4E8EA

Structural characterization of bombyx mori glutathione transferase bmgstd1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
216
structure length
216
Chain Sequence
b'HMPVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGEHMTPEYLKMNPQHTIPTMDDNGFILWESRAIQTYLVNAYGKDDSLYPKNPRQRAIIDQRLNFDLGTLYLRYLNLYTPILFRGEAYDQEKADKFDEALGWLNTFLDGRPFVAGENMTVADITIVVTITNIDAFGYDFSSHENIAKWFERTKKMLEPYGYDEIDVTGAKMLASFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structural characterization of Bombyx mori glutathione transferase BmGSTD1
rcsb
source organism Bombyx mori
molecule tags Transferase
total genus 82
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4e8eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4e8eA01
2DSAA 2JACA 2C3NA 2VCVA 1XW6A 4IP6A 3ZREA 3J7Yk 4IQ1A 3IA1A 4EO3A 1K0BA 2G2QA 1JZWA 1G7OA 4I8BA 5B8AA 4OWYA 1TRWA 4KGIA 4KB3A 2CV4A 2H0IA 3TJBA 4J2FA 4AGSA 3A2WA 3EMXA 4G2EA 1ZMAA 4FYBA 1PN9A 3N5OA 4BL7B 2DJKA 3VFIA 2YCDA 1J9BA 2V6KA 3M9JA 3TB2A 1FHEA 3LXTA 1B9XC 4K8MA 4O7HA 2YOIA 4HI7A 1FOVA 1EEJA 1V9WA 3UBKA 4F82A 2I4AA 3GKMA 4BVXA 1OC9A 2L5OA 4KDUA 1PA3A 3C8EA 4NV2A 5AISA 3HCZA 1TDIA 1A2JA 4TXVA 3UBLA 5ELGA 3IE3A 5IM9A 3DVWA 4WF4A 5F07A 1AQVA 2WGRA 2L57A 5DAKA 5J9CA 1M9AA 2HRKA 1SL1B 1TP9A 1TU8A 6GSTA 1O6JA 1QMVA 2F9SA 2P5QA 3DEXA 2LSTA 3RHBA 2XC2A 3ZVJA 4HS1A 2H1AA 13GSA 4OFNA 2HZEA 4LMWA 2H1DA 4XRDA 4ISDA 5AN1A 4DSSB 5HR3A 1BAYA 5BMUA 1R5AA 2F3MA 4F9ZA 2PVQA 4TR4A 1PKZA 1WPIA 3GV1A 3D4MA 4MCUA 5G1KA 1YJ6A 5JCWA 1YDKA 3S9FA 1XWCA 3QDNA 4MZCA 4ML1A 2C0GA 1F9MA 1K0OA 1U88A 2DC5A 1TXXA 3LWAA 4L0UA 3FW2A 1B9YC 4V1Ag 4HU7A 3RPPA 2CAIA 2GSRA 3IK9A 3P2AA 3HZ4A 3QAWA 3M3MA 1QQ2A 3KP8A 1WIKA 2FWEA 2OA7A 3WGDA 19GSA 4POLA 5J41A 3D6IA 1HQOA 3H8QA 2HE3A 2XPEA 1G7EA 2IMEA 3GTUB 4HUAA 2H6ZA 3C73A 3KEBA 3TKSE 3D0ZA 1N8JA 3F6DA 3MSZA 2OKAA 2HRNA 6GSVA 1KEBA 2XBIA 3A3TA 4ZBBA 1O85A 3DIEA 4EKZA 2LNSA 1TI1A 3HJPA 1V57A 4HJ2A 4IN0A 5HFIA 5J5NA 2WS2A 1XCCA 2E2MA 5ECLB 1XFLA 2OE0A 1YKAA 4JR6A 5DAKB 2JSZA 1AUCA 2HRKB 2PVOC 1VF4A 1ILOA 2DMLA 3TUEA 5KN2A 3RHCA 2DIZA 3WGXA 5CNWA 5IOWA 4MA9A 2IIYA 1XVWA 5E59A 2GQLA 3FR6A 3GYKA 3EYTA 4NHZA 1MD3A 2PUKC 4HEA2 1R7HA 1PRXA 3VWUA 5C00A 1K3OA 2A4VA 2RIIA 2E2GA 1TK5B 3RAZA 1BYEA 2GQKA 2YJHA 2IMDA 4BPYA 4RI7A 18GSA 2X64A 5AIVA 1XPVA 2C0EA 2WULA 3BOAA 5HQPA 2C0FA 4GCIA 3G9BA 3APSA 1Q4JA 3APQA 3DRNA 3GMFA 5JWQB 4YAPA 3Q18A 2VAFA 2WJUA 5F06A 3BD2A 2N5FA 1V2AA 4CHSA 1FW1A 5ECOB 2FUG2 1ACVA 3KH9A 4O32A 2CX3A 2FY6A 2GS3A 2KLXA 2FD3A 2Z9SA 3GH6A 1K0AA 2HSYA 3FZ5A 4XS6A 3HY2A 2V2GA 4I2UA 3FHKA 4PUAA 3H1NA 3C1SA 2MMOA 1W4VA 1UC7A 5AGYA 1Z6NA 1JLVA 4D73B 3I9V2 1ZGNA 2B7JA 1PKWA 2DJ0A 4KUNA 2VCTA 2R2JA 1SJIA 4V2MA 3M0FA 3E0UA 1EWXA 2IMIA 1RK4A 1ZOFA 2VLUA 4NXIA 3MDKA 2HT9A 1M2DA 3APOA 3NZNA 5LCZA 1SD9A 3IC8A 4AF2A 1K0CA 4OCFA 3JCML 5J9BA 2IN3A 3LG6A 4TR1B 3LGCA 5DCHA 1TU7A 4G19A 4AJ7A 1GLQA 5C04A 2B7KA 1SU9A 3GKXA 3U5RE 2C3QA 4RQXA 5A4UA 3HZ8A 3VWWA 2PMTA 3IXRA 4MZWA 1F2EA 4ZL8A 3VI5A 6GSWA 2EIOA 4I2TA 4ECCA 3TJKA 2H01A 1ERTA 5G31A 2RM5A 3Q6OA 1DE1A 3WT2A 1ERVA 1SENA 5CO3A 2JZRA 4PNGA 4GXZA 1AW9A 1RQMA 2CT6A 3UVTA 2H19A 1A2LA 1UA5A 4G0LA 4POKA 2RLIA 1MTCA 5HFKA 3F4RA 1TRSA 4J57E 3IHQA 4KCEA 2FWFA 3RDWA 2MBTA 5HFGA 2B5EA 2HFDA 2I81A 2PN8A 2LQQA 4BWQA 3FEUA 1T8EB 4HZ2A 2KP2A 1K0DA 4TXOB 4MP4A 2WB9A 2H1BA 3KMNA 4F03A 3QPMA 2GGTA 2H70A 2VD1A 2GZYA 2GT5A 3ZZXA 2OE1A 4ML6A 1THOA 4MH2A 22GSA 5D73A 3ZRDA 4N0ZA 2DLXA 2IL3A 3UOMA 5IQYA 5JWRB 1AQXA 3F63A 2VCWA 4AJ6A 2LUSA 5IMZA 4TR0A 4G9HA 3IDVA 4WEYA 5AIXA 2LNTA 3ZLPA 3CXGA 3QCPA 1MEKