VA7A 2QA4A 1RILA 1QQJA 5K7HA 5JS2A 2VKNA 2XSDC 4M7DB 5D4SA 2QW9A 3CC2N 3DKMA 1TS9A 4FPAA 3VQ9A 3UR3C 3HHGA 5CKHA 1SD7A 1S72N 1SKRA 3CDLA 4BRLA 4JP0A 5GAOp 1V4TA 2LKPA 4Y92A 3PVLA 4CHNA 2XHCA 2IDOA 4G9YA 1XMQK 4AWXB 1WXUA 3CW7A 2PYLA 1Z6TA 1ZQ3P 4XU0A 2DRKA 3JCMP 1HJOA 3F8MA 5FWBA 4I02A 1W4SA 3VS4A 4K43A 1TXQA 3D7SB 2HL5C 1U45A 3A98A 1NGBA 3FHGA 1WJQA 2OZSA 1BISA 2CV2A 4EM0B 5DM6L 4OX9K 2GAUA 2DXTA 1E6HA 3CBPA 1IG8A 2W00A 3DLKA 4CJTA 1J5YA 3TWHA 2Z99A 2EYZA 2NXNB 3GPLA 5E26A 3R4KA 3ZGKA 4NOYA 2JJ9A 4JOMA 1YJ9Q 3G10A 3JCMJ 3PVQA 1Y64A 5LFAA 4A0XA 1SD6A 3EG1A 1RC9A 2L02A 3JRCA 2A07F 3G6EI 3CXCM 4OIQF 2DMOA 1KYZA 4P1WA 1MA9B 4RW4A 4JI2K 4L9VA 1KG6A 2NUTB 4Z02A 3SK3A 2MLGA 2RHYA 3VPRA 3IP4B 2MAMA 1P8ZA 1XPXA 1BR4A 3K6GA 3R9PA 1LWFA 2ED0A 5JVGL 1I1JA 2DT5A 2QBYB 1QVFM 4FXDA 2JVGA 2ESWA 3UPUA 4X64K 3VS3A 4F7UF 2NUPA 3LGLA 1N3CA 2DM1A 2RJCA 3A0IX 2CZ0B 4ON0A 4MDBA 2O8EB 1YP5A 2FO0A 2Q97A 3DM2A 3BCBA 2LX9A 2XI9A 2HYJA 3REAB 3VSKA 3ZPLA 2HAXA 1XJWB 2CGLA 4J2BA 3A5LC 3LDSA 1R5GA 2EBPA 1JT0A 1YJ9N 3MEVA 1BQMA 2G8IA 4B3AA 1YIJI 5CKDA 3CPEA 4A3FJ 3RRHA 4KJZA 3QZ9B 4M78G 2AIRB 2OTJQ 2VQGA 1V4SA 2CP3A 2R57A 3PGGA 2DYIA 3SQNA 3I55A 4F9OA 1ZSZB 4HVVA 4PDKA 4YY3K 3ZRGA 1W0TA 4B08A 4XOTA 2V1XA 3CO6C 5AQXA 1GV5A 3BR1A 2VQHA 2CP7A 1S22A 4F16A 5IOYA 4ENJA 4B1YB 3OMGA 3C7JA 5GAMg 2O4XA 2ID3A 5C25A 1W2BP 1NK2P 2Q8KA 2Y75A 3ZQQA 2YG8A 2VODA 4RAGA 1PP8F 3BJ6A 2IVOA 2L3RA 4JI1K 3SEZA 5K7FA 4DUYK 3VQ4A 1A5WA 2QWLA 1M1FA 4IEIA 2XGDA 1EKEA 4LE9A 4DFPA 3GFLA 2DA9A 1DDNA 3DLHA 2CQNA 3KK3A 3ISPA 3OSVA 3EN9A 4M9ZA 1SFEA 4CGHA 2NVUB 4S04A 5LJ5j 3CCRQ 5ED4A 4RAYA 4FZXC 3TU4K 4P55A 3IMXA 4JKBA 4FASD 3DLMA 1B34B 3VEXA 2Z1HA 1J75A 3HPWA 2HTJA 1X43A 4RB0A 3QQAA 4HNUA 4MQVA 4ZN1A 4PIIA 2OFIA 2GUIA 2G6FX 3PO2J 4HX8A 4AMCA 1JTXA 3MCPA 2P1JA 2ZMEB 3QMLA 4EJWA 3I5UA 2NNYA 4UB8C 1EWRA 2LRDA 5EEGA 1S72I 3G6EQ 4H0TB 4KIBA 3M57A 4C23A 1B9NA 1T56A 3N0UA 1KONA 3TSUA 3DLLA 3IQLA 3LM2A 2N8GA 2DMTA 1AOYA 2IS3A 4QSHA 4FSSA 2Q36A 5C0YA 1JLFA 3RTRA 4PJ0C 4DIQA 4CI0C 2V9PA 1HCRA 2IS2A 3LZIA 3WTYC 1F4KA 2FOWA 3BY5A 3FKIJ 1DTTA 1R1UA 4GKKK 1YHQQ 4KITB 4BXUA 1SG5A 5D5XB 2VYPA 1FKPA 1RT4A 1YTYA 9ANTA 3HL8A 2A0FB 3EGDA 1M90C 1TKZA 2E12A 4BRGA 2ZPHB 3QEPA 3KUFA 2GWRA 1UHMA 4XTZA 3KX2A 1L3SA 4HVJA 1Z9QA 3FC3A 2JZ2A 5HY6A 4MTDA 2WSFE 1LJ9A 1M2VB 4OINF 2DO3A 3SZ2A 4OVLA 1TW3A 4FLUA 2XY8A 1PG5B 1QZYA 1T33A 3OSFA 4Z94A 1TL1A 5HVQC 4CF1A 3IL2A 2UXBK 2LREA 2PMHA 2D5VA 1WYXA 3JB9F 4EJVA 3FFIA 2EJGA 3O5BA 3O3HA 3G1JA 3H9GA 1BBYA 1QP3A 3GTMJ 3IV5A 3VUBA 1OYWA 4EW0A 5CHIA 1P7IA 1R23A 3SJJA 3RIRA 5FKNA 1VQ5Q 1IUFA 1YIOA 1RDWX 4JRIA 1WH5A 1IZ1A 2IVMA 5FLXZ 3KXTA 4GV9A 3E1YA 4RWTA 3SUQA 2HWVA 2O8BB 4YDUC 2DXUA 2PJRA 2KZMA 4AC0A 2BDPA 3CCLN 2JN0A 1H8AC 4D7NA 3K5LA 2H3EB 1DQUA 3CXCP 4MQ3A 4FYVB 5F08A 4BG9A 1VQNI 4CGZA 4W5NA 4NBQA 2DAQA 3NEUA 1PUFA 1I5OB 4HAMA 2LTPA 3R1XA 4E7IA 1SVMA 1JXMA 5AQKA 3ASOH 1H88C 3LGFA 1ETVA 3AT1B 4LG0A 4BR4A 3QYHB 3PX0A 3S2WA 2KR3A 4M75A 1Q82O 4EP4A 2XRIA 1HJRA 1S72Q 3VYTB 1GLJO 4LUDA 4B3XA 5AQNA 4IFVA 1PC0A 1UAXA 2NS0A 1H9TA 2XROA 2G8HA 1BB9A 2XC7A 4OKJA 3T0YA 3PNTA 1BU6O 1W1WE 4BY9C 4B09A 1VQ4N 4ESBA 1OQKA 3CCMA 2L3DA 3NF6A 2RQTA 3HOSA 3ZEUA 3VPZA 4JEPA 4NB5A 2WY8Q 3DRRA 2YHAA 1VQ7N 3PTAA 4W5QA 3MKLA 1KHCA 4LLLA 1VQ5N 3CM5A 2XY5A 1A04A 4MO5A 2P9UA 1UA1A 2R7FA 3CC4T 4PGHA 4ZDLA 3CFRA 3O6BB 4FLWA 3CFOA 3OOPA 1W2BM 2KIUA 2JMWA 2Z1JA 3LPTA 1R8OB 3EG3A 3TO6A 3I0RA 1Y57A 3TABA 3NARA 2P6TA 2ZPGB 3SZTA 4ILGB 1KG5A 5FWCA 2AT1B 1T2KA 3QEVA 3L4QA 2E64A 3HKZA 2E35A 2XAUA 2YNHA 2Z2SB 4MO4A 3IH3A 2V1RA 2PU9B 2Q0OA 2OZUA 5IN1A 1OPKA 1KQSP 4Z8AA 3WU0A 3TSZA 3MN9A 1ZYRF 2X6YA 3AARA 3LM9A 4A2BA 5LHHA 