4E7XA

Structural basis for the activity of a cytoplasmic rna terminal u-transferase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
339
structure length
319
Chain Sequence
b'HKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Structural basis for the activity of a cytoplasmic RNA terminal uridylyl transferase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
molecule tags Transferase
total genus 107
structure length 319
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4e7xA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4e7xA02
4PGQA 3RJKA 3UQ2A 9ICEA 4FO6A 3MBYA 5DB6A 4P2HA 4KLSA 1BPDA 4M0AA 3HWTA 3C5FA 1BPZA 7ICNA 4XA5A 5J0PA 1ZQQA 1ZQFA 9ICQA 4E7XA 5J2FA 4RQ6A 1ZQLA 8ICNA 4KLOA 1ZQEA 4IQTA 3ISDA 5HRGA 4PH5A 3OUYB 4X5VA 4Z6CA 4PHEA 4M9HA 1KEJA 4K4IA 2BPCA 1UEUA 3V7KA 1PX5A 3RJEA 8ICIA 4UB5A 5DEDA 3ISBA 5J29A 4NLNA 2VANA 4X0BA 1ZQZA 5DBAA 4NXZA 8ICKA 3RH5A 2O5AA 4M2YA 5DDYA 8ICLA 3NYBA 3RJIA 1KNYA 4X4RA 1ZQJA 4M5DA 4UB3A 4X4UA 1Q79A 3RJJA 3C2KA 2Q66A 3V72A 4RPZA 4RQ3A 1HUOA 4IQVA 5HRFA 4UB2A 3MDCA 5IILA 3AQNA 3WFQE 8ICSA 1R8BA 1ZQHA 4NY8A 3PMLA 4WC2A 2GWSA 3B0XA 4MFCA 5D46A 8ICWA 3RH4A 4M9NA 4WBZA 4KLMA 1ZQRA 5IIOA 4DOBA 4LZGA 4KLJA 4PHDA 4RPXA 4M47A 4MF8A 1KDHA 4YN4A 9ICKA 5CP2A 3JPQA 5DBBA 4FHVA 4WBYA 3TFRA 4MFAA 3HJ4A 2DRAA 1Q78A 4I2JA 1TFWA 5J2EA 4X4NA 4K4GA 4PPXA 2BE3A 4QZAA 3H37A 5J2HA 4I2BA 1YLQA 4WC1A 4FHXA 1MIVA 4O5KA 3OVBA 3MDAA 4LT6A 4GXIA 4R65A 4I27A 4EP7A 5CJ7A 4RPYA 2BPGA 1F5AA 7ICKA 1ZQUA 2PBEA 4WC4A 4Z6FA 4RQ5A 4I28A 2ZHAA 2ZH1A 4TUPA 2FMSA 1ZQAA 3ISCA 2B56A 8ICCA 7ICHA 1FA0A 4JWMA 8ICXA 9ICVA 5HRKA 3JPTA 2M2WA 8ICZA 4PHPA 1MQ3A 9ICNA 8ICPA 1BPEA 4YMNA 9ICIA 4MFFA 9ICGA 5DBCA 4AT8A 9ICWA 4EBJA 4X0AA 8ICGA 4DOCA 3UPQA 5HHIA 2ZH7A 3C2LA 2RFFA 4FH5A 2ZH6A 4F5RA 4R64A 3GDXA 4KLFA 3UPSA 1NOMA 4UB1A 1VFGA 2W9MA 8ICMA 1UEVA 3C18A 1ZQOA 3H3AA 4M9JA 4DO9A 1ZQCA 1ZQDA 7ICPA 4RQ0A 4E80A 4E8FA 2B51A 4FHWA 9ICTA 1ZJMA 4TURA 2DR5A 1TV9A 4F5NA 1ZQBA 5CHGA 1MIYA 2ZH3A 8ICFA 4JWNA 3K75D 4Z6DA 4QZ9A 5CWRA 4KLTA 4R66A 4I2GA 4AT9A 4KLGA 4UD4A 3HX0A 9ICUA 4ATBA 3HJ1A 5IIIA 4M9LA 2B4VA 4UAYA 5TZVA 4X4PA 2FMPA 4WCWA 1WOTA 5BOLA 4WC3A 3RH6A 2DVIA 3WFRE 4NM1A 3V7LA 7ICUA 5DB8A 8ICBA 3OGUA 4F5QA 2PFPA 3JPNA 4KLEA 4RT3A 1R8CA 9ICAA 1R8AA 8ICVA 4AT8B 2PFQA 5J0UA 1JAJA 8ICTA 4RQ1A 4RQ2A 1HUZA 4RT2A 2HHPA 5J2JA 2ZH2A 4FH3A 4LZDA 4I2HA 4O9MA 1ZQWA 1RZTA 4RWPA 1BPYA 4I2AA 5HRLA 2IHMA 1JN3A 3JYYA 4WC0A 4KLUA 5J0RA 3LK9A 3B0YA 9ICPA 9ICCA 8ICJA 8ICHA 4X4SA 3OVAA 2DRBA 4KLQA 4UAWA 4O5EA 4XQ8A 5HRIA 1ZQPA 4QZCA 4AT9B 2NRKA 4ATBB 7ICJA 5J2IA 2M2VA 4P4PA 4NKUA 2BCUA 1R89A 5IINA 8ICYA 3PMNA 3OVSA 7ICTA 5HREA 4M9GA 5IIKA 3RJHA 1TVAA 3JZ0A 3JPOA 1ZQYA 4XQ7A 4IQUA 2O1PA 4NLKA 4UBBA 5DB7A 5IIJA 4QZEA 1MQ2A 3HIYA 2DR9A 4UB4A 1ZQTA 3AUOA 4KLLA 9ICFA 4AT7A 5BOMA 4IQWA 4DOAA 4FHPA 3WFPA 3TFSA 1UETA 3V7JA 7ICVA 4XRHA 4QZGA 4XUSA 9ICMA 5HRBA 4WC6A 4KLHA 7ICFA 3UXOA 4KLIA 2BPFA 1NO5A 5J0XA 2P66A 7ICQA 8ICQA 3H38A 4QZ8A 5DECA 8ICUA 7ICEA 7ICRA 3L9DA 8ICAA 2ISOA 4X4QA 3RJFA 3OV7A 3WFOA 3WFSC 3AQKA 4X4TA 9ICLA 4NLZA 4I29A 1JQRA 5HHHA 7ICOA 1ZQKA 4I2IA 4QZFA 5J0WA 5HR9A 1BPBA 1ZQXA 4LVSA 5CR0A 5BPCA 3AU2A 2DR7A 4RWNA 2BCVA 5D4BA 2ZH8A 9ICHA 5EOZA 4I2DA 8ICEA 5DB9A 2BCSA 4RQ8A 4NM2A 2M2UA 2ID1A 4X4VA 2FMQA 5J0YA 4AT7B 5J2DA 3HW8A 4IG8A 5J2KA 3MGHA 1ZJNA 4S3NA 5J0OA 1BPXA 4YMOA 2M2TA 4WC7A 1ZQSA 4I2CA 9ICOA 5J2CA 5J0SA 4QZIA 3UXPA 4QZBA 3LQCB 1XSLA 3JPSA 4I2EA 7ICGA 4P4OA 1ZQNA 4PHAA 1ZQIA 9ICJA 2ZH4A 4NKTA 3JPRA 4YMMA 4F5PA 4F5OA 7ICIA 4RWQA 5F2VO 4UAZA 4YD1A 4YD2A 4PGYA 3AU6A 4I2FA 4YCXA 1V4AA 3PNCA 5IIMA 5CB1A 3UQ0A 4TUQA 4MF2A 4EBKA 2ZH9A 4Z6EA 5J0QA 2ZHBA 4KLDA 1VJ7A 3AQLA 2PFOA 5CA7A 1ZQGA 1TFYA 2BCQA 4RWOA 5HRHA 4WC5A 2ZH5A 4RQ4A 5DKWA 4O5CA 4TUSA 4X4OA 2ISPA 4QZHA 4K4HA 5D49A 5J2GA 2I9GA 2PXIA 3JPPA 3RJGA 1ZQVA 5J0TA 4PGXA 3OUYA 9ICRA 3H39A 4QZDA 3C2MA 5HC9A 4P4MA 7ICLA 4GXJA 7ICMA 1MIWA 5J2AA 5J2BA 3C5GA 8ICOA 1JMSA 5DDMA 9ICXA 4R63A 2PFNA 4UBCA 8ICRA 3UXNA 1XSPA 4GXKA 3AQMA 4M04A 1XSNA 2BCRA 9ICBA 3C66A 4FHYA 5HRDA 4UD5A 3MGIA 4RQ7A 1OU5A 1ZQMA 9ICSA 2DR8A 1RPLA 7ICSA
chains in the Genus database with same CATH superfamily
4PGQA 3RJKA 3UQ2A 9ICEA 4FO6A 3MBYA 5DB6A 4P2HA 4KLSA 1BPDA 4M0AA 3HWTA 3C5FA 1BPZA 7ICNA 4XA5A 5J0PA 1ZQQA 4K9BA 1ZQFA 9ICQA 4E7XA 5J2FA 4RQ6A 3K7DA 1ZQLA 8ICNA 4KLOA 1ZQEA 4NXWA 4IQTA 3ISDA 5HRGA 4PH5A 3OUYB 4X5VA 4Z6CA 4PHEA 4M9HA 1KEJA 4K4IA 4K99A 2BPCA 1UEUA 3V7KA 1PX5A 4O6AA 3RJEA 4EEDA 8ICIA 4UB5A 5DEDA 3ISBA 5J29A 4NLNA 2VANA 4X0BA 1ZQZA 5DBAA 4NXZA 8ICKA 3RH5A 2O5AA 4LEZA 4M2YA 5DDYA 8ICLA 3NYBA 3RJIA 1KNYA 3NVOA 3ER8C 4X4RA 1ZQJA 4M5DA 4UB3A 3NKUA 4X4UA 1Q79A 3RJJA 3C2KA 2Q66A 3V72A 4RPZA 4RQ3A 1HUOA 4IQVA 5HRFA 4UB2A 3MDCA 5IILA 3AQNA 3ER9B 3WFQE 4FO1A 1R8BA 8ICSA 1ZQHA 4NY8A 3PMLA 4WC2A 2GWSA 4N7RA 3B0XA 4MFCA 5D46A 3ERCC 8ICWA 3RH4A 4M9NA 4WBZA 4KLMA 1ZQRA 5IIOA 4DOBA 4LZGA 4KLJA 4PHDA 4RPXA 4M47A 4MF8A 1KDHA 4YN4A 9ICKA 5CP2A 3JPQA 5DBBA 4FHVA 4WBYA 3TFRA 4JLXA 4MFAA 3HJ4A 2DRAA 1Q78A 4I2JA 1TFWA 4X4NA 5J2EA 4K4GA 4PPXA 2BE3A 4QZAA 3H37A 5J2HA 4I2BA 1YLQA 4WC1A 4FHXA 1MIVA 4O5KA 3OVBA 3MDAA 5D63A 4LT6A 4GXIA 4R65A 4I27A 4EP7A 5CJ7A 4RPYA 2BPGA 1F5AA 7ICKA 1ZQUA 2PBEA 4WC4A 4O69A 4Z6FA 4RQ5A 4I28A 2ZHAA 2ZH1A 4TUPA 2FMSA 1ZQAA 3ISCA 2B56A 8ICCA 7ICHA 1FA0A 4JWMA 8ICXA 9ICVA 5HRKA 4MKPA 3JPTA 2M2WA 8ICZA 4PHPA 1MQ3A 2BBJA 9ICNA 8ICPA 1BPEA 4YMNA 9ICIA 4MFFA 4O68A 9ICGA 5DBCA 4AT8A 9ICWA 4EBJA 4X0AA 8ICGA 4DOCA 3UPQA 5HHIA 2GAFD 2ZH7A 3C2LA 2RFFA 4FH5A 2ZH6A 4F5RA 4WQLA 4R64A 3GDXA 4KLFA 3UPSA 5B3QA 1NOMA 4UB1A 5CFUA 1VFGA 2W9MA 4K96A 8ICMA 1UEVA 3C18A 1ZQOA 3H3AA 4M9JA 4DO9A 1ZQCA 1ZQDA 7ICPA 4RQ0A 4E80A 4E8FA 2B51A 4FHWA 9ICTA 1ZJMA 4TURA 2DR5A 1TV9A 4F5NA 1ZQBA 3PHZA 4EV6A 5CHGA 4WH5A 1MIYA 2ZH3A 8ICFA 4JWNA 3K75D 4Z6DA 4QZ9A 2HN2A 5CWRA 4KLTA 4R66A 4LEWA 4I2GA 4AT9A 4KLGA 4UD4A 3HX0A 9ICUA 4ATBA 2GA9D 5CFTA 3HJ1A 3EF2A 5IIIA 4M9LA 2B4VA 4UAYA 5TZVA 4X4PA 2FMPA 4WCWA 1WOTA 5BOLA 4WC3A 3RH6A 2DVIA 3WFRE 4NM1A 3V7LA 7ICUA 5DB8A 8ICBA 1GPJA 3OGUA 4F5QA 2PFPA 3JPNA 4KLEA 4RT3A 1R8CA 9ICAA 1R8AA 8ICVA 4AT8B 2PFQA 5J0UA 1JAJA 8ICTA 4RQ1A 4RQ2A 4OAHA 1HUZA 4RT2A 4K98A 2HHPA 5J2JA 2ZH2A 4FH3A 4LZDA 4I2HA 4O9MA 4NXTA 1ZQWA 1RZTA 4RWPA 1BPYA 4I2AA 5HRLA 2IHMA 1JN3A 3JYYA 4WC0A 4KLUA 5J0RA 3LK9A 4K8VA 3B0YA 9ICPA 9ICCA 8ICJA 8ICHA 4X4SA 3OVAA 2DRBA 4KLQA 4UAWA 4O5EA 4XQ8A 5HRIA 1ZQPA 4QZCA 4AT9B 2FCLA 2IHOA 2NRKA 4ATBB 7ICJA 5J2IA 2M2VA 4P4PA 4NKUA 2BCUA 1R89A 5IINA 8ICYA 3OVSA 3PMNA 2IUBA 7ICTA 5HREA 4M9GA 5IIKA 3RJHA 1TVAA 3JZ0A 3JPOA 1ZQYA 4XQ7A 4IQUA 2O1PA 5D62A 4UBBA 4NLKA 5DB7A 5IIJA 4QZEA 3OWGA 1MQ2A 3HIYA 5JTGA 5B3PA 5CHEA 2DR9A 4UB4A 1ZQTA 3AUOA 4KLLA 4NXXA 9ICFA 4AT7A 5BOMA 4IQWA 4DOAA 4FHPA 3WFPA 3JCFA 3TFSA 1UETA 3V7JA 7ICVA 4XRHA 4QZGA 2BBHA 4XUSA 5CFSA 9ICMA 4WQKA 5HRBA 4WC6A 4KLHA 7ICFA 3UXOA 4KLIA 2BPFA 1NO5A 5J0XA 4K9AA 2P66A 7ICQA 8ICQA 4KM5A 3CK6A 3H38A 4HX0A 4QZ8A 5DECA 8ICUA 7ICEA 7ICRA 3L9DA 8ICAA 4LEVA 2ISOA 4X4QA 3RJFA 3OV7A 3WFOA 3WFSC 3AQKA 4X4TA 9ICLA 4NLZA 4I29A 1JQRA 5HHHA 7ICOA 1ZQKA 2EWRA 4I2IA 4QZFA 5J0WA 5HR9A 5D61A 1BPBA 1ZQXA 4LVSA 5CR0A 5BPCA 3AU2A 2DR7A 4RWNA 2BCVA 5D4BA 2ZH8A 9ICHA 5EOZA 4I2DA 8ICEA 5DB9A 2BCSA 4RQ8A 4NM2A 4K97A 2M2UA 2ID1A 3NWIA 4NXUA 4X4VA 2FMQA 5J0YA 4NXVA 4AT7B 4OAFA 4OAGA 5J2DA 3HW8A 4IG8A 5J2KA 3MGHA 1ZJNA 4S3NA 5J0OA 1BPXA 4YMOA 2M2TA 4WC7A 1ZQSA 4OAIZ 4I2CA 9ICOA 5J2CA 5J0SA 4QZIA 3UXPA 4QZBA 3LQCB 1XSLA 3JPSA 4XJEA 4I2EA 7ICGA 4KB6A 4P4OA 1ZQNA 4PHAA 1ZQIA 9ICJA 2ZH4A 4NKTA 3JPRA 4YMMA 4F5PA 4F5OA 4EEBA 7ICIA 4RWQA 5F2VO 4UAZA 4YD1A 4O67A 4YD2A 4PGYA 3AU6A 4I2FA 4I0UA 4YCXA 1V4AA 3PNCA 5IIMA 5CB1A 3UQ0A 2HN1A 4TUQA 4MF2A 2ZH9A 4EBKA 4Z6EA 5J0QA 2ZHBA 4KLDA 1VJ7A 3AQLA 2PFOA 5CA7A 1ZQGA 1TFYA 2BCQA 4RWOA 2ZH5A 5HRHA 4WC5A 4RQ4A 5DKWA 4O5CA 4TUSA 4X4OA 2ISPA 4QZHA 4K4HA 5D49A 4WOYA 5J2GA 2I9GA 2PXIA 3JPPA 3RJGA 1ZQVA 3OUYA 5J0TA 4PGXA 9ICRA 3H39A 4QZDA 3C2MA 5HC9A 4EGWA 4P4MA 7ICLA 4GXJA 7ICMA 1MIWA 5J2AA 5J2BA 3C5GA 8ICOA 4LEYA 1JMSA 4JLZA 5DDMA 9ICXA 4R63A 2PFNA 4UBCA 8ICRA 3MCRA 3UXNA 1XSPA 4GXKA 3AQMA 4M04A 1XSNA 2BCRA 9ICBA 3C66A 4FHYA 5HRDA 4UD5A 3MGIA 4RQ7A 1OU5A 1ZQMA 9ICSA 2DR8A 1RPLA 7ICSA
chains in the Genus database with same CATH topology
4PGQA 3RJKA 3UQ2A 9ICEA 4FO6A 3MBYA 5DB6A 4P2HA 4KLSA 1BPDA 4M0AA 3HWTA 3C5FA 1BPZA 7ICNA 4XA5A 5J0PA 1ZQQA 4K9BA 1ZQFA 9ICQA 4E7XA 5J2FA 4RQ6A 1ZQLA 8ICNA 4KLOA 1ZQEA 4NXWA 4IQTA 3ISDA 5HRGA 4PH5A 3OUYB 4X5VA 4Z6CA 4PHEA 4M9HA 1KEJA 4K4IA 4K99A 2BPCA 1UEUA 3V7KA 1PX5A 4O6AA 3RJEA 8ICIA 4UB5A 5DEDA 3ISBA 5J29A 4NLNA 2VANA 4X0BA 1ZQZA 5DBAA 4NXZA 8ICKA 3RH5A 2O5AA 4LEZA 4M2YA 5DDYA 8ICLA 3NYBA 3RJIA 1KNYA 4X4RA 1ZQJA 4M5DA 4UB3A 4X4UA 1Q79A 3RJJA 3C2KA 2Q66A 3V72A 4RPZA 4RQ3A 1HUOA 4IQVA 5HRFA 4UB2A 3MDCA 5IILA 3AQNA 3WFQE 8ICSA 1R8BA 1ZQHA 4NY8A 3PMLA 4WC2A 2GWSA 3B0XA 4MFCA 5D46A 8ICWA 3RH4A 4M9NA 4WBZA 4KLMA 1ZQRA 5IIOA 4DOBA 4LZGA 4KLJA 4PHDA 4RPXA 4M47A 4MF8A 1KDHA 4YN4A 9ICKA 5CP2A 3JPQA 5DBBA 4FHVA 4WBYA 3TFRA 4JLXA 4MFAA 3HJ4A 2DRAA 1Q78A 4I2JA 1TFWA 4X4NA 5J2EA 4K4GA 4PPXA 2BE3A 4QZAA 3H37A 5J2HA 4I2BA 1YLQA 4WC1A 4FHXA 1MIVA 4O5KA 3OVBA 3MDAA 4LT6A 4GXIA 4R65A 4I27A 4EP7A 5CJ7A 4RPYA 2BPGA 1F5AA 7ICKA 1ZQUA 2PBEA 4WC4A 4O69A 4Z6FA 4RQ5A 4I28A 2ZHAA 2ZH1A 4TUPA 2FMSA 1ZQAA 3ISCA 2B56A 8ICCA 7ICHA 1FA0A 4JWMA 8ICXA 9ICVA 5HRKA 4MKPA 3JPTA 2M2WA 8ICZA 4PHPA 1MQ3A 9ICNA 8ICPA 1BPEA 4YMNA 9ICIA 4MFFA 4O68A 9ICGA 5DBCA 4AT8A 9ICWA 4EBJA 4X0AA 8ICGA 4DOCA 3UPQA 5HHIA 2ZH7A 3C2LA 2RFFA 4FH5A 2ZH6A 4F5RA 4R64A 3GDXA 4KLFA 3UPSA 1NOMA 4UB1A 1VFGA 2W9MA 4K96A 8ICMA 1UEVA 3C18A 1ZQOA 3H3AA 4M9JA 4DO9A 1ZQCA 1ZQDA 7ICPA 4RQ0A 4E80A 4E8FA 2B51A 4FHWA 9ICTA 1ZJMA 4TURA 2DR5A 1TV9A 4F5NA 1ZQBA 5CHGA 1MIYA 2ZH3A 8ICFA 4JWNA 3K75D 4Z6DA 4QZ9A 5CWRA 4KLTA 4R66A 4LEWA 4I2GA 4AT9A 4KLGA 4UD4A 3HX0A 9ICUA 4ATBA 3HJ1A 5IIIA 4M9LA 2B4VA 4UAYA 5TZVA 4X4PA 2FMPA 4WCWA 1WOTA 5BOLA 4WC3A 3RH6A 2DVIA 3WFRE 4NM1A 3V7LA 7ICUA 5DB8A 8ICBA 3OGUA 4F5QA 2PFPA 3JPNA 4KLEA 4RT3A 1R8CA 9ICAA 1R8AA 8ICVA 4AT8B 2PFQA 5J0UA 1JAJA 8ICTA 4RQ1A 4RQ2A 4OAHA 1HUZA 4RT2A 4K98A 2HHPA 5J2JA 2ZH2A 4FH3A 4LZDA 4I2HA 4O9MA 4NXTA 1ZQWA 1RZTA 4RWPA 1BPYA 4I2AA 5HRLA 2IHMA 1JN3A 3JYYA 4WC0A 4KLUA 5J0RA 3LK9A 4K8VA 3B0YA 9ICPA 9ICCA 8ICJA 8ICHA 4X4SA 3OVAA 2DRBA 4KLQA 4UAWA 4O5EA 4XQ8A 5HRIA 1ZQPA 4QZCA 4AT9B 2NRKA 4ATBB 7ICJA 5J2IA 2M2VA 4P4PA 4NKUA 2BCUA 1R89A 5IINA 8ICYA 3OVSA 3PMNA 7ICTA 5HREA 4M9GA 5IIKA 3RJHA 1TVAA 3JZ0A 3JPOA 1ZQYA 4XQ7A 4IQUA 2O1PA 4NLKA 4UBBA 5DB7A 5IIJA 4QZEA 1MQ2A 3HIYA 2DR9A 4UB4A 1ZQTA 3AUOA 4KLLA 4NXXA 9ICFA 4AT7A 5BOMA 4IQWA 4DOAA 4FHPA 3WFPA 3TFSA 1UETA 3V7JA 7ICVA 4XRHA 4QZGA 4XUSA 9ICMA 5HRBA 4WC6A 4KLHA 7ICFA 3UXOA 4KLIA 2BPFA 1NO5A 5J0XA 4K9AA 2P66A 7ICQA 8ICQA 4KM5A 3H38A 4QZ8A 5DECA 8ICUA 7ICEA 7ICRA 3L9DA 8ICAA 4LEVA 2ISOA 4X4QA 3RJFA 3OV7A 3WFOA 3WFSC 3AQKA 4X4TA 9ICLA 4NLZA 4I29A 1JQRA 5HHHA 7ICOA 1ZQKA 4I2IA 4QZFA 5J0WA 5HR9A 1BPBA 1ZQXA 4LVSA 5CR0A 5BPCA 3AU2A 2DR7A 4RWNA 2BCVA 5D4BA 2ZH8A 9ICHA 5EOZA 4I2DA 8ICEA 5DB9A 2BCSA 4RQ8A 4NM2A 4K97A 2M2UA 2ID1A 4NXUA 4X4VA 2FMQA 5J0YA 4NXVA 4AT7B 4OAFA 4OAGA 5J2DA 3HW8A 4IG8A 5J2KA 3MGHA 1ZJNA 4S3NA 5J0OA 1BPXA 4YMOA 2M2TA 4WC7A 1ZQSA 4OAIZ 4I2CA 9ICOA 5J2CA 5J0SA 4QZIA 3UXPA 4QZBA 3LQCB 1XSLA 3JPSA 4I2EA 7ICGA 4KB6A 4P4OA 1ZQNA 4PHAA 1ZQIA 9ICJA 2ZH4A 4NKTA 3JPRA 4YMMA 4F5PA 4F5OA 7ICIA 4RWQA 5F2VO 4UAZA 4YD1A 4O67A 4YD2A 4PGYA 3AU6A 4I2FA 4YCXA 1V4AA 3PNCA 5IIMA 5CB1A 3UQ0A 4TUQA 4MF2A 2ZH9A 4EBKA 4Z6EA 5J0QA 2ZHBA 4KLDA 1VJ7A 3AQLA 2PFOA 5CA7A 1ZQGA 1TFYA 2BCQA 4RWOA 2ZH5A 5HRHA 4WC5A 4RQ4A 5DKWA 4O5CA 4TUSA 4X4OA 2ISPA 4QZHA 4K4HA 5D49A 4WOYA 5J2GA 2I9GA 2PXIA 3JPPA 3RJGA 1ZQVA 3OUYA 5J0TA 4PGXA 9ICRA 3H39A 4QZDA 3C2MA 5HC9A 4P4MA 7ICLA 4GXJA 7ICMA 1MIWA 5J2AA 5J2BA 3C5GA 8ICOA 4LEYA 1JMSA 4JLZA 5DDMA 9ICXA 4R63A 2PFNA 4UBCA 8ICRA 3UXNA 1XSPA 4GXKA 3AQMA 4M04A 1XSNA 2BCRA 9ICBA 3C66A 4FHYA 5HRDA 4UD5A 3MGIA 4RQ7A 1OU5A 1ZQMA 9ICSA 2DR8A 1RPLA 7ICSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGQ A;  3RJK A;  3UQ2 A;  9ICE A;  4FO6 A;  3MBY A;  5DB6 A;  4P2H A;  4KLS A;  1BPD A;  4M0A A;  3HWT A;  3C5F A;  1BPZ A;  7ICN A;  4XA5 A;  5J0P A;  1ZQQ A;  1ZQF A;  9ICQ A;  4E7X A;  5J2F A;  4RQ6 A;  1ZQL A;  8ICN A;  4KLO A;  1ZQE A;  4IQT A;  3ISD A;  5HRG A;  4PH5 A;  3OUY B;  4X5V A;  4Z6C A;  4PHE A;  4M9H A;  1KEJ A;  4K4I A;  2BPC A;  1UEU A;  3V7K A;  1PX5 A;  3RJE A;  8ICI A;  4UB5 A;  5DED A;  3ISB A;  5J29 A;  4NLN A;  2VAN A;  4X0B A;  1ZQZ A;  5DBA A;  4NXZ A;  8ICK A;  3RH5 A;  2O5A A;  4M2Y A;  5DDY A;  8ICL A;  3NYB A;  3RJI A;  1KNY A;  4X4R A;  1ZQJ A;  4M5D A;  4UB3 A;  4X4U A;  1Q79 A;  3RJJ A;  3C2K A;  2Q66 A;  3V72 A;  4RPZ A;  4RQ3 A;  1HUO A;  4IQV A;  5HRF A;  4UB2 A;  3MDC A;  5IIL A;  3AQN A;  3WFQ E;  8ICS A;  1R8B A;  1ZQH A;  4NY8 A;  3PML A;  4WC2 A;  2GWS A;  3B0X A;  4MFC A;  5D46 A;  8ICW A;  3RH4 A;  4M9N A;  4WBZ A;  4KLM A;  1ZQR A;  5IIO A;  4DOB A;  4LZG A;  4KLJ A;  4PHD A;  4RPX A;  4M47 A;  4MF8 A;  1KDH A;  4YN4 A;  9ICK A;  5CP2 A;  3JPQ A;  5DBB A;  4FHV A;  4WBY A;  3TFR A;  4MFA A;  3HJ4 A;  2DRA A;  1Q78 A;  4I2J A;  1TFW A;  5J2E A;  4X4N A;  4K4G A;  4PPX A;  2BE3 A;  4QZA A;  3H37 A;  5J2H A;  4I2B A;  1YLQ A;  4WC1 A;  4FHX A;  1MIV A;  4O5K A;  3OVB A;  3MDA A;  4LT6 A;  4GXI A;  4R65 A;  4I27 A;  4EP7 A;  5CJ7 A;  4RPY A;  2BPG A;  1F5A A;  7ICK A;  1ZQU A;  2PBE A;  4WC4 A;  4Z6F A;  4RQ5 A;  4I28 A;  2ZHA A;  2ZH1 A;  4TUP A;  2FMS A;  1ZQA A;  3ISC A;  2B56 A;  8ICC A;  7ICH A;  1FA0 A;  4JWM A;  8ICX A;  9ICV A;  5HRK A;  3JPT A;  2M2W A;  8ICZ A;  4PHP A;  1MQ3 A;  9ICN A;  8ICP A;  1BPE A;  4YMN A;  9ICI A;  4MFF A;  9ICG A;  5DBC A;  4AT8 A;  9ICW A;  4EBJ A;  4X0A A;  8ICG A;  4DOC A;  3UPQ A;  5HHI A;  2ZH7 A;  3C2L A;  2RFF A;  4FH5 A;  2ZH6 A;  4F5R A;  4R64 A;  3GDX A;  4KLF A;  3UPS A;  1NOM A;  4UB1 A;  1VFG A;  2W9M A;  8ICM A;  1UEV A;  3C18 A;  1ZQO A;  3H3A A;  4M9J A;  4DO9 A;  1ZQC A;  1ZQD A;  7ICP A;  4RQ0 A;  4E80 A;  4E8F A;  2B51 A;  4FHW A;  9ICT A;  1ZJM A;  4TUR A;  2DR5 A;  1TV9 A;  4F5N A;  1ZQB A;  5CHG A;  1MIY A;  2ZH3 A;  8ICF A;  4JWN A;  3K75 D;  4Z6D A;  4QZ9 A;  5CWR A;  4KLT A;  4R66 A;  4I2G A;  4AT9 A;  4KLG A;  4UD4 A;  3HX0 A;  9ICU A;  4ATB A;  3HJ1 A;  5III A;  4M9L A;  2B4V A;  4UAY A;  5TZV A;  4X4P A;  2FMP A;  4WCW A;  1WOT A;  5BOL A;  4WC3 A;  3RH6 A;  2DVI A;  3WFR E;  4NM1 A;  3V7L A;  7ICU A;  5DB8 A;  8ICB A;  3OGU A;  4F5Q A;  2PFP A;  3JPN A;  4KLE A;  4RT3 A;  1R8C A;  9ICA A;  1R8A A;  8ICV A;  4AT8 B;  2PFQ A;  5J0U A;  1JAJ A;  8ICT A;  4RQ1 A;  4RQ2 A;  1HUZ A;  4RT2 A;  2HHP A;  5J2J A;  2ZH2 A;  4FH3 A;  4LZD A;  4I2H A;  4O9M A;  1ZQW A;  1RZT A;  4RWP A;  1BPY A;  4I2A A;  5HRL A;  2IHM A;  1JN3 A;  3JYY A;  4WC0 A;  4KLU A;  5J0R A;  3LK9 A;  3B0Y A;  9ICP A;  9ICC A;  8ICJ A;  8ICH A;  4X4S A;  3OVA A;  2DRB A;  4KLQ A;  4UAW A;  4O5E A;  4XQ8 A;  5HRI A;  1ZQP A;  4QZC A;  4AT9 B;  2NRK A;  4ATB B;  7ICJ A;  5J2I A;  2M2V A;  4P4P A;  4NKU A;  2BCU A;  1R89 A;  5IIN A;  8ICY A;  3PMN A;  3OVS A;  7ICT A;  5HRE A;  4M9G A;  5IIK A;  3RJH A;  1TVA A;  3JZ0 A;  3JPO A;  1ZQY A;  4XQ7 A;  4IQU A;  2O1P A;  4NLK A;  4UBB A;  5DB7 A;  5IIJ A;  4QZE A;  1MQ2 A;  3HIY A;  2DR9 A;  4UB4 A;  1ZQT A;  3AUO A;  4KLL A;  9ICF A;  4AT7 A;  5BOM A;  4IQW A;  4DOA A;  4FHP A;  3WFP A;  3TFS A;  1UET A;  3V7J A;  7ICV A;  4XRH A;  4QZG A;  4XUS A;  9ICM A;  5HRB A;  4WC6 A;  4KLH A;  7ICF A;  3UXO A;  4KLI A;  2BPF A;  1NO5 A;  5J0X A;  2P66 A;  7ICQ A;  8ICQ A;  3H38 A;  4QZ8 A;  5DEC A;  8ICU A;  7ICE A;  7ICR A;  3L9D A;  8ICA A;  2ISO A;  4X4Q A;  3RJF A;  3OV7 A;  3WFO A;  3WFS C;  3AQK A;  4X4T A;  9ICL A;  4NLZ A;  4I29 A;  1JQR A;  5HHH A;  7ICO A;  1ZQK A;  4I2I A;  4QZF A;  5J0W A;  5HR9 A;  1BPB A;  1ZQX A;  4LVS A;  5CR0 A;  5BPC A;  3AU2 A;  2DR7 A;  4RWN A;  2BCV A;  5D4B A;  2ZH8 A;  9ICH A;  5EOZ A;  4I2D A;  8ICE A;  5DB9 A;  2BCS A;  4RQ8 A;  4NM2 A;  2M2U A;  2ID1 A;  4X4V A;  2FMQ A;  5J0Y A;  4AT7 B;  5J2D A;  3HW8 A;  4IG8 A;  5J2K A;  3MGH A;  1ZJN A;  4S3N A;  5J0O A;  1BPX A;  4YMO A;  2M2T A;  4WC7 A;  1ZQS A;  4I2C A;  9ICO A;  5J2C A;  5J0S A;  4QZI A;  3UXP A;  4QZB A;  3LQC B;  1XSL A;  3JPS A;  4I2E A;  7ICG A;  4P4O A;  1ZQN A;  4PHA A;  1ZQI A;  9ICJ A;  2ZH4 A;  4NKT A;  3JPR A;  4YMM A;  4F5P A;  4F5O A;  7ICI A;  4RWQ A;  5F2V O;  4UAZ A;  4YD1 A;  4YD2 A;  4PGY A;  3AU6 A;  4I2F A;  4YCX A;  1V4A A;  3PNC A;  5IIM A;  5CB1 A;  3UQ0 A;  4TUQ A;  4MF2 A;  4EBK A;  2ZH9 A;  4Z6E A;  5J0Q A;  2ZHB A;  4KLD A;  1VJ7 A;  3AQL A;  2PFO A;  5CA7 A;  1ZQG A;  1TFY A;  2BCQ A;  4RWO A;  5HRH A;  4WC5 A;  2ZH5 A;  4RQ4 A;  5DKW A;  4O5C A;  4TUS A;  4X4O A;  2ISP A;  4QZH A;  4K4H A;  5D49 A;  5J2G A;  2I9G A;  2PXI A;  3JPP A;  3RJG A;  1ZQV A;  5J0T A;  4PGX A;  3OUY A;  9ICR A;  3H39 A;  4QZD A;  3C2M A;  5HC9 A;  4P4M A;  7ICL A;  4GXJ A;  7ICM A;  1MIW A;  5J2A A;  5J2B A;  3C5G A;  8ICO A;  1JMS A;  5DDM A;  9ICX A;  4R63 A;  2PFN A;  4UBC A;  8ICR A;  3UXN A;  1XSP A;  4GXK A;  3AQM A;  4M04 A;  1XSN A;  2BCR A;  9ICB A;  3C66 A;  4FHY A;  5HRD A;  4UD5 A;  3MGI A;  4RQ7 A;  1OU5 A;  1ZQM A;  9ICS A;  2DR8 A;  1RPL A;  7ICS A; 
#chains in the Genus database with same CATH topology
 4PGQ A;  3RJK A;  3UQ2 A;  9ICE A;  4FO6 A;  3MBY A;  5DB6 A;  4P2H A;  4KLS A;  1BPD A;  4M0A A;  3HWT A;  3C5F A;  1BPZ A;  7ICN A;  4XA5 A;  5J0P A;  1ZQQ A;  4K9B A;  1ZQF A;  9ICQ A;  4E7X A;  5J2F A;  4RQ6 A;  3K7D A;  1ZQL A;  8ICN A;  4KLO A;  1ZQE A;  4NXW A;  4IQT A;  3ISD A;  5HRG A;  4PH5 A;  3OUY B;  4X5V A;  4Z6C A;  4PHE A;  4M9H A;  1KEJ A;  4K4I A;  4K99 A;  2BPC A;  1UEU A;  3V7K A;  1PX5 A;  4O6A A;  3RJE A;  4EED A;  8ICI A;  4UB5 A;  5DED A;  3ISB A;  5J29 A;  4NLN A;  2VAN A;  4X0B A;  1ZQZ A;  5DBA A;  4NXZ A;  8ICK A;  3RH5 A;  2O5A A;  4LEZ A;  4M2Y A;  5DDY A;  8ICL A;  3NYB A;  3RJI A;  1KNY A;  3NVO A;  3ER8 C;  4X4R A;  1ZQJ A;  4M5D A;  4UB3 A;  3NKU A;  4X4U A;  1Q79 A;  3RJJ A;  3C2K A;  2Q66 A;  3V72 A;  4RPZ A;  4RQ3 A;  1HUO A;  4IQV A;  5HRF A;  4UB2 A;  3MDC A;  5IIL A;  3AQN A;  3ER9 B;  3WFQ E;  4FO1 A;  1R8B A;  8ICS A;  1ZQH A;  4NY8 A;  3PML A;  4WC2 A;  2GWS A;  4N7R A;  3B0X A;  4MFC A;  5D46 A;  3ERC C;  8ICW A;  3RH4 A;  4M9N A;  4WBZ A;  4KLM A;  1ZQR A;  5IIO A;  4DOB A;  4LZG A;  4KLJ A;  4PHD A;  4RPX A;  4M47 A;  4MF8 A;  1KDH A;  4YN4 A;  9ICK A;  5CP2 A;  3JPQ A;  5DBB A;  4FHV A;  4WBY A;  3TFR A;  4JLX A;  4MFA A;  3HJ4 A;  2DRA A;  1Q78 A;  4I2J A;  1TFW A;  4X4N A;  5J2E A;  4K4G A;  4PPX A;  2BE3 A;  4QZA A;  3H37 A;  5J2H A;  4I2B A;  1YLQ A;  4WC1 A;  4FHX A;  1MIV A;  4O5K A;  3OVB A;  3MDA A;  5D63 A;  4LT6 A;  4GXI A;  4R65 A;  4I27 A;  4EP7 A;  5CJ7 A;  4RPY A;  2BPG A;  1F5A A;  7ICK A;  1ZQU A;  2PBE A;  4WC4 A;  4O69 A;  4Z6F A;  4RQ5 A;  4I28 A;  2ZHA A;  2ZH1 A;  4TUP A;  2FMS A;  1ZQA A;  3ISC A;  2B56 A;  8ICC A;  7ICH A;  1FA0 A;  4JWM A;  8ICX A;  9ICV A;  5HRK A;  4MKP A;  3JPT A;  2M2W A;  8ICZ A;  4PHP A;  1MQ3 A;  2BBJ A;  9ICN A;  8ICP A;  1BPE A;  4YMN A;  9ICI A;  4MFF A;  4O68 A;  9ICG A;  5DBC A;  4AT8 A;  9ICW A;  4EBJ A;  4X0A A;  8ICG A;  4DOC A;  3UPQ A;  5HHI A;  2GAF D;  2ZH7 A;  3C2L A;  2RFF A;  4FH5 A;  2ZH6 A;  4F5R A;  4WQL A;  4R64 A;  3GDX A;  4KLF A;  3UPS A;  5B3Q A;  1NOM A;  4UB1 A;  5CFU A;  1VFG A;  2W9M A;  4K96 A;  8ICM A;  1UEV A;  3C18 A;  1ZQO A;  3H3A A;  4M9J A;  4DO9 A;  1ZQC A;  1ZQD A;  7ICP A;  4RQ0 A;  4E80 A;  4E8F A;  2B51 A;  4FHW A;  9ICT A;  1ZJM A;  4TUR A;  2DR5 A;  1TV9 A;  4F5N A;  1ZQB A;  3PHZ A;  4EV6 A;  5CHG A;  4WH5 A;  1MIY A;  2ZH3 A;  8ICF A;  4JWN A;  3K75 D;  4Z6D A;  4QZ9 A;  2HN2 A;  5CWR A;  4KLT A;  4R66 A;  4LEW A;  4I2G A;  4AT9 A;  4KLG A;  4UD4 A;  3HX0 A;  9ICU A;  4ATB A;  2GA9 D;  5CFT A;  3HJ1 A;  3EF2 A;  5III A;  4M9L A;  2B4V A;  4UAY A;  5TZV A;  4X4P A;  2FMP A;  4WCW A;  1WOT A;  5BOL A;  4WC3 A;  3RH6 A;  2DVI A;  3WFR E;  4NM1 A;  3V7L A;  7ICU A;  5DB8 A;  8ICB A;  1GPJ A;  3OGU A;  4F5Q A;  2PFP A;  3JPN A;  4KLE A;  4RT3 A;  1R8C A;  9ICA A;  1R8A A;  8ICV A;  4AT8 B;  2PFQ A;  5J0U A;  1JAJ A;  8ICT A;  4RQ1 A;  4RQ2 A;  4OAH A;  1HUZ A;  4RT2 A;  4K98 A;  2HHP A;  5J2J A;  2ZH2 A;  4FH3 A;  4LZD A;  4I2H A;  4O9M A;  4NXT A;  1ZQW A;  1RZT A;  4RWP A;  1BPY A;  4I2A A;  5HRL A;  2IHM A;  1JN3 A;  3JYY A;  4WC0 A;  4KLU A;  5J0R A;  3LK9 A;  4K8V A;  3B0Y A;  9ICP A;  9ICC A;  8ICJ A;  8ICH A;  4X4S A;  3OVA A;  2DRB A;  4KLQ A;  4UAW A;  4O5E A;  4XQ8 A;  5HRI A;  1ZQP A;  4QZC A;  4AT9 B;  2FCL A;  2IHO A;  2NRK A;  4ATB B;  7ICJ A;  5J2I A;  2M2V A;  4P4P A;  4NKU A;  2BCU A;  1R89 A;  5IIN A;  8ICY A;  3OVS A;  3PMN A;  2IUB A;  7ICT A;  5HRE A;  4M9G A;  5IIK A;  3RJH A;  1TVA A;  3JZ0 A;  3JPO A;  1ZQY A;  4XQ7 A;  4IQU A;  2O1P A;  5D62 A;  4UBB A;  4NLK A;  5DB7 A;  5IIJ A;  4QZE A;  3OWG A;  1MQ2 A;  3HIY A;  5JTG A;  5B3P A;  5CHE A;  2DR9 A;  4UB4 A;  1ZQT A;  3AUO A;  4KLL A;  4NXX A;  9ICF A;  4AT7 A;  5BOM A;  4IQW A;  4DOA A;  4FHP A;  3WFP A;  3JCF A;  3TFS A;  1UET A;  3V7J A;  7ICV A;  4XRH A;  4QZG A;  2BBH A;  4XUS A;  5CFS A;  9ICM A;  4WQK A;  5HRB A;  4WC6 A;  4KLH A;  7ICF A;  3UXO A;  4KLI A;  2BPF A;  1NO5 A;  5J0X A;  4K9A A;  2P66 A;  7ICQ A;  8ICQ A;  4KM5 A;  3CK6 A;  3H38 A;  4HX0 A;  4QZ8 A;  5DEC A;  8ICU A;  7ICE A;  7ICR A;  3L9D A;  8ICA A;  4LEV A;  2ISO A;  4X4Q A;  3RJF A;  3OV7 A;  3WFO A;  3WFS C;  3AQK A;  4X4T A;  9ICL A;  4NLZ A;  4I29 A;  1JQR A;  5HHH A;  7ICO A;  1ZQK A;  2EWR A;  4I2I A;  4QZF A;  5J0W A;  5HR9 A;  5D61 A;  1BPB A;  1ZQX A;  4LVS A;  5CR0 A;  5BPC