4E7JA

Pfv integrase target capture complex, apo form (tcc-apo), at 3.15 a resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 98
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7jA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7jA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7jA03
1FKOA 3CM6A 3F9KA 4CJVA 4C8LA 4CK3A 1S5JA 4E89A 4QOZB 4B9TA 1T03A 2PYJA 2QQRA 3PV8A 1WSGA 4II1A 3ASMA 4H4MA 3I0SA 5HROA 1L5UA 3MP1A 5KH6A 2DTUA 2GFAA 1A5XA 2LVMA 4DTNA 3QESA 4NCGA 2RJFA 1C0TA 3V9WA 1YT3A 2EX3A 2Z1HA 1L3SA 2YRVA 4OKKA 2EQMA 4FW1A 4J2EA 2R58A 2RHUA 3MEEA 4DFMA 4RG2A 3P8DA 3SUQA 4J2BA 1HPZA 3V1QA 1FKPA 1ASVA 1ZBFA 1U47A 2G8FA 1BI4B 1HYSA 2R57A 2IGIA 3C94A 2RPIA 3FDRA 1L3TA 3UWNA 3MEWA 4IBNA 5HP1A 4CJTA 4AHVA 3OS1A 3NH0A 2HQXA 4E3SA 4HUEA 3PX6A 4HCCA 2D0AA 4B9NA 4ZHRA 4FW2A 4KO0A 3LAKA 2X74A 3KLEA 1U4BA 3BGRA 1KLNA 1GOAA 2IOCA 3TAGA 5CY4A 5KE3A 3OYJA 2P5OA 3RMCA 4W5RA 4IUTA 2RHZA 3QJ6A 3SZ2A 4CJUA 3LALA 4B9XA 1JLEA 3DI6A 5J2MA 3KUFA 4XIUA 1XHXA 4NS5A 5IN1A 3NH2A 5KGXA 3F70A 2YNFA 3QIIA 4M3ZA 2A1SA 2E4LA 3C6TA 3G10A 1VSIA 3M8QA 4M3UA 2M0OA 1CLQA 4DSKA 4O5BA 3VQ6A 2M16A 4CK1A 4AHRA 3E9FA 3QLHA 1HNVA 3RTVA 3QBYA 3TANA 1DTQA 3AV9A 4OLAA 1TL1A 4FLZA 4DTOA 1RDDA 4FVMA 2PQWA 3OYMA 4FYDA 2VWKA 4NYNA 1W9HA 3CFPA 3PX4A 3JSMA 1LW2A 4FM2A 4MQ3A 3KD1E 1TVRA 5KTQA 4Z4HA 2XHBA 1VRUA 1VSLA 3T1AA 3ZT0A 1IG9A 4N56A 2BKDN 4FZZA 4CEOA 4BWJA 2XO7A 1MHNA 4KKOA 3NGIA 4IFYA 2KZMA 3SUOA 4HCZA 1H3ZA 3VA3A 4C8KA 1IH7A 2B8AA 3EY1A 2L3RA 3O8VA 1HMVA 2JTFA 3HYFA 4EP5A 1ZBLA 3LANA 3H6ZA 4CJQA 4Y1DA 2HVIA 4Z4FA 3DLKA 2X4YA 2OPRA 4B9UA 1RDCA 3NGYA 2X6SA 5KRSA 1RBRA 3FEOA 1OI1A 4E7HA 3KKSA 3D45A 2YKMA 2PY5A 2RI3A 3NAEA 4CGDA 1EKEA 2EQJA 3KD5E 4K8XA 4ZTFA 3OY9A 1R0AA 4ELVA 2DAQA 3NTKA 1GOBA 3NHGA 3MEVA 2GF7A 1T8EA 1BI4A 3VN5A 4UQGA 2FBTA 1O1WA 4CJEA 4DS4A 3OYEA 3SYZA 3TAFA 3ZSXA 3WNEA 4CF9A 4CJSA 1WSHA 4F3TA 4J2AA 2YHAA 1SL1A 1SUQA 3ZSWA 4KHYA 3OA6A 1WAJA 2HHVA 3FFIA 2YNIA 1CZ9A 1TGOA 2EQKA 4DQPA 3HSTB 2ZE2A 3QNOA 3V9SA 3MEGA 2HNZA 4O44A 1JLGA 3NF8A 3LLRA 3O4NA 4JLHA 2BGGA 3MEUA 2VYTA 1NK8A 4H4OA 1BGXT 3SQ4A 1WGSA 4FZXC 3PX0A 2P1JA 4FU6A 4M3TA 3LAMA 3OYGA 3PFSA 4CIGA 1RT7A 3V1RA 4KHSA 3T3FA 3WNGA 1KHCA 5J2QA 1WSIA 1RBVA 3O4QA 4F2SA 2X35A 3HM9A 3P1GA 3MECA 3ITHA 3E9GA 1IKYA 3TARA 3ZT4A 2Y1IA 2F8TA 2HHTA 4EP4A 3AVBA 1S9EA 3AVGA 3UT1A 4FXDA 4W5OA 3U6FA 3AVHA 4DSFA 1NK9A 1VSHA 4CFDA 5FRMA 3CG7A 2G8UA 2D0CA 2QXFA 2RF2A 3ZSYA 1EETA 4KREA 3DOKA 1LWCA 3VQAA 1VK0A 4DFPA 1RBUA 1KFDA 4CHNA 1NJZA 3H08A 4I7FA 3ZT3A 3S3OA 2YHBA 1QS4A 1S6PA 4IUPA 4YNQA 1RT5A 2HHUA 2P0KA 3L2QA 1GOCA 1NK6A 2XDPA 2HVHA 1NKEA 3MXMA 4PWDA 3SI6A 4OLBA 2XK0A 3T19A 3SQ0A 2FHDA 3M8SA 1S1XA 4QQ6A 3ZSRA 1JXEA 4E1NA 4KB0A 1TKXA 4JRQA 3OYIA 1ASUA 3QIPA 3NTHA 3QEXA 4BE1A 2FC0A 4CFBA 4CESA 4GMJB 3C6UA 3OMGA 3TABA 3K5OA 4PLLA 3FLGA 2DFEA 2MWOA 1BIZA 3QEIA 5C24A 2DY4A 4E1MA 4NZGA 1Y97A 2MWPA 3RR8A 3CQ8A 4CEEA 4CGGA 3L2UA 3LZJA 3NH1A 4CEDA 2O4XB 2G8IA 4N4GA 5D3GA 3SD4A 3ASKA 1KTQA 1TKDA 4OGCA 1IKXA 1QSSA 1D9DA 1Q9YA 4F3OA 2HMIA 2NUBA 3HPGA 4CGJA 1YTAA 3LZIA 4H8KA 3V9XA 4CEBA 3DLMA 2L89A 3SQ2A 4FJ5A 4IUQA 3SV3A 3OYDA 3VQ9A 3S6WA 2VG5A 3Q1JA 4PL6A 1REVA 3H8ZA 3AO2A 3HO1A 2WACA 2RJCA 4AILC 2G8KA 5M9OA 1CXUA 3OYKA 3K59A 2XY6A 4DU3A 3AVAA 3AA4A 1WNSA 4Q5WA 2FBXA 1RCHA 1ITGA 3KLFA 4CK2A 1LV5A 4N76A 1JLFA 3OYCA 1YVUA 4FLVA 4CHOA 4GW6A 3F73A 2LRQA 1S1WA 1NKBA 3L3UA 3ALYA 3RMAA 2E6NA 3VQBA 1QQCA 4FL6A 2R7YA 2RI5A 4LSNA 2E5QA 3G0ZA 1L3VA 4O0JA 2Z1IA 4M42A 3GOXA 3LP3A 4DQSA 4M41A 2VWJA 3B6PA 4IFVA 3MP8A 3DLHA 4N41A 3V9UA 4CEQA 1ZBIA 4TSXA 4OKEA 1BQNA 1OYXA 3ULDA 3M9QA 5IAYA 1TK8A 4DG1A 2D5RA 3QEPA 4LH4A 3DLEA 3PO4A 2IC3A 3CFRA 1C1BA 1G15A 3JYTA 1CZBA 4FJ8A 3DB3A 5JS1A 2KFNA 1QSYA 1LWEA 4F4KA 4FJMA 1WJRA 2K3XA 3LPUA 3L3VA 1RDAA 1BIUA 5J2NA 3KK3A 1WSFA 5C42A 2BE2A 3AVNA 1NOZA 2BANA 1IKVA 3U3GA 4DQQA 4ELUA 2LSNA 4HTUA 4CHPA 1RTJA 3OS2A 2RKIA 4C8NA 4KHNA 2G8WA 5SWMA 4PLIA 1UAXA 4DSLA 2BIVA 3KTQA 2IAJA 3PMIA 1SKWA 2X4WA 3OYNA 1RT6A 1HYVA 2P51A 4RW7A 1S6QA 1NJXA 1WJQA 3OYFA 5T7BA 5CZ1A 4N47A 1L3UA 1JLCA 2D0BA 3HK2A 3PY8A 1JKHA 3K5LA 2OZMA 4A4HA 2XY5A 2HB5A 4CF1A 4CEZA 3HVTA 4N5SA 3OYHA 4IUUA 1SV5A 1RT2A 1S1VA 4FZYA 3HL8A 3KIOA 4KI6A 4I2PA 3CYMA 4AH9A 1XWLA 1SSFA 2B6AA 2RHXA 3BDPA 2EFIA 1HJRA 1BCMA 3DM2A 4QQDA 4IG0A 4B08A 1YTUA 2I5JA 4CFCA 1FK9A 3LGLA 4CJKA 5CYQA 5KE2A 3RRHA 1UA0A 4ELTA 3O3HA 2R5MA 2OA8A 2EKOA 1TAUA 1XI1A 1K6YA 3ZSVA 3HXMA 4E7JA 4RG8A 2EQUA 3AA2A 4FLWA 3P8HA 2KFZA 2HNDA 4Z4IA 3ZCMA 1BISA 3VQ4A 3WNHA 1KSPA 4KHQA 4B9SA 1X9MA 3ZEHA 2DFHA 2LCCA 3MO8A 2HHWA 1JL1A 1BQMA 2ZD1A 3V81A 2JLEA 3QO9A 1UWBA 2Z1JA 4AHTA 4O0IA 1KRPA 1T7PA 3ME9A 3DLGA 3TAQA 1NKCA 1T05A 2ZQBA 3K5MA 4IURA 4G1QA 3KKRA 3HP9A 1NJWA 2YNGA 4C8MA 4FK2A 1VRTA 2W42A 4CJPA 4I9LA 1ZBUA 3AVJA 3U3YA 4BDYA 3AVFA 3DRSA 1SKRA 4NCAA 4B3OA 3RMBA 3KK1A 4DU1A 1DTTA 4FM0A 4L8RB 4FJJA 3QEWA 4CGIA 4FJXA 4KTZA 4FCYA 4CIEA 2HHXA 2Z1GA 4L59A 4CFAA 1BL3A 4M3RA 1OZ2A 1B92A 3L42A 5C0MA 3E01A 1EP4A 4FJNA 4DSEA 2F5KA 5CZ2A 