1S1TA 3GWZA 3SFZA 4HSRA 4Y0WA 3PNYA 3GCMA 2XVCA 5FRMA 2IVWA 2CUDA 1ZKGA 2HEOA 2EQUA 3OS2A 3IH7A 3LWMA 1Y56A 2Z0WA 2JWLA 5LJ3j 2LH9A 4BC2A 4QPOA 2DZCA 4DSJA 3JCMW 1K8AU 3KJVA 4HEA2 2YSRA 4FT4A 1VQ6Q 4OMQA 1HLVA 2AHQA 3C6TA 2Y31A 4JYKA 3E9PA 3TQNA 1BKBA 5D6YA 1QE1A 4M3FA 3DLLF 2CQXA 2DMUA 4X1EA 5IT9E 3ZSZA 5C3EJ 1VQNN 2COMA 3SPZA 1M2VA 4CJEA 3PJRA 3DTKA 2L7KA 2VPLA 4RW7A 3C0BA 4PA1A 4C92D 5B1BH 2HW3A 2JPSA 4XK4A 1VSMA 1BM9A 4EMKC 4FVUA 2DFHA 2L9SA 5AFUH 1Z6RA 1FKOA 1E0EA 2B8AA 1XX5A 4GO1A 4E1NA 2NOHA 2FMYA 2P9UB 1HKTA 4WTOB 1X58A 1T3VA 3H9NA 2KKZA 1N78A 1KRPA 1R0CB 4BR5A 1Q7YC 2DA6A 2Q0RA 1G3WA 1QVFP 2XASA 2MWOA 3TW6A 2VASA 4WXDA 1HSJA 1FBUA 3VEPA 1KU3A 4BEHB 3LWLA 4BHCA 4M6YA 3CCEQ 4KH6A 2OA8A 1S9EA 5B8HA 1RI7A 4OAZA 3P8BB 4QW2A 3N5NX 4XN0A 3M9AA 4N0AA 2GIZA 1A6IA 5AJ3K 4FQGA 1YHQI 2F5DA 4FT2A 5AQWA 2ELKA 3S16J 1VQOI 4RMOA 2DBBA 3K10A 3J81Z 3K5NA 3I53A 4EMGA 2A1SA 1HD3A 2F4IA 3C6HA 2VG5A 4EA5A 5LL6Z 2GTDA 3WG7H 2HBWA 4G94A 1AD5A 4HDUA 1IXSB 2ZAEA 3O3GA 1G83A 3WGIA 4EPCA 3AVNA 3CQYA 5C24A 2LNBA 3BZCA 3IKMA 2H1LA 4PFOA 1VIEA 2QYZA 1SHGA 1VQ9A 4BE1A 1SZ2A 5HRNA 2J6KA 1LPQA 3K9JA 1X9MA 3ZEUB 3H3ZA 5A2QK 2ESNA 1OV3A 1YCYA 5HDKA 3PNVA 1BI2A 5HROA 3P1GA 3QWYA 2DCEA 1Y1VJ 3QYBA 3CCEI 1QVGS 2K5LA 3M3YJ 3KD5E 2K4BA 1MMNA 3BTIA 4CZIA 4RBOA 3THXB 3H5AA 1MJBA 5HDNA 1VQMN 2DK3A 4BR0A 4R1HA 3FSPA 1NLPC 2XDDA 4LG3A 2J7IA 4B8XA 1VQ4I 3GF2A 4NC8A 4JRKA 4N41A 2PY5A 2RVCA 3QPTA 2YV0X 3GX4X 4FLYA 3BTLA 1YITI 3CMMA 4JAXA 2FF3B 1FLIA 4PUSA 1VQ5T 2FB7A 1N32K 3GXOA 4Y15A 2DPNA 4B48A 4QS7A 2V1NA 1Z67A 2HNZA 4FJ7A 4M77F 3V7RA 3CM6A 5GMKl 2NUBA 5D5WB 4IPAA 1GXQA 2OU2A 2K5FA 2I0NA 2XK0A 3LA7A 3AVHA 4EV0A 1LFPA 1X6OA 4MLOA 4IG0A 2RHXA 3VF4A 5J2NA 3CBOA 2K57A 5J1UA 2W1OA 2XAFA 3QBXA 4OGCA 3I0WA 2DEUA 1UZCA 2ZGWA 5GAN4 3FB9A 5F2RA 2VQFK 4F52A 1U0JA 1KC8C 2KY9A 1YYVA 1NWKA 3G6ET 4UQGA 4YFNF 4CF2A 3UA7A 1HRHA 2E6LA 1W70A 4JI6K 4CJPA 4UNFA 4QVZA 4UVBA 1VQ7A 2Y1JA 1FBSA 2AQFA 2P5VA 4AHCA 2BW3B 2FQ4A 2WADA 1MW7A 1JXBA 2HOEA 1IF1A 4RCCA 4CYDA 3BEXA 4HZFA 3KKSA 2M9UA 2EGCA 4WCIA 4OVAA 1FXXA 4AIHA 1UHCA 1SSHA 5KCMA 4XRSA 3CCRT 3RMQA 2YX4A 1JCEA 2KLAA 3VETA 3RKQA 3CC4N 5DUKA 2JN6A 4F14A 3LWIA 4H03B 2XHKA 2M02A 2HQEA 2E4LA 4DEYA 1QSYA 2E7WA 4LF9K 2O8DB 2V52B 4HUGA 5CYVA 2X85A 2R7XA 5BREA 1XS9A 4B44A 1ZQ1A 3FEOA 1TGOA 3LDPA 4M78A 1XWLA 4QVDA 1OI1A 1I3QJ 5IWAK 1RDBA 2FPFA 1YW8A 2P81A 4RG8A 4WYBA 1CKAA 1VI0A 1NU0A 2XDVA 1T38A 1D8JA 3I56N 1Q95G 1YS7A 2NNWA 4JD2A 4RB1A 4M3ZA 5FKLA 1Z25A 1IRXA 1U84A 1QGPA 1I27A 4EVVA 3C2GA 3QKJA 2OQGA 2MA3A 1OU8A 1Y07A 2RKIA 3ZCMA 4DFMA 1DIZA 1WQWA 2HF4A 2OTJT 4CJ3A 3SCXA 2ADUA 1NK6A 3VYUB 1Q1HA 4M73A 1GBQA 3Q3SA 2JLEA 2IGMA 3FJ5A 3O8GA 2HTSA 1ACIA 2WAQA 1SKUB 4U0WA 3CO7C 2QWPA 3UKRA 1QCNA 2AKKA 3QPSA 2YX7A 3H45C 5HBMA 3KTQA 1VQKQ 3KK7A 1YJNN 2DL7A 3KHYA 4HNTA 2GA2A 1BUPA 3NMUA 2B6AA 5FU7C 1ARKA 2X6SA 2QDLA 2JT1A 2P9KA 2KRFA 3BOQA 1VQLI 1BI3A 1H3HA 2P6SA 1ZHIA 2DMNA 1SFUA 3QINA 1JL1A 3G4SI 2YUOA 4BY1J 1TWGJ 3HRTA 1ORPA 4PJOC 2MI6A 3LA2A 4CECA 1MU2A 5ECAA 4M3RA 3D4VA 2C0IA 4BDPA 1W5SA 3MN2A 4GVEA 1GLDG 1Z05A 1BOBA 1ETXA 4XU3A 2KFZA 2BY3A 3PIPA 2GOMA 3ABUA 2UUZA 3R0JA 3RJPA 1XSXA 1MMDA 1YWOA 2FEIA 5BN9A 4XTVA 1K4SA 5F1JA 3ERED 3FGUA 2JA7J 2XAJA 3CJRB 3MK6A 4L9JA 4E0DA 5DDGA 5TRDA 1CKBA 3KZBA 4J19A 3CC2A 2I8DA 1YT3A 2VXZA 1CZ9A 1HQEA 4IWVA 4E9HA 5BR8K 5KYNA 2DVEA 5CK9A 3JRIA 3ZQFA 3L1PA 4FVMA 5CQEA 3RR6A 3CJBA 2HBJA 3K4MA 4KT0E 1RI0A 4PJOD 3LL7A 1QMCA 3F9MA 1XDUA 3IWZA 5CR2A 4J5YA 1IRGA 3CCSA 4OPHA 1JXSA 3CC2T 2NLUA 3IAM2 3PSFA 5E1ZB 2IAIA 1X3WB 3HYFA 2EYQA 3JXUA 1ULYA 4AHSA 1RI9A 4CHOA 1X4PA 1X3NA 4A0YA 4WXCA 2X3WD 4ATOA 1LKXA 3R6NA 4RTUA 3QNOA 