A;  3AU2 A;  2DR7 A;  4RWN A;  2BCV A;  5D4B A;  2ZH8 A;  9ICH A;  5EOZ A;  4I2D A;  8ICE A;  5DB9 A;  2BCS A;  4RQ8 A;  4NM2 A;  4K97 A;  2M2U A;  2ID1 A;  3NWI A;  4NXU A;  4X4V A;  2FMQ A;  5J0Y A;  4NXV A;  4AT7 B;  4OAF A;  4OAG A;  5J2D A;  3HW8 A;  4IG8 A;  5J2K A;  3MGH A;  1ZJN A;  4S3N A;  5J0O A;  1BPX A;  4YMO A;  2M2T A;  4WC7 A;  1ZQS A;  4OAI Z;  4I2C A;  9ICO A;  5J2C A;  5J0S A;  4QZI A;  3UXP A;  4QZB A;  3LQC B;  1XSL A;  3JPS A;  4XJE A;  4I2E A;  7ICG A;  4KB6 A;  4P4O A;  1ZQN A;  4PHA A;  1ZQI A;  9ICJ A;  2ZH4 A;  4NKT A;  3JPR A;  4YMM A;  4F5P A;  4F5O A;  4EEB A;  7ICI A;  4RWQ A;  5F2V O;  4UAZ A;  4YD1 A;  4O67 A;  4YD2 A;  4PGY A;  3AU6 A;  4I2F A;  4I0U A;  4YCX A;  1V4A A;  3PNC A;  5IIM A;  5CB1 A;  3UQ0 A;  2HN1 A;  4TUQ A;  4MF2 A;  2ZH9 A;  4EBK A;  4Z6E A;  5J0Q A;  2ZHB A;  4KLD A;  1VJ7 A;  3AQL A;  2PFO A;  5CA7 A;  1ZQG A;  1TFY A;  2BCQ A;  4RWO A;  2ZH5 A;  5HRH A;  4WC5 A;  4RQ4 A;  5DKW A;  4O5C A;  4TUS A;  4X4O A;  2ISP A;  4QZH A;  4K4H A;  5D49 A;  4WOY A;  5J2G A;  2I9G A;  2PXI A;  3JPP A;  3RJG A;  1ZQV A;  3OUY A;  5J0T A;  4PGX A;  9ICR A;  3H39 A;  4QZD A;  3C2M A;  5HC9 A;  4EGW A;  4P4M A;  7ICL A;  4GXJ A;  7ICM A;  1MIW A;  5J2A A;  5J2B A;  3C5G A;  8ICO A;  4LEY A;  1JMS A;  4JLZ A;  5DDM A;  9ICX A;  4R63 A;  2PFN A;  4UBC A;  8ICR A;  3MCR A;  3UXN A;  1XSP A;  4GXK A;  3AQM A;  4M04 A;  1XSN A;  2BCR A;  9ICB A;  3C66 A;  4FHY A;  5HRD A;  4UD5 A;  3MGI A;  4RQ7 A;  1OU5 A;  1ZQM A;  9ICS A;  2DR8 A;  1RPL A;  7ICS A; 
#chains in the Genus database with same CATH homology
 4PGQ A;  3RJK A;  3UQ2 A;  9ICE A;  4FO6 A;  3MBY A;  5DB6 A;  4P2H A;  4KLS A;  1BPD A;  4M0A A;  3HWT A;  3C5F A;  1BPZ A;  7ICN A;  4XA5 A;  5J0P A;  1ZQQ A;  4K9B A;  1ZQF A;  9ICQ A;  4E7X A;  5J2F A;  4RQ6 A;  1ZQL A;  8ICN A;  4KLO A;  1ZQE A;  4NXW A;  4IQT A;  3ISD A;  5HRG A;  4PH5 A;  3OUY B;  4X5V A;  4Z6C A;  4PHE A;  4M9H A;  1KEJ A;  4K4I A;  4K99 A;  2BPC A;  1UEU A;  3V7K A;  1PX5 A;  4O6A A;  3RJE A;  8ICI A;  4UB5 A;  5DED A;  3ISB A;  5J29 A;  4NLN A;  2VAN A;  4X0B A;  1ZQZ A;  5DBA A;  4NXZ A;  8ICK A;  3RH5 A;  2O5A A;  4LEZ A;  4M2Y A;  5DDY A;  8ICL A;  3NYB A;  3RJI A;  1KNY A;  4X4R A;  1ZQJ A;  4M5D A;  4UB3 A;  4X4U A;  1Q79 A;  3RJJ A;  3C2K A;  2Q66 A;  3V72 A;  4RPZ A;  4RQ3 A;  1HUO A;  4IQV A;  5HRF A;  4UB2 A;  3MDC A;  5IIL A;  3AQN A;  3WFQ E;  8ICS A;  1R8B A;  1ZQH A;  4NY8 A;  3PML A;  4WC2 A;  2GWS A;  3B0X A;  4MFC A;  5D46 A;  8ICW A;  3RH4 A;  4M9N A;  4WBZ A;  4KLM A;  1ZQR A;  5IIO A;  4DOB A;  4LZG A;  4KLJ A;  4PHD A;  4RPX A;  4M47 A;  4MF8 A;  1KDH A;  4YN4 A;  9ICK A;  5CP2 A;  3JPQ A;  5DBB A;  4FHV A;  4WBY A;  3TFR A;  4JLX A;  4MFA A;  3HJ4 A;  2DRA A;  1Q78 A;  4I2J A;  1TFW A;  4X4N A;  5J2E A;  4K4G A;  4PPX A;  2BE3 A;  4QZA A;  3H37 A;  5J2H A;  4I2B A;  1YLQ A;  4WC1 A;  4FHX A;  1MIV A;  4O5K A;  3OVB A;  3MDA A;  4LT6 A;  4GXI A;  4R65 A;  4I27 A;  4EP7 A;  5CJ7 A;  4RPY A;  2BPG A;  1F5A A;  7ICK A;  1ZQU A;  2PBE A;  4WC4 A;  4O69 A;  4Z6F A;  4RQ5 A;  4I28 A;  2ZHA A;  2ZH1 A;  4TUP A;  2FMS A;  1ZQA A;  3ISC A;  2B56 A;  8ICC A;  7ICH A;  1FA0 A;  4JWM A;  8ICX A;  9ICV A;  5HRK A;  4MKP A;  3JPT A;  2M2W A;  8ICZ A;  4PHP A;  1MQ3 A;  9ICN A;  8ICP A;  1BPE A;  4YMN A;  9ICI A;  4MFF A;  4O68 A;  9ICG A;  5DBC A;  4AT8 A;  9ICW A;  4EBJ A;  4X0A A;  8ICG A;  4DOC A;  3UPQ A;  5HHI A;  2ZH7 A;  3C2L A;  2RFF A;  4FH5 A;  2ZH6 A;  4F5R A;  4R64 A;  3GDX A;  4KLF A;  3UPS A;  1NOM A;  4UB1 A;  1VFG A;  2W9M A;  4K96 