4E7JA

Pfv integrase target capture complex, apo form (tcc-apo), at 3.15 a resolution
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pro-Pol polyprotein
publication title 3'-Processing and strand transfer catalysed by retroviral integrase in crystallo.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 98
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4e7jA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 4e7jA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4e7jA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4e7jA03
4EP4A 3E9FA 1S6PA 3VQDA 2HHTA 4RW6A 1J54A 3QNOA 1TK0A 1NJXA 3U3GA 3V4IA 4PY5A 4CF0A 2WONA 4M3TA 1JLEA 1BCMA 3OYFA 3AO5A 2KFNA 2JZ2A 1IO2A 3PNWC 4CGHA 3KIOA 3LPUA 1XWLA 2HHXA 1W9HA 1L3VA 4JRPA 3H08A 4DLEA 4KHYA 1BIZA 4AHTA 5HP1A 1RBRA 4HTUA 4FW2A 4FJ8A 1BHLA 1U4BA 3E9GA 4CEZA 3P83D 2Z1HA 3L8BA 2VG5A 4O0JA 1YT3A 1IG9A 4IUQA 4NCBA 4FM0A 4CJ4A 3CEYA 3PFSA 1RILA 1D9FA 3G0ZA 3TABA 1BCOA 2RJEA 2RHZA 2FHDA 1ZBLA 3HO1A 4QQDA 3LH0A 5HROA 4OKEA 2Y1IA 2G8KA 2FBYA 2Q3SA 4DSFA 4GVMA 5SWMA 1I39A 3AA4A 2DY4A 1N6QA 1TV6A 3LAMA 4IUUA 4AILC 5J39A 1NKCA 1NOZA 1DTTA 1NK9A 4BE2A 1SL1A 4QOZB 2HVIA 2OYQA 1FK9A 1UOCA 1NK7A 4DU4A 3S3MA 3QEIA 4E89A 4RW7A 4Z4HA 5IAYA 3AVMA 3DLEA 4M3RA 3TR8A 3K5LA 1JLFA 1A5WA 2BUDA 2XRIA 3LZIA 1FXXA 4H8KA 4MQ3A 1WLJA 4FM1A 3MP8A 4FJIA 4PL6A 3VQAA 5HRNA 3VA3A 4HUEA 3ZSVA 3RR7A 4Z0UA 2XY7A 3NH1A 2ATQA 4CK3A 2R7YA 3V1QA 3O3FA 4FW1A 4FZYA 3S3NA 3FC3A 2MWOA 2HHQA 4A4EA 2YRVA 4CIEA 3M8PA 2O4XB 3KJVA 3S3OA 1OI1A 1KVBA 4OLAA 2VWKA 1QTMA 3AVBA 2YNFA 2L89A 1WN7A 2F96A 2EFIA 3SI6A 3OS1A 3SZ2A 3ZT0A 2IDOA 2XDPA 4DQSA 3V9WA 4FLTA 4B9TA 4FLZA 2G3RA 4DTNA 5D6YA 4TSXA 3C94A 5C42A 3M8RA 5HRSA 3OA6A 3HXMA 3LP0A 1G15A 3DLBA 2B6AA 3WNHA 4NCAA 2RHUA 3VN5A 4CF1A 4CGDA 3Q1JA 1NK4A 2RHYA 3H8ZA 4BDZA 1KFDA 2RI2A 1CZ9A 1EKEA 3KTQA 4BDPA 5K14A 3MEUA 2L3RA 4CEOA 4G1QA 3V9XA 2IS3A 2X6SA 3NGYA 1JXBA 2RPIA 1ASWA 2FBTA 3MXJA 3QESA 3AO2A 1HYZA 3LX7A 1HNIA 3V1OA 4DTPA 3C6UA 2VG7A 4FJLA 1SKWA 2EQMA 4ZHRA 3DMJA 4CHQA 2QKBA 1HQEA 2EHGA 4RW4A 1ZBHA 1ASUA 3RMAA 4YFUA 1TAQA 1LW0A 2F5KA 3SV4A 2E5QA 4B9NA 3DRPA 2YNIA 3SUQA 2O4IA 3NFAA 3ASKA 3TARA 4M3XA 3U6FA 4KHNA 1BQMA 3V1RA 3RTVA 1EP4A 2HMIA 2OA8A 3LGFA 2YHBA 3KLGA 2O4XA 1RCHA 2KZZA 4KREA 1WAJA 2BKDN 3NTIA 3KKSA 4EZ9A 3SPZA 1G5VA 2MWPA 1EXQA 1I3AA 1RDCA 3VQPA 3VA0A 4CJKA 1S1TA 4Z4FA 1IKYA 4FJ5A 4RW9A 5KGWA 4FVMA 2RHXA 2ZD1A 4O0IA 3QIIA 3SV3A 1S1XA 4B9LA 3LP3A 2VYTA 3NDKA 4CJLA 3DRSA 4JRQA 2X6NA 1T05A 2NLUA 3O4QA 2OPRA 4O5BA 3HP9A 2GBZA 1XNIA 1JKHA 3OJUA 3K59A 3K5NA 1WSGA 3WNGA 3OYJA 3NF6A 3L3UA 4ZTFA 1C1AA 2FBXA 1C0TA 3CFPA 1CXUA 2AJQA 3T3FA 1CZBA 1HPZA 4J2BA 1JLAA 3TAEA 4IUVA 3ZSQA 4CFCA 2G8UA 3B6PA 1TAUA 2P1JA 2QKKA 2Y1JA 3QJ6A 5D6XA 4B9XA 3HJFA 4DTXA 3RMCA 1CLQA 2M0OA 5FROA 3RMBA 3SNNA 3ITHA 3VQQA 1Z26A 3MO8A 1UWBA 3E01A 3VQ6A 4C8LA 3RMDA 1QQCA 2G8HA 4FZXC 4KTZA 1A5VA 1VSIA 4E19A 2XY5A 3FDRA 1VRTA 2X35A 4UQGA 4JLHA 3TAGA 4DQIA 4M3WA 4M42A 1S9GA 4IG3A 3OVNA 2KTQA 3MEVA 4AHRA 3AVFA 2XK0A 2O4GA 4E1NA 4CJUA 3PMIA 4FXDA 2EQKA 1YTUA 4OJRA 2QXFA 3DB3A 1MHNA 4E7KA 1S9EA 2LDMA 1RT2A 1JXEA 4FM2A 4C8OA 3SPYA 2B5JA 2D9TA 1HYSA 4CGJA 3PX0A 3HL8A 3O8VA 3P8HA 1VRUA 2BANA 4W5OA 3DOLA 3G10A 4CJ5A 3TAFA 2BIVA 3PX6A 3C4SA 2OZSA 4C5GA 4FJMA 3L3VA 4OKJA 3OY9A 3ZSOA 4AHCA 1JL1A 4OPJA 4C5HA 4IFYA 3SCXA 3AA2A 4X34A 2DIQA 2F8SA 1A5XA 1VSLA 2Z1JA 1ASVA 1NK5A 3F70A 3VQBA 5EU7A 4J2DA 3D0PA 5KGXA 3L2QA 1ZBIA 3PUFA 3MECA 2IC3A 3QO9A 4CJ3A 4AHUA 4C5EA 4NYFA 5J2PA 2QQRA 2JLEA 3KLHA 1RDAA 4E0DA 2ETJA 4A4FA 1O1WA 3HM9A 4CGGA 4OVAA 1BGXT 2G8WA 1T8EA 3M9QA 2E6LA 1VSJA 3QETA 4DSIA 3NH0A 4DTRA 1L3UA 3IAYA 5FRMA 1X9SA 4OGEA 4IKFA 4IURA 3OYEA 5KE2A 3S6WA 4F3OA 4CEQA 1S1UA 3HP6A 5J26A 4N56A 1NJWA 1L3SA 4M45A 1SV5A 1XHXA 4KAZA 3NCIA 3ZEHA 4FCYA 3CM5A 1C6VA 3HPHA 3MXIA 4KKOA 1SKSA 1F21A 2KZMA 3QBYA 3TAMA 2IG0A 4GY5A 1RBTA 3NNQA 1R0AA 5DMRA 4AHVA 1J9AA 1IH7A 3H6ZA 2HW3A 1X1PA 5C0MA 2QK9A 5HLFA 1ITGA 3OYCA 3DLRA 2EQUA 2KW4A 2YV0X 4LH4A 4BWJA 4JS4A 4N4GA 2HVHA 4H4MA 1WSIA 2X74A 3V9UA 3OYNA 4FK0A 4YNQA 2HNYA 4DFMA 2D5RA 2Z1IA 2G8IA 2OPQA 1S1VA 4BE1A 5C6SA 1C0MA 2DFHA 4HUGA 4CJTA 3EZ5A 4C8KA 3SD4A 4J2EA 1LWEA 3CFRA 3L2VA 4W5RA 5KTQA 1REVA 4KRFA 2OZMA 4II1A 1VSEA 3KD5E 3DB4A 1IKWA 1U47A 3MAQA 4CJSA 3AVGA 4CHNA 4QW2A 1KRPA 1W0HA 4DLGA 3HYFA 4I2PA 4KO0A 5HBMA 3L2WA 1Q9YA 4F2SA 3VQ8A 1HQUA 5CIUA 3LPTA 3ZSYA 1SUQA 3HPOA 5KCOA 4CK2A 4EP5A 3AA3A 3PV8A 4N5SA 5D3GA 4O55A 4F2RA 2RJFA 4OKKA 4PLIA 4XIUA 4M3ZA 3OYBA 2D0AA 4M41A 3AVIA 3GOXA 3AVLA 2RO0A 4RG8A 1U04A 4DSKA 1WAFA 1QSYA 5KRSA 4E7LA 4R5PA 3A2FA 3EAEA 3VQ9A 4PLLA 4IUTA 3FEOA 3AO3A 3O4NA 3QEXA 1RT4A 1X9MA 5D6WA 3LZJA 3K57A 3DLMA 1QSSA 4CK1A 3P1GA 4DQPA 4PA1A 3OYDA 1TKTA 1SKRA 4FL6A 4DSEA 2JTFA 2LCCA 2XY8A 3SYZA 3NAEA 2HHUA 3QERA 4ICLA 3MEWA 3VQ4A 2GV9A 3K2PA 4DF4A 2RI5A 2RJDA 1TVRA 1NOYA 3MP1A 4C8MA 4BD3A 3P5JA 4N4HA 4W5QA 1BL3A 2EX3A 4RW8A 3BGRA 2YKNA 3UWNA 4W5TA 1TK8A 4KPYA 3NF7A 1LAVA 3I0SA 3SUPA 4CFBA 1X9WA 4KFBA 1CXQA 4HCCA 3FLGA 3QEPA 4IG0A 3FFIA 4O44A 1TGOA 3SQ2A 1BIUA 4HCZA 4N4IA 3OQ5A 4CEFA 2ITGA 2KFZA 4ID5A 3LGLA 2E6MA 1S1WA 1EETA 3OYKA 4CF8A 2FC0A 3L2RA 2P5OA 3L42A 2DFEA 3NBPA 3AO4A 3WNFA 1ZBUA 3NHGA 1JLGA 3JSMA 4FLXA 3AA5X 4Z4GA 3TI0A 4CERA 1WSEA 3DLKA 3MP6A 2YNHA 1TKZA 3HVRA 3RR8A 1RT6A 4FU6A 3KK1A 1WGSA 3VQ7A 3QEVA 4DSLA 5E41A 4B9VA 2DTUA 4CHZA 4N41A 4CJQA 2VWJA 4CCHA 3BDLA 3OYHA 3CM6A 3UT1A 3KK2A 1RT1A 3L2UA 4BE0A 4CHPA 4LD6A 4CEBA 2B8AA 4FLWA 4E7IA 2HNZA 2X4YA 1JLCA 2I5JA 3SQ4A 3HPGA 3O3GA 3DM2A 1EX4A 3CFOA 4HCBA 1BI4B 2PY5A 2E4LA 5DK5A 3LLRA 4CESA 1RBSA 4CFAA 3LAKA 3LWMA 3V6DA 1U48A 3OJSA 1KTQA 3RRHA 3NH2A 2HHVA 2EQJA 2GUIA 3ZSRA 2P0KA 4KHSA 3OS0A 1UA1A 4L8RB 2D0CA 2PYLA 3F73A 3ZSXA 2RF2A 1KFSA 1RTHA 3CYMA 4KV8A 3T19A 3M8SA 1XHZA 1RT5A 3VQ5A 3SQ0A 5KH6A 1RI0A 3B6OA 1VSHA 2ZQBA 3DI6A 4DU1A 1KCFA 4A4GA 3ASMA 2IAJA 4FJXA 3KLFA 5M9OA 3QNNA 1OZ3A 4CHOA 2HQEA 3IG1A 3ZCMA 3RRGA 2OPPA 4B9WA 3HT3A 3K5OA 1SSFA 4QCLA 2EKOA 2L8DA 4I9LA 3UIQA 4LY7A 1S5JA 4CEDA 3NF9A 3VQEA 2LVMA 3S9HA 4KHWA 2P51A 1L3TA 1TL3A 3WNEA 2JGUA 3PMTA 3DOKA 3ZSZA 1DTQA 4AHSA 4B08A 4FJGA 2HHSA 3SQ1A 1RTIA 3OYGA 3OMGA 3KD1E 3TANA 1TL1A 3AVJA 4CJPA 4J2AA 3NTHA 3IS9A 4CEEA 1QHTA 2QQSA 3META 2HQXA 4A4HA 3EYZA 4FJHA 1YVUA 3OYAA 4OGCA 2E6NA 3AVNA 4B9UA 5KI6A 4CJEA 3F9KA 4WE1A 1RT7A 3TWHA 4Z4EA 3ME9A 3PO5A 1WJRA 2RHIA 3LP1A 2IOCA 3M8QA 2K3YA 4DF8A 5J2QA 1KLMA 1RBVA 4CGIA 1UAXA 1BI4A 3QEWA 4FJ7A 4FJ9A 3CQ8A 2CKKA 4F3TA 1MU2A 3ZSWA 4DTJA 2A1SA 4KHUA 2IGIA 4M3YA 4CJRA 3EY1A 4ELUA 2RJCA 2HB5A 1B92A 2Z1GA 4BDYA 4FK4A 4IUPA 3HK2A 4CF9A 3DLHA 1U49A 1WSHA 1IKXA 1WNSA 4PQUA 2X78A 1WSJA 1HJRA 4NZGA 4CJFA 1LW2A 1FKOA 4I7FA 2W42A 5KE3A 1Q9XA 1XI1A 4OVLA 3HSTB 1S6QA 4LD0A 2HNDA 3KKRA 3DRRA 3QINA 3HVTA 4DFKA 4HHTA 1K6YA 1WJQA 1RTDA 1OYXA 2YKMA 4QQGA 3V81A 3ZT4A 5JS1A 4DWIA 4JS5A 4Z4CA 1HRHA 4K8ZA 1SL0A 4NYNA 1HMVA 3DYAA 4N76A 3D45A 2PYJA 5I42A 2K3XA 3OYLA 2KQ2A 3C6TA 5C24A 3AVCA 4UC4A 1L5UA 1RDDA 2F8TA 3CG7A 2G8VA 4DTMA 1VK0A 4ID1A 4CRIA 1RNHA 3NE6A 2B4JA 4B3OA 1TK5A 4CGFA 3BDPA 1JLBA 1WSFA 3PO4A 1NK6A 3JYTA 4QQ6A 3NGZA 4CFDA 1RTJA 2M16A 4K8XA 2RKIA 1KSPA 5FRNA 1C1CA 3PX4A 3LANA 3NTKA 1ZYQA 1QE1A 1VSFA 3I8DA 1RT3A 4MFBA 4FJNA 3KLEA 1U45A 3QLHA 4CE9A 4KHQA 3DLGA 4HVJA 1NK0A 4KTWA 4Z02A 4CEAA 2XY6A 3P8DA 3O3HA 2PQWA 1Q8IA 5SZTA 4IBNA 5CYMA 4FYDA 2LSNA 3QKJA 2WACA 2BDPA 3MEAA 1Y97A 4ELVA 1TKDA 1D5AA 4C8NA 1NKEA 1SL2A 1WJSA 3AV9A 3THVA 4FJJA 4CECA 5CYQA 2RN2A 3MEGA 5CY4A 4H4OA 1NJYA 1B9FA 4OLBA 2HHWA 1BISA 3I0RA 1TKXA 3ZT2A 4DS5A 4KB0A 3ZT3A 4O4GA 3NF8A 2RI3A 4Y1CA 3TAPA 2NUBA 1JLQA 3KLIA 1RBUA 4DFJA 2GFUA 4BACA 2GFAA 5CZ2A 2PZSA 1LV5A 1ZBFA 4DSJA 3SUOA 4L59A 3OS2A 1NKBA 3LALA 1LWCA 2XO7A 3NGIA 4GMJB 3MEEA 4DS4A 5FDLA 3V9SA 1KVAA 3SUNA 2M1HA 3TAQA 4PWDA 2D0BA 1J5OA 2YNGA 2DAQA 1KVCA 2DFFA 4DTOA 4DMNA 1LAWA 4FJKA 2VG6A 3K5MA 4M3UA 1T03A 4KB1A 4CJVA 4CIFA 4EDUA 3U3YA 1HYVA 4KI4A 4DFPA 4LSNA 5KRTA 1GOAA 1DLOA 1N5YA 4NS5A 3IRXA 2X4XA 2X4WA 3AVKA 4B8AB 5I3UA 4ELTA 1KHCA 4NCGA 4QAGA 2ZE2A 2R58A 1C0UA 5J2NA 3ALYA 4FLVA 1HNVA 1C1BA 1N27A 1UA0A 4Q0BA 2P5GA 1IKVA 4B9SA 4W5NA 4CIGA 1J53A 2G8FA 4CJWA 1D9DA 4QVZA 4FZZA 1NK8A 2YHAA 5CZ1A 4I2QA 4BWMA 5J1EA 2LRQA 4PUOA 2R5MA 1Z25A 2A1RA 4DU3A 3OB9A 3LYIA 4DTSA 2GF7A 4FLUA 4FLYA 4Y1DA 4CF2A 3RWUA 4KI6A 4ZTJA 2BE2A 3LDSA 1GOBA 2FBVA 1XC9A 4N47A 1BQNA 4E7JA 1VSKA 3KK3A 4KTQA 1VSDA 2XHBA 4B8CA 4IFVA 4F4KA 2BGGA 4EZ6A 4DTUA 2DIGA 4Q5VA 1GOCA 1JL2A 3AO1A 2R5AA 4LSLA 5IN1A 4DQQA 3LP2A 4E1MA 1NJZA 4Z4IA 3OMCA 3ISNC 3QIOA 3MEDA 3KUFA 2OPSA 4E7HA 4RG2A 4DG1A 4Q5WA 4I9QA 1D8YA 3ZT1A 4HUFA 2LTOA 3OYIA 4OPKA 1KLNA 1LWFA 2WOMA 5J2MA 3AVAA 3C95A 3SJJA 2R57A 4GW6A 4IDKA 1H3ZA 3V9ZA 3QIPA 3LWLA 3PY8A 1B9DA 3VQCA 4FK2A 4LH5A 3K58A 5JS2A 4F8RA 4AH9A 1QS4A 1T7PA 3ULDA 4DQRA 5KCHA 3OYMA 1OZ2A 5HRRA 1VSMA 4E3SA 1YTAA 1QSLA 3AVHA 4CHYA 5T7BA 3T1AA 1RDBA 5HRPA 4B9MA 5C25A 1FKPA 3MXMA 4C5IA
chains in the Genus database with same CATH superfamily
2AQFA 2V1QA 3E9FA 5J1RA 2BEOA 2XI9A 4U0WA 3VQDA 4EMKB 3JV3A 1WUAA 3VSKA 3U3GA 1DKGD 2ZSHB 1UHCA 4C8QF 2LMDA 5LJVA 1AZGB 2P9KA 2M34A 1Z9QA 1XSDA 4M3TA 1BCMA 1BN5A 4CHUA 3HZJA 1SZ2A 2DO3A 1RLQC 2VXFA 1N8RU 1KU2A 3KWIA 3LPUA 3F22A 1LOJA 1XWLA 2HHXA 2MMPA 1SRLA 2R7XA 2I5WA 4CUGA 2Z0WA 4JRPA 1KQ1A 4DLEA 4ILGB 4AHTA 1YJNT 3GMEA 4BHPA 4J8FA 2LNHB 1Q81C 4FW2A 3R6MA 2HVSA 4UY8I 3THWB 1FYLA 4LB6B 2MOXA 4D6WA 3QODA 4ZDLA 1Z3XA 1N25A 1S72Q 3VS4A 5EGOA 4BQLA 3L8BA 2E71A 2VG5A 1M1EB 1HKQA 1DUXC 2LY9A 3A5MC 2DMNA 4O0JA 4NCBA 4FOIA 2MW8A 3CCEI 4CJ4A 3CEYA 5GAMe 3PFSA 5CR2A 4QPQA 2DPDA 5HK0A 1DIZA 5BR9A 1M1KR 3K4LA 4EA4A 3LH0A 2FX0A 1KQ2A 2GBQA 1VQPA 1ZAOA 3G1JA 4CYCA 3JCMd 2RV8A 2X3WD 4HZFA 1MBFA 3NVKA 2HOSA 2NRZA 4L9JA 5CR4A 1MDMB 1W0UA 5SWMA 1I39A 3GCMA 1O7FA 2HAXA 1M8MA 1IBKK 2DY4A 3BJ6A 1PCXA 1HLUA 1K9AA 4JOMA 4AILC 3M54A 5J39A 3CCVA 2C06A 1WJ5A 1DTTA 2XAFA 3GVAA 2HVIA 2L01A 2OYQA 2MG4A 3NHNA 3IMXA 1ON2A 3WTVC 3JTHA 1U0JA 1NK7A 3VW4A 4BS9A 2FZGB 3E6MA 4UHTA 3GXOA 3WTSC 1M1GA 3QEIA 2ZFWA 5D8LB 4E89A 2B0LA 1KD1C 4KH6A 2E2NA 3DLEA 4CCLA 1YJNN 5L8RE 4X0GA 1WWXA 2B86A 1MBEA 4ZJZA 2ABKA 5F64A 4WFNL 3U2RA 4CCJA 1WXTA 1JCFA 4M74A 2A69F 1WYXA 1SD7A 2UWMA 4R79A 3VQAA 5BRDA 3VPRA 4J6XA 2RQPA 1NGGA 3ZETA 2R7RA 5IPAA 2ZXWH 3SB2A 2RDPA 3QDKA 4H5WA 2ATQA 1H1VA 2UXNA 2XG8D 2JSCA 3ZMSA 4UVCA 2H3JA 4LUEA 2ED1A 2YRVA 2K3FA 3COAC 4YPHA 4IFEA 4MQVA 2CUEA 4NNJA 3HSRA 1OI1A 4DBFA 2R92J 2YNFA 1G3SA 2LX7A 1T3LA 2L89A 3SMSA 1U3EM 1WN7A 2DKGA 1GBRA 5FKKA 2O8CB 2K2MA 3FBIB 2HOTA 3ZT0A 3WG9A 2RNAA 3ISPA 1I8FA 2QWNA 4JJCA 3V9WA 3THYB 4FLTA 4KT5C 3HOUJ 2PMZN 3DLLA 2PN6A 4XR6A 1NGHA 5H6QA 3PNVA 2VKDA 3C94A 2NUTA 3M8RA 3WTZA 1R4NB 3T1HK 1Z05A 4BRPA 2BXZA 2RHUA 3VN5A 2X0LA 1SFEA 1J5EK 1JE8A 3KLOA 1R1UA 3LQQA 3AT1B 1EWRA 2CQQA 2CS3A 2JUGA 2V1RA 3A5NC 2CH0A 1KFDA 2RI2A 1EKEA 4BRHA 1GXPA 5K14A 1POGA 5AIPA 3O1BA 4RTFD 4CEOA 1J75A 1VQ9Q 2M8EA 1ORPA 1BU6O 1VQOQ 2IS3A 4D7NA 1G99A 3CCLI 3IKTA 1H88C 1WDXA 4P5NA 2FBTA 1ETQA 3MD2A 1SMYF 2LKXA 3RUXA 4J5YA 1HYZA 1N77A 1HNIA 1HYOA 3V1OA 5GAHP 2VG7A 2IW5A 1U9NA 3PVQA 1GV2A 5CKHA 2QSGX 3AKZA 3DMJA 4CHQA 2IS4A 1OU9A 2HSEB 3QQAA 3PJRA 1HQEA 2K9SA 2CUFA 3RMAA 4X9DA 3W2WA 1TAQA 2Q2EA 1JXMA 1P92A 1X1BA 4BRGA 1OCOH 3O9RA 1TLHB 3DRPA 3EUHC 3ZFJA 2DBMA 2CRGA 2OJ2A 1M1KU 2O4IA 3NFAA 2Z33A 1BQMA 4FYVB 3E5UA 3BF1A 1NGNA 3BR5A 4IOCF 3NVMA 4RWTA 2EBIA 2QKLB 2HYJA 1VQ4Q 3Q9SA 3LGFA 2O4XA 1M27C 2KZZA 3A03A 4F7UB 3NTIA 1S8NA 2KJBA 2YUPA 2M30A 1TBXA 3EGUA 2F2VA 1KQ0A 3SPZA 4IPAA 4YPRA 1G5VA 4EEFG 4BUGA 3FZKA 1S1TA 4ATOA 2H3GX 3JSCA 3BPVA 2X9HA 2WWYA 2YUOA 1R4MB 5GP9A 4KUDK 3JCMQ 1IGNA 1GXIE 2ZD1A 5HODA 4O0IA 3UATA 2VT3A 4E6KG 4OMQA 3SV3A 4BXUA 3SDZA 2VV5A 4C1NI 3CTAA 4CJLA 3VF4A 5LGTA 1UELB 3KP3A 3HDDA 2OPRA 2XB0X 2ZPBB 4KRTA 3K59A 2HBWA 4QS9A 2IP2A 4LFUA 3RMQA 3RERA 3CCUI 2CP7A 4YHHK 3NF6A 5CKTA 4A2BA 3GTGJ 2FBXA 3CFPA 1YF5L 3ULEA 1ZRDA 3ZX3A 3T3FA 4NB5A 4GV3A 1HPZA 4GLMA 1Q7YC 3JCMc 3DKXA 4IUVA 3ZSQA 4CFCA 2G8UA 1Y56A 2W24A 2LFBA 2WSCE 4JI0K 5EG0A 3B6CA 5M3MJ 3RDVA 3RMCA 1CLQA 3CC2Q 3V8KA 5FROA 1L0OC 5KQ8A 4A63B 2WV1A 2I10A 1NTCA 3I33A 4DOZA 2DMQA 3UKRA 2ZBKA 5KYUB 3U9DA 1G2HA 1KD1R 2JM9A 3MO8A 4HAMA 5H2FC 1UWBA 2MD0A 1IO6A 3P31A 4C8LA 1FNNA 3MKDA 3K4CA 2COMA 1R9TJ 2V1UA 4FZXC 1A5VA 3SYTA 2VVKA 5E26A 2QGUA 2ZMEC 1BR2A 2MI6A 3FDRA 3HOXJ 3BR1A 2RQRA 4XLFA 2Z16A 4JLHA 3HKSA 1P8ZA 3A5ZB 2XKOC 3SAGA 3A5LC 4HCKA 1OJLA 5TKWA 2NVYJ 1H92A 2EJGA 1B34B 3OVNA 3MEVA 1SMTA 2HNIA 2Y0MA 4A5BA 1YAGA 3QHSA 2J5PA 3PMIA 3ZGKA 4FYXB 1NGFA 1TWFJ 5F0XA 2O8FB 4C8OA 3CQZJ 3FZVA 4UUSA 1WPYA 1VQNI 3SPYA 3MAJA 4IXCA 4F91B 2D9TA 1HYSA 2R7SA 1TQPA 4M7DB 4CGJA 2JVGA 3HL8A 1BO5O 5HLTA 2O8BA 1BG3A 4OOIA 2E1CA 3FFKB 1H641 2W84A 3M57A 3W6KB 2BANA 2YS9A 4EW0A 2DQRA 4YTLA 3ASNH 3EUKL 3LDQA 2OD5A 3U1DA 3CUQA 3G10A 1WJFA 1T2KA 2L3PA 1U6ZA 1NM7A 3OR2C 4BQZA 3I64A 1P9QC 3C4SA 2O8EA 4KH1B 4C0ZA 3OY9A 3CPEA 3ZSOA 1JL1A 4C5HA 2ZGWA 1MJBA 3H0FA 5H1SQ 4LF9K 3SCXA 2F8SA 3ZQIA 1A5XA 1JJ2M 5ILSA 2Z1JA 2CV1A 1ASVA 2RK2A 1NK5A 2X1EA 2ACJA 3K4JA 2JRTA 4AC0A 4GDFA 1XMOK 2XPWA 3CCMI 1VQ8I 2FD5A 5AQTA 3MECA 4M9SA 2IC3A 4FX4A 5FWCA 4NYFA 5HLHA 1TOVA 2QQRA 3KLHA 2VPLA 1LNWA 4A4FA 3RCOA 3GBGA 3CDHA 2Q0RA 1BGXT 3ULRB 1J5YA 1E3HA 3MJXA 2GOXB 1KQSP 2BY3A 2BW3B 2E6LA 1KG1A 5HNFA 3QETA 1JUPA 4DSIA 3IAYA 1Q81U 3PIPF 2QENA 1PSEA 1W7PD 5LMNK 4IURA 3TEEA 4JRKA 2KHOA 4F3OA 4CEQA 4NL3A 3K9TA 3O6BB 3HP6A 3K9JA 1RDUA 4FSXA 2W48A 5GJVB 1NJWA 1IXCA 2UV1A 3OL4A 2AZSA 1FBQA 2EB7A 5J3LA 1PM3A 4C0DC 3SBGA 4EM1A 3TREA 4OMLA 3K4KA 3F6VA 3FX3A 2CSQA 1FYMA 2K27A 1KQ9A 3OWTA 2GELA 4KKOA 1F21A 3J81K 4OFEA 3TAMA 2UYTA 3QXEB 3LL7A 2IG0A 3ENHA 1RBTA 4A3GJ 2JJ9A 5DMRA 2IVWA 4IVNA 3F0ZA 1QP2A 2JRMA 4Z94A 4CC2A 1IUFA 4JI1K 2QWWA 4BR7A 3IWFA 4Y13A 2EQUA 2KW4A 5KHDA 1RAAB 3B73A 1XCBA 3KZYA 3V9UA 2NYSA 2BGCA 3QPLA 2ZXHA 4FK0A 3ZR8X 1VQLA 4YNQA 4IQ4A 3CMEI 3CERA 4BJ6C 2KRFA 2Z1IA 2STTA 3CD6I 1GLBG 1RAHB 3SFZA 5I2SA 2PG4A 1FIAA 2KIUA 3ZN0A 2V9VA 1SFOJ 4Y0WA 1C0MA 3EZ5A 3CI5A 3Q0VA 1QW1A 3SD4A 5FLVA 3QYBA 1V55H 3T0YA 3Q5FA 3B8AX 4BEHA 5FFXA 1LJOA 5GIPA 4W5RA 2ZPHB 1XC5A 1F1BB 4KRFA 4NB4A 1ZXOA 4II1A 4IF4A 3VS0A 2DK8A 1U47A 2OC6A 2ZC2A 5CKBA 1QA6A 3AVGA 2LJ0A 4CHNA 1GLEG 4QW2A 2W00A 3BUZB 1W0HA 4C3IJ 2KYBA 4XH4A 4DLGA 4G7HF 3HYFA 4F16A 1YJ9I 4F2SA 1YXQA 2R7OA 5GAMj 5LJ3h 2DTOA 5KYWB 4CK2A 4YOYA 4IRHA 5CE3A 4JI6K 2I0NA 1PU6A 3IH2A 2UUAK 5D3GA 3QYGB 4F2RA 4OKKA 2EH3A 4A5MA 3EN9A 9ATCB 2KISA 3GOXA 2Z9OA 1ZKGA 2E1NA 4YOWA 2LBFB 1SFXA 1NGDA 1SAUA 5KRSA 2X3XD 4E7LA 2DD5A 4A53A 5KYXB 3EAEA 3O5BA 5DUKA 2G0EA 1J59A 5JMVA 2AQEA 4IUTA 2R5YB 2OTLT 1WZOA 1RT4A 3LZJA 3K57A 3H3NO 1QSSA 2ASOA 1FT9A 3P1GA 5GAEJ 2MF2A 3WG7H 1YJWI 2L7KA 4PA1A 1TKTA 1TH7A 2RA2A 1O3RA 4BYYA 5GPAA 2YX4A 3NAEA 1E3OC 1VQMI 4E4HA 6PAXA 4DF4A 2RJDA 4IHXA 3ECHA 2DYRH 1GCQC 5B1AH 3HSBA 3OW2A 3VOVA 3QYFA 2NUPB 4A12A 3OMYA 4HV6A 3JTGA 2P4TA 3GPLA 3WXKA 2QWOA 3VESA 5KN8A 5CHZA 5LRSA 4CFBA 2NVUB 3E2UA 4BC2A 4KFBA 3EKSA 1N3CA 3FLGA 3QEPA 2LQKA 4IG0A 3CPWA 4JHDA 2W03A 3SDBA 1Y7XA 3SQ2A 1XSXA 3K0LA 2M0YA 4BL0B 3M56A 5DLQE 4HCZA 3M1EA 4N0AC 4DR6K 2EPFA 1HLVA 3R6OA 5IYBJ 2EJFA 2XHKA 4M7AB 4HBLA 4B3SK 2ITGA 1N9RA 3BOQA 5AQVA 5LGNA 3REBB 3JAMZ 3X26B 