1N36K 1VOMA 2ECCA 1IW7F 3O1BA 3IUCA 3CLOA 3DWLA 5H6QA 1N33K 2GGRA 3EPZA 1U3OA 5D6FA 3MPUB 1DUXC 2KT0A 4BB7A 1EH8A 3B6OA 3HOVJ 5GAEJ 1XTDA 2SEMA 5J8CA 3H0DA 2E8AA 2R93J 3QDFA 2D0OA 2CGKA 4LF7K 4LF5K 1ETQA 4V2FA 1WGSA 2M0YA 2P8TA 3G71N 4E3SA 2AS5F 1JCFA 3S93A 2RA2A 3FZLA 4B1UB 1TNTA 1U2WA 1TWFJ 2LBFA 2L0KA 1XUPO 2OTLN 3SB2A 2UUCK 5HS8A 4EMKB 4EATA 4Y91A 4WXHA 1AHDP 4FX0A 3CCQA 2P9LB 4ASNA 2DIQA 2OZ6A 1NOYA 4DSFA 2QAZA 2HKOA 3RSEB 3FMRA 4DV1K 1VQ8Q 4XLPF 1WJRA 2KE9A 3VQ8A 4DV2K 2HL3A 3VSLA 3QYEA 2V1QA 4YNQA 1XCVA 3G71A 4FJ9A 1A6QA 4JDSA 2XGXA 2X6XA 2L01A 4AIJA 1N6QA 2HNYA 5GAHJ 1QQNA 1VQ9N 4IQ4A 1MUZA 1JKHA 1IDYA 2FOKA 1KD1R 2QKBA 1VF9A 3HP9A 1JJ2A 5JVHL 5FPNA 4W1UA 5AZJA 1M90O 4XR6A 1FMWA 1HYSA 4R5PA 1J7KA 2D1HA 1GLFO 2ZJRL 1BDGA 3LDOA 2DL4A 2PLYA 1VQLN 2HSTA 1U6GA 1NJIO 3KP4A 3DLRA 4FISA 3M9QA 4KHNA 2GBYA 1BC7C 2A5XA 3HXLA 2V8JA 1YTUA 4DZJA 2GM4A 2E1HA 2KT8A 5JLHA 3F0CA 2ETJA 2HS5A 1JBMA 4NQWA 1OVQA 2D1VA 2EAYA 4M3UA 2XV4S 3NAUA 1U5TC 2E2JJ 1GLAG 2ZWHA 3A01B 3F8FA 5J8FA 2EFOA 2FBKA 1DGRM 4N4NB 3WGGA 3SMPA 1E3OC 4MEXF 5KAFC 3WU2C 1KFZA 3CPWS 1VFCA 3SAFA 3VB2A 2NOIA 1E3HA 3CMAA 4FSXA 1KC8R 4YELA 1U4BA 2AXLA 5M5YJ 1KG7A 4GLKA 3VS1A 4B1XB 3GTKJ 2I7PA 4BRDA 2HI3A 2DDAA 4QQDA 2K9GA 1PYVA 1D5AA 2XDPA 2BIVA 1WSEA 1Q9YA 4BQZA 2EJFA 1JU5C 2DAOA 3RUXA 2V1UA 3HM5A 5HS7A 3CC2I 4L59A 4BQAA 4OMZA 5ILUA 2VKEA 1V5GA 4HX7A 2DIGA 3TVTA 3DLEA 1E2XA 2E3IA 2KFNA 1Y71A 4Z4EA 3LAPA 5GANf 2QENA 3E66A 2XKOA 4BU2A 1UGRB 2IGNA 4LD5A 1TQMA 1JLGA 2HOAA 3ZCOA 5GAOm 3BGRA 5IT9Z 1WKMA 5BOXA 3JTGA 2GV9A 4KN7X 2E2PA 5GANh 3B02A 3HFNA 5FLXE 5KCOA 1G5VA 3K59A 4IEJA 4KHPK 3FK6A 1KQ0A 1XQHA 4C2MJ 2QEXA 3EHQA 3DBHB 2L9VA 2UXXA 4EEFG 2GLOA 1F36A 3U6FA 5FU6B 4RLQA 2XGCA 3EE9A 4MMKA 1WPYA 2LKSA 2HR3A 4DLEA 3K7AJ 3TQ7P 5D6EA 3O4QA 3MX5A 2VBWA 4B4CA 2EWNA 3AAQA 1Q86C 5IHIA 3G4ST 4XEIA 3QPLA 2G8VA 3W2AA 3QG1A 4Q5WA 4HG2A 3FXRA 4IFEA 4AIKA 2XDBA 1SF9A 3SD4A 3BP8A 4YFUA 3MEUA 2RHIA 4GMJB 3IHUA 3K5MA 5D8KB 1MPGA 3HSCA 1V5EA 3MEAA 1FJLA 2LCCA 2L5QA 3QRFF 3KEYA 1T6SA 2KZVA 3OTOK 3SFIA 1LWYA 3VEYA 1UFMA 2DA2A 3L2ZA 2E88A 4JLGA 2IA2A 3A0HC 4KGXB 3HSBA 3CCJQ 3O8MA 4FL9A 1VQ9I 2R5YA 1BBZA 2QVOA 5DY9A 4BXXJ 3I3LA 2MFZA 3QLHA 3CCVI 4NS5A 3I59B 2OTLT 3ZT0A 5J39A 3KKRA 4EGZA 4J00A 2DOEA 2UZKA 2Y30A 3BR5A 1YITQ 3D45A 4BHPA 2HEQA 4M7DA 1S6QA 4ELYC 4FLVA 4NYNA 4IUVA 4LD6A 1VHXA 4G9ZA 1LW0A 4CC7A 1ZA2B 1PRLC 4U88A 3B6PA 3CWAA 2B4JA 4OFEA 2O8KA 4XTYA 4BQOA 3MWMA 3LA3A 4B24A 5CLSA 3RKWA 2E1CA 1ATRA 1POGA 2BANA 4AU7A 3FXKA 4M45A 2XSJC 1TL8A 3V9SA 3VQ5A 3HGYA 3SV4A 4J9IA 2ELHA 1KYWA 3AG3H 1MSEC 2WC9A 1K9MR 4HW0A 3F6VA 2IT0A 3NWSA 5LJWA 2R7ZJ 4YTLA 4G7OF 1FWZA 3GBGA 4LFCK 4C0DB 1G3TA 4FETA 1E4GT 1NGGA 3F73A 3RQ4A 1BC8C 2WY7Q 2VWBA 3PO4A 1WJSA 1HU0A 1J6ZA 2EW3A 4UNOA 1S1NA 1KK7A 1Q82C 1AEYA 4I2OA 2CFOA 1YRNA 3O5ZA 5I2MA 4WK8F 1IJJA 2RQPA 4KGZB 4IOAF 2DFIA 3V1QA 3ZOBA 1V55H 1ASVA 3HTSB 1T95A 5DM7F 1YAGA 3KWGA 1FBQA 1C1AA 4KH5A 1N75A 2ITMA 1XQSC 4V2GA 3BTJA 3FM5A 2FXUA 4AFSC 1HMVA 2VE9A 3CUQB 1TV6A 1ZUUA 1KA8A 1WSHA 3OB9A 1O7LA 3LOCA 2L54A 3I56Q 1FW6A 3T19A 4AD9A 3VESA 4BEHA 2DJZA 3NRVA 5BNGA 1WEFA 4M75C 5F64A 1A0NB 4DQSA 2BGGA 3NWTA 3D5RC 2LKXA 2BGCA 1TUDA 3AG1H 5AONA 4AYBA 3M07A 2HHSA 4UC4A 4UVCA 4LDWA 3J81O 3QIOA 1TK8A 2OYQA 2HYFA 3OIQA 2XY6A 5J1EA 3MZHA 4PKCC 3GEZA 5HP1A 4I7FA 3FHNA 3GOIA 1Z9CA 2R7TA 2Z1DA 1PU8A 2COBA 2Z33A 2EINH 5GTIC 4XTWA 4ENKA 3E6BA 4IRHA 2WV0A 2QGUA 2F48A 2HVQA 2KISA 2I10A 1QCFA 5FDLA 3ZYYX 1BGXT 2EX3A 4PJLA 1ZRFA 4XM3A 4OPKA 3KYDB 4X0GA 1W4MA 5GPCA 4BRMA 4B23A 2CUEA 4KT5C 3TAQA 3DU5A 3BF1A 3KP5A 3RCOA 4XLAA 5HL7L 1X19A 4RLFA 3EQLF 2OUMA 4XRMA 3RKXA 2VKDA 4I7HA 1S5LC 2ZSIB 4JRQA 