1XC9A 3P5JA 1DLOA 1LAVA 2IS3A 3RWUA 1WSEA 2GFUA 4LY7A 4HHTA 5HBMA 4DTXA 3I0RA 2HNYA 3L2WA 5CIUA 1IO2A 4PY5A 1HYZA 3NCIA 2O4IA 2ETJA 1UOCA 4C5EA 1G5VA 4EDUA 1B9FA 1ZYQA 4CJ3A 1TKTA 3THVA 4DTRA 5KCHA 4E0DA 3LP0A 4QQGA 4CJ5A 1S1TA 3OJSA 1U49A 4KV8A 1Q9XA 3NDKA 1N6QA 1D8YA 4B9MA 5C6SA 3VQ7A 3QERA 3MXJA 2HHSA 4M3WA 4X34A 4KI4A 1JLQA 3VQQA 3FC3A 3IG1A 3DMJA 3SJJA 1C1AA 4PA1A 5D6YA 2LTOA 4FLTA 1WJSA 5HRNA 1SKSA 3AO1A 2DIQA 3CEYA 3SCXA 2G3RA 4R5PA 2OYQA 4OPJA 2O4GA 4Z4EA 3LWLA 3EZ5A 4B8CA 4HUFA 5HRPA 4IUVA 4DSJA 3S3MA 4CF0A 4FJLA 2P5GA 1TL3A 4HVJA 2IG0A 2QK9A 1ASWA 4ICLA 3K58A 2OZSA 2QKKA 3HT3A 2KW4A 3HPHA 4PUOA 1SL0A 1WSJA 4Z4GA 3L2RA 4KPYA 1NK5A 4OPKA 3QETA 1RBSA 3ZSZA 4BWMA 3NGZA 1EX4A 4DLEA 4FJIA 4Z02A 3KK2A 1KLMA 4K8ZA 3SUPA 3ZT2A 3PO5A 3LGFA 1CXQA 4ZTJA 4BD3A 3DRRA 3LPTA 3L8BA 2E6LA 4DTJA 3QNNA 3ISNC 1VSJA 3QKJA 1KVAA 3SQ1A 2PZSA 1QE1A 4FK0A 3EAEA 2GV9A 4KTWA 2LDMA 4Z4CA 1XHZA 2GUIA 4I9QA 1RILA 3AVCA 4DWIA 3OMCA 4CIFA 1D5AA 3IRXA 3VQDA 2RJEA 3NF7A 3VA0A 1LAWA 4FJHA 2E6MA 2KTQA 2PYLA 4CHZA 3OYAA 4LD0A 3LH0A 3C95A 1JLAA 2JGUA 3DYAA 2YKNA 4DTSA 4CEAA 4CF2A 4OVAA 4BACA 1WLJA 5J2PA 1NK0A 5FROA 1N5YA 2RO0A 3NTIA 1HRHA 3DLRA 4IKFA 3ZSOA 1RT3A 3VQCA 4A4GA 2L8DA 4IDKA 3K5NA 1BCOA 3TAMA 1D9FA 1X1PA 4DTMA 2ATQA 3AO3A 4C5GA 4KTQA 3EYZA 1RTHA 1C0MA 3KJVA 1KCFA 4CERA 3KLHA 3TAEA 1I39A 1A5VA 1RT1A 5KI6A 2RI2A 3MP6A 2Y1JA 5EU7A 3OYLA 3RRGA 5E41A 3DOLA 3TWHA 5C25A 1VSKA 4W5QA 3OQ5A 1TAQA 3BDLA 4DTUA 4C8OA 1HNIA 3AVIA 2G8VA 2HW3A 4DLGA 4ID1A 1U48A 4FJKA 1Z25A 2RHIA 1W0HA 4N4IA 2BDPA 4DU4A 4QVZA 2Q3SA 4LD6A 1JXBA 4KHUA 3MAQA 3ZT1A 3DB4A 1NK7A 3V6DA 3SPYA 3NFAA 4RW8A 4KHWA 3AA5X 3V4IA 2O4XA 4FLYA 5K14A 2JZ2A 3PMTA 2AJQA 5D6WA 3TR8A 4AHCA 2OPSA 2M1HA 2RN2A 4F2RA 1TKZA 1XNIA 3AVMA 3NNQA 3VQPA 1J5OA 5KCOA 4F8RA 3MEAA 1C6VA 5KGWA 2XY7A 4E7IA 4BDZA 1C1CA 5CYMA 3LP2A 1MU2A 1NK4A 1SL2A 3LDSA 5FDLA 4BE0A 2HQEA 4M3YA 4YFUA 3META 3CM5A 5J39A 1RDBA 1VSEA 4N4HA 3S9HA 1RI0A 4OKJA 2F96A 3MXIA 4C5IA 3KLIA 3M8PA 4E19A 1TK0A 4NCBA 4GY5A 4KFBA 5KRTA 4HUGA 1A5WA 2G8HA 4QAGA 4ID5A 3HPOA 4DQIA 3M8RA 3OJUA 1RNHA 5JS2A 5D6XA 4O55A 3HVRA 4EZ9A 3UIQA 1QHTA 3LP1A 4LSLA 4MFBA 4JS4A 4PQUA 1U04A 1UA1A 2X4XA 4CRIA 3I8DA 1WAFA 3OS0A 2FBVA 4CJFA 4B8AB 2KZZA 4RW6A 3AVLA 2DIGA 3CFOA 1QTMA 2F8SA 3B6OA 4AHUA 2VG7A 3DRPA 1I3AA 3C4SA 3AO4A 4OGEA 4OVLA 4CGHA 3PNWC 2QQSA 4FJ7A 4M45A 1VSFA 4FLUA 1IKWA 3TI0A 1RBTA 1U45A 1RTDA 2FBYA 3QEVA 4J2DA 1JLBA 3SNNA 3VQ8A 4Q5VA 2K3YA 4B9VA 5HRRA 4AHSA 5DK5A 4FJ9A 3SUNA 4UC4A 2DFFA 4CE9A 1QSLA 2B4JA 2QKBA 3K57A 4CEFA 2HHQA 1S9GA 4C5HA 4CJ4A 4FLXA 3VQEA 1LW0A 4RW9A 3QINA 4CHQA 1OZ3A 4OJRA 2OPPA 1HQEA 3RMDA 3KLGA 1X9SA 1EXQA 2VG6A 4KAZA 5SZTA 4B9LA 3L2VA 1B9DA 4E7KA 3AA3A 5HLFA 5FRNA 2A1RA 1JL2A 3WNFA 3OVNA 5J1EA 4FM1A 3SV4A 3ZSQA 1LWFA 3AO5A 1KVBA 3DLBA 3V9ZA 5I3UA 2X78A 4A4FA 1TK5A 2WOMA 2NLUA 4BDPA 4KRFA 3MEDA 4DS5A 3K2PA 4DMNA 2IDOA 3V1OA 3NF6A 1WN7A 4DFJA 3HJFA 3VQ5A 4HCBA 5HRSA 2YV0X 2YNHA 3RR7A 4CECA 2WONA 3OB9A 4DQRA 3LX7A 4LH5A 3IS9A 1Z26A 2XY8A 4Y1CA 1BHLA 3SPZA 2RJDA 4O4GA 4RW4A 3LWMA 5J26A 4A4EA 3TAPA 4CJRA 3PUFA 2GBZA 3IAYA 4B9WA 1NOYA 3S3NA 2CKKA 4DSIA 3HP6A 4BE2A 4E7LA 3QIOA 3NF9A 4DF4A 4NYFA 4CF8A 4QW2A 1RT4A 1FXXA 2R5AA 1X9WA 4DF8A 2OPQA 4EZ6A 1HQUA 4QCLA 3A2FA 4CJLA 1J53A 2D9TA 4CJWA 2KQ2A 4FJGA 1F21A 3AVKA 4I2QA 2ITGA 1KFSA 1ZBHA 2EHGA 1VSMA 4KB1A 4W5TA 4WE1A 5I42A 4Z0UA 4JRPA 3O3GA 4FK4A 3LYIA 4W5NA 4M3XA 4DTPA 1NJYA 3D0PA 4IG3A 4CGFA 1C0UA 3O3FA 1S1UA 3NBPA 4DFKA 3OYBA 2BUDA 1J54A 2X6NA 1RTIA 5DMRA 1N27A 4CHYA 1VSDA 2RHYA 2B5JA 4CCHA 1Q8IA 4GVMA 3NE6A 1TV6A 4JS5A 2XRIA 1J9AA 1KVCA 4Q0BA 3P83D
chains in the Genus database with same CATH superfamily
2ZPBB 1NGIA 4R0KA 1UELB 2ZFWA 1X3UA 4B43A 1T03A 4O5FA 5BR8K 1AZGB 2L9SA 2K3BA 3ABLH 2QQRA 4HWIA 3CCJN 4U87A 1MDMB 1N3AA 2YT6A 3ASMA 4M75E 4H4MA 1OFCX 3BJOA 2DA5A 1RC9A 4XOPA 1Q82R 2DTUA 2GFAA 1A5XA 3EG0A 4AIHA 1HKGA 1BJZA 2P7VB 4V2GA 4WCEL 3JTGA 1IXCA 1ZK8A 2X1DA 3BG6A 1QQMA 2RJFA 4OF1A 3UF4A 2AXTC 2O8BA 1ZA1B 2Z1HA 2QASA 4A3LJ 5AQXA 2RE2A 1CSKA 1NGDA 1GFCA 4OKKA 1N32K 3KHYA 1Z7UA 1QVGS 1ATRA 2Y0MA 1MGQA 2OTJA 2HXOA 3A01A 1H9GA 2RHUA 4DFMA 3EYIA 3TTCA 4Y17A 5D8LB 2GCXA 4ZNXA 5IPAA 3SZPA 2QEXT 3GTOJ 3QPLA 3IFRA 1ZBFA 2LF7A 2VXZA 3C3WA 5FD5A 2A37A 3MWPA 2D5VA 1HF0A 2MC4A 1HYSA 5DEQA 3FDRA 1FLIA 1Q81O 3UWNA 2XC7A 4IBNA 1R59O 1NK2P 1G4DA 5JICA 4AIAA 5GMKl 2COWA 3T1HK 1AWXA 1R58A 4E3SA 4JD2B 4XH5A 1L3LA 1ZBJA 4HUEA 5DCFA 2X6YA 3M4OJ 1BG3A 2D0AA 4RUGA 3Q9VA 4B9NA 3SEQA 3TSZA 1BIBA 5J47A 5H2FC 1NG7A 3ZOBA 1M90C 3BGRA 4AI4A 4L6V5 5CY4A 1X9JA 1WJCA 5KE3A 3M0UA 4E1JA 2P5OA 2K4JA 4IUTA 4RMOA 1N6AA 3MKWB 3LALA 1N36K 2YDLA 4XN3A 3MWTA 2AQFA 1S5LC 1JLEA 4BBRJ 3FXQA 5KN9A 4KIBA 1YS6A 3KUFA 4IHVA 2M9UA 5KGXA 3F70A 1UE9A 5GAMj 2E4LA 3E5UA 1UB9A 4C0GA 4DEYA 3C6TA 2YXYA 4M3UA 1JGSA 1LDJA 1CLQA 3KETA 3ULEB 4CJ7A 2VBXA 5DCMA 1IV8A 1QVGA 3A4CA 3OMYA 2ZJQL 2VCPA 3VQ6A 5KAIC 3LM2A 3M3YJ 3BE3A 2P9IA 4BQOA 1VQ6N 1W0UA 5BPLA 4MO5A 1TU0B 4AHRA 4OINF 3E9FA 4LN2A 3RTVA 1QQOA 3GUDA 1NEBA 2W10A 3TANA 1D3YA 2RNAA 1YF5L 4OLAA 4FLZA 1RACB 4FVMA 2PQWA 3OYMA 4NYNA 3A8HB 4ILJA 1HD3A 1PSEA 3KP6A 1B3QA 1GCQA 1BWFO 1D4XA 3RNJA 4HQMA 4KUDK 1A31A 1TVRA 2RQWA 2XHBA 3FK6A 3AFHA 3OH9A 2HKNA 4C8QE 4CEOA 4BWJA 4UY8O 1MHNA 2RPNA 3TQNA 4P5OA 4CVNE 3UNGC 3R6OA 1MDMA 3ZN0A 2L3RA 4P96A 1HMVA 3HYFA 3QBXA 2YPRA 2DA3A 4CJQA 3TOBA 4F52A 3SEMA 4Y1DA 2EIMH 2L7KA 5JVGF 2OTJQ 3DLKA 3ZEUA 5FFXA 2KMUA 1XNQK 3JRHA 5AQUA 4LIVA 3AG2H 3TSQA 2CWEA 4KIFA 1PM3A 4YRVA 3JAMK 1A0NB 3PSFA 3CCMQ 1FBQA 4PUSA 2H27A 2X6SA 3R6NA 3H5RA 3J80E 3QYFA 4M63C 5BRFA 3SWNB 3FEOA 2YCHA 1U06A 1N9SA 2W0ZA 2PY5A 5KYXB 1YJWA 1EKEA 5AONA 4I98B 2E2PA 4BRDA 1U3OA 2ELKA 4ELVA 3PFIA 2VGMA 3NHGA 3MEVA 2F5DA 2XF7A 1T8EA 4CJEA 1A6QA 2ACJA 1ZX6A 4YOWA 4KA4A 4I01A 5C2FA 2OTJN 2DMUA 4GKKK 3FXOA 3G71Q 1X43A 3DPUA 2CGLA 1G2HA 4CJSA 2Q8KA 4M78E 4BHPA 4J7FA 4IRGA 4J2AA 3WEEB 4JD2A 3CC2Q 3ZSWA 4KHYA 1AOYA 3DKYA 2AXLA 2CJJA 5GPCA 1WHLA 1WAJA 2R5ZB 1VQ4I 2F4VK 2DMNA 3CC4T 3TL4X 1TGOA 1TP4A 3D7EO 3HSTB 1E3OC 3HSBA 1QCFA 2PQ8A 1VQ7Q 2ZPGB 2E6ZA 1VIEA 1AEYA 2HNZA 1NKUA 1U8RA 4QPOA 2EYXA 3O8GA 3HJEA 3IAS2 3H3NO 4JLHA 1Y71A 2EZLA 4CCLA 1BW5A 3G71N 2RB6A 2ESHA 2D0PA 1Z7LA 3PX0A 1MMNA 1HKBA 4M77D 4F7ZA 4BQLA 3OYGA 4JJCA 3CF5F 2RDPA 1GV2A 2O8EA 5LJ3h 4KHSA 1VQNT 3WNGA 2R7DA 3ULEA 1WSIA 3TSUA 1NGGA 2XICA 1DQUA 4Q47A 5CKHA 5BN8A 2EYYA 2DA6A 1RDUA 1VQ7N 3AY9A 1WRJA 2LKPA 3CCQA 2QWQA 2DQLA 3WXIA 3PM1A 1JRIA 1IKYA 2RAEA 4XSZF 2VXEA 2DLPA 2KHMA 2F8TA 3M1CA 4RTYA 2UUAK 2IT0A 2W00A 5CPRB 2MABA 1U6ZA 2EFPA 2K40A 3UT1A 2LP5A 1BI2A 5KQ8A 3EGXB 4CFDA 5FRMA 1U2VB 3CG7A 2G8UA 2D0CA 3ZSYA 4KREA 2AA4A 1VQMQ 4RS8A 1W70A 3JB9F 4H03B 1T33A 4BY6C 4ESJA 2ZPFB 4LD9K 2F4IA 1RNLA 2IAIA 4B22A 4C3JJ 3H08A 1NGNA 2JM8A 4VUBA 3HTRA 2C0TA 2WSFE 1NNEA 2ECBA 2QQAA 1HCRA 1RT5A 4PFPA 3EH2A 1ZG5A 3FXKA 1DPRA 4FETA 5DLQE 2UWMA 1YJ9I 5FLXE 2JHNA 1YJNT 4N4NB 3JCMc 5F04A 3CCRA 4BUPA 3CMAT 2JW4A 2PX9A 1T39A 2F4OB 3ML6A 3LSKA 1WLPB 3CJRB 3ZSRA 1H9TA 2C0IA 1YJWQ 3FHNA 3HRSA 2UXBK 4BXXJ 2Q36A 2DBMA 2ZCWA 1UHWA 4A93J 1EJ9A 1XUPO 4AG2C 2DE0X 3NTHA 2FSNA 3I55T 2ESNA 5LJ3e 2FB7A 1VQOQ 5IT9O 4CBUA 4RLFA 3OMGA 4BRPA 3TABA 1PKSA 1TBXA 4ANJA 3K5OA 4PLLA 3K2AA 1EBMA 3MCPA 2XPWA 2IS6A 5C24A 3NMZC 5GMKi 1Y97A 3RR8A 5EY4A 2W1OA 2FVUA 3LZJA 1YJWN 3P4IA 2O31A 3QSUA 3WGIA 1SEUA 1NJIO 3O6WA 1ETWA 1NGJA 4UV8A 5D3GA 3SD4A 5M1OA 2R5ZA 4BY9C 2DW4A 2GXGA 5L23A 3EFOA 2NVQJ 2NUZA 3UA6A 2O0YA 3F5TA 5CR2A 1VQKT 2BOLA 3LZIA 3V9XA 3DPTA 1WFXA 1Z21A 1QP2A 1W4SA 2L89A 4CC4B 3SV3A 3SQ2A 3VQ9A 1MD0A 2ZCFB 2VG5A 3T5XA 2OJED 3HXLA 2WACA 3HO1A 2AQEA 1YI2T 1M1FA 3ELKA 3PL8A 2RJCA 1SHFA 2G8KA 3R9PA 3T8TA 5M9OA 4H5WA 1P59A 1H88C 1Y64A 3D2EB 1IBLK 2XY6A 5HK0A 4JK7A 4MLOA 3EUKL 4MZMA 1RCHA 3J81K 2WBNA 3QJYA 1KU3A 1B72B 1LV5A 1WNLA 4K0KK 2GBYA 1JLFA 1ATSA 3OYCA 1MW7A 1XGNA 2XDBA 4BU2A 3R61A 5LRRA 4A0ZA 1S1WA 1NKBA 2V9KA 1T3VA 2M7BA 3ALYA 3CPWP 3D5SC 2H8WA 4DYCA 2E6NA 1QQCA 4FE7A 3EGXA 1VQ5I 4FL6A 3O1WA 4LG0B 2R7YA 3K4LA 2LY2A 1U2VA 3CJ9A 3LA2A 4LSNA 3N0UA 4A2AA 2ZSHB 2HCKA 2DCEA 2ID3A 2FBHA 3HFNA 4M42A 1OU8A 4JK8A 3G0QA 3V9UA 4C2MJ 3K2ZA 2KFDA 2MMPA 3H92A 4K42A 2K2MA 1BQNA 1DT9A 2JUFA 5CCAA 3ULDA 4OMQA 1M90R 3EDPA 3TPQA 3WTSC 3M9QA 1UECA 1TSFA 4MNUA 1HC8A 4NC6A 5EYRA 3BG3A 4LH4A 3WU1B 3M6GA 5GJWB 1TOVA 4JKHA 4XIDA 2HNHA 2IJLA 1K8AR 1SEMA 3E9PA 4L9JA 4DR2K 3MX2A 4FJ8A 2OAUA 3GTQJ 3DB3A 1I94K 3CXCS 1LWEA 4JLIA 4FJMA 2HR3A 2QWPA 3OIPA 2K3XA 2HQRA 3CCRN 1MZBA 2DTIA 3LM9A 5BOXA 2CYZB 1SFKA 3F8FA 4JRKA 4KIGA 2HEOA 3L3VA 1XMAA 4IEJA 3DU6A 4P55A 4B9QA 5C42A 1FWZA 1NOZA 2BANA 1IKVA 5DM7L 3QQAA 1KQSP 4DQQA 4DBQA 3X25B 2VXDA 4QT7A 4C8NA 2F2WA 2XAUA 4KHNA 3K10A 2KT1A 2DDBA 5M1QA 3KYCB 1FJLA 2G8WA 2B9SA 1UHFA 4PLIA 2G0EA 3PSIA 5DUIA 1K4SA 1PNJA 4DSLA 2BIVA 3RQ4A 4KGXB 1R36A 2L02A 4L9VA 1WZOA 1S6QA 1W36D 3OYFA 1IDZA 2E19A 1UFFA 4EHUA 3PNVA 4F04B 1O4XA 3K4BA 2DT5A 3VSKA 2IVNA 2NYSA 1H89C 4LFUA 4A53A 4N5SA 3CC7A 2OTJT 1KQ9A 1S1VA 1ZUKA 2QA4I 2L5QA 3KIOA 4KI6A 3CYMA 3RPQA 4GYIA 5DUKA 4JUVA 3V8KA 3CCMT 1TNTA 1WSUA 1S9HA 2B6AA 2OPTA 2RHXA 3V42A 1Z77A 1ARKA 3CXCA 2XMFA 3DM2A 2WBMA 1GLLO 4JX4A 2B7EA 3DKXA 2I5JA 3LGLA 1KC8O 2NUTB 2XHIA 2R5MA 3PUBA 1TAUA 1MMSA 2QWOA 3RJPA 1BOAA 1XI1A 3G3ZA 3KYDB 1DU6A 1K6YA 2LNHB 2UXNA 4RG8A 3G71T 4J5YA 2K85A 2EQUA 1FTZA 3BZ6A 5KN8A 3H5AA 2M9HA 2HNDA 4A57A 3VQ4A 3BFMA 1KSPA 4KHQA 3CC2T 3INZA 1X9MA 1KYZA 2DFHA 2LCCA 3GLLA 3TEEA 1YN8A 2L7FP 1QCNA 5LFAA 2P0QA 2XI9A 4OO1J 2Z1JA 1KRPA 2NS7A 1IN4A 2F48A 1VQ7T 1T6DA 2XROA 3TAQA 1NKCA 1T05A 4DIQA 3K5MA 2M1BA 1W1FA 1W2BP 2YHXA 2NOIA 2XD0A 3J80K 4C8MA 3JRIA 2F1LA 3SZTA 3DFGA 3J7AO 2OBPA 1R00A 3I0XA 2HOSA 3U3YA 1GDTA 1OH6A 1U78A 3OHRA 2YX4A 1R0BG 2HBJA 1YLFA 3RMBA 3RZDJ 5F0HA 4B4CA 1M2OA 3VU3C 2X0LA 1XCBA 5LRSA 5LGTA 1IREB 1ZHFA 4FM0A 3HOSA 4FJJA 3QEWA 3S2DJ 1XDSA 2ETHA 1OH8A 1YWOA 5IP7J 3G4SA 4KRTA 1Q1HA 2VBZA 2VUBA 3Q7BA 3S1MJ 3SZGA 4C23A 3ZN1A 1SD4A 4M3RA 1OZ2A 1B92A 1HYOA 3L42A 1YXQA 2NVXJ 5KYWB 2PMZA 1R6RA 3RKXA 1LWWA 3FB9A 2ZBKA 1VQMT 3GEZA 3W6VA 2BGCA 3FR0A 4LY7A 1K6OA 4DTXA 3LFKA 1JKOC 4EJWA 2LCSA 1HYZA 3LOCA 5FU7B 4F3QA 4J9CA 2LQKA 4WF9L 2O4IA 1YHQA 2ETJA 4BL0B 2P9PB 2XB5A 1UOCA 4C92B 4C5EA 2ASPA 2F5FA 2DF6A 5DLOA 4GBQA 1QNTA 5D4RA 4CJ3A 4HV5A 2F4MB 3IDHA 1YIOA 1ZELA 1D0ZA 3ZL7C 4HOBA 2HVSA 4XLPF 1K4US 4OB3B 3GFMA 3T0YA 3OJSA 1XMKA 1VQPA 1N8RO 5A2QE 5C6SA 4MQVA 3EE9A 1YJWT 3VQ7A 1L0OC 2R7SA 3QOPA 4GKJK 3K9KA 7AT1B 3I3LA 3MXJA 3VS0A 2D4WA 1JTXA 3LSJA 3HHGA 5IY5H 2HHSA 4GLKA 1PUEE 2E7XA 2D1VA 3JV3A 3VQQA 3O9TA 1VQOT 3CC7N 2EIJH 1YITA 3R60A 2ZXHA 3DTEA 5JVGL 5C10A 3LNQA 4FLTA 1JHHA 5HRNA 2DK5A 2LQ8A 3AO1A 3R0JA 3CEYA 3URGA 3SCXA 3QP5A 1AOJA 4R5PA 3CJQB 4M7AD 3J80Z 4B1YB 4XLFA 2JA6J 1ACMB 3CVSA 1NYFA 1MUYA 3LWLA 4YY3K 3GNGA 2NRRA 4PL8A 1H0MA 4HUFA 1DEJA 3ZLJA 2EK5A 4IUVA 4DSJA 4DKWA 4KISA 3S3MA 4CF0A 2N8GA 5FLXK 4PJOD 4L5JA 1WGXA 2QTVA 4NLBA 1XQPA 2IG0A 3EE8A 1ON2A 1IBKK 1E3PA 2VT2A 2OZSA 1IBMK 4PUOA 1JB0E 1WSJA 1MV0B 4Z4GA 3L2RA 2CQXA 1J75A 1SAZA 3HG9A 2VODA 4OPKA 1TC3C 3PTAA 2JZYA 3ZSZA 3NGZA 1J5EK 3VPRA 4DLEA 4Z02A 2DXUA 1SG5A 1JJ2S 1KLMA 2HNIA 3ID8A 4H5TA 4E4HA 3LGFA 4U7DA 4KHPK 2RREA 2ITMA 5AQKA 1AHJB 1E4FT 1JUSA 2OZ6A 5D5UB 3CJCA 3QNNA 4GV6A 4HNUA 4PCQA 4RTFD 2XAJA 2DMTA 4IIOA 3P7NA 3GTJJ 1X6GA 3VTIA 1KQ1A 4RTWA 2PZSA 1TTYA 4EW0A 4FK0A 3PGGA 3EAEA 3TBIA 2RN7A 4XTWA 4Z4CA 4J7IA 3LDNA 2FU4A 2L54A 3S1RJ 1YHQQ 4IQJA 3R4KA 3QP6A 4XLCA 2RJEA 3CCUI 1VNDA 1KG2A 2KDSA 4X1EA 1UGQB 4JKCA 2VLAA 3F2KA 2PYLA 1JE8A 4KGZB 3BTJA 4CHZA 4LD0A 3M9AA 2P9PA 4C92A 2DYBA 3ZX0A 1QW1A 5GAMe 2PMZN 1NG6A 4RMNA 5J2PA 3DBRB 1AWCA 1ORPA 1B4AA 2JMWA 4H0YB 2A69F 1NK3P 3NFCA 2EB7A 5HLHA 5L3CA 4GFBA 3GTMJ 3VS7A 1V4TA 1WVRA 3DLRA 1TYQB 4IKFA 4DYRA 3KLNA 5IWAK 2WB1A 2R7WA 1YHQN 1YITQ 2GOXB 2WTUA 3VEVA 3K5NA 1Q1VA 4J9GA 2KLAA 3OOPA 3QPHA 1JJ2A 2ATQA 1PD1A 4X64K 3AO3A 1GLCG 2DA7A 2GAUA 5FLXZ 3LL3A 3BTLA 1I39A 3JB9I 4HT9A 3X20B 2X48A 4BBSJ 2HQHA 4L18B 2Y1JA 1VQPN 3L4QA 3V7RA 5EU7A 5LMUK 3DLLA 3TO7A 2LQNA 2VE8A 4BJTA 5C25A 1EO1A 1F9NA 2OTLQ 1LKXA 2O3FA 1GL5A 1TAQA 1YITN 2KBTA 4EVVA 3LSPA 3VB2A 3WTUC 1GT0C 4DLGA 1C0FA 4FIBA 1YX3A 5IYDJ 4ID1A 4J8FA 3VF6A 4XKWA 1U48A 5M1NA 5ILSA 1UHMA 1T3LA 3SB2A 1HKTA 1YIJA 2K86A 2BDPA 4DU4A 2XRLA 3M58A 2Q3SA 3CP8A 1PG5B 2FEZA 2LY9A 3DQVC 3ZT1A 2KIQA 1NK7A 5CVIA 1OEBA 3BOQA 3A8OB 3V4IA 2O4XA 3EG2A 2AJQA 2OTLN 2NNNA 5D6WA 4XTUA 1KAZA 1TXQA 4RAZA 3CBOA 2HDAA 4XU1A 3W0LA 4F2RA 1P4WA 4ISGA 4YHHK 3FX3A 3VQPA 3DXJF 5E3NA 1YQMA 2VV5A 3JCMg 2P9LA 4M75C 2UXXA 2E65A 4YOTA 3NEUA 4DBRA 1YUWA 1OCOH 4JI7K 1TTHB 4U0VA 3WGHA 1M1KR 3F0CA 5TRDA 5JI6A 2NVYJ 3EG3A 2P81A 3NARA 4HLYA 1VSEA 3ZETA 2CSOA 2DNUA 1M2VB 4MDXA 1X58A 3DBHB 1XGOA 2XAGA 1K9MR 1I1SA 2IGOA 1ZRDA 3FJ5A 5D5WB 1ZQ3P 4MZTA 4DJAA 3KLIA 3QBWA 5LBQA 3M8PA 2C06A 3RKWA 2P9SB 1AD5A 4X62K 4JI5K 5IYCJ 1BC8C 1WIEA 5LJ5f 1A35A 4GY5A 1OVYA 2G6FX 1AKHB 4QWQA 2ZJPF 4HKEA 3CJ7A 4HUGA 2JN6A 4HPQA 2EZIA 5F2RA 3FIWA 4R79A 2P6TA 1MNMC 4DQIA 4BY7J 4FYYB 2NS0A 4U0YA 1WHMA 3D0SA 1VQLQ 1M30A 2Y9YA 1W1WE 1JCEA 4IDHA 1ZH5A 2W03A 1QHTA 2KT0A 4XICA 1HNXK 4K43A 3KLOA 4YPHA 1UCRA 4G6DA 3I8DA 1V54H 5LHGA 4Z94A 3F8MA 5AQWA 3HFOA 3LDQA 2EQIA 2VOOA 2JWKA 3LSRA 4D9JA 1F1ZA 2HL3A 2W40A 2EPDA 3KTUA 4JI0K 1C6VX 4OVLA 2Z9OA 3PNWC 2QQSA 1WEFA 2V4JC 4LF7K 2O88A 4C0DB 3FWEA 1RUWA 4LF6K 2DD5A 2DTZA 3CCQI 3PT9A 3TI0A 3QB0A 3J7YP 2JWTA 2R7QA 4BREA 2X1CA 3B02A 1SRLA 1K79A 5IT9Z 2E7WA 1T38A 1N77A 1RTDA 2FBYA 2O8XA 1JLBA 3CCEI 1VFCA 2DL3A 2XAQA 4CCKA 4Q5VA 2K3YA 2Y69H 3HTUA 3LMMA 1XOVA 1G3TA 1WCMJ 3K4NA 2DFFA 2KLOA 5L3EA 1UG0A 1KEAA 1HJOA 3DLLF 4CEFA 2HHQA 2DA9A 2YRDA 1LEBA 4CJ4A 1P9QC 4RW9A 3EPZA 2FA5A 3FHZA 3GLXA 1HQEA 2ENMA 2EVRA 1S8NA 5F0XA 3R6SA 2KRMA 1QVGP 1X2NA 4WQ4C 2EBPA 1WXBA 3H41A 2RC4A 3JRFA 2IP2A 4C8QC 2KXDA 2HTSA 4E7KA 1FEXA 2V6EA 3V7SA 1AWJA 2D45A 2M02A 3OVNA 3BPVA 3K4CA 3FISA 2OV7A 4MEXF 2ABKA 4FM1A 2GQIA 3M53A 3AO5A 4IIMA 3CCSA 3DLBA 1X3NA 3V9ZA 3R2XC 2IPOB 1VF9A 4A4FA 1SD6A 2WOMA 2NLUA 4KRFA 3W2AA 1M2VA 3C2GA 5AQIA 2MIOA 2IDOA 4ORZA 1T44A 2BY0A 2I2LA 3ASNH 3NF6A 2WAEA 1M4ZA 4M77C 3CP2A 3QYEA 4WXCA 1AVZC 2P9SA 1LNWA 2JRTA 5IHNA 5E8IA 3H6EA 5HDGA 1AKHA 2EYQA 3LX7A 4LH5A 4DQRA 3IS9A 2DKGA 4XORA 4B1RA 4Y1CA 3GDQA 4RCHA 2JTEA 3SPZA 2JT4A 1V5EA 4J6WA 4B8XA 1MKMA 3LWMA 4CZKA 2QWRA 3J7YJ 4B9WA 5A2QK 2GTDA 2LC2A 3ZR8X 1I4K1 2QDYB 2L3DA 3FXUA 2LMDA 2CP5A 2X9HA 3S3NA 2KEAA 1P7MA 4PKGA 3U8XA 1TZLA 4IPAA 3HP6A 1F4KA 1MGTA 3CF2A 5AQGA 1JT0A 1OX9A 2HZYA 3MWMA 2XUBA 3H0FA 3L6QA 2A6HF 1YW9A 1PSFA 4M77A 4G7ZF 2VJIA 4DYQA 4CF8A 3I58A 1FXXA 1X27A 1X9WA 1OCCH 4AVZA 1UB4A 1H1VA 1UJYA 5FPMA 3HPWA 2E2JJ 4ENNA 1HQUA 4ZN3A 4QCLA 3WE2A 2V9PA 4KICA 2F2VA 2D9TA 5GMKj 3L2ZA 4CJWA 2W6LA 3E66A 4M75F 3FJPA 3AVKA 1I50J 4I2QA 2Y2ZA 2CH5A 3BT9A 1KFSA 3SMPA 4DHYA 4KB1A 5KPZA 4HEA2 4Z0UA 3N4MA 3PO2J 3LYIA 2W7NA 2ZNYA 1ZBXA 5IXFA 2K9LA 1G99A 1LUJB 3D0PA 3L09A 4CGFA 2D1HA 1C0UA 3NBPA 2RNGA 3DV8A 4IO9F 2CT4A 3G1OA 2Z3YA 1RTIA 3QFUA 4CHYA 4B47A 4OMFB 4GLMA 2OX7A 1Q8IA 2KKOA 5C2DA 3GOIA 4S0HB 1P4XA 1N3CA 2IVMA 1Q86O 4IOAF 1SFOJ 5GAN4 4EMKC 5C12A 3MAJA 5GINA 5CKTA 1QQJA 4DOVA 3F9KA 4CJVA 5FW9A 2LP0A 4ENMA 1X1AA 2PBDA 3CCSQ 3PV8A 2FE3A 5LJ5h 3KPHA 1BUPA 5HROA 4PJOG 2QLZA 2BW3B 4WF2A 1A04A 2VBYA 2BE5F 2RVCA 4ILHA 5C3EJ 3QESA 5L8RE 4NCGA 1RR7A 1C0TA 3V9WA 1OV3A 4F91B 3UKRB 5GAOq 3JB9D 2H94A 2HDWA 4CZCA 2EX3A 4B1XB 2YRVA 1JT6A 5ICEA 1SFUA 2R7ZJ 4LFAK 4CW7B 3IKMA 2ASOA 4EQQA 4RG2A 5F27A 2OTLT 2M4GA 3CERA 3VGLA 2FZGB 4E9EA 5BN9A 3FGUA 1HPZA 3A8LB 3CCSN 1S22A 4IJAA 2O8FA 4P9UA 2KL4A 2DERA 2HFHA 2G8FA 2A5YB 1NPRA 3WG7H 3C94A 2IGIA 3OL4A 2D8HA 1VQ8Q 3CC4I 4FWQA 3MEWA 4RLQA 4CJTA 4AMCA 1K76A 3OS1A 3NH0A 3AARA 4UUTA 4DV0K 2LT4A 2JXBA 5F0CA 3UKGA 1TQPA 2HBPA 2JVVA 3C1DA 3OIQA 2E60A 3PX6A 1IHWA 3OW2A 2UV1A 3MK6A 2CUZA 4BHCA 1RAAB 1KIKA 4E9FA 3TAGA 1VQNI 2I7NA 4C8QF 3CCYA 4IEIA 3ECHA 3HM5A 4EJTA 4W5RA 1SF9A 3SZ2A 3OSVA 4CJUA 2JQ7A 2LCLA 4B9XA 1DDNA 1PRMC 2DPPB 1B34B 5CVUA 3DI6A 3P9IA 5E18F 3M8JA 4HX4A 3OH6A 4WK8F 2R3SA 2YNFA 4IXCA 2AKLA 1VZ0A 3GP8A 3HM8A 3G10A 2RMOA 4LDVA 3K69A 4DSKA 3WHBA 4XBFA 3VEZA 5CE3A 3CCLI 1OPCA 2YS9A 3AHUA 4B21A 2CGHA 4LB5A 3J7ZI 2W85A 1HW1A 4BGDA 3OBWA 4M77F 3SMSA 3KNTA 3AL0B 4EHTA 1HNVA 1QU3A 1J9IA 2K6DA 1CF7B 1DTQA 2VIXA 1FZPB 3AV9A 4KDPA 3IRQA 3QXEB 2STWA 1W9HA 4ETSA 5I2MA 1LW2A 3JSMA 4FM2A 4MQ3A 4ZGJB 2LVSA 2TRTA 3HB9A 4L0ZB 4Z4HA 3HRUA 1YJNI 4CBWA 1MMDA 1VQLT 3ZT0A 1IG9A 4X66K 2BKDN 2J05A 3CMAI 4M4ZA 1KG1A 3MD2A 4MFEA 2D6FA 4A3MJ 3FBNB 1S7EA 1Y07A 1BW6A 1BJAA 3HGYA 3GTLJ 4OFEA 3KXTA 4HCZA 1H3ZA 3VA3A 1W5TA 2VC0A 2B8AA 3EY1A 1BO5O 2LNBA 3O8VA 1W36C 2JTFA 2DJZA 4EP5A 3I55I 5CKDA 3LANA 4D0PA 1XC5A 1Y0NA 2OPRA 3UKRA 2VJ4A 4B9UA 3CD6A 1NHAA 1Q82O 3AG1H 3RVCA 3GBGA 4PZJA 3NGYA 4E6RA 2CFXA 3HKZA 3G4SI 4OB1B 1RBRA 3SDBA 4BI4A 2YKMA 4XU2A 2WC9A 3NAEA 4CGDA 1WFWA 3KD5E 2JPSA 1WBDA 2XF6A 3NTKA 2K27A 5CVRA 4F7UB 1XSVA 4ZYDA 5EG0A 2IEKA 4PHTX 3VN5A 4UQGA 5K7FA 3VYUB 4DS4A 4IOCF 1OVQA 4DV7K 1FOWA 3L7WA 4LIUA 3TAFA 2X3XD 1VQKI 1BA5A 3G1JA 1ZRFA 3VRZA 1TW3A 1ODDA 1Y8QB 4M3DA 1QVPA 4KH4A 4F3TA 4AC0A 2YHAA 2ZPIB 4OMOA 1Y1WJ 1SL1A 2FQ4A 1QVTA 1ZREA 2QCOA 1DJ7B 3OA6A 1YI2I 2HHVA 2YNIA 2IRFG 3S15J 1NJIC 2PLYA 2DL8A 4DQPA 2VKVA 3V9SA 3F8BA 2GXBA 3ABTA 1XQSC 3ERED 2W41A 2RK1A 3LLRA 1ORNA 3CI5A 1IV0A 3O4NA 3RCOA 3TU5A 2FPEA 2GA2A 2VYTA 1PU7A 3GZNB 3E1YA 5GIOA 1I5OB 3KEQA 1ZUYA 2DODA 2KRSA 2P1JA 4FU6A 2E2QA 3P8BB 3LAMA 4CIGA 2G9WA 3PFSA 1RT7A 3V1RA 3KP4A 3T3FA 1QHAA 1G6NA 1S72Q 1NJIU 3O4QA 4PJOE 4Y28E 4N0BA 2X35A 3HM9A 3T1YK 3P1GA 3HHTB 2YX6A 2GIZA 5GAOr 2WWYA 1AHDP 3A0BC 3MECA 3J7ZO 3ATVA 1K8KB 2K4BA 1CF7A 2Y1IA 3MKYB 2UU9K 2BXYA 2M0YA 1S9EA 1WOQA 4DOWA 4E9HA 4FXDA 1VQ4A 3AVHA 4RGSA 4DSFA 1KYWA 4PJOB 4NXMK 4KH6A 5E3LA 3WU0A 2ZXIA 2CGKA 2VQFK 3F22A 1EETA 1WHGA 3DOKA 2GIVA 2RF0A 4BVPA 4GY2B 5EF6A 1O3RA 3IP4B 3JRZA 3N97A 1Q81R 1NJZA 3V8LA 2K9GA 1K73C 4WX9A 3QWYA 4EIKA 2YHBA 3E5QA 4IUPA 2C0OA 1OKJA 4NHJA 3CXCP 2P0KA 2JWLA 4RCCA 1GOCA 2ZAEA 4EPCA 3U2RA 3M55A 2HQAA 4I99C 3I56T 4PWDA 3SI6A 2XK0A 4PDKA 2NRZA 3M8SA 2PVGB 2CP0A 1VYUA 4E1NA 2XKOC 3RDVA 2JA7J 4KB0A 2XG8D 1TKXA 1LWYA 1WJ5A 1ACIA 2EYWA 1RPWA 4FYVB 5HS9A 1RRJA 3COAC 1K73U 5LHIA 1ABOA 4JV5K 4YFKF 4CESA 4GMJB 1YWPA 3C6UA 3BG5A 3HYIA 5C15A 4F7UA 4XTYA 3FLGA 2DFEA 2K02A 1BIZA 2HF4A 3QEIA 3HKZN 2EGCA 3TKYA 4E1MA 3LCNA 3VS5A 1WUAA 2PMHA 3CQ8A 5LGNA 3L2UA 3FKIJ 3LDOA 3H0DA 4NNJA 2XB0X 2JOYA 2G8IA 1OJLA 2PBIA 3ZMUA 1ZGJA 4G6QA 5DS9A 2D2WA 2FEIA 4M7AC 2XKOA 5E1ZB 1IKXA 1YJ9A 1WQ2A 2Q2EB 1LNXA 1JTYA 2K5LA 3CCVI 4K11A 2NUBA 1BA0A 3DU5A 4Y7NJ 4CGJA 3CCMI 2CUEA 3F8CA 3CCST 3EKUA 3P9KA 3BCBA 2QSGX 5EOYA 3AO2A 2DT6A 3E0JB 1QVFM 2H1LA 3IAM2 4EJUA 4AYBA 3D1NI 2E64A 4LK1F 4D8DA 3AA4A 5AFUH 4A63B 2E5KA 4Q5WA 2CP6A 3JAMO 4GCVA 1ITGA 2FRHA 3ER0A 2H3GX 3HHHA 4XMYA 2COZA 3JCMf 5HCKA 1M1GA 4M7AA 2HTJA 2A3ZA 1XCVA 3FDYA 5DTDA 1ZLJA 1VQ4Q 1WX6A 1IO6A 2EBIA 3CC2I 3CMEA 3S17J 3L3UA 4CD1A 2V51B 4LG3A 1GLNA 2SEMA 4N0AC 1ETXA 4A5BA 2QKMB 1VQ8T 4Z6YA 2F2XA 2VUMJ 1KC8C 1W7PD 1YVNA 1JKPC 3IUCA 1VQ7I 3I0TA 1TT5B 1L3VA 5FB2A 4O0JA 1J6ZA 2Z1IA 3GOXA 4DQSA 1KHIA 4M41A 3DCFA 4D7NA 2VWJA 1LMZA 3B6PA 3N4QA 3DLHA 2MH9A 4FWNA 3IH3A 4DR3K 1M9SA 1ZBIA 1W97L 4OKEA 1NM7A 4RGXA 4W97A 1VQ4N 4LF9K 2YUPA 4QVCA 4JDSA 4LUDA 3RKQA 3I5RA 4LITA 3CDIA 1D0YA 1E2XA 2DOAA 2M45A 4AG1C 3EHQA 2C6YA 1TK8A 2D5RA 4JJNK 1KC8U 3DLEA 4RTVA 2O9VA 3EEQA 4IHYA 3H9JA 3CFRA 2GM4A 2V8JA 5FKNA 1FBUA 2CUDA 4L9TA 5JS1A 1ESVA 5AQFA 3CJ1A 4OAZA 4EA5A 4F4KA 1OCPA 4P1WA 4D1QA 2JUGA 2QKLB 4JPBW 3O6BB 1OULA 5J2NA 3G6EQ 1HNZK 2R5YB 1WSFA 1ITYA 4ILGB 1VQ5A 3EFSA 2AZVA 4FSSA 3AVNA 1B7TA 1VQMI 4MDAA 2LKXA 2LR8A 3U3GA 4BEHA 3TSWA 2LSNA 5K5RA 4QPQA 3OS2A 2DETA 4DV6K 1PKTA 4BAYA 1UAXA 4AFSC 4HX7A 3TP0A 4M7DD 3KTQA 2IAJA 3OYNA 1HYVA 4Y92A 2AS5F 2CQ7A 1X6OA 1WJQA 2Q2EA 4DZPA 2CP2A 3A8MB 3PFYA 3HK2A 3PY8A 4IO9L 1YQKA 1JKHA 4JI1K 3DP7A 4ISEA 2JK3A 3K5LA 3BG9A 2Q1NA 1X19A 2BYVE 4A4HA 2HB5A 4CF1A 2QENA 5GIPA 5HNHA 1YJ9N 1VQOI 5H1SQ 4IOAL 4RTTA 1HKSA 3MKZA 4JZ3A 3TQ7P 1B6AA 3HL8A 3KFWX 4JX5A 2DTHA 4HAMA 4CYCB 1WBBA 2EA2A 1SSFA 4AT1B 3BDPA 3KBGA 1ZARA 1PWTA 1V55H 5ICFA 3S8PA 3K70C 5JHFA 1YBYA 5FPDA 3AAPA 2PJRB 4B3AA 