1U84A 4YFNF 3K6GA 1ZUKA 5L23A 2YG8A 5AZIB 2FRWA 2DZCA 2FC0A 2IIMA 1EH8A 1P2FA 3M59A 2P5OA 3ZQFA 1VQ6Q 2OTLN 4M7YA 3NBPA 3AO4A 1KQJA 1ZBUA 5LL6S 2IVNA 2IGKA 2CUDA 4LXCA 4A3MJ 1WSEA 1TKZA 2OZ6A 4FU6A 3KK1A 5GAOr 3VQ7A 2VJ4A 5E41A 3ELKA 4FX0A 4B9VA 4UY8O 4CHZA 3CCMA 2LTPA 3BDLA 3OYHA 3AHUA 3LDOA 1YQMA 3KK2A 2H8WA 3PTAA 1RT1A 1HJOA 4CHPA 4CEBA 3FLCO 4RMNA 2FU4A 1JLCA 1P90A 3FRNA 3CWUA 5JHUA 4F7UE 1UTIA 4D8DA 4RCHA 1QVFS 4HCBA 3FR0A 2G7HA 3EE9A 2E4LA 5CJ9A 4XU3A 3LAKA 2K9NA 4IJAA 1Q7YU 3F8CA 1OKRA 3RRHA 4YG2F 2JM8A 1AKHB 2NVXJ 2GUIA 2P0KA 5FPMA 1UA1A 1U6GA 4JZ4A 2LDUA 1KFSA 3TW7A 3OW2M 1MMAA 2LREA 2P9LB 3AY9A 4EJYA 3TL4X 4FYWB 1RT5A 1OLTA 5KH6A 1RI0A 2GM4A 2ZQBA 4M75F 5GAOl 1PC0A 3DI6A 4DU1A 3CJAA 2DPNA 1H9TA 2FXUA 3CETA 4H0VB 4FJXA 1WRJA 2E7WA 5M9OA 3QNNA 4XNFA 3WGHA 4M3DA 1WQWA 4G7OF 1VQKT 3ZCMA 2NWMA 2ZJRL 3CPWM 3M0UA 4BY7J 1TZLA 2OPPA 4D9JA 2KT0A 2V51B 1ESVA 3K5OA 3DEWA 3BTLA 2E34A 2EKOA 1IRXA 3T9NA 3R8EA 4CCOA 1IN7A 5GAN7 2Q31A 4LY7A 3ATVA 3QU3A 2LVMA 4GV9A 2MBFA 3PMTA 4XK4A 5GIOA 2EIKH 1LEBA 3AAPA 4FJGA 4MZTA 3CF5F 4C92F 1D0ZA 3OMGA 3K0SA 3U8XA 4JV5K 3W2VA 3RQIA 2HFHA 4NL2A 3NTHA 1HSTA 2XC7A 2Q8KA 2FL7A 2OF7A 3META 3CCRN 4A4HA 4EW4A 2A41A 1WEIA 3I9QA 4FJHA 2D8HA 1YVUA 3OYAA 1ACIA 3I56Q 4MO7A 5E1ZB 4G9ZA 5CAIA 5DEQA 5LHHA 2E6NA 3O4WA 1BL0A 1GHCA 3SQNA 2QSHX 4M78B 4CJEA 1R58A 2K02A 2ZJQF 3PO5A 2KZGA 1WJRA 3LP1A 4B9QA 5J2QA 1SFKA 1KLMA 2RQWA 4AFSC 4LIVA 4ELYC 1LOTB 1VQKN 4CGIA 1P6RA 3ZP5A 3QWYA 5H6RA 4JPBW 1BI4A 1XQOA 3QEWA 4G6TB 1PP7U 1HDDC 2VXEA 3CQ8A 3LAPA 2DL5A 5GMKl 4JYKA 2P0PA 1TNSA 1SKUB 3M4GA 4KHUA 2GTJA 3HEFA 1X1AA 1T44A 5J6XA 1R8OB 4C8QC 4AIDA 5KYUA 2RJCA 5LLQA 2CP2A 3GBQA 1B92A 2Z1GA 4F9OA 3DLHA 1U49A 3CCSI 3CCRA 2P5VA 1UGRB 1WNSA 4G6QA 1QZ6A 3ERED 3DPUA 4RAGA 4DYQA 4NZGA 1P7MA 4I7FA 4G9YA 4XLPF 3QPSA 5KE3A 1Q9XA 1VFCA 1K8AC 5FD6A 2WC2A 2Y9ZA 5FD5A 4OVLA 5BRHA 1S6QA 2HNDA 3DRRA 5CKEA 3HVTA 3G25A 1Y07A 1K6YA 1X3WB 3CZ6A 1WJQA 1RTDA 1UB4A 2YKMA 2HOAA 1VTNC 5GAMg 2EWSA 3M53A 1EF4A 4DWIA 1OH6A 5JS1A 1U5TC 3PL8A 1WKMA 1TXQA 4MEYF 4K8ZA 4EATA 1OYWA 3ID6A 2PMHA 2XIGA 1SANA 3I0WA 1AOYA 3OYLA 2KQ2A 1QVGA 3FIFA 4DV1K 3AVCA 4UC4A 1EH7A 1RLPC 2F8TA 4H5NA 2PU9B 1W2BS 2RHKA 1XGOA 1HNZK 3M0QA 3V7SA 3SXYA 2MIOA 3EUHA 4B3OA 4IEIA 1XQPA 1CF7B 3BDPA 1JLBA 2OTJT 4R1HA 1WSFA 3PO4A 2X6WA 5AJ3K 2SEMA 2DA7A 2EIMH 1R00A 3MWMA 2HGCA 4XN0A 4GVEA 1G59A 2E10A 4BGBA 5CHIA 2M16A 5F0CA 2RKIA 3CCJQ 1NMDA 5BN9A 1KSPA 4A5NA 5FRNA 5C12A 2XD0A 4JKEA 3LANA 2X6YA 3NTKA 1QQMA 2E19A 1RT3A 1CGPA 2HQRA 1K73C 3VUBA 2MCNA 1N3AA 2B63J 3TP0A 3DLGA 2O6GE 1T3SA 2XF6A 1NK0A 3TO7A 4KTWA 4Z02A 2IGOA 2O8DB 3TDZC 1YIJQ 3OIQA 1WVRA 3HRSA 1NNEA 1V3FA 1WJCA 4LFBK 4FYDA 4B1ZA 2LSNA 1HW1A 1U2VB 3NQOA 2O9VA 4DBQA 2WACA 1EZZB 2BDPA 1RADB 3FDYA 1B7TA 2ZJPL 4FWQA 2LG4A 1TKDA 1QZZA 3J7AY 3FHFA 5DM7L 3CO6C 2L7FP 1SL2A 3WXJA 1HPMA 3AL0C 4CZLA 4X1EA 3THVA 2EFOA 4JQFA 2ZPGB 1AVZC 3HRGA 4AM3A 3BG5A 2OTJN 5CYQA 1YHQI 2DX1A 2A5YB 2W85A 2RN2A 1WHGA 1MMDA 4H4OA 1B9FA 3CCET 2HHWA 2L7MP 3C0CA 3O5ZA 1XOVA 1KGSA 3I0RA 1MBGA 3QUIA 4A62A 4YIRX 2CV0A 3X28B 3WXIA 3V7CA 3E6BA 3NWSA 5C44J 3MN5A 1QVGM 2DXIA 1MNEA 2FE3A 1PVEA 3BG6A 4RAYA 2NNYA 3KVGA 4AFQC 4Y1CA 2COZA 1JLQA 1ZYRF 2XIDA 2QDLA 5I11A 1RBUA 5GAMh 4ZDPA 1QVTA 1YP5A 4V2FA 4IO9F 2ZMEA 5GANf 3LWHA 2KMUA 2D1HA 4DSJA 5BPDA 1H3HA 4L59A 2HVRA 4DCHA 1WBDA 3IL2A 1JBMA 2EIFA 1LWCA 4PFZA 3TSPA 3DP7A 2WC9A 1T33A 2D1VA 2XKOA 1M3QA 1KVAA 2XGXA 3G1OA 2MGQA 3GTOJ 3SZPA 1HW5A 4HQMA 3QO3A 4KULA 2VG6A 2L5QA 3K5MA 5FLMJ 4CJ7A 4CJVA 2SRCA 2DOEA 2KY9A 2EV6A 4OMZA 2VIXA 4FE7A 1J0RA 2LJ1A 2UUCK 1VIFA 2JK3A 2DOFA 1GOAA 3CCEN 4L5GA 4DBRA 4W97A 4AIHA 1KC8C 3LDLA 3CCQI 3EGXA 4FWKA 5I3UA 2QA4I 4NCGA 1ZRFA 4DR7K 3LAJA 2CYZB 5IT9O 1IC8A 4J01A 3ALYA 3K1NA 4YEJA 2Z99A 1R6RA 1BC8C 3KFWX 2E6ZA 3TVTA 2RE2A 1MBHA 3OBYA 1IKVA 4B9SA 1R77A 3TO6A 4CIGA 1S72A 4PJOF 2G8FA 2DTIA 2O88A 5C4JJ 2IVMA 2L54A 2YHXA 2Y9YA 4QVZA 3G6EI 4FZZA 1T6SA 1T95A 3QYHB 3U23A 4BI4A 2OI3A 2GA2A 4HSTA 3K4MA 3SWNB 4I2QA 4AM7A 1VQ9T 3MCZA 2A1RA 1USSA 3EGDB 1DGRM 1VQOT 4MMLA 2GF7A 4FLUA 1OYYA 2VBZA 1GLCG 3T1BA 2AK5A 1K8AR 4GYIA 4ZTJA 3L2ZA 2R7DA 2GAUA 1GOBA 2FBVA 1ZLMA 5GANd 3FWEA 5HKCA 4N47A 1QZYA 1BQNA 1DGKN 1VSKA 4M7AE 4KTQA 3P9IA 3CQYA 2X85A 1XC3A 1D1BA 1NHAA 5GPCA 3O8GA 2IGMA 4F4KA 1HBXG 1E4FT 1S5LC 1O7LA 1K9MC 2L9RA 4LSLA 1E17A 1Z3YA 3CCLT 2K9LA 4M3FA 2VC0A 3VUZA 4CZGA 1G2BA 3QIOA 3MEDA 2OPSA 4B1XB 2CZ1B 1VQ4T 4UV8A 2BVLA 1YW7A 1SEUA 1RUOA 3FXOA 4Y28E 1ULYA 1YJNQ 1JXOA 4AD9A 1FLIA 1Q82C 3ML6A 1YG2A 3MKYB 2LTOA 1Z7UA 5C10A 4LDUA 3WVEB 3SDGA 1Y8QB 1HKGA 5CCAA 4RTTA 1VQ9N 2A28A 3C95A 3GZ6A 3SJJA 1VQON 2JA6J 1AOJA 4IDKA 2A37A 3PIOL 2XSDC 2Q1NA 4XM3A 4LK0F 3QIPA 3VTIA 1HDPA 1B9DA 2P7CB 5AONA 1K73R 1PD1A 2VXZA 3KP2A 2E1YA 1UHFA 3A0IX 1QSLA 2ZM6K 4CHYA 3DLAA 5T7BA 3LSIA 1JTYA 5L3EA 5HRPA 2EKHA 4B9MA 3MXMA 3KBGA 2ECCA 4LJZF 2K5FA 2ASPA 5AQFA 4EJUA 1K73O 5ICCA 5FO5A 2HZDA 3U1KA 3CJQB 1Y0MA 2HHTA 1SFUA 1I0CA 3WTXC 2HBLA 4BRNA 1VQ4N 2EFWA 3M8JA 4HT8A 4BREA 3BZCA 1FOKA 1CZAN 2R5ZB 3V4IA 3K1PA 1JLEA 3OYFA 3AO5A 3ZX2A 1O3TA 2KFNA 2DYIA 1VQ9A 4CGHA 4P96A 4Q48A 4A2UA 3NEUA 1VQOA 3H0HA 4NQWA 3CCUT 1W9HA 1RUWA 2OUMA 2V79A 3QRFF 3H1QA 1Y64A 1G3WA 1OX8A 4KHYA 5HP1A 5AQZA 2MLKA 1JO8A 2CW0F 4ESJA 4HTUA 1BI3A 3UR3C 4X65K 2P9LA 1MDUB 1WJAA 3D2FA 4RTWA 1BHLA 1TWBA 4J6WA 2VE8A 3QBWA 4DA4A 3CJ9A 4BVOA 1K8KA 5CVJA 1RRSA 3J80O 4FM0A 3L2CA 3CMAI 4DIQA 3M3YJ 4M78E 2DILA 1RILA 3KTUA 1BCOA 2EAYA 2E41A 3T69A 1ZBLA 4JKDA 3QJYA 3IH7A 5FU7C 4F7UF 3QU6A 2CP0A 2M9UA 1K8AU 5J47A 5C4XJ 4XKBA 2KLOA 4HW0A 2VBWA 3U9ZA 3M5AA 2FBYA 2Y1IA 3IWZA 1UJ8A 5HS9A 2Y2ZA 3AA4A 3KP4A 3UPUA 4J6YA 4JUVA 1TV6A 5AQHA 3ZQHA 3W0LA 4IUUA 4FT8A 3FHZA 4NBQA 1NKCA 3CWTA 1GDTA 3A98A 3FF5A 1GCQA 1YO5C 3O8MA 3H41A 3TKYA 3N4QA 4BGAA 1OYIA 4RW7A 1QVPA 3OH6A 1UG2A 1ABOA 1XX5A 3FM3A 3OIPA 1A5WA 3ZCOA 1J2XA 2XRIA 1FMKA 1FXXA 1VQNT 4FM1A 2NNWA 1RC9A 2R93J 2R0QC 3KZBA 4IOXA 1BU1A 5GAEP 3BFMA 3IKMA 2UXXA 3M1FA 1TT0A 2M0MA 3BE3A 1S22A 1XPXA 2QBYA 3ZSVA 2E60A 4N0AA 2WAQA 2IS1A 2FMYA 4NC6A 4LDWA 4Z0UA 1S7EA 2QGFB 3LH5A 4RTUA 3F10A 2XY7A 4IOAF 2L3SA 3NH1A 1M3CA 4DHYA 2CJJA 3O3FA 1X19A 3F3XA 4FZYA 1OX9A 3FC3A 2HHQA 2PUOB 4YRVA 4LIUA 5BNGA 2K7AA 2N8GA 3M8PA 3JB9J 1W36D 3TTDA 3KJVA 2P9SA 2E2JJ 3UDCA 1RL2A 1QTMA 1NKUA 3LWIA 2Z1DA 2OJED 1JI8A 1LWWA 2O8XA 2DK3A 2EFIA 1XNQK 3CC2A 4EV0A 3A02A 3A4CA 5DCMA 5F1RA 2XDPA 4J9DA 4AG2C 5C0YA 4XSXF 4HXJA 4A3JJ 2VWFA 2DPPB 4BNCA 1K9MR 4UVAA 4BU2A 2G3RA 3LDNA 1IW7F 3FIWA 2M45A 1M2VA 1MSFC 2I5UA 4N4OB 2LZ6B 4RLFA 3MKWB 3OA6A 3LP0A 4CZKA 1WI7A 2MAMA 1RIOH 1FPQA 3J7AP 1VQNN 1M90U 3H1VX 1TSFA 2FMLA 2DJIA 4JJNK 4CF1A 1Q82R 3H8ZA 4FQGA 4BDZA 3DLLL 2L9NA 3PFYA 3CXCA 2BZYA 1ZBJA 4J9EA 2KE9A 3MEUA 4BRLA 1VF9A 1HKTA 4DV4K 1FZPB 4LLGF 4G1QA 3K9KA 2JUCA 1G83A 1JXBA 2YDLA 2LF8A 1DQUA 2J06A 2M87A 4M7DF 3HOYJ 3MCAB 5EEHA 1QBJA 2Y90A 5BPLA 4HLYA 2FF6A 4A3CJ 3LX7A 2NNNA 2FSNA 2A6HF 2GIVA 4DTPA 3CDLA 4EA5A 1ATRA 2KDOA 1VYVA 1SKWA 4ZHRA 5IT9E 4M6XA 2O9LA 4J9FA 3R6SA 1KG3A 4E9GA 3I55Q 5AIQA 3BDDA 4K25A 2QKBA 3T5XA 2DE0X 3JCMV 3UA7A 4RW4A 1IN8A 5FU7B 1LEAA 4JJBA 4M77B 5IYCJ 2CH6A 2F5KA 2FOWA 4Y4RA 2H94A 2BV6A 3I0XA 1ZHFA 4BRDA 2YNIA 3SUQA 3TARA 1B6AA 1MNDA 4DKWA 2CU7A 4CDGA 3CMET 3V1RA 5C2FA 3RTVA 1EP4A 2HMIA 3QICA 1JXSA 3CD6T 2YHBA 2HI3A 3VEPA 4E9FA 2NOLA 3G71I 2D0NA 2O7OA 1KK7A 3KKSA 4C8QE 3GZ5A 2NOJB 1AHJB 4FISA 1I3AA 3VJPA 2FEIA 2V1XA 1KG6A 4BHBA 1KC8U 1VA7A 2CQ7A 3E19A 4CJKA 3FJ5A 1IKYA 1PWTA 1KAXA 2Y31A 1NWKA 4FVMA 4JKGB 4RGXA 1YBYA 4DNCA 5JR3A 2RHXA 3JCMX 3S32A 2GIZA 3JCMJ 2CREA 4XTYA 1I5ZA 5E8GA 4Y92A 1S1XA 4WTOB 3LP3A 1L3LA 1RUNA 2AXLA 1APLC 2XDDA 4OO1J 2JPSA 4XKVA 1V4RA 3O4QA 3I54A 1Q1VA 2HMPA 4YIFA 1O57A 5FW9A 3H3OB 2OBPA 1WSGA 1JKPC 3A2KA 1YQRA 2HDCA 2K9MA 1RACB 1ETYA 2J6OA 2QEXI 3CXCM 3CVTA 2VKHA 2L2OA 5AQOA 4HF1A 3MHXA 2DW4A 4C8QA 1C0TA 3OW2P 2F48A 2R3SA 1CZBA 3OGDA 3S15J 4NLCA 3CMEN 5GADJ 2JS2A 3QMLA 1YWPA 1GLLO 3TAEA 3ROUA 3M6GA 3CD6N 1T38A 3B6PA 4AIJA 2QKKA 3D4VA 2XAQA 3ZRGA 5DPKA 1W4MA 3HJFA 3REOA 3FHGA 3VF2A 4AQYK 2M0OA 3CPWP 3FZMA 3C2HA 1DDNA 3SNNA 3PLAA 2HXIA 4BY6C 1UHWA 3V8JA 3J7YJ 3SFIA 3E01A 3VQ6A 2NRHA 4OX9K 1QQCA 2G8HA 4EJTA 1VQMT 4KTZA 2CQXA 3H1CA 1U5TA 1Z0XA 3TO9A 1FTTA 3CJ1A 1VRTA 3FZLA 4EJVA 1PVSA 1VQ7Q 2V7ZA 1BBZA 3D7SB 2UU9K 1W0TA 2KTQA 3QFUA 1VQ6T 3IKVA 4M75C 1KQSA 2O4GA 3E97A 5EVZA 2VC1A 5M5WJ 1WH7A 4CJUA 4FXDA 4F7UG 1GFCA 2PJRA 1HKBA 2QXFA 3EG0A 1PRMC 1S9EA 2LDMA 4V2GA 5FU6B 2ELJA 3IAS2 4FM2A 4F3QA 4BBSJ 5F0HA 3MDQA 4JX4A 2UXBK 1SC7A 3RYRA 1YI2I 4WXHA 2XRNA 2XAUA 3K70D 1XS9A 1O13A 1WH5A 1OH5A 5J4VA 4JRIA 4LD5A 4EMHA 3QDFA 3QPHA 1VRUA 1C0GA 1Z21A 1VUBA 3ZL7C 5GAN4 1RZ4A 2FZCB 1GBQA 2PJPA 2J7IA 1Q86C 2EGAA 1CKBA 1MD0A 4ISEA 3KYDB 4C92C 2LKSA 2HCKA 4FJMA 3L3VA 2O31A 1WIEA 3KLNA 4HX4A 5LJ5f 5D5UB 3J80E 2XICA 1R5GA 3AA2A 2DIQA 4BRFA 3MKZA 4KUIA 3NWTA 3E9PA 2JVVA 2PFBA 3VQBA 1E2XA 2K5CA 2F5CA 5A2QO 2KK4A 4JI5K 5EU7A 1M3HA 3THKA 3O1WA 3L2QA 2ZFUA 1Z91A 4FWMA 2UXCK 3SZTA 4AHUA 5J2PA 4MGRA 1VQ6N 2TRTA 1UEBA 1BDGA 2ETJA 1SEMA 1ORKA 1Q18A 1SAXA 4OVAA 2XSJC 1HJDA 2MC3A 4Y52J 4DK9A 4M3BA 1VQ5I 3P38A 1QPMA 2JZYA 3JCMe 2W40A 3NMZC 3EKUA 4DTRA 4IHYA 3BC8A 1X9SA 3VGKA 1D8KA 2JT1A 4CC4B 3HHTB 2DBBA 3CC4Q 2ELHA 4K0KK 3RKXA 3PO3J 3A8OB 3S2HJ 5KE2A 2EQRA 4IRGA 3D0SA 1H8KA 2VGNA 3GTMJ 1S1UA 1UGQB 1O4XA 3DXMA 2BZTA 2FXAA 2FJ1A 5F6FA 1OCCH 1RRQA 1QVUA 4L9VA 1UUEA 4M7AF 2YR2A 2DA2A 1KQSM 2HU9A 1QU3A 1TUYA 5AQPA 4HKEA 1YITQ 1I1GA 4FCYA 3HJEA 3WT0A 4EM2A 1ONVA 1MNMC 3MXIA 2WSEE 4DGWB 2KZMA 3G1MA 3IUOA 3Q9VA 1F4KA 4A3KJ 3A1PA 4QT7A 1YCYA 4GY5A 3HB9A 4NXMK 1OPCA 3NNQA 4BBRJ 3EG3A 2DCEA 1IH7A 5IT9Z 5M3FJ 1VQ6A 3O6WA 2VQFK 1X1PA 2ZPEB 4LG0A 1X2NA 3KE2A 5C0MA 2QK9A 2JSPA 2M4GA 1T0FC 4C2UA 3R2XC 1ITGA 3JB9H 1MPGA 5J40A 5AZJB 3OYCA 4QVCA 3DLRA 5LJ5d 2YV0X 4LH4A 4M7DG 4JS4A 3FJPA 4JLIA 2BY0A 2DTHA 2QWPA 1HW2A 2A0FB 4MO4A 3K2ZA 3OYNA 3CC7Q 2OTLQ 3C7NB 2QTVA 2DBKA 4BJ5C 4A4KA 4NOYA 3DWLE 2D5RA 1Y0UA 4XRMA 2CT3A 2AA4A 5GJWB 1TQIA 1JQQA 4HUGA 3KX2A 3TGNA 4RTYA 2E2HJ 3I4PA 1LWEA 3M0TA 1YW9A 4F17A 2EQIA 4JYAK 3WEEB 5KTQA 2YHYA 4N9IA 1FW6A 4WK8F 3H9JA 2FF4A 1SVLA 1HD3A 3E6CC 1LB2A 5AYFA 4HSBA 2ZNZA 3L9FA 3OSVA 5AQUA 1G6NA 1KXPA 5GMKe 2DM1A 1E4GT 3I59B 3KYLA 4I2PA 1XMQK 3H5NA 4KO0A 2NOHA 5AQSA 1Q9YA 3Q0WA 4Q47A 3ZYYX 1WHUA 1Y8RB 2R7VA 3DWLA 3CCST 4ASNA 5CIUA 3LPTA 1LMZA 5HY6A 1MBJA 5KCOA 2JTVA 4EP5A 3AA3A 1W2BA 2PNIA 3UKUA 4O55A 1BJZA 2LR8A 1SS6A 4KYWA 2D2WA 1BC7C 1M30A 3AVLA 2DL7A 5AQGA 1D3BB 2KQWA 1WAFA 4BC5A 2KIMA 1YS7A 2WADA 3A2FA 4MQ9F 2OCEA 2XHIA 4PLLA 4MDXA 1RPWA 1N5ZA 3O4NA 3QEXA 3S17J 4A69C 1HA8A 3BWGA 3MN7A 4CK1A 2P9PB 2WTEA 1VQPI 4EJZA 1VYUA 1RR7A 1IREB 1WOQA 4GGGA 4UV9A 4FL6A 2XY8A 2LNBA 2HHUA 3VQ4A 1IBMK 3I56A 4IL6C 3MZHA 1P4WA 1NOYA 4C8MA 2V6CA 3P5JA 3VPZA 3CCVI 2ABLA 2D45A 2VKVA 5L3GA 2ATCB 5J3BA 2QM3A 3Q7CA 2CZ7B 3JRZA 4EM0B 1OPLA 2WBNA 3UWNA 1R71A 4W5TA 4LFAK 4BXFA 2JN0A 1LAVA 2Z3YA 1Q86R 3ZX0A 1X9WA 2E8AA 1VRLA 3HTVA 4HCCA 3CCSN 5AQIA 2NUZA 3D2EB 2KPMA 3CP8A 5LRRA 3IDHA 1RESA 3C65A 1MKMA 1NGAA 2P4WA 1BIUA 2COWA 3HPWA 4EMKC 2LY2A 2KIFA 2Y0SA 2X6XA 1WNLA 3OQ5A 2M02A 3ZQ7A 3S1MJ 4FWRA 2KFZA 4ID5A 3QPTA 2E6MA 3WTWC 1VQKQ 2RKHA 4HWIA 4CD1A 5ICGA 2ECZA 2ADUA 1EETA 3OYKA 4CF8A 3L2RA 1K4US 4GKJK 1WHHA 3WNFA 3NHGA 1JLGA 2HR3A 3TI0A 5ILUA 1MH4A 4JI4K 4CERA 4MFDA 1B72B 1NG2A 2HBPA 4M77E 3HIFA 5AQNA 3QEVA 4WXDA 4DSLA 2QSFX 3J80Z 5CO7A 2A68F 3K4BA 4CJQA 3HKZA 4CCHA 3OA9A 4KA4A 3CM6A 2P84A 4JKCA 3SLCA 4BE0A 4B3AA 2ZKZA 1NU0A 4LD6A 5AQQA 4PJOC 3VS1A 1YHQT 2NOFA 4E7IA 3B6AA 2X4YA 3SQ4A 2I5JA 2ZNYA 4E1JA 1E3PA 1DT9A 4WQ5C 2JA7J 3DM2A 3HBLA 4EHTA 1BKBA 1AWCA 1BK2A 4A3EJ 2EJRA 2PY5A 4HF2A 1FTZA 1LQ1A 2DPUA 4CESA 1YIJN 3V6DA 2O5RA 4ZGDB 2DERA 1U48A 4P55A 3BW1A 1TW3A 3S8PA 2IVOA 1SD5A 3KZIC 3NH2A 4XQFA 3VSLA 3ZSRA 3OS0A 2E4HA 2PVOB 1ON1A 2IPOB 3ZSXA 2C0TA 2MC4A 3G4SQ 1O9SA 3T19A 1WJDA 5B66C 3MN2A 3JB9D 3ZEUB 1XHZA 3VQ5A 1XMXA 3B6OA 3I35A 3TDUC 2JUFA 4AIKA 2COYA 4ELZC 1KCFA 3VEZA 2RN8A 4ZYDA 4M7AD 3ASMA 2DD4A 3CCJA 3JS6A 1K61A 3CW7A 3PIPA 2JHNA 4ILJA 1HNWK 1S6LA 1KFZA 3WGGA 1OZ3A 2DN0A 3RI4A 2HQEA 3DQVC 2EYWA 1GVJA 3OIOA 1GLNA 4U87A 3BF3A 3GYHX 3RRGA 1GL5A 1SSFA 4QCLA 2DTRA 1IF1A 2KLAA 3GTLJ 2E2PA 1W7PB 2BVMA 3F21A 1PKSA 1S5JA 2DMUA 3NF9A 3VQEA 4RAZA 3BDUA 3S9HA 1M4ZA 3JB9G 2KGTA 1YHQN 2JGUA 3H35A 4M7AG 1DTQA 1DP7P 2VB6A 3SQ1A 2A08A 1YIJA 3OYGA 5JFRA 5FKNA 4UNOA 3BZ6A 1DU0A 5A2QE 3CCQT 3KD1E 2DFUA 2QA4T 3TANA 5AQRA 3AVJA 4HA8A 3KETA 4Y7NJ 3QAHA 5D5VB 4AM6A 4KIBA 2HKNA 3FK6A 3HTSB 2L3QA 1K6OA 2ASMA 2GZWA 3DFGA 4Y3OA 2Q36A 5KI6A 3KZZA 3AG3H 4Q5SF 1Y96A 1RT7A 4Z4EA 3JW4A 3ME9A 3G6ET 2F5EA 2PVDB 2RHIA 1Q86U 2NRWA 2P6SA 3GF5A 4XICA 4DF8A 2GGRA 2ZCWA 4OAZA 2HTJA 3DKWA 2Q97A 2JVHA 1M90O 2OTJQ 1G4DA 4AVZA 2WAEA 2WB1N 3JXUA 4ILHA 1PUFA 2ROTA 3FXJA 5GAGJ 1NG9A 1JTXA 4U67L 3CBMA 2P0WA 4AVPA 2K2VA 1MSEC 3P4IA 4AIAA 1F1ZA 3JAMO 4UB8C 1X3UA 1ODDA 4AFUC 2A1SA 3KEYA 4M3YA 3HHGA 2CG4A 3TMOA 3TW6A 4BH9A 5DM6F 1IXSB 1LCUA 1Z67A 2D6FA 5KQDA 1REPC 4BY1J 4CO8A 3L4IA 2IA1A 2F1LA 2QA4N 4PQUA 1HJRA 3CHWA 3BG3A 4CJFA 1X69A 1FKOA 4ZGEB 5M1QA 2ESWA 3M0SA 3BCBA 2F7TA 3CJTB 1IG8A 4PJOB 2P9IB 4KBOA 3HM5A 4OMMA 5FB2A 1SVOA 2XB5A 5FKMA 2IT0A 2WY7Q 5IP9J 1N9SA 3KP5A 3E1YA 3QINA 3TP3A 4DFKA 4NHJA 3Q3SA 4I0BA 1UG0A 1OYXA 1JHFA 1O3SA 3G6EN 2QQAA 4QQGA 3ZT4A 1MMSA 1VAZA 4B1RA 2OQGA 1QKXA 1ZSZB 2COBA 4JS5A 3FXKA 4XLAA 2KAFA 4L9NA 1OQYA 1BJAA 1HMVA 3DYAA 4XKWA 3L0QA 2HSPA 2K3XA 4M71A 3A8YA 4M78D 3GFIA 2CZ6B 3RKQA 5C24A 1L5UA 4A59A 1RDDA 2G8VA 3CCEQ 4PGGA 2K4JA 1NK2P 1R5ID 3TBIA 3HSCA 1J7KA 4XK8E 1X4OA 1IDYA 1VK0A 2BYVE 2Q1ZB 3OOPA 1AU7A 4WX9A 4RS8A 4CGFA 3GG4A 1D3YA 2X51A 4KUMA 1T0JA 2UXDK 1IAWA 3RVCA 4KH0B 3FMSA 1EWQA 5E3MA 2DT7B 1RTJA 1J3TA 3Q7BA 3NFCA 3CJ7A 2F2WA 4M78G 1WZ2A 4CGZA 5AT1B 3DCFA 1U8BA 2HDDA 1YQLA 3FXUA 3N97A 3VDXA 2HKQB 3BR0A 1ZYQA 1QE1A 3A01B 2JG6A 5LJ3j 3P39A 1V29B 3KLEA 1U45A 3EG9A 1TYQB 4KHQA 4L5EA 3F8MA 1M1FA 3SFMA 2F9TA 2V9KA 2ECBA 3M1CA 1BOBA 3K70C 4CEAA 4DQ8A 3P8DA 3T8RA 2CUZA 2K5IA 4P9UA 2PQWA 1OISA 1YS6A 1N39A 1FWZA 2P8TA 1Q8IA 2YUQA 4GXOA 3GP8A 4NO7A 3HOZJ 1Y97A 4OB1B 4XU2A 2KROA 1BA1A 5E3OA 1YJNA 4MDBA 3L4QA 2ZWHA 3U9GA 3OH9A 2HKXA 1ATNA 4FJJA 3BT9A 4CECA 4KHPK 3JCMP 1B9NA 3M4YA 4EJWA 1BOAA 3MEGA 3THXA 3A0HC 4H03B 4O5FA 1TP4A 1YQKA 1IV0A 3FXMA 3CMAT 1NJYA 4M75E 2CWEA 4HT9A 3BROA 1IJJA 2P9UB 2XV4S 3W3DA 3SEZA 1R23A 2R7QA 3SZGA 4C2TA 2W7NA 3ZN1A 2PUKB 1TKXA 8ATCB 2ID6A 3ZT2A 3EYYA 1YRNA 3BCAA 5DYMA 1Z9CA 4O8UA 4RM3A 4FETA 4P9FA 5D7UA 2YI1A 3BY5A 4RCBA 2VJIA 2HEQA 2RI3A 4NXNK 1N32K 1CSKA 5HS7A 2GFUA 5CZ2A 1W97L 1VNDA 3I9V2 2ICWG 5ERIA 3JSOA 5GADP 3F72A 3CBPA 1JJ2S 4HTLA 4CW7B 1NKBA 3LALA 1WEFA 4RGUA 5KYYB 4C92E 3HUGB 4ANJA 4GMJB 2GOMA 4MZPA 1MWMA 2PMZA 2M1HA 2DVEA 1LPQA 2D0BA 4DOWA 2F6CA 5GAN8 2YNGA 4M7DC 1Y1VJ 4M75A 2LF7A 2P5KA 4XORA 4DMNA 2E36A 3H46O 3J7YP 4F52A 4LE9A 3CCLQ 3IV5A 4M3UA 1I27A 1XDSA 5F27A 1E7OA 4JD2A 4KB1A 3X25B 3EE8A 2K4BA 3FKJA 4JKBA 4DFPA 5BS6A 2OAZA 2FQ3A 3WEEA 1FC3A 1JU5C 1K83J 5L3FA 1RR8C 2HZYA 1A0NB 1N5YA 4NS5A 3IRXA 4Z2YA 4RAFA 3OTOK 2I8DA 1VQLI 4I99C 4ELTA 2GQQA 1KHCA 5A2QZ 1KU7A 2XAGA 5K5QA 1O3QA 1A35A 4R0KA 3LA7A 5ILVA 2V75A 4ZDOA 3NRVA 3JRBA 1HNVA 1TUUA 2H56A 1N27A 3GDQA 4II2A 4ENMA 