2ZM6K 3M8SA 1QVGP 3PMIA 2OAWA 1WHJA 3A02A 5HLGA 3FHZA 3REBB 3CWSA 2YHTA 3I56I 1T44A 3S3NA 2ABKA 2EKOA 2C06A 5E18F 3OJSA 2P0WA 4GYIA 2MW8A 1JKPC 3F10A 1M1KO 5CVRA 3SHFA 3Q0WA 1BI4B 5BPIA 3SXYA 4F91B 5ICGA 4FU6A 3MN5A 5IP9J 5H1SQ 4LDUA 3C18A 3HI0A 1RKTA 1S1WA 3VJPA 2H3JA 2M0CA 5GANe 5AQPA 4OU0A 4BJTA 4LITA 1ZSZC 3HPOA 2PMZN 1QQMA 1Y0UA 4P5OA 3PUFA 1SSFA 2ZMEA 4BI3A 3S41A 3OR2C 4OIPF 4M7DE 1O3QA 3M8QA 2YHBA 2HHVA 1S6PA 1WJBA 1WJDA 1E6GA 4Z4FA 3ZMVA 5IY5H 3CCST 2L7ZA 2QEXI 4GLMA 3KP2A 4CSWA 1DJ7B 2E4HA 1HLUA 5ICCA 3LSJA 4M75E 3DB4A 2RQQA 3CCRA 3OYDA 2Y0SA 3WNHA 2ROLA 3F72A 2ASOA 1W0HA 2VL8A 5AYFA 2E3HA 1K8AC 4HWIA 1MWMA 4CICA 3FLGA 5A0GA 3VQBA 5F0CA 1UCRA 3A5MC 1VQKN 4Z4IA 4CZHA 2HHQA 4P96A 3NGIA 4IKFA 5D6WA 4BY6C 1YW7A 3EG9B 4H0OA 2XAGA 5JVGF 5DLQE 1YO5C 3E19A 1M8VA 1C0FA 2ISZA 1HNZK 1YVUA 4CYCB 4QQ6A 1VAZA 1IXRC 2DPUA 3H08A 2JOYA 1TC3C 2RQRA 5CCAA 2JG6A 1U1TA 5H2FC 1OZ2A 1Y7XA 2A37A 1VQ9T 3ID6A 1R4NB 3HKSA 2BOLA 1RTHA 4JX5A 1B9MA 1OCOH 4I6ZA 3WXIA 4BRFA 2RO0A 1MDUB 2Y0MA 4AIDA 3EFRA 3CMET 2YKNA 2OF7A 4HTUA 5C44J 1Y97A 4B3RK 1WGXA 1UOCA 3IHOA 1IGUA 3VGLA 3HM8A 3SUPA 4R79A 4A3IJ 2NRAC 1XDSA 2EIJH 5K1YA 1G4DA 1JKQC 1XI1A 3FE1A 5M5WJ 3SPYA 1HNIA 1NK5A 4FL6A 5ADXH 4RM3A 2VKVA 5C4JJ 4XIDA 1AKHB 5DM6F 3ZFJA 2R5YB 3TAMA 3NH1A 4QAGA 3HSFA 1QRYA 1FMVA 4IXAA 1APLC 3LWFA 2V9KA 1BW5A 3A8HB 2EZKA 5B5EC 1TUCA 1RAGB 1S1UA 1BIUA 3CQ8A 3M8FA 2YU9J 3D5LA 4BKXA 2IEKA 1PM3A 2JW4A 5FKMA 2HQRA 1GCPA 3FJPA 4N4IA 4DNCA 2YRDA 1Y8QB 3C4SA 2YLCA 2W48A 2JZYA 3CXCA 3OYAA 2RPNA 1TKTA 2NS7A 3MKDA 2EGEA 2DA1A 2KP6A 3TANA 5C15A 3THVA 3ZX2A 3HBLA 4CEFA 4JHDA 3KK2A 4Y33A 2QQSA 1QZ5A 2Z16A 4PL8A 1JE8A 4PFPA 1SV5A 3KWIA 2IS4A 1HKCA 3FXOA 2KDSA 1ABQA 2K9LA 4DYQA 3PIOF 2O03A 2VJ4A 1KFDA 2K3YA 2GFUA 4EM2A 3FF5A 3UKGA 5GAN2 3H0FA 3HVTA 3T1BA 1TZLA 3PUBA 3OSSC 3H9JA 4FM2A 4WFBL 1YNZA 1AOJA 2FL7A 3RSEA 4C8QB 3G4SQ 4FWSA 1AZEA 3RVCA 4ZZDA 1YQAA 3GZ6A 1W97L 3N4MA 4J6XA 3HP6A 3WTXC 1YN8A 2P4TA 4ID1A 1B9DA 1JLAA 1Y39A 2NRTA 2W57A 4KDPA 4DG1A 5J26A 4G6TB 3W2WA 2FHDA 2B0LA 3TO9A 5KAIC 4YOVA 2JXBA 1LWEA 2EPFA 1QLYA 2DRMA 2VGMA 1BIZA 5IPAA 2L9NA 3RYRA 1C0MA 2PMZA 3F8BA 4OMLA 3QFPA 4BR2A 4X66K 4AFZC 1R49A 3KP7A 3NF7A 1FX7A 3RBBB 3SWNB 1WQ2A 3G73A 4BRHA 4OB1B 3MKYB 1M90U 2AXTC 2DJNA 4FTHA 2BHYA 4CD1A 4CFCA 4A3BJ 4CCOA 4OPAA 2KHMA 4W5TA 3HZ6A 1T6CA 4NCGA 1W2BA 1P7JA 4J6WA 3RNJA 1YX3A 1B1BA 1WDXA 5KYYA 1NJIU 4W5OA 3S1QJ 4EGYA 4PK4A 4AHVA 4PQUA 5EC7A 3BFMA 2RH2A 4PFZA 2VXFA 1DKGD 2ZJQF 4FWPA 1VQOT 2Y1IA 1X1BA 3BLYA 2GF7A 1TVRA 1YHQT 7AT1B 1OCZH 2DW4A 1RIOH 3LFUA 1ESVA 1VQPI 3JCMb 1KG2A 3CBMA 4BE2A 4FYYB 3IRQA 8AT1B 5M9OA 3FLCO 1JEGA 2W04A 2JM9A 1OR7C 2MIOA 5CQXA 3VODA 3MMYB 1I8FA 3HB9A 4RW8A 4KTWA 4HHTA 3TR8A 3C7NA 2FU4A 4A3JJ 5D8LB 4GV6A 4GGGA 2VB6A 3L7WA 1LVAA 3G71T 1TKXA 2C0OA 2XIDA 3PQJA 2OJED 4AHUA 1XN7A 3HSEA 4KICA 4HSBA 2CUFA 4M7XA 3Q9VA 5D6XA 3IH4A 3F70A 2DXBA 4E4HA 1RNLA 2Z5UA 4CHQA 2Y48A 5E1WA 2NYSA 2F2WA 4JLHA 1A5JA 5B1AH 1KQ9A 1MBHA 3R2XC 4PL6A 1ZUYA 3C1DA 4AFQC 1DP7P 1MMSA 4U7DA 3QP5A 4Z4GA 4O0IA 5LHGA 5LY3A 1BA5A 4L18B 2MYSA 1NE8A 3L4IA 1WZOA 5F04A 5CQGA 1BA0A 3OHRA 4HCCA 2DYSH 1QZEA 4UV8A 3JSOA 3OW2A 2RJDA 3PSIA 3MCZA 2ZXHA 4GDFA 2IS1A 5GAOq 4ZGDB 4F3OA 4H0EA 5HKCA 1YJWQ 4IUUA 3DOKA 5KTQA 1V29B 1T98A 3CDHA 2XIGA 3CPWP 3CCUT 3H3VK 2RNGA 3AA2A 3D2FA 2G3RA 4AI4A 3C2BA 3MP1A 4A61A 1MUDA 4DF8A 2KAFA 1YG2A 3SZGA 3JCMg 2DI3A 2CS3A 2K3PA 5FU7B 2DA3A 1XG7A 3CJTB 3RMDA 3ER0A 4NL3A 1U1SA 5AQLA 2CO5A 4AM6A 3IFRA 2J5PA 1SPKA 5GAMd 5K14A 2O8DA 4L0YB 2ME6A 1TSFA 4MIMA 2X6WA 3QB0A 1M1GA 2RC4A 4FLZA 3ALYA 1YI2Q 4N4OB 4XIUA 1XC5A 4HVWA 2D0BA 4LK0F 5AN4A 1K76A 1G2BA 1J5EK 2EYWA 3EG2A 3TO7A 