5M5WJ 1GXQA 1RAHB 3VS3A 1ZQ1A 3OSFA 1PP7U 1K0XA 1FK9A 5CVJA 4PKCC 4KT5C 1M3CA 3AT1B 4CJKA 3A98A 3O3HA 1O3TA 3JRAA 2X85A 4F9OA 2VKEA 4H0VB 1RI7A 4LF4K 3ZSVA 2A28A 1TWAJ 2GBQA 4E7JA 2XHKA 4K25A 2DBKA 4BJ6C 4UVCA 4X0GA 1OU9A 1LFBA 2E1MB 4BY1J 3P8HA 4CO8A 2NUPB 1XG7A 5CKFA 4Z4IA 3ZCMA 1IXRC 2LT1A 3VGKA 3AGRA 3BLYA 1YNZA 5FKOA 3ZEHA 1SMTA 1JL1A 3S1NJ 1EZZB 4M7AF 1BQMA 3V81A 2JLEA 1UHCA 1JJ2P 1FSEA 1NJIR 1YE9A 4O0IA 1BC7C 2QA4A 3NMUA 2ELHA 4BR2A 2A3LA 1UTIA 3RERA 1GBQA 2ZQBA 2SRCA 2JA8J 2F2EA 4G1QA 1XMQK 1NJWA 1WJFA 3SBGA 3EG1A 1AA7A 4AFUC 2Y31A 2FSJA 4I9LA 2KAFA 1PRLC 3AVJA 1D09B 4ESFA 4L0YB 3AVFA 1SKRA 1MJAA 4YIFA 1RAEB 2FD5A 3L0QA 3ABKH 4A61A 1S72T 4CGIA 2Z2SB 2A6TA 1XSDA 2JPBA 4KTZA 3J81O 1X3MA 3M7GA 3CW7A 2EV5A 3M0SA 2P6SA 3CQYA 4FCYA 2HHXA 2NAZA 1ZN2A 4A3CJ 1D1BA 2Z1GA 4O3MA 4L59A 5LMNK 4CFAA 3E9OA 4XRMA 4YELA 1I8FA 4CYDA 1MBGA 5C0MA 3E01A 3CESA 2QTDA 1KJWA 3O4WA 2KZGA 1GLBG 3M1EA 4XKBA 2I5UA 1VQ5N 2KDOA 1GV5A 3MN6A 3RWUA 2W25A 4YOUA 1FOYA 2GFUA 1RFQA 2E8AA 5HBMA 3IRRA 1KG6A 2HNYA 2NOGA 4UB6C 3L2WA 4PY5A 3HOXJ 1FSHA 1K1ZA 1SZ2A 2LX9A 2F9TA 3NCIA 3JCMh 4IZ9A 2J6OA 1R22A 1GBRA 5GMKe 4LOCA 2D0OA 3QUIA 1VQ9Q 3K6GA 4EDUA 4HSRA 1D5VA 2WUSA 4DUZK 4RTZA 3GTKJ 4DTRA 2HYFA 4E0DA 3UA7A 3OSSC 2O8BB 2OCCH 4CJ5A 4CYCA 1U49A 4KV8A 1N6QA 4XNFA 5HK3A 2BUPA 3IL2A 2CP7A 1DIZA 3JCMW 1T0FC 3VEOA 2DXTA 3BDDA 3A01B 1Y7XA 2KY9A 3GTPJ 1FYKA 2MF2A 4KI4A 1JLQA 3OV8A 2V75A 3H46O 3FC3A 2XGCA 2XASA 4BG9A 1M3HA 3QDFA 2HVQA 1VQ9N 1PUFA 1WJSA 2LFBA 3KK7A 4XU0A 1SKSA 5CQYA 4EVIA 1RR8C 2OYQA 9ATCB 4OPJA 2EKHA 4FHTA 4CZLA 2EJRA 2NNWA 3JW4A 5CVVA 4XOTA 2DXCA 4IWVA 4BRFA 4QLCU 2YJFA 4AFZC 1T0FA 3P9CA 2HOEA 2CG4A 4CSWA 1TL3A 4E9GA 2AP1A 4HVJA 4XQFA 2Z0WA 4IOCL 2R93J 3JCMe 3G2BA 3K58A 2H8RA 4OAYA 5F1RA 2CS7A 5CQGA 1RKTA 2EINH 2CDTA 1S6LA 4KPYA 3H0IA 1IRGA 5DM7F 4JI6K 1J2XA 3VRYA 4O8UA 1Q7YU 4M9SA 4CC2A 2E2OA 1XQHA 4IRHA 1Y56A 2H6CA 5JMVA 4FJIA 2Y90A 4XL9A 2BVLA 3LSMA 2NWMA 1E7OA 1D5YA 4HTLA 3IUOA 1B9MA 4PFZA 1GLAG 1U9NA 2D8JA 4K8ZA 5DCMB 4HZFA 3SUPA 3PO5A 1CXQA 2VKHA 4KT0E 3K1MA 4BRCA 1OYIA 4BD3A 4ZN1A 4OP0A 1XSXA 2MLKA 2VOPA 3CCJQ 2F5VA 4HVWA 2HI3A 3L8BA 2E6LA 2K57A 4DTJA 2KHOA 1VQ4T 4B1VA 4C2UA 4JI2K 2O9LA 1VSJA 3RTRA 3U1DA 3VYSB 2CQKA 4HNVA 4IL6C 1KVAA 2DJNA 2EJ9A 2NOFA 2NOHA 2XKPA 2CW7A 4AWXB 1FMKA 1QE1A 1P2FA 2LDMA 3C6HA 1KC8R 1XHZA 4HF2A 1UG1A 2PUOB 5LJ3f 4Y91A 2NS8A 1KGSA 4HDVA 1SVOA 3IV5A 2QK0A 4CBXA 3OMCA 2J5PA 1RZ4A 1MPGA 4Y52J 3C6AA 4YIIA 4S04A 2LLKA 5FKMA 3VA0A 1LAWA 4FJHA 3NVMA 3ZQFA 5EZGA 4LDXA 1PCXA 3LH0A 4NC8A 3UKUA 2DO3A 1JLAA 2JGUA 2YKNA 5M5YJ 3SEZA 4CEAA 4CF2A 5TJJA 3H0GJ 2DA1A 3W2VA 1H8KA 1OR7C 1IV6A 1KD1O 2YLBA 3ZEUB 4PSWA 2HGCA 2ID6A 3CPFA 2OD5A 4KJZA 1U9OA 3K0SA 1MSEC 1QZEA 2RHKA 2RO0A 1HRHA 3ZSOA 5AYFA 3BR6A 3J80O 6PAXA 4A4GA 4V2SA 4IDKA 1KQ0A 2X6OA 3ZMDA 1PYVA 5KPTA 3CPEA 4XAXB 3L1AA 4KTQA 1C0MA 3WXJA 1KCFA 4CERA 2IVOA 3KLHA 4UV9A 3TAEA 1A5VA 3ABMH 2MCNA 3G6ET 3MP6A 3A5NC 4H0TB 3CJBA 4A3KJ 2DPDA 1X3WB 3BROA 2YHYA 2LKSA 2EGEA 4YEJA 2CZ6B 4BRIA 2JMAA 2YSQA 1XPXA 1ZBSA 3VWBA 2R7RA 3CCUA 4YDUC 3PQKA 5L3BA 3FXLA 1QVUA 2KMTA 3R3LA 3RMQA 2CZ1B 2G8VA 1E3MA 3BR1A 1NPPA 4XQ3A 1TWCJ 1O3SA 1MWKA 1Y0UA 3M5AA 5GJVB 1WQ7A 2GWJA 2KRNA 3RYPA 1VQ6Q 3FSPA 3EYYA 4M75D 3N05A 5ICGA 3LQRA 5FU6C 5GAN5 4FTHA 2BTTA 1UHSA 4OPAA 1QHHD 2MAMA 1JXBA 2O8KA 1BR4A 4XN0A 4KHUA 1BL0A 2AT1B 4OX9K 3EG9A 2TCTA 4LLNA 3DB4A 1JUMA 3NFAA 3MMYB 4KHWA 4ON0A 2V6CA 2DEQA 3RSNA 1C0WA 2COBA 5DM7R 4FLYA 3KE2A 4D6WA 4AU7A 3CQXA 3S32A 2OI3A 2M1HA 1W4MA 2V8IA 1XN7A 3RSEB 2RN2A 4J83A 4PJNA 2O8EB 1IG8A 4A69C 5AN4A 4C1NK 5KCOA 4F8RA 3U21A 4A0XA 3CD6I 4OIPF 2WC2A 5AQSA 3EH1A 5KHDA 4DV2K 1MA9B 2YG8A 4A2BA 2RNJA 2KRFA 3KP2A 1N8RR 1R23A 1R77A 3D5RC 1LEAA 1SL2A 3LDSA 1ZAOA 5KNLA 5JHUA 1WDXA 5FDLA 3THKA 4LF8K 2PUKB 2HQEA 5E8GA 5J39A 4KN4X 1RDBA 1WHJA 4P9FA 2CV2A 4E2FB 2V1RA 1DUXC 3FXJA 4JKBA 2F96A 1X6BA 3CWUA 2IS1A 3W6KB 1G3SA 1LE8B 2K4YA 4A4KA 3MN2A 1TK0A 5GAOl 3SDZA 1J7KA 4CZMA 3V8JA 3EQLF 5C0YA 4GDFA 5KRTA 1TUGB 1A5WA 5LEJA 4QAGA 4IX7A 2KROA 3HPOA 3GBQA 5FLXO 1QCOA 3M8RA 2WAQA 5GAN2 5EX5A 4DEXA 3X24B 2DL7A 3FXMA 2BY1A 2XDDA 1C0GA 2HZTA 3HVRA 3EL2A 1BM9A 2OU2A 2P5KA 8ATCB 4LSLA 3BR5A 4U7BA 2QSHX 4PQUA 3FHFA 1U04A 4JK9A 2X4XA 3K4JA 2PU9B 1TLHB 4LC9B 3OS0A 4B8AB 4RW6A 3AVLA 3SHFA 4XRSA 3CFOA 1QTMA 1HBXG 1BU1A 4BY6B 1GVJA 1P7IA 1T98A 4AHUA 5E20A 2VG7A 3T8RA 3C4SA 2ZGZA 3CUQC 3VPZA 4CGHA 1UDLA 2JRMA 2VQCA 1VSFA 2FF6A 1U5SA 5EDNA 2YRCA 2EFNA 3VERA 3JSOA 2P4RA 4HVUA 2F5CA 1IKWA 4EM2A 2PJPA 2LD5A 2CZ7B 1RBTA 2BEOA 3FZVA 2YG9A 2XSDC 4M6XA 2XRNA 4HG2A 3GX4X 1XS9A 2JJ9A 2J7IA 3VS6A 4C8QD 3OW2P 1R8OB 4J2DA 4AD9A 3EFOB 3O8MA 4NBQA 4NDLA 4XTVA 1TUDA 5HRRA 4JHDA 2H1KA 4AHSA 3J7AY 1RAFB 4FJ9A 2ED1A 3SUNA 2KJCA 1V76A 4CE9A 1NWKA 1QSLA 1S7AA 3DEUA 2Q2RA 3CCUN 2O5RA 1TH7A 3KZBA 4CA0A 4HLXA 3I53A 1BI1A 1S9GA 2MPXC 4ZDLA 3LSTA 1VQ9T 4CHQA 1IN8A 2HKOA 4BRQA 3ZPLA 3FFKB 2V7FA 4Y0WA 3THWB 4FT4A 3RSEA 1Q86C 1EXQA 4AIDA 3CTAA 2VN2A 5SZTA 2KGTA 3HRMA 5GAOp 1TUYA 2R92J 1B9DA 3QRFF 