A;  8ICM A;  1UEV A;  3C18 A;  1ZQO A;  3H3A A;  4M9J A;  4DO9 A;  1ZQC A;  1ZQD A;  7ICP A;  4RQ0 A;  4E80 A;  4E8F A;  2B51 A;  4FHW A;  9ICT A;  1ZJM A;  4TUR A;  2DR5 A;  1TV9 A;  4F5N A;  1ZQB A;  5CHG A;  1MIY A;  2ZH3 A;  8ICF A;  4JWN A;  3K75 D;  4Z6D A;  4QZ9 A;  5CWR A;  4KLT A;  4R66 A;  4LEW A;  4I2G A;  4AT9 A;  4KLG A;  4UD4 A;  3HX0 A;  9ICU A;  4ATB A;  3HJ1 A;  5III A;  4M9L A;  2B4V A;  4UAY A;  5TZV A;  4X4P A;  2FMP A;  4WCW A;  1WOT A;  5BOL A;  4WC3 A;  3RH6 A;  2DVI A;  3WFR E;  4NM1 A;  3V7L A;  7ICU A;  5DB8 A;  8ICB A;  3OGU A;  4F5Q A;  2PFP A;  3JPN A;  4KLE A;  4RT3 A;  1R8C A;  9ICA A;  1R8A A;  8ICV A;  4AT8 B;  2PFQ A;  5J0U A;  1JAJ A;  8ICT A;  4RQ1 A;  4RQ2 A;  4OAH A;  1HUZ A;  4RT2 A;  4K98 A;  2HHP A;  5J2J A;  2ZH2 A;  4FH3 A;  4LZD A;  4I2H A;  4O9M A;  4NXT A;  1ZQW A;  1RZT A;  4RWP A;  1BPY A;  4I2A A;  5HRL A;  2IHM A;  1JN3 A;  3JYY A;  4WC0 A;  4KLU A;  5J0R A;  3LK9 A;  4K8V A;  3B0Y A;  9ICP A;  9ICC A;  8ICJ A;  8ICH A;  4X4S A;  3OVA A;  2DRB A;  4KLQ A;  4UAW A;  4O5E A;  4XQ8 A;  5HRI A;  1ZQP A;  4QZC A;  4AT9 B;  2NRK A;  4ATB B;  7ICJ A;  5J2I A;  2M2V A;  4P4P A;  4NKU A;  2BCU A;  1R89 A;  5IIN A;  8ICY A;  3OVS A;  3PMN A;  7ICT A;  5HRE A;  4M9G A;  5IIK A;  3RJH A;  1TVA A;  3JZ0 A;  3JPO A;  1ZQY A;  4XQ7 A;  4IQU A;  2O1P A;  4NLK A;  4UBB A;  5DB7 A;  5IIJ A;  4QZE A;  1MQ2 A;  3HIY A;  2DR9 A;  4UB4 A;  1ZQT A;  3AUO A;  4KLL A;  4NXX A;  9ICF A;  4AT7 A;  5BOM A;  4IQW A;  4DOA A;  4FHP A;  3WFP A;  3TFS A;  1UET A;  3V7J A;  7ICV A;  4XRH A;  4QZG A;  4XUS A;  9ICM A;  5HRB A;  4WC6 A;  4KLH A;  7ICF A;  3UXO A;  4KLI A;  2BPF A;  1NO5 A;  5J0X A;  4K9A A;  2P66 A;  7ICQ A;  8ICQ A;  4KM5 A;  3H38 A;  4QZ8 A;  5DEC A;  8ICU A;  7ICE A;  7ICR A;  3L9D A;  8ICA A;  4LEV A;  2ISO A;  4X4Q A;  3RJF A;  3OV7 A;  3WFO A;  3WFS C;  3AQK A;  4X4T A;  9ICL A;  4NLZ A;  4I29 A;  1JQR A;  5HHH A;  7ICO A;  1ZQK A;  4I2I A;  4QZF A;  5J0W A;  5HR9 A;  1BPB A;  1ZQX A;  4LVS A;  5CR0 A;  5BPC A;  3AU2 A;  2DR7 A;  4RWN A;  2BCV A;  5D4B A;  2ZH8 A;  9ICH A;  5EOZ A;  4I2D A;  8ICE A;  5DB9 A;  2BCS A;  4RQ8 A;  4NM2 A;  4K97 A;  2M2U A;  2ID1 A;  4NXU A;  4X4V A;  2FMQ A;  5J0Y A;  4NXV A;  4AT7 B;  4OAF A;  4OAG A;  5J2D A;  3HW8 A;  4IG8 A;  5J2K A;  3MGH A;  1ZJN A;  4S3N A;  5J0O A;  1BPX A;  4YMO A;  2M2T A;  4WC7 A;  1ZQS A;  4OAI Z;  4I2C A;  9ICO A;  5J2C A;  5J0S A;  4QZI A;  3UXP A;  4QZB A;  3LQC B;  1XSL A;  3JPS A;  4I2E A;  7ICG A;  4KB6 A;  4P4O A;  1ZQN A;  4PHA A;  1ZQI A;  9ICJ A;  2ZH4 A;  4NKT A;  3JPR A;  4YMM A;  4F5P A;  4F5O A;  7ICI A;  4RWQ A;  5F2V O;  4UAZ A;  4YD1 A;  4O67 A;  4YD2 A;  4PGY A;  3AU6 A;  4I2F A;  4YCX A;  1V4A A;  3PNC A;  5IIM A;  5CB1 A;  3UQ0 A;  4TUQ A;  4MF2 A;  2ZH9 A;  4EBK A;  4Z6E A;  5J0Q A;  2ZHB A;  4KLD A;  1VJ7 A;  3AQL A;  2PFO A;  5CA7 A;  1ZQG A;  1TFY A;  2BCQ A;  4RWO A;  2ZH5 A;  5HRH A;  4WC5 A;  4RQ4 A;  5DKW A;  4O5C A;  4TUS A;  4X4O A;  2ISP A;  4QZH A;  4K4H A;  5D49 A;  4WOY A;  5J2G A;  2I9G A;  2PXI A;  3JPP A;  3RJG A;  1ZQV A;  3OUY A;  5J0T A;  4PGX A;  9ICR A;  3H39 A;  4QZD A;  3C2M A;  5HC9 A;  4P4M A;  7ICL A;  4GXJ A;  7ICM A;  1MIW A;  5J2A A;  5J2B A;  3C5G A;  8ICO A;  4LEY A;  1JMS A;  4JLZ A;  5DDM A;  9ICX A;  4R63 A;  2PFN A;  4UBC A;  8ICR A;  3UXN A;  1XSP A;  4GXK A;  3AQM A;  4M04 A;  1XSN A;  2BCR A;  9ICB A;  3C66 A;  4FHY A;  5HRD A;  4UD5 A;  3MGI A;  4RQ7 A;  1OU5 A;  1ZQM A;  9ICS A;  2DR8 A;  1RPL A;  7ICS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...