1H8KA 2KJBA 3NHGA 2K9SA 3LP0A 1IV8A 3K0SA 2OD5A 3T8TA 1T0FA 2M34A 1OH7A 3AA5X 1KAYA 3BJAA 1B72B 3KD1E 4CJ7A 2KK4A 4KGVB 1XHZA 1K78A 1KVCA 4BY7J 3ASNH 3H0HA 4CEZA 3L00A 2OX7A 3AHUA 1T05A 1PUFB 4YEJA 2M1HA 1GLEG 2M16A 5LEJA 5DUIA 2GZWA 4LIUA 1LDDA 3OV8A 4Q4ZF 3PX4A 1KSWA 3L3VA 3J7ZO 5JI6A 3NH0A 2B9SA 5TGTA 2OPPA 2NOBA 1WFWA 5GJWB 4B43A 1QHTA 1S3XA 3AV9A 2X6OA 1NJIR 4PJOA 1LAVA 4IG3A 2RHUA 3DP7A 4M75F 1JJ2P 4DV5K 4Y4RA 5AQFA 4C3IJ 1GT0C 5AZIA 3EG0A 3PE0A 1YITN 2QDYB 5DS9A 1P2FA 3H36A 4Y7NJ 3TSQA 3F0ZA 1Q7YO 1VSLA 4IOAL 4IX7A 1K73U 3RR7A 1BI1A 3EETA 4J7IA 1KD1O 2HKNA 4M7DF 1M3BA 3CJQB 1O3RA 1PVSA 5EXWA 1TT5B 5CVJA 4JS5A 2CMPA 4JI5K 3WG9A 3VV0A 2F8SA 1L3UA 4KHUA 2BXYA 4ZGJB 3T1AA 3ZP5A 2A40A 1T0FC 3W3CA 2BZTA 3O8VA 3HFOA 4M3TA 3ATUA 2V51B 4E89A 3AA4A 2FRYA 1ZBXA 5FU6C 3VQDA 5FFZA 3VDXA 4QKUA 2J6FA 3VS7A 2NOJB 4EJZA 1TAUA 1VQKT 4XAXB 2X4XA 1OOTA 1BK2A 3H46O 2IGKA 3VS2A 2Y4XA 2E5NA 4CJLA 4XORA 2PVOB 3DTEA 5E20A 2RK2A 1D1AA 2ZQBA 2HB5A 3I0TA 2RN2A 1C6VX 4K42A 5C2FA 5KRSA 1FEXA 4O5FA 1N6AA 4C9YA 4CZJA 4YIIA 3OYIA 3DB3A 1KQ1A 1V54H 4RS8A 4Y28E 2HKQB 1QVFA 2HMIA 3LX7A 2A3ZA 1NHAA 2AQEA 1NNEA 1GVDA 4BWJA 4PY5A 3U8XA 4FJLA 2R5ZA 3O9UA 2CYZB 1G99A 1F43A 2YHWA 1VQ7T 2XO7A 3IS9A 1KQSM 4CC3A 2NOZA 4ANJA 1VQ5A 4EP5A 3BR2A 4Q5VA 1C0TA 2YKMA 3X2QH 2OZMA 3DLGA 4CGFA 4IO9L 4JK9A 3KLOA 3K4LA 2A05A 4D1QA 5KE3A 1C1CA 3FDRA 2GUPA 4RA2A 3VF2A 4YRVA 1BCMA 1AWWA 2JNGA 1NG2A 1MWKA 5DCFA 1S8NA 2M7AA 4DQRA 1FZPB 4AQYK 1T0JA 3KYCB 4EW4A 2YPRA 1V3FA 3G6EN 1PKSA 5FPMA 5D5VB 4C2UA 2DT6A 3QNNA 2JRMA 1GLLO 3X24B 1XNRK 5CVVA 4CJRA 3J80Z 4C1NK 1WBBA 2ASPA 2LYCA 1GOAA 3X28B 2K02A 4RM2A 2A1RA 4XLNF 3I4PA 3OVNA 1P4AA 2E1ZA 2BY0A 4FM4B 1TL3A 2R0QC 1FN7A 2OTJA 2P9IB 1ZARA 4RGRA 2YUSA 4J2DA 1IKYA 2R7YA 2DN0A 2E34A 3WTZA 3NHNA 3NGYA 2WA0A 1JJ6C 3CMEA 4OLAA 3OS1A 4NXMK 1PDNC 1KC8U 4KBOA 4YIFA 2KVQG 2WOMA 1B72A 4HNVA 1NOZA 2KZZA 1JUMA 2HZTA 1UG1A 2LQKA 1AU7A 1EH6A 4A62A 3S2DJ 2DE0X 2JA8J 1QQIA 1IG9A 1JT6A 3A2KA 2VV5A 3IRXA 4A2AA 4CZEA 3WQUA 5LJ3g 4DV3K 3TSPA 1RAIB 3P83D 3NQOA 2K5IA 3EH1A 2RPIA 2CP2A 1IHWA 3H3UA 3E9GA 3D5SC 3E9LA 2UYTA 4LG0B 2PYJA 1NLVA 2NAZA 3KEQA 1AVZC 2X4WA 4JNEA 4XKBA 3HO1A 5KCHA 1VQ8A 2YJEA 3IKTA 2LY2A 4F93B 3P4IA 2JWKA 1BI0A 4G12A 3EH2A 1YCSB 3TAGA 1K73C 3SUNA 2XGEA 4R8HA 2CRGA 2DOFA 3MEDA 1WBDA 1KO9A 2COYA 1LQ1A 4EJYA 4B3MK 2FZCB 1NGAA 3LCNA 4MGRA 2YX6A 2ISYA 1YQMA 2O8CB 2Q1ZB 4JKFA 4O5BA 1LDKB 2HYGD 3CCJN 5GAGJ 3AO4A 2HQHA 2EA2A 4CEOA 1JLQA 1RT7A 2LNVA 1JHHA 1K73O 4II2A 3DBLB 4XTXA 1N34K 2NWMA 4PNOA 2DQLA 4FJKA 1PD1A 1FT9A 1PSEA 3WXMB 3TDZC 3M8EA 1KHIA 5A0LA 3VYHB 4DOZA 2EILH 1MBKA 4L9NA 1OH6A 4LB5A 2YSQA 2IIRA 4IHYA 3THYA 1RKWA 2BVLA 2YHXA 1MUNA 2E6ZA 2EHGA 3M56A 3AVCA 4A3KJ 4CEAA 1E3PA 4E2FB 3V7CA 2KDOA 5EDNA 5GIOA 3ZQLA 3G4SA 2RI2A 1X2MA 3EHRA 3M6GA 3TEEA 5J2QA 4XSZF 2IPQX 4DTUA 4FZYA 3TPQA 1SL2A 4B22A 1M8MA 1NPPA 4O0JA 4CF0A 3CVSA 1HSTA 3J8AA 2HQXA 5KYYB 5GINA 2F9WA 3H0GJ 4C8QE 2W41A 3GMEA 3VU3C 2VYTA 1ZRDA 2HNHA 2WAFA 1KU9A 2FPEA 1GRIA 4I6MA 3ZT4A 4DBHA 4IZ9A 4LOCA 2RQUA 3NF8A 3QHSA 4B1VA 1E17A 3C0CA 4KHSA 3DXJF 3GG4A 1WSUA 3WTWC 3QO3A 4M3DA 1F1BB 2XF5A 4UXNA 4CI6A 4BGDA 4YORA 1ZYQA 2KDZA 5SWMA 3DKWA 1M30A 4RMNA 3KEOA 1PD0A 3EYZA 1IGQA 1PVEA 1WHMA 5AQYA 4KT6A 1I5ZA 5EG2A 3THXA 4DWIA 4Z88A 2M51A 3VA3A 1BR1A 1X75C 3VFZA 3ZSWA 4ENMA 1R9TJ 3P31A 2Q2EB 3EZWA 4A69C 1OYXA 2HDAA 1T08B 3ZLJA 3JSMA 5ELZA 1TU0B 2P0QA 2KT1A 5HOOA 4MLEA 2DNUA 4OMMA 3CCQT 1P4XA 1A5XA 2P9PB 3D6RA 5TISC 1K79A 4E7SA 2X4YA 2NRWA 1F21A 3TTDA 1VQPA 3CJ7A 3JB9I 3RPUD 4IOXA 2XKPA 2ZXWH 3CG7A 2PVGB 2QKMB 3FX3A 4J9HA 2CZ1B 5AQRA 2BZXA 3TP0A 5GAEP 5CPRB 4D0PA 1P92A 4E6KG 5GMKi 2PZSA 1HR0K 2MWPA 2GXAA 1OYYA 4ZN3A 2HCKA 2CYYA 3RMAA 5GAMj 2FBIA 1Y96A 3V8JA 3PT9A 3GLXA 4XNFA 5L3BA 4IIOA 2W6KA 4JI4K 3SQ2A 4M63C 4AF1A 4A4FA 1Q9XA 2P5KA 4NC7A 5KYXA 1XG1A 3T5XA 3A8OB 1N5YA 3CF5F 1YXQA 2FNAA 3CCUQ 5C6SA 5E3OA 3EKSA 4B9XA 2A5WA 3REOA 4GYGA 1TUGB 4AM7A 2ZJPL 3FRNA 2LG4A 4O55A 4LFAK 1QSLA 1GUUA 1QBJA 1CXQA 3FM3A 2KI7A 3NAEA 2CUBA 1YRNB 4C8QA 3QETA 5BPMA 3AL0C 2Z9OA 4J2AA 1B4AA 3AVKA 4IOCF 2Q31A 3RMCA 1SMTA 4I99C 3I55I 4ELVA 4S05A 4M7AC 4E9EA 2VKHA 4JX6A 4R0KA 3K5OA 2LVSA 3K1PA 3TAFA 3AAPA 4HX4A 1ITYA 2ZBKA 1KCFA 4FOIA 4L5IA 3PQKA 2XG8D 2EQMA 1P59A 1G2HA 4PHTX 5L3CA 4RW9A 2V6EA 3I64A 3ROUA 1JUSA 3F8CA 3CERA 3QJYA 3I33A 1ZRCA 4RTWA 4H4OA 1KU7A 4RTVA 3I5RA 3EYIA 4KFCA 3P9IA 1ORKA 1W7PD 1C6VA 4N56A 2FNPA 4DR5K 3QBYA 1O3TA 3CD6I 3HKZN 2DMPA 2IOCA 5DK5A 4DR2K 4BC4A 1UAAA 2FX0A 1RNHA 4C8QC 4CIFA 2YUPA 4CA0A 5L8RE 4Q47A 3LW5E 4DTPA 1RUNA 1TLHB 1IRFA 1FIAA 3ECHA 1Q86U 3K57A 3JRBA 4BQNA 3PLAA 2CFXA 4II3A 3RMSA 5LRSA 3DQVC 3J81K 1VQMA 1VK0A 4FO0A 3VQ6A 2KTQA 3HOUJ 4N9HA 2O8FB 5H20A 2I7NA 2VXEA 4V19K 4E9FA 5I21A 4MO7A 2VGNA 1VQOQ 1ENHA 2A68F 1HYVA 5EF6A 2LCSA 2KXCA 4JKGA 3AAFA 1TH7A 4AVPA 3H0IA 4X9CA 1N77A 1SD4A 2VG7A 3HIFA 3SZPA 3SQ4A 1BU1A 4EZ9A 2JQ7A 3VF6A 1OKJA 3G1MA 4WQ4A 4NLBA 4BYYA 3FXLA 1DTQA 1UGVA 1XQPA 2LF8A 3BJOA 1ZGWA 2LMJA 5AQJA 2X3XD 3TREA 2CW7A 3QICA 4DYCA 2LK2A 5EEHA 2M0OA 2HMPA 2L4AA 1XNQK 3NF9A 1MMGA 4M3BA 3NPFA 2Q2EA 4H5RA 4HDVA 3KTUA 2CV0A 3O80A 2E65A 3J7YP 3OYEA 3ZMUA 1B07A 3ME9A 4M7DG 5CR4A 4RGSA 4UY8I 1X1AA 3GZ5A 2FRWA 2W6LA 3IC7A 3H8ZA 2A36A 4CFBA 5CY4A 3M4OJ 1Y1WJ 1SVOA 3CMAI 3NFAA 1VQLA 4BD3A 3UIQA 1CF7A 4A5BA 2OPSA 4CEDA 4P9UA 5F27A 2RB6A 1QVTA 1I1GA 3FIWA 1V76A 1X9WA 4CZCA 3QERA 5AQVA 3C65A 2P5LC 2RGVA 3LP2A 4OLBA 4LF8K 3SMSA 2AO9A 2RNAA 2KMTA 2ECZA 4CJUA 1TBXA 4J9EA 4LJZF 3D2EB 2DBKA 4CW7B 1KG1A 1JXOA 2E2IJ 2LX7A 3CCQN 4M41A 5CHZA 5GAN6 4I0AA 3DJCA 5C42A 1S7AA 4JKCA 4ABZA 2L7FP 4O8UA 3H5NA 3GTLJ 1YIJN 1YS6A 2AZSA 1Z7UA 2KQRA 1M1KU 4CJQA 4F3QA 1KD1U 4JX4A 3A5ZB 4PZJA 5F0FA 1MBGA 4A54A 5D5UB 3CCMI 2MOXA 2F5FA 1USSA 3JREA 4K11A 4R56A 4BVOA 3QBWA 4EQQA 3U23A 1BI4A 2DZ9A 3OYGA 1RAEB 2QZ8A 4FK4A 4OIRF 1T03A 1LV5A 3R61A 4K0KK 4B9MA 1RDDA 3TARA 3QDKA 1RZ4A 4IF4A 5DTDA 2P7CB 1MDMB 4XRSG 2ZZDA 3E9OA 1QQOA 2PI0A 3UDCA 1IZ6A 3TDUC 4IO8A 3N4QA 3WUHA 1WFXA 4HV6A 1R4MB 1BW6A 1Q18A 1YI2T 3NCIA 4MHGA 1E4FT 4Y1DA 1P9QC 4CEBA 3A8GB 3DPLC 4JK1X 1RFQA 3M0SA 4WF9L 4HCZA 1UWBA 3ATVA 3AVJA 2X35A 2J5OA 5F0HA 3ZL7C 1TK0A 1X69A 1XMAA 3CP2A 4K2EA 3O08A 1IBLK 4LD0A 2ZPBB 2ZFUA 4KBMB 2V7FA 2BEOA 1Q8IA 2IC3A 1GFDA 2DO7A 4DEXA 2HXIA 2K2MA 2JS0A 4DV4K 5C2DA 3CCUN 3BUZB 2E1YA 1X2QA 1K4US 2VT2A 4LY7A 3L2CA 1IO2A 3CMAQ 1LW2A 1XCBA 5ADXA 3DI6A 1QKXA 4II1A 2IG0A 3R6MA 3ENBA 1JXEA 4CVNE 3CJ9A 2BHZA 4BDYA 3LSTA 5JLWA 1BL3A 4WCEL 3ZT2A 3ZX0A 2FMLA 4H0XB 2VT3A 3LYIA 2RMOA 1NLOC 1NM7A 1IB8A 4YOXA 5TKYA 5CYMA 5BPNA 3H35A 2F1LA 3A5NC 3SBGA 1Q7YU 2F4MB 1B34A 2M4GA 4LC9B 4EZ6A 3KPHA 2JMAA 1RR8C 3TAPA 2B63J 4FPBA 1QTMA 4DSEA 4B9QA 4U7BA 1VQ7I 3T1HK 4FJXA 3LL3A 4XTUA 1K0SA 2Y2ZA 2FRHA 2HGCA 3A1YA 1U48A 4BREA 3CTAA 4D8KA 4CGJA 4C92F 2V8IA 5GAMf 3C3WA 4UUSA 1SANA 3VERA 4N5SA 3H1VX 1J3TA 4ZYHA 3K9TA 1JI8A 4A93J 1XNIA 4XH4A 1S3JA 2FF4A 3GE1A 2MABA 1ZBSA 3O6WA 4FWNA 4XLCA 3JB9J 4DQQA 3ZN1A 1Z21A 4YOQA 4M7AG 4CEQA 1QS4A 2X0LA 5KI6A 3ZQCA 1YJ9T 4DBQA 3J80K 3A8MB 1MNEA 4XQ3A 1QCOA 3EE8A 3MEEA 3K58A 1M3CA 1B92A 2VJ5A 3NNQA 2W84A 2M8GX 2WTUA 2M45A 2FZGB 4BRIA 4RAZA 2F5KA 1CLQA 1HOMA 5AQTA 3DXMA 2ZO4A 4L5JA 2O3FA 4DW6A 5GAN5 3LH5A 3TOAA 2X74A 2PJPA 1I50J 4DQPA 1WHKA 5DM7R 4FJIA 3N97A 4B3OA 5HLIA 3ZSXA 3T1YK 1K6OA 2WAQN 1UB9A 1ACMB 3OA9A 3DRSA 3SLCA 3ENOA 2O8FA 4PSXA 1W0UA 4HKEA 