3E1SA 4JKEA 1U5TC 4IHXA 4BVOA 5HLFA 5FRNA 3R6MA 3ZXSA 2A1RA 2OTLI 1V5GA 3CPWA 3DXKB 3O5BA 3AG3H 3I8BA 3QU3A 4V19S 3RKYA 2RQRA 1MH4A 1KVBA 1LDKB 4YG2F 1JGGA 1APLC 3ZQHA 2X78A 4JNEA 2QI2A 1TK5A 1O9SA 2XHCA 1FPQA 4M78D 4CZHA 4BDPA 3VEPA 1ZKGA 3MEDA 3CCEA 3QWLA 4DMNA 2B86A 1X1DA 2FO0A 5CK9A 1Q86U 3JAMZ 4YIRX 1WN7A 2MD0A 2UZKA 4MMKA 4BHBA 1LE8A 2YV0X 3RR7A 4CECA 2WONA 1VYVA 3KP3A 5K7ZA 1TQIA 1IZ6A 2ECZA 4GRIA 2XY8A 1BHLA 4KITB 2TDXA 2RJDA 2Q0UA 4RW4A 1U5TA 3M0PA 4BR0A 5J26A 1QWFA 4GVEA 4A4EA 3LH5A 3PUFA 5ADXH 3KX2A 2ELJA 4PJMA 2DZ9A 5GAN6 4RB0A 2RQQA 4HF0A 2BV6A 3LDLA 3P31A 4BE2A 4E7LA 4RB2C 2RKHA 1FMWA 1KG3A 3QIOA 2A5XA 2WAQN 3NF9A 4OU0A 2EFOA 3VKIA 2FOWA 4GV3A 4QW2A 4F14A 2R5AA 3EO3A 2IVPA 1RABB 4DF8A 2BE9B 2OPQA 3I54A 4AM6A 4CJLA 4YOYA 3GZ6A 2QG9B 4FJGA 3CCJT 1F21A 1OCRH 2R7OA 4XRFA 2EHGA 1I1GA 1G8XA 1NLOC 3CMEI 1N33K 4N9IA 4JRPA 1T3SA 4FK4A 4W5NA 4FT8A 5DM6L 4EJZA 1NJYA 1K61A 1EQYA 2HYGD 5AIQA 4YPRA 4IG3A 3ASOH 1VQLI 3UB5A 3O3FA 5J4YA 4RAGA 1J54A 2ZMEC 4A3IJ 2ATCB 1ZG3A 3CPWM 2RHYA 5E26A 3GCMA 2LC4A 2Y48A 3H35A 5IYBJ 4PIIA 2DPUA 4IF4A 4OFHA 5J6XA 3FXRA 2MA3A 5MLCQ 3B6AA 1PD0A 4K41A 4PGHA 2VWFA 1KVCA 3THWA 2GXAA 1IRXA 3P83D 1LFPA 3CM6A 5ELZA 2EGAA 3CCQQ 4E89A 3MEXA 4QOZB 4B9TA 2PYJA 2QYOA 4C92G 1WSGA 4CC7A 4II1A 4LD5A 1L5UA 3MP1A 5FPEA 3HGGA 1XGSA 2LVMA 2V79A 3DXKA 1JKQC 9ANTA 5E1XA 5C44J 2E88A 2HS5A 5AQYA 3TSPA 1ZC6A 2XGXA 3BY7A 5HLGA 1M8VA 5AQJA 2KRCA 2J6KA 3E3VA 2O7OA 2MOXA 2O2OA 3H9GA 1R5ID 2MD5A 4J2EA 3JSPA 3WGGA 1Q82C 3MEEA 1QLYA 1K73O 3CCQN 2DTOA 2RD1A 4J9IA 4J2BA 1OQKA 3FZHA 3O8HA 1BI0A 3Q0VA 5E79C 2MGQA 1N78A 1ASVA 2HKQB 3CCRQ 2O01E 5H20A 1IB8A 1TL8A 2HU9A 1UFMA 1W5SA 4KYWA 3CLOA 2RPIA 1KQSM 2P9NA 3B6CA 1VQ6T 5CO7A 1NMDA 4DGWB 5HP1A 4AHVA 2LDUA 1LQ1A 2BH1A 1Q82U 3OOUA 1K7AA 4FL9A 4HCCA 2OC6A 4RAFA 5B1BH 5JLWA 3I4NJ 2XF5A 4ZHRA 3L00A 4FW2A 3LAKA 4LLGF 1U4BA 1GOAA 1LCKA 4AM3A 4G7HF 1BDGA 1LCUA 5BRHA 4IHWA 5IP6A 3RMCA 4OIRF 3FZLA 2RHZA 4FSVA 5GAMf 1Z1DA 3QJ6A 1RETA 4QS7A 5AQRA 2A42A 3K9TA 2QYZA 4UUSA 5DY9A 3TGNA 4XIUA 2IVWA 4KBMB 4I6MA 4QS9A 4NS5A 1RUNA 3LSGA 3QIIA 2OCEA 4M3ZA 2A1SA 2O9SA 5JLFA 1W7AA 1EWRA 5BMZA 5AQHA 1FW6A 4CXFA 1U3EM 2DVEA 4O5BA 4A3EJ 4ZZDA 4HW0A 3CC4A 3KEOA 1W7PA 5F1JA 3WTVC 2BXZA 2CMPA 3QLHA 3J81Z 5AZJA 1W0TA 1MUZA 3QBYA 4FPAA 5B1AH 2NRTA 4EMGA 2FRYA 1SC7A 5EJCA 4ZC3A 1TL1A 1QZZA 3J8AA 1RDDA 2VWKA 1HKCA 3CFPA 3VEYA 3KWIA 1XJWB 4M74A 1JQQA 4ZJZA 1XTDA 3E6BA 2QAZA 4JK1X 3KD1E 5KTQA 1VRUA 4RKUE 3I56I 2RK2A 1B9NA 4OIOF 4CCJA 2KQRA 2XGEA 1VQNA 4FZZA 4QKUA 3UDCA 2XO7A 2HD0A 2ZNZA 3NGIA 5A2QO 2KZMA 1VHXA 4M7DC 3SUOA 1AT1B 5KAFC 3NAUA 1ZSZC 1RUOA 4E70A 1QHGA 4U67L 3HOUJ 1VYTA 2L7MP 1LOTB 4C0FA 1ZBLA 4M75G 3ISPA 1R4MB 2HVIA 2A68F 2E1CA 4JZ4A 1W2BM 2W48A 1IUYA 2RQPA 2DXIA 3CCLA 4XH1A 1OX8A 1FN7A 4LLLA 3VTHA 1X2QA 3M4GA 1RDCA 3DWLA 5E3OA 5A0DA 5KRSA 1B07A 4E7HA 1A36A 4BKXA 4ZDOA 3A8GB 3ZMVA 3KKSA 3THXB 3D45A 2VJJA 2RI3A 1RLQC 3GG4A 1ONVA 4EJYA 4K8XA 4XU3A 2CRGA 3OY9A 5BREA 1R0AA 2CW8A 5F64A 3VYGA 2GF7A 5J1YA 4M7DA 3ZMTA 1Z3XA 4DB3A 4A54A 4JYKA 2JMCA 1YJNA 4MDWA 2YUOA 3CMAA 4M3GA 3ZSXA 4CF9A 2ZC2A 3E2UA 1BI3A 1S1NA 3QICA 4RGUA 3RPUD 4JKFA 2ISZA 2WV1A 3JTHA 4A3BJ 3M57A 1XC3A 2CYYA 2ROLA 3VGMA 2MK5A 3FFIA 1N34K 3I55A 3S2HJ 2EQKA 3C0CA 4HV6A 3QNOA 4GO1A 3IKTA 3MEGA 5J3LA 4MO4A 3F21A 1JLGA 3NF8A 4FWLA 4M6VA 1YCYA 2GELA 2KKZA 2IXSA 1S7OA 2BGGA 3MEUA 1NK8A 1WXTA 2LRDA 5IHKA 1BGXT 4MTEA 1WGSA 5ECAA 4M3TA 2H3JA 2HQ5A 3A0IX 2ZO4A 4C92E 1QZ6A 4BC4A 4E47A 5CYVA 1E3HA 1KHCA 4WQ5C 4CZIA 1RBVA 1SVLA 2GQQA 1F5TA 4D8KA 1VQ8I 3AAQA 2DRKA 1CZAN 3THYA 3MZ8A 3AG4H 1VIFA 3I9QA 1VQKA 1HQCA 2FPDA 2YU3A 1MSFC 1OOTA 3J7AP 3E9GA 2BZTA 3TARA 1DPUA 3HSRA 5LJWA 4ENKA 3QPTA 3CC7Q 2B0LA 1FX7A 4EP4A 3AVBA 2CFOA 1YI2A 1USTA 3AVGA 4ABZA 4W5OA 3CC4N 1VSHA 1R71A 2V1NA 5EXWA 3ZRGA 2RF2A 3PVQA 4DCHA 1PP8F 2ZM6K 1MNEA 1LWCA 1QO0D 1QPMA 4WTOB 3VQAA 2O03A 1RBUA 1KFDA 4CHNA 4I7FA 1LOJA 3ZT3A 4UVBA 3S3OA 4YNQA 1FYLA 4KT6A 3DKMA 1KSWA 2HHUA 2GX9A 4RM2A 3TW6A 1J59A 4BRAA 3L2QA 3CCLQ 3F23A 4B3XA 2XIDA 4JN4A 1KA8A 4OOIA 3PIPF 2DT7B 5LHHA 4LF5K 1TG0A 3MXMA 3CWSA 3M8FA 2L4MA 1VQNN 2KVQG 1YTYA 4OLBA 2ZXWH 2NOBA 2JUCA 2AO9A 2EILH 1SRMA 2FHDA 1FOXA 5FLVA 5L3FA 1WA7A 1JXEA 2QSFX 3OWTA 1O13A 4JRQA 1X01A 1ASUA 4M77G 3QEXA 3THXA 5IOYA 3C65A 4W1UA 2FC0A 2K5CA 2CUFA 3I5SA 1MWMA 4IOXA 4CFBA 1TWFJ 1YFHA 5TKYA 2FOKA 3CCLN 2VL8A 5JR3A 4KUMA 4H4KC 2HHHK 2NYXA 4ZDPA 2QW9A 4MTDA 4D5CA 5GAMh 1ZG1A 2DY4A 1Y8RB 5EGOB 5D8KB 2GGRA 4M72A 5TGTA 3U9GA 4DV1K 2DI3A 2V1DA 4F16A 1J3TA 3NH1A 2O4XB 4N4GA 5ED4A 3TVTA 2F69A 4NQWB 3U23A 1KTQA 3GXOA 1TKDA 2E1NA 1QSSA 3HOVJ 1YJNN 4KMFA 4RTXA 4F3OA 2HMIA 3G4SQ 1YG2A 3ECOA 3CMAN 3WVDB 2J4RA 5IOZA 2W84A 3CCQT 3H9NA 4M7DF 1YTAA 1RDWX 1AU7A 3HZJA 4CEBA 3HL2A 2CQQA 1NGFA 2FSKA 3MN9A 4NC7A 4H0OA 1BIAA 3Q1JA 4B1WB 3HBLA 1REVA 3H8ZA 2P9LB 4HA8A 3HUGB 4C2TA 1PC0A 5B8HA 4XK8E 3I55N 1IHVA 1MDUB 2F5TX 4Y4RA 3L2CA 4M7YA 3BP8A 3LAPA 3OYKA 3U9ZA 3AVAA 1VQKQ 3ZETB 3ZQLA 4JAXA 4DQ8A 1X2MA 4M7XA 5CKBA 1NGHA 2FBXA 2IIRA 5D7UA 2LH9A 3G4SN 4N76A 5K1YA 1NG9A 4JP0A 1YI2Q 5AZIB 4FLVA 3D4VA 2M5WA 2MFZA 5DD8A 3CCRT 1WJDA 3BR0A 5DPKA 5GAN3 2QDLA 2XU8A 3NWSA 3VQBA 1VQPQ 4OIQF 1T08B 4A0YA 2K5IA 3LQQA 3F6VA 5A0LA 3CCVA 3IWFA 4M75B 4LGWA 2HAXA 1VQKN 2L3QA 2CUJA 2Y75A 3IHOA 2NOEA 3CCMA 5ILUA 4IFVA 3WTZA 4N41A 4JKGA 1ZGAA 5AJ3K 2DFIA 2BHYA 1YI2N 4KGVB 2D0NA 3O80A 3MVPA 1OYXA 1ETQA 5M3MJ 3FIFA 3CIPA 4OPHA 2EV0A 1S72I 1MBHA 3TO9A 3MKLA 3QEPA 1Q7YO 1WQWA 2XIGA 2E5LK 3PO4A 3G71A 3DTKA 2IIMA 2IC3A 5K5OA 1KQ2A 1C1BA 2NVTJ 3JYTA 1FY7A 4WXDA 2WTEA 5JFRA 3DEWA 1WEGA 1CZBA 4WFBL 4DBFA 3WQTA 3BDUA 4B1UB 2KFNA 2KRHA 1QSYA 3CC2A 4WYBA 2H8HA 3VV0A 4ASNA 4FYXB 1YW7A 1RAGB 1RDAA 1BIUA 1GCQC 2FZCB 4IFEA 1LJOA 5D5VB 4B3SK 1R9TJ 4PFOA 2BE2A 2PFBA 3FMQA 2I8DA 5M3FJ 4G9ZA 3CDHA 5AQOA 4CH7A 1VQ7A 2YJEA 1K8AC 4QVDA 1X4PA 3REOA 5BPNA 4ELUA 5GANg 3HDDA 5EGOA 4CHPA 1RTJA 2RKIA 3KP7A 3VYTB 3E6DA 5SWMA 1BR1A 1GLDG 3EHRA 3PMIA 5HVQC 1KZHA 3M8EA 4NQWA 1RT6A 4IO8A 1M90U 2MC3A 3C7JA 4HXJA 4JKAA 4FISA 1T6SA 3K70D 5T7BA 5CZ1A 2GLOA 4N47A 5JVHL 1XD7A 4B48A 2RH2A 3OBYA 4G7OF 2MYSA 4FQGA 1K8AU 5KYYB 3FZKA 4B09A 3HUGA 2XVCA 5GAEP 4LXCA 3HVTA 3TTFA 1KU2A 1D0XA 3OYHA 4RWTA 1G83A 4IUUA 1SV5A 1NH3A 2RM4A 4FZYA 2M3AA 1MNDA 4I2PA 4AH9A 3MZYA 1SANA 1I07A 1XWLA 1V4RA 1VQMA 3EZWA 2WA0A 1BCMA 2KDZA 2W4SA 2K5FA 4FX4A 3JCUC 1UUEA 4QQDA 2FLOA 3H3OB 2KIMA 5AZIA 2JG6A 4B08A 2LX7A 3SAFA 3VEXA 2ZFUA 3CCVQ 2P9UB 5CYQA 5KE2A 3RRHA 5GANd 1UA0A 4ELTA 3D7SB 3CQZJ 4C8QB 1HSQA 3V7CA 3VDXA 1V1CA 3BCAA 4M77E 3HXMA 1QP3A 4EGZA 4ESRA 1R5GA 4FLWA 4M75A 1PU8A 4R8HA 2KFZA 4JEPA 3JR9A 4BYYA 3I5UA 3RQIA 1IUFA 4B9SA 2IGMA 3QDKA 3MO8A 1TS9A 1MBJA 5GP9A 4A59A 2ZD1A 5AR0A 3PNTA 4M9XA 1XB4A 3QO9A 2IA2A 3V4GA 2FXUA 1VQOA 4AHTA 4KMUX 4M3FA 2Q97A 4M77B 3ME9A 3CCVN 3DLGA 1REPC 3QOEA 2GTJA 4IURA 5LGUA 1O3QA 3CCMN 3HP9A 2YHWA 4JJBA 1J0RA 1WI9A 4CI6A 4FK2A 3LSIA 2WB1N 1VRTA 1Y6IA 2W42A 4CJPA 4JOMA 2UXCK 1MH3A 4F17A 1ZBUA 3RR6A 3G25A 4BDYA 4B3TK 2E2IJ 3DRSA 2DQRA 2OAWA 1SD7A 4B3OA 1QVGM 2DD4A 3KK1A 2Z33A 3L1PA 4XONA 4ZGEB 4FO0A 3SXYA 1YIJQ 4PJJA 4BQNA 5FLMJ 5CLSA 4M78B 3RUXA 4YORA 1ZR2A 2CV0A 5GAEJ 3CLQA 4CIEA 4FPBA 2PN6A 2V1UA 2CH6A 3LAJA 2X51A 3OR2C 4LFCK 2E71A 1OH7A 1JHFA 3HOYJ 3CC2N 3CC7T 1EP4A 2QGUA 2GWKA 3H1VX 4MLHA 4J6XA 3P5JA 1DLOA 2XPUA 1STZA 3O9RA 4DR6K 1WSEA 1YIJN 2HYJA 3I0RA 5FO5A 5LJ5g 5CIUA 1IO2A 2PAVA 2VQHA 1YQRA 2E3HA 2M34A 4ZZLA 2BE7D 1BN5A 1BBYA 2EZKA 3B8AX 3GIBA 5KYYA 2FL7A 4J9FA 4X65K 3EUAA 4UB8C 2V1QA 2W6KA 1GCPA 3A1PA 3CCLT 2LYCA 3SWNC 1ZYQA 1TKTA 3THVA 2QEXI 3M0TA 4Z8AA 5KCHA 3F10A 1U0JA 4M3BA 4QQGA 3G6EI 1KD1C 5I21A 3NDKA 2KPMA 5GAN7 1D8YA 4B9MA 5AFUA 3S2WA 2Y9ZA 4M9ZA 3KZYA 4EMHA 1ZYRF 4LE9A 4M3WA 1DP7P 4X34A 1X69A 4EMKB 8AT1B 2P8TA 1B1BA 1QA6A 2OA4A 2VVKA 2BBYA 3VSLA 3IG1A 4S05A 2QQ9A 1JBMA 3SJJA 2O8FB 4UVAA 2RA2A 4PA1A 2FMLA 5D6YA 2F7TA 2GNCA 2P9UA 4WQ4A 2LTOA 1U2WA 3R8EA 1SS6A 2K9QA 3BQZA 4C8QA 2OF7A 2DIQA 1VQMN 1UEBA 2G3RA 3EUHC 2UXDK 1KD1U 4HRIA 3SWNA 1VI0A 4RDUA 5F08A 2Z5UA 1NM1A 4ATOA 3SFZA 1ZSGA 1FYMA 1WHUA 2A5WA 3EZ5A 5KYXA 1HLVA 1M3AA 3HEFA 4M78C 4B8CA 5HRPA 4F7UG 2COYA 2L3SA 5LJ5d 2VC8A 3E6MA 5IHIA 3KWGA 1IW7F 2A36A 5J1UA 1T0JA 1RAIB 4D5FA 3G4ST 4HBLA 4BQZA 4AIJA 2H3EB 1W6XA 4DV4K 2AKKA 3SQNA 1FT9A 2KW4A 3HPHA 2Y0SA 5CHIA 3S6IA 4DNCA 5KK1A 2COMA 3WEEA 5KCMA 2KK4A 1YW8A 3O5ZA 4H5VA 2P0WA 1E17A 3QETA 1RBSA 3QYGB 1VAZA 1UGPB 5GAN8 4BWMA 2XGDA 4GNIA 3A8YA 3VFZA 2A7YA 1VQON 3JB9J 3HZ6A 3EUHA 3KK2A 1E0EA 4RCBA 2KI7A 4KUIA 4IHSA 3MQ0A 1NU0A 1WB9A 3ZT2A 4M78A 4ZTJA 4CCMA 3WXMB 5HL7L 2BZ8A 1BA1A 1GVDA 3CVTA 1YHQT 4BR4A 4UNOA 3JCMV 3LPTA 2VPRA 1WJAA 2HBWA 2A40A 4LNPA 3O9UA 4GYGA 1CKAA 3FM5A 3LSHA 1PHTA 1ATNA 2KT8A 1JXMA 4IZZA 1ZXOA 4MEYF 5GANj 1VQPT 4KTWA 1E6HA 5F1XA 2JTVA 1O75A 5AQLA 4BRMA 4I02A 4M7AG 2GUIA 2HSPA 3OW2S 2EJGA 3AVCA 4DWIA 3ZCOA 2WSCE 1U1SA 1HSJA 5FKLA 1HLUA 4YFNF 2KTQA 4NB4A 4BQAA 3QYBA 3LW5E 4Q5SF 3OYAA 1O7FA 1YITT 3ATUA 2MH2A 5HKCA 4DOZA 1Q18A 1DKGD 3GMEA 4BACA 5GPAA 1WLJA 5FROA 4Z2YA 4J8OA 2AZSA 1UG2A 3EFRA 1V3FA 3OIOA 4IXAA 3AKZA 2W57A 1JCGA 1N5YA 5A2QZ 1NBEB 1RT3A 2E1YA 3VQCA 1TWGJ 3DXMB 2HPIA 2KISA 1BCOA 3JREA 2E2NA 3BTIA 3HSCA 1YP5A 1X1PA 4XR6A 4EMKA 3CMMA 3LWFA 5LEKA 2E5NA 2KNBB 3EYZA 3H3UA 3KJVA 1WH5A 3PIPL 2O8DB 2VWBA 3RDIA 2RI2A 5EG0B 3ONQA 5CKEA 3ZMSA 2CSIA 3OYLA 1BOTO 3RRGA 5E41A 3VEWA 3TWHA 4RM3A 3B73A 2WAFA 5CQXA 1GXIE 1VSKA 1ETVA 4W5QA 4B3MK 3OQ5A 3PJRA 3BDLA 4DTUA 3QZ5B 3AVIA 1HU0A 5IT9E 4BC2A 2DPNA 2HZDA 1VQ9I 4XTZA 1UGVA 4FJKA 3GTGJ 2GA1A 2ZPEB 1ZTRA 2RHIA 5IT3A 2X1EA 4NLCA 2H6BA 3REBB 1P6RA 2HBMA 1IJWC 1HW2A 3IH2A 3ABUA 5AQZA 3V6DA 2GZWA 3AA5X 3BR2A 3VUZA 1MJ9A 5K14A 3PMTA 2A6AA 4CICA 4I0BA 1LDDA 2LY1A 2J5OA 1GXPA 4FT2A 4BGAA 4ZYHA 2LJ1A 1DGKN 2E4HA 3AVMA 3NNQA 3JRBA 1J5OA 3H9QA 4FE4A 5KYUB 3Q5FA 2ME6A 2Y0SN 2DMPA 3GO5A 4A3GJ 1NGEA 5D4SA 2IBDA 1C6VA 2K9MA 5KGWA 3ID6A 4E7IA 4BDZA 1ORKA 4U88A 5CYMA 4RGRA 1NK4A 4PKIA 2L0AA 1JU5C 1QZ5A 2L7ZA 1A5JA 5I11A 4K2EA 3C18A 3W3DA 1DP3A 3CCVT 3D2EA 4M3YA 4U0WA 5C4XJ 3META 3CM5A 3NRVA 3BY5A 4LUEA 4N4HA 2IGKA