1WHLA 4Q0BA 2P5GA 1WCMJ 3RSEB 3L6QA 2EGEA 4C92A 1IGQA 1J09A 3G2BA 2YRCA 3CXCP 2W41A 1NM1A 5D5XB 4O8KA 2HBKA 1D9DA 1BI1A 2O61A 1V5GA 1XMAA 2YHAA 1VQLQ 3WU1B 5CZ1A 4C8QD 1DGWY 3HHHA 3IP4B 5DLOA 3EDPA 2LRQA 4PUOA 4DU3A 3TSUA 3VOEA 3RKWA 4KITB 4UVBA 4DTSA 2HPMA 4FLYA 2QCOA 4XRFA 5JVGL 4Y1DA 3M8FA 4NC8A 2STWA 2HF4A 3H5AA 2P9KB 3HFOA 2CMPA 1SAZA 1QKWA 2WAFA 4PCQA 2LMJA 3LDSA 5D6EA 1KYWA 1QWEA 2DL3A 4E7JA 3WTYC 4F04B 4JI2K 1PKTA 4BKXA 1E6GA 3I55T 3VYSB 4B8CA 1UHSA 4ENKA 4C8QG 2X4JA 4Q5VA 1GOCA 1IZ1A 4RTVA 3SAFA 4Z4IA 4E7SA 5KNLA 3OMCA 1FMWA 2Y48A 3CCUQ 1IXDA 4NUBA 5EGOB 1T56A 4RG2A 4DG1A 2F2XA 1ACMB 2ME0A 4Q5WA 1Y1WJ 4PKIA 2E1MC 4I9QA 3V7RA 1D8YA 3P9CA 2K79A 1ZELA 3GW2A 4KN7X 4ESFA 3T7ZA 5DD8A 4HUFA 3JRCA 4OPKA 2K6DA 1JHHA 5CKFA 2VN2A 2D4WA 2W4SA 3LSMA 3ZQQA 2WOMA 4JK8A 1EJ9A 3S6IA 5JLFA 5J2MA 2QASA 1R59O 4P5OA 4ON0A 3PT9A 4CYCB 4H0TB 1KU3A 4CBWA 2KIQA 4ZH4F 2X48A 1IRFA 5ICFA 4BC3A 2KRHA 4WFAL 2F5TX 2VE9A 2ZB9A 4C0FA 4OP0A 1YOVB 1H3ZA 3V9ZA 5AFUA 1A36A 1T0FA 3C3WA 1Z1DA 2DJNA 3LWLA 2BE7D 5KAIC 2A07F 1NBWA 4XH1A 3VETA 4YOQA 3VFZA 2MFZA 3E7LA 4MIMA 3G71T 2AXTC 3ULDA 3L00A 4GV6A 1OZ2A 4GBQA 2O03A 1TTHB 3I55N 5J1YA 4YY3K 1G3TA 3JAME 5EJCA 1RETA 1FKPA 4YOXA 1XQHA 2PBDA 3ABTA 2NVTJ 3K10A 1H89C 3W3CA 1RKWA 4EP4A 1S6PA 1NMNA 3TSWA 1UJ0A 5LGUA 3FK7A 3R60A 4RW6A 1J54A 1FIPA 1NJXA 3ZETB 4XKCA 3NAUA 3URGA 4BJTA 1EQYA 2A5XA 2D0PA 3DV8A 3LA3A 2E12A 4V19S 1MUYA 2P9NA 1VQNQ 3ZOBA 1IO2A 3PNWC 3BG7A 1GV5A 1ZG3A 1JKRC 1NK3P 2QEXT 1XGSA 4J8OA 1L3VA 4JKAA 2HS5A 2W10A 1T6CA 2FVUA 3H08A 1ZN2A 2YJEA 2L0KA 4LN2A 2M1BA 3A1YA 4P1WA 4LDVA 1N75A 2JA8J 3FXRA 3GTJJ 4OFAA 5LJ3g 4OPAA 1N36K 3D1NI 4YFXF 1FP1D 1NG6A 3M8EA 1U06A 3G71N 3AG1H 1U4BA 3E9GA 1EV7A 2NLXA 4M77F 4CEZA 4B48A 3V4GA 4YFKF 1VQ7T 3SHFA 1IV6A 5MLCQ 2JWTA 3LFUA 4I6ZA 1YT3A 3X2QH 3CJBA 3ZMZA 2NUTB 2ZJ2A 2VUMJ 4VUBA 1D9FA 3G0ZA 3TABA 1QO0D 3CCMQ 1VQ8Q 4DQ2A 1G3YA 3O9UA 2VJ5A 4QKUA 3CP2A 2RHZA 2E2OA 3HI0A 4QQDA 5CKDA 3JCMg 5EY4A 4JX6A 4OKEA 3MX5A 3VS3A 3GLLA 3KEQA 1MJ9A 4GVMA 1OH7A 5FLXO 5KYNA 3TPQA 4H5TA 4LB5A 4M72A 5AQLA 3INZA 1NOZA 2GXBA 4R56A 1FK9A 1D1AA 4K42A 4B24A 4LK1F 2QEXN 4DU4A 4Z4HA 4DR4K 5IAYA 4M7AC 4BI8B 2CW8A 3K5LA 2E1MB 1JLFA 1WI3A 1DU6A 4MMKA 1YYVA 1NLPC 2HKOA 2ED0A 2QWLA 4H8KA 1WLJA 4MNUA 1YI2T 3MP8A 4FJIA 1NEBA 2VXDA 2W6KA 1KD1U 1NPRA 4PL6A 8AT1B 4EMKA 4PJOE 3VA3A 5DCFA 2Q2EB 1QZ5A 4YOTA 2OV7A 1RAIB 1VQ7N 1UAAA 1OOTA 2HNHA 4MLHA 4ESRA 4CK3A 4IEEA 3V1QA 2KZVA 4FW1A 2O8KA 2JS0A 3OW2S 4B09A 4ISFA 4CIEA 3BLYA 2O4XB 4JBAA 4H4KC 3S3OA 2ESNA 2VWKA 1NH3A 2J05A 2CDTA 3U4LA 1ZQ3P 3CC4T 4ZN1A 1FMVA 1QCFA 3I4NJ 3CPWS 3OS1A 1BOTO 1YFNA 5IXFA 3CMEQ 1GRIA 2IDOA 3THWA 4DQSA 1KAZA 3CD6Q 3ABLH 3K2AA 4A57A 3HRMA 4XN3A 1QQIA 5IHNA 1I1SA 4DJAA 1T08B 2CW7A 5FGMA 2E88A 4M73A 5D6YA 4PJOA 4FYYB 1VQ5T 3ULQB 3HXMA 3VS5A 1G15A 5F0FA 5LEKA 2B6AA 1YITT 2JN6A 2OANA 2CGKA 3VF6A 3VERA 1YI2N 3WTUC 3E66A 1LVAA 1TUDA 1OCPA 3FMRA 2CGHA 2FO0A 2VONA 4LF7K 2RHYA 1MJAA 3CCRI 2W0ZA 1MDMA 2HZTA 3E9OA 4KMFA 1S3JA 5AN4A 3KTQA 4BDPA 4AI5A 2RVCA 2HD0A 2L3RA 4KN4X 1UGSB 3JCMh 1NJIR 3NGYA 3W6JB 5K7FA 2KDSA 2RPIA 1YJ9Q 2XF7A 4DR2K 3AO2A 3CC7T 2NOIA 1W7AA 5EG0B 1P59A 3HSFA 4PKCC 4A3DJ 1XB4A 1NBEB 3C6UA 5K7ZA 5F08A 1K7AA 2XGEA 2VODA 2ESHA 3CC4N 5IWAK 3OV8A 2DL4A 1PP8F 4CZCA 2EIJH 2EW3A 1NJIO 4LFCK 2BTTA 2EHGA 2HQ5A 2E1OA 1ASUA 1W1WE 2GTDA 4FT4A 4YFUA 3ENBA 1SSHA 3I4MJ 3LSGA 1LW0A 2EK5A 2CGLA 3W6VA 3HXLA 3SV4A 2HHHK 2EVRA 2E65A 1HC8A 4MZMA 4RCCA 2XUBA 1VQ5N 1P7JA 3ASKA 2B9SA 3L09A 4KHNA 3IC7A 1P4XA 2WBMA 3LSKA 1YITN 1N8RR 5E20A 2FPDA 1YJWQ 2OA8A 2NOEA 5CQYA 4WQ4C 3KLGA 4M78C 1RCHA 4KREA 1WAJA 1VQMQ 3N05A 2EYYA 2C6YA 2KRMA 2MWPA 1EXQA 1SD6A 4JX5A 1RDCA 4B23A 2KKOA 3ASOH 3DF8A 4I01A 1W2BP 2RAEA 2O8CA 4FJ5A 4X6AJ 1B8IB 4A6DA 1N8RO 5KGWA 4MLOA 4UUSB 2KBTA 3THYA 2QTXA 4J7FA 4RGRA 5JI6A 3CC7N 3O3KA 5HLGA 2O8BB 1X58A 3CC4A 2GLOA 4B9LA 1E3MA 3DEEA 2WUSA 3DRSA 4O6JA 5GANe 4JRQA 5JHFA 2X6NA 1ZK8A 2Q0OA 4FWOA 2DZ9A 4O5BA 3HP9A 1XNIA 2MA3A 2ELKA 2O9SA 1H8AC 3S1QJ 1XUPO 4JNEA 3GNGA 1JKHA 3OJUA 4G94A 2KFDA 4AG1C 3K5NA 2O8EB 2W25A 1YTYA 1MGQA 3WNGA 4CVNE 1QQOA 2V26A 3OYJA 1WQ2A 5BPIA 1CQTA 1C1AA 2DETA 3R0AA 1YITA 2DF6A 3TU5A 1U8RA 4CD3A 1RAGB 3RZDJ 3ATUA 5F1XA 4D8KA 2DA4A 2GXGA 4J2BA 5GMKh 1JLAA 3MVPA 5LMUK 3VKIA 3G1LA 4HQEA 3EG1A 4M77D 4NC7A 2GWRA 3RDIA 2P1JA 1S7OA 1V54H 2Y1JA 3QJ6A 4B9XA 2JA5J 4PJMA 1AZEA 1R0CB 3ABUA 2Y75A 3RMBA 3OBWA 5GAGP 5KYYA 4C1NK 4EQQA 3HUGA 3VEVA 1X3MA 3ITHA 5C3EJ 4O3MA 1VQPT 2H09A 4ZYEA 2V52B 3CC7A 2OTLA 2EFNA 1FBSA 3T8TA 3RMDA 4RUGA 4DEYA 1VSIA 3VV0A 2VQHA 5LJ3f 3CCVT 4M77G 1VOMA 1ETKA 2X35A 2G6FX 4UQGA 2V7FA 4BB7A 3P8BB 4M3WA 2X1CA 1TQMA 2VOPA 1PD0A 5HDKA 4F7UA 3G3ZA 4AHRA 3IUCA 1ZA1B 4XEIA 3AVFA 2LP0A 2XK0A 2HL3A 2K5LA 4E1NA 1IB8A 4OJRA 3RESA 3DB3A 1MV3A 3C2BA 3FBNB 2FEZA 1WHMA 3RSEA 3R0JA 1JXEA 4KIGA 2EILH 3V8LA 1KONA 2VCPA 2ZZDA 2PX9A 4FT2A 1BM9A 4RB2C 2BE5F 5M5XJ 3FZHA 2CFXA 1I1JA 2ZCFB 3TEDA 3O8VA 3P8HA 4XLCA 1RI7A 1K78B 5D4SA 2BBYA 4H0XB 1Y6IA 3EFOB 1SG5A 1S9HA 1R1VA 3BPXA 1QVGS 2HQNA 4CJ5A 3TAFA 4ZYGA 3GBTA 