2HMAA 3ABKH 4QS8A 2QSFX 4KULA 3CJAA 4B1RA 4LDYA 4M78C 1UFFA 4HT9A 1LFBA 5E3NA 2A6TA 2HKXA 2KRHA 5C10A 4M42A 2YS9A 2LC2A 2CV1A 2CGPA 3CJNA 2Z1GA 3C7NB 1ZR4A 4EIAA 4M72A 4B3TK 3DBRB 5LRRA 3FZMA 3FHFA 3CD6N 1REPC 1O7FA 1HUXA 2DFFA 2EJ9A 3ONQA 1HNXK 4LB6B 4NLCA 4LSNA 1WI7A 3BR0A 5K5QA 2VQLA 3E01A 3Q5FA 4CCNA 4FW1A 4HCKA 4M3YA 1MUYA 3MAJA 1I4K1 3O9TA 1VQ4A 5E84A 2KHOA 2RK1A 5H6RA 4RDUA 4DV0K 2F2EA 2EPDA 1XOVA 2M1BA 3HBTA 1G59A 3SDGA 4ELZC 3WEEB 1IBKK 4DMNA 5LEKA 4I0BA 3QEIA 2G8FA 2YI1A 1VQ5I 5GADJ 2HF3A 2ID6A 1KQ2A 3G4SN 3BY6A 1KC8O 4DR3K 4E7JA 1WI3A 2DL3A 4J9CA 2PFUA 4DQIA 1XMKA 2ZJ2A 2LJ0A 1VQLQ 3QIIA 1UHWA 2EFNA 3OSGA 1IRZA 1I6HJ 2J4RA 5A2QE 1OQYA 3G2BA 3TCJA 4GKJK 3QWXX 1BOTO 1Z3YA 4NO7A 1BIBA 1KSPA 4CZKA 3PV8A 4LH4A 3K69A 1YE9A 2P4WA 5CO7A 3D1NI 2G9WA 4LF6K 3MX2A 3CCSI 4PKGA 3U1DA 4IUPA 4E7HA 3LDQA 2BTFA 5L3GA 2K9NA 3W2VA 2ZPFB 2NOLA 3B6CA 4E7LA 1ZK8A 4LDXA 2ZF5O 2UUBK 2YWWA 3Q9SA 1R77A 1K7AA 3I9QA 2AK5A 3CCUI 3V7SA 1OR7A 4H5VA 1QHHD 3BDDA 1MD0A 1R71A 3BG6A 3HHTB 1G6NA 4OP0A 2PAVA 4OMPA 3M0PA 2GQQA 1EBMA 3QYFA 2KYBA 2JGUA 2O8CA 2P9PA 2FSWA 3KVGA 3L2QA 2P9SA 1ZTRA 4M6XA 2K79A 5IAYA 4MDXA 5DD8A 1S1XA 1YJNA 4M6VA 3FZVA 3EL2A 4A6DA 5EZGA 5C0MA 2KW4A 4CE9A 2HBLA 2CT3A 1TWBA 1MDMA 4BL0B 4CCKA 4OB2B 1YLFA 4HOBA 2RJEA 3ABTA 4KNYA 1SAUA 3CMEQ 2QK0A 1AWCA 1W5TA 4J9GA 4KB0A 4DV7K 1ZH5A 4FWLA 4FJNA 2E19A 2V4JC 2M3AA 4JBAA 4MZTA 2DFUA 3QEXA 2B7EA 1K83J 4KUIA 1I5LA 3A1PA 3LALA 3VA0A 3CCSQ 1VQLT 2WAEA 1R00A 4OMNA 2AJQA 5FD6A 1S9HA 4YOTA 2ENMA 5IT9O 3LSRA 2R7DA 5A2QZ 3U3GA 3KLEA 1PJRA 4M7AF 1QWFA 2E6MA 4BR7A 1HPZA 3IDHA 3OBWA 2JTFA 4CGIA 4LDVA 3VWBA 4M7AD 4X6AJ 1ABOA 1NKEA 4XU2A 1HKSA 3KP6A 1IAWA 3OW2S 2FSJA 2HHHK 3QJ6A 1S7OA 1LWWA 4CJKA 5C4XJ 3UKRB 2CH4A 2VIXA 1TWCJ 1HKQA 4JI0K 3AL0B 3RPQA 1VTNC 4DUZK 4OFHA 2D5RA 3AY9A 2WSCE 2D0QB 3T9NA 3R60A 4E70A 5KQDA 3DLLL 4ZZLA 3ML6A 2VG6A 4NB4A 2MC3A 4F3TA 3JAMO 1IN7A 2R7UA 4QLCU 3TGNA 4HV5A 2FJ1A 4KV8A 3MKZA 4CHZA 2EZLA 1NEBA 3IKVA 2JTVA 2OPQA 1LOJA 5GAOr 1VQMQ 4E7ZA 2OPTA 1SHFA 3PM1A 2X48A 5LGUA 3LWHA 1SRLA 2CH5A 2DEQA 4CRIA 2D0NA 1VYVA 4DR1K 4JKHA 2DXCA 4KFBA 3MEXA 1IO6A 2DYBA 2W42A 1KLMA 4JKEA 1SFXA 4A5NA 5GJVB 4P9FA 1FOKA 1HQCA 5EOYA 2KSSA 2IA1A 2JVVA 4UB6C 1KIKA 4TSXA 5J3LA 2F2XA 4XKVA 4ILJA 3WEEA 1R59O 4G1QA 3NVKA 2DYRH 1LEAA 3HRMA 4XN3A 1J54A 4ELTA 1ZLMA 1CZBA 3BG9A 2K27A 2ZCWA 1R7JA 2QLZA 2Z1IA 4BJ5C 4CJSA 2R7OA 1GOCA 3O9SA 1CZAN 3MEWA 3JRFA 1T8IA 4H4KC 4IDHA 1YUWA 1Z77A 2LVMA 3MKWB 5AQGA 1Q86O 2HHTA 3JRZA 3KBGA 1ZR2A 1RLPC 3L2VA 3SI6A 4EJTA 1GFCA 2O61A 4C1NI 2QQ9A 5DCMA 4H8KA 2KPMA 3A8LB 1W2BS 4DTJA 4DU4A 4M77D 3CCYA 4CH7A 4CFDA 3LSIA 4OGEA 1VQ8N 4CIEA 3A4CA 2C6YA 4C92C 4AUXA 4KHYA 3L3UA 1YI2N 3QFUA 1WSFA 3E5XA 4JK8A 2QF7A 3GFMA 3HRGA 1D09B 2H3GX 5AFUA 1RBRA 3S2HJ 3VTIA 2ELJA 4JYAK 2YRVA 2DTOA 3ZQIA 3JCMV 2G0EA 4IHWA 2NRRA 1VQPN 2R92J 2P51A 3OMCA 3META 3THKA 4B9TA 4JI7K 3GUDA 2JA2A 2STTA 3M58A 3IG1A 2E5QA 4O4GA 2GWKA 2OQRA 4EMHA 1UEBA 1Q7YR 4C0FA 1R5HA 1NH3A 1S5JA 2RI5A 3FXUA 1UDLA 2WACA 4BROA 1EH7A 1S6LA 4D5CA 3VQAA 5L3DA 3CCEA 3CUOA 1TKDA 4C30A 3MZ8A 2EFWA 2E20A 3LSHA 4B9NA 4L6V5 1LWVA 1NPRA 3ECOA 4KI6A 2V7YA 2LC4A 1VQ8T 3FBIB 2JMCA 1ATNA 1IH7A 2LY1A 5GMKe 5K5OA 3ZX3A 4PLIA 3X26B 2JSCA 3FZKA 4KO0A 2AP1A 1ZG1A 3CMYA 4A3DJ 3SQ1A 4M9SA 1LCUA 1KQSS 4YIRX 3NVMA 1HQUA 2OC6A 9ATCB 3JB9D 5AQZA 3VQ7A 2YR2A 3HRUA 3L8BA 1KQSA 4XKCA 3MCAB 4EVIA 1HJDA 3CCVA 2DJIA 4M77E 2DFEA 1NGEA 5D3GA 2QXFA 1G8XA 2ZSHB 5HNFA 3CCLA 2HDDA 3WODF 4KRTA 1PRMC 1EIFA 2G8UA 4A2UA 5F6FA 3MFKA 3CDIA 2RM4A 1OCCH 2NRVA 2FBVA 2G7UA 3G6EA 1EFNA 3I0XA 3JR9A 2VJIA 1LUJB 3M8JA 1Q81R 3JCMh 4ZYDA 4LNPA 5J2MA 5HLHA 1D3BA 1RDUA 1FYLA 3SV3A 1RR7A 4IQJA 2O5RA 4NDLA 1TUYA 3U9GA 4QIWN 1QQCA 2XF7A 3CCVQ 2VVKA 1EJ9A 4XMYA 4D5FA 3D0PA 2L3QA 3S6WA 1M4ZA 1IBMK 1WAFA 1SL1A 3OYMA 1MJAA 1ZBJA 1RT5A 2VN2A 4IXCA 2CJJA 3F8NA 2OFKA 2ZC2A 4F17A 4IVNA 3K2AA 3OYJA 4UUSB 3RQIA 1GXPA 2XPVA 5JICA 1YWPA 4HQMA 1QA6A 3INZA 3I8BA 4OAYA 4D6WA 1MH3A 5AIPA 3P8HA 1X9JA 4FYDA 4MEYF 5JHUA 5J2PA 1QPMA 3ELKA 2HNIA 4BBSJ 1IREB 3L42A 3UATA 5IOZA 1T0HA 4JS4A 3G7ZA 3QODA 4HUFA 4L8RB 3WVEB 2D0PA 4IUQA 3G1OA 3CP8A 4BUGA 2H8HA 2CQQA 2BVMA 5LHIA 2X4JA 2O6GE 1HSQA 3OW2P 4DZPA 4B8AB 4R55A 5CZ2A 4FYXB 4I6MB 2EQRA 3CQXA 2PMUA 3BQYA 3PO5A 4J9DA 1SC7A 3CCEN 3RWUA 3JRAA 3TOBA 4RG2A 3Q7CA 1RBVA 4I01A 2ZNYA 3UKUB 2K4JA 4B9SA 3J7YJ 4B3SK 2ED1A 4A4KA 3L9FA 2DA5A 4HF2A 2WWYA 3HXMA 4NC6A 2O88A 4GY2B 1HW1A 4Y3OA 3CCRN 5KGXA 3T3FA 4FWOA 1IXCA 2RF0A 1NK0A 4DK9A 1K8AR 4ZC3A 2E5LK 2RJFA 3J7AO 2JTEA 2DD4A 2UV1A 2ZGYA 1WH7A 2W7NA 1WNLA 3H1QA 5KYWB 2NS8A 3KLIA 3NFCA 2O8BA 3MWPA 1A5VA 4I76A 5FLMJ 2DXIA 2KGTA 3UA6A 4J01A 2JUFA 4YFXF 3WNGA 1RTIA 2QKKA 1RT2A 3CESA 2VQEK 1T6DA 4DSIA 2RN8A 1M1EB 1K8KB 3SWNA 2OTLI 4QWQA 2A41A 2HDCA 5GAOn 1VQPT 3CCVT 5J3BA 1Q86R 1WXTA 1MV0B 2E36A 3ENHA 1EXQA 4EAHD 3J80E 2CWEA 2UXDK 2EZIA 4KB1A 4CCMA 5FJ8J 3VGMA 3MO8A 4FZZA 3LAJA 4M77A 2QYOA 4H0YB 3U9ZA 2XD0A 4I2PA 4CHPA 1C0WA 4FSVA 5JMVA 1K4TA 1HBXG 2F7TA 3CQZJ 1D1BA 2JPBA 1LPLA 4C0GA 2YJFA 3ULRB 1U9NA 2GCXA 4ESJA 3TBIA 2NOEA 4FE4A 2OJ2A 2ZE2A 2V8KA 4AVZA 1H92A 5CJ9A 4HCBA 4OJRA 3BDPA 4AYBN 1TUUA 1HKBA 2FBTA 4F7UB 5M1PA 3ZETA 1L5UA 5M3FJ 3PL8A 5KN8A 3BZ6A 4M3EA 2V6CA 2QK9A 2L7MP 1WWXA 1LVKA 4RTFD 3M3ZA 2HPMA 1IV6A 5HNHA 5KPTA 3HDDA 4M71A 1QWEA 2KRNA 4H5TA 2K3FA 3ZQ7A 3T8RA 2VC0A 1R6RA 2KBTA 4JKDA 2DD5A 4CF9A 4FIBA 1NK4A 4QQGA 4CZFA 2HPIA 1SL0A 4IHXA 1OCTC 4M9XA 1VQ6A 3E0JB 5LD2C 1LDJA 4FJ8A 2D9TA 4JJCA 5SZTA 2HU9A 1YQLA 2QQBA 2KYMA 3HSRA 3RYPA 5EYRA 5FFXA 1BYMA 2JHJA 1ZG5A 2QWRA 4C2TA 2QI2A 3VRYA 3G0ZA 1VSFA 1K8KA 2ETHA 1AT1B 4AT1B 1ZGAA 1WVRA 4K25A 1I0CA 1X4OA 3ZBDA 4KYWA 4LLGF 4A12A 2ZKZA 2LP0A 2QG9B 5HS9A 2R5ZB 4I9LA 2FYKA 5AQOA 1FY7A 2LJ1A 5KQ8A 5BMZA 2OTJI 5AQQA 4N9IA 1YVNA 4ITVA 5HRPA 2EV0A 1L3LA 4C0ZA 5BS6A 4PJJA 3NTHA 4PJMA 4KA4A 3U3YA 3FMSA 2XHIA 3CJ1A 1H1VA 3CCLQ 4CCHA 1H3ZA 2BYVE 1WLJA 1E3MA 2CH0A 3QU6A 5BN8A 2AA4A 4DBFA 3UNGC 4O3MA 2DF6A 4CZMA 3S9HA 4GV3A 1QNTA 1UJYA 4JZ4A 2M9HA 5DEQA 1ZBIA 3KK1A 4IIMA 1K6YA 4RW6A 3AO5A 1J53A 4Y52J 3SUOA 3CF5L 5J4YA 1E7OA 3P7NA 3CLQA 2JRTA 1V1CA 2HD0A 4OF1A 2LDMA 2SRCA 1ETOA 2CH6A 1ETYA 4NUBA 4LK1F 3S6IA 1U8RA 2WC2A 4OO1J 2DY4A 2W25A 3L1AA 2P9SB 2ATQA 3VEZA 1IGNA 5K5RA 2JT4A 5L3FA 2O9VA 3VENA 3EO3A 2NUPB 3T69A 5D4RA 4CJVA 2CGJA 1O9SA 1HW2A 4CGDA 4M7YA 2QCOA 4AH9A 2K6DA 1FOXA 2DTZA 2PTKA 3P38A 3VS5A 3M54A 3MDQA 1FTTA 2EV6A 2UWMA 1VQMT 2W0ZA 3QU3A 4F04B 2FUG2 1ZC6A 3ZT1A 1XHXA 4IHTA 2EZHA 3M53A 1PCXA 5IP7J 1R58A 3L2WA 5CYQA 4IRIA 1DT9A 3F5TA 4F8RA 5FLXK 4BRKA 4GFBA 2G8KA 1LOTB 4BI8B 1LEBA 1EETA 1OJLA 3ID8A 5AQIA 4CZZA 1TQIA 2HBPA 2W85A 4CJ5A 4C8OA 2GQVA 1HXDA 1VQNT 2FD5A 2FSKA 3M0QA 1S72A 2E2HJ 1YIJT 2VBZA 1W9HA 2XPUA 3O2PE 5GIPA 3MXJA 2J05A 2O4IA 5BPDA 1WOQA 2X1EA 2A42A 2RQWA 2E6NA 4EA4A 5TKWA 4BGAA 3K1MA 4CBUA 4C8QF 2Q3SA 1LJOA 4CYCA 3URGA 4LFUA 2LD5A 1FOYA 2QASA 5E1XA 3GFIA 2LDUA 5KPRA 2QA4I 3KE2A 4HT8A 2LMDA 2NUZA 2DTRA 4RTYA 3TEDA 5I2SA 1U2VA 2IP2A 2EA4A 3EUHC 4ZYEA 3GL1A 3H5RA 2VUBA 4Z4CA 1SMYF 1RT3A 4OKKA 2BH1A 3DKXA 1H89C 1QU3A 1DU0A 1SFKA 4ETSA 2KJCA 1XC9A 4CO8A 3U4LA 1Z3XA 1AWOA 4HLYA 2VOOA 1NGJA 3NTKA 2GBZA 2FBXA 3ZQGA 4DKWA 5GAGP 3QYGB 3BE3A 1YI2I 3NGZA 5EEAA 4FJMA 3TW7A 3OBYA 2M8EA 1HYZA 3VRZA 1C0GA 2ZJPF 2L89A 4XLEA 4BDZA 3EKUA 3QOPA 3JSCA 1WPKA 3X25B 3FXMA 3L6QA 2PNIA 2GXBA 2HVIA 3ZXSA 1WN7A 1NG7A