5KVRA 4A5AA 4DR1K 1RAEB 1VQPN 1WPKA 3VEWA 2MSYA 4C5GA 4OKJA 2VKEA 4AHCA 1QHHD 4OPJA 5B8HA 1S72I 4IFYA 3I53A 2M7BA 1I3QJ 2BOLA 4IWVA 5IH2A 3CCVN 4CZZA 5E3NA 3I5SA 3VS7A 4H5RA 4J2DA 1GLAG 4BEHB 2QZ8A 5KGXA 3D0PA 2V4JC 5ICEA 3G4ST 4NDLA 4CC7A 3FHNA 3R1XA 2ZJRF 3QO9A 5E1XA 5J8CA 5FLXE 4AI4A 2JLEA 4X66K 4E0DA 2KRCA 1O1WA 4H0OA 3BG9A 2PVGB 2G8WA 4PFOA 5LJ3d 5GAN5 5HLIA 3M9QA 3OS5A 4PDKA 4M7DE 2RREA 3CLQA 1KG7A 4PJJA 4DV6K 4OGEA 4K41A 3LM2A 1MW7A 1PG5B 1XJWB 2QQ8A 3S6WA 1DPRA 1QNTA 5IT9K 1X2MA 4A2AA 4XRSG 4Z8AA 4AUXA 2Y30A 1HNXK 2H3EB 5D6FA 5J26A 3Q0UA 2IPQX 4M45A 1SV5A 2LYCA 4N4NB 2X1DA 1R5HA 1B34A 2CSIA 1KHIA 3E9LA 1A6IA 3K4NA 4AT1B 3J7AO 4BQAA 2ZAEA 5FKLA 3CCSQ 3CM5A 3WQUA 3HPHA 1M1KO 4BQNA 4PGHA 2XU8A 4DV7K 4UUTA 1SKSA 3IRRA 2RQQA 1VQKA 2XDVA 2XDBA 4U88A 3KNTA 1J6ZA 4L0ZB 2RPNA 3OSSC 4LOCA 4ENJA 3H0GJ 2O8FA 3BZKA 4B6MA 1K76A 3G4SN 3JB9I 3SBTA 1OCRH 2HW3A 3EG2A 4M7DA 3SAHA 2FG0A 5KN9A 5HLFA 3DKMA 3S2WA 2OX7A 4BWJA 5LHIA 3MQ0A 4N4GA 3HOSA 3AARA 4BRQA 4H4MA 1X75C 5DY9A 2X74A 3DU6A 1SD4A 2RC4A 5AFUH 3PNTA 2DDAA 1IN6A 4PK4A 4X64K 1MUNA 2FF3B 4DZPA 1GT0C 2G8IA 1MV0B 2F9WA 2LCLA 2LQNA 1TNTA 4J9GA 4BE1A 1YWOA 4S0HB 4JHDB 1UDLA 2E5KA 3SWNC 3EETA 1JKQC 1IV8A 4HVVA 1QLYA 5F2RA 1JT6A 1ZBXA 3KPHA 7AT1B 4U0VA 4UB6C 2DA5A 2OZMA 3GWZA 1VSEA 3KD5E 3DB4A 1ZTRA 3EHQA 1DJ7B 1YFHA 1IKWA 1W5CC 2L02A 4XLHA 3LM9A 4J9IA 3O9TA 4CJSA 3G4SA 2BW3A 3EFRA 2AHJB 2ZGYA 2EZIA 1KRPA 1VQ9I 4U7DA 4IOCL 5HDNA 1VQOI 2O2OA 2H8RA 2KDZA 1X6GA 1PU8A 4K2EA 2HOEA 2A42A 5GTIC 4KFCA 4RA2A 2GUPA 1HF0A 4FASD 1NYFA 3JREA 2VKNA 3HOWJ 2FSWA 4XBFA 3PV8A 4N5SA 1IGUA 2DXUA 1HKSA 2YHWA 3S1NJ 2MLGA 2M51A 4XIUA 3L1AA 4M3ZA 1ZG1A 3OYBA 3AVIA 4XLEA 4J19A 3H0DA 3ECOA 4RG8A 3WVDB 1U04A 2BXYA 1QSYA 4Y15A 3FB9A 4FSVA 3FE1A 3HOTA 4L3QA 3FEOA 3AO3A 2HWVA 3DLMA 1M2OA 3VGMA 3BJOA 3H3UA 5AQYA 2DT6A 2QGGA 4K43A 1WEGA 2NYXA 1VQ4I 4HNTA 1YHQQ 1SKRA 2VQCA 4M75D 3CF2A 2JTFA 2LCCA 4CC3A 2E70A 3SJHA 2EWNA 4ICLA 3QERA 3N5NX 2DO7A 4MFEA 1TWGJ 2YU9J 3MP1A 1ZX6A 4N0BA 4XH5A 4H5VA 2BHZA 4RW8A 4YDUC 3BGRA 4PJ0C 2YKNA 2XGCA 1DP3A 4RDUA 4DR5K 3RPUD 3NF7A 3MFKA 3F6OA 3LSHA 1CXQA 5E8IA 4JI8K 3CBOA 2ZJPF 1Q95G 2OTJA 3FFIA 4RKUE 4O44A 2EA4A 3G7ZA 2GWKA 5FPDA 2H6CA 4M75G 3C6AA 2I2LA 2JPCA 5DM7F 2CT4A 1UGVA 3BQZA 2K57A 2AS5F 4N4IA 3EH2A 4C92D 2FYKA 1WGXA 2V8JA 3J80K 4CEFA 5FPNA 4LG3A 1U1SA 3LGLA 1K79A 1S1WA 2A3ZA 4G12A 2HYGD 4ZC3A 4OB3B 2IGNA 4XQ3A 4C30A 3L42A 2RNJA 3PSFA 1UE9A 2DFEA 2FSJA 3GEZA 1Q81R 3FKIJ 4A0ZA 3AA5X 3M58A 1RRJA 3DTIA 5C2DA 3E3VA 5IHIA 5KYWA 3DLKA 2YNHA 4C92G 3RR8A 1RT6A 1NGEA 4MTEA 1FY7A 3CC2I 5I9EB 3CCQQ 2FBHA 2QA4Q 1XGMA 2QK0A 2IVPA 4BRMA 1Q81O 2KJCA 4FL9A 4PFPA 1RNLA 1NZ9A 2NS0A 1TG0A 2LBFA 2VJJA 1JJ2A 2F4OB 4M7XA 3QP6A 2JXBA 3HPGA 3O3GA 3JRFA 4HRIA 3CFOA 1SPKA 1BI4B 5KYXA 5FLXZ 5DK5A 3SJMA 2K40A 2R5YA 2LRDA 1H9GA 1RI9A 5GAN3 5CLSA 2LCSA 2XF5A 5IOYA 1FN7A 3G6EQ 3WU2C 2VLAA 4RLQA 3CCEA 3O80A 3OJSA 4DV5K 1BWFO 2D0QB 1QCOA 2HHVA 2EQJA 3WQTA 4KHSA 2QAZA 4BRKA 1Z7LA 2PYLA 1PNJA 4TVRA 3WE3A 4IDHA 3EO3A 1LDKB 1VHXA 1RTHA 3CYMA 2NUPA 3R61A 3SQ0A 5FWBA 4IIOA 1ZH5A 2CH5A 4A4GA 2IAJA 5EXWA 5EC7A 3KLFA 4GYGA 1BR4A 4CHOA 2F5DA 3AAQA 2R7WA 4XOTA 1KD1O 4WWCA 2VL8A 2EFPA 1ZREA 4HNUA 1D4XA 4PZJA 3CQXA 4G6DA 1UJYA 2M8GX 1RABB 3UIQA 4R8HA 5J4YA 4EGYA 2GQIA 4M7AA 1IUYA 2P51A 1GFDA 4ISGA 2P5LC 1QQNA 2L9VA 3WNEA 2E5NA 3PIPL 2OQRA 1T8IA 1B8IA 2JMCA 1RTIA 4HOBA 5AZIA 1X6OA 2VQLA 1VQLT 2IRFG 1TL1A 1EA3A 4J2AA 2RK1A 3ZMUA 4CEEA 1QHTA 5EZHA 2NVQJ 5IHKA 4UXNA 2QUFA 2P4RA 2E64A 3SEQA 2QQSA 1ZA2B 4O5VA 3EYZA 2YX7A 4BR9A 5GAMf 4DV0K 4GCVA 1IN4A 3VEYA 5A0LA 5GANj 2JNGA 1ZHIA 4OGCA 4Q4ZF 1NGJA 4B9UA 4X1VA 3QG1A 2KXDA 1BUPA 1PUEE 3CCLN 5E18F 3F9KA 3QDRB 4WE1A 4PSWA 1XSVA 1VI0A 1KIKA 2IOCA 3M8QA 2K3YA 1FOWA 1ZR2A 1ZUYA 4FO0A 4QLCU 3GUDA 4LLNA 1RBVA 1A31A 1Z6RA 2JPBA 1UAXA 2DU9A 2QYOA 4ESBA 2QTDA 4CH7A 4FJ7A 4XTXA 4EVIA 2M9HA 5DDGA 2W6LA 2QQ9A 1M3AA 3E1SA 3KXTA 1MU2A 3UE5A 4M6YA 1AKHA 1EH6A 3KP7A 2VQEK 3C7JA 4A61A 4E2FB 3IQLA 2H8HA 3EY1A 1N78A 4M4ZA 2HB5A 5ELZA 4IUPA 3HK2A 2LNVA 3PIOF 2C0OA 5CQGA 2CGPA 4OIPF 3JRAA 1VQLN 3MN6A 1KG2A 2DYSH 2X78A 1EFNA 4MDWA 3BTIA 1LW2A 3DTEA 3I5RA 1JGSA 4XLNF 4OMYA 3CCLA 4XOPA 1I5OB 4E9EA 1IDZA 5C15A 3KKRA 2ID3A 2L3DA 1JCGA 3LSRA 5CVUA 1D09B 5I22A 2IA2A 2CZ0B 1ETXA 1TU0B 4M77C 1VQ4A 4YOUA 2IAIA 2XAHA 4RB0A 2KI7A 3V81A 5B1BH 5LJ5e 4AFZC 2YHTA 3LA2A 5IYDJ 5GAMd 2B7EA 4NYNA 3DEUA 4BR5A 4B3MK 4LNPA 2VGMA 3D45A 5I42A 2KT1A 3C6TA 3AAFA 3HG9A 3CMAQ 3ABMH 4IXAA 2DMTA 4LGWA 4DTMA 3VS6A 4E9HA 2DT5A 4OIOF 5HS8A 3CCUN 1K78A 3CXCS 4ID1A 4CRIA 4I98B 3EFOA 1RNHA 1LFUP 2DLLA 2ZMEB 5E17F 1W6XA 2AZVA 1V5EA 1TK5A 1N6AA 1OU8A 1F36A 4PIIA 2DA6A 4IEJA 2CO5A 3JYTA 5E1WA 4H0PA 4QQ6A 1MWKA 4WQ4A 4M78A 1ZG5A 4CFDA 1FJGK 2E1ZA 2LC2A 2QWMA 4OB2B 2XHCA 2YX6A 4A3FJ 3PX4A 3I8DA 2JWKA 4MFBA 2AT1B 2YUSA 2ETHA 3M7GA 1B3QA 4XTWA 3IFRA 2DXBA 3UKGA 4IHVA 2MD5A 4AF1A 3EGXB 1Q7YR 4HVJA 5EEAA 1RAFB 4LLLA 2K85A 2XY6A 2FA5A 4PJOD 2YLCA 1K73U 4M3GA 5SZTA 3O9QA 2K9GA 2RM4A 1IZ6A 3CCMT 1VQ8T 4DUZK 2BY2A 3PSIA 3CCUA 3MEAA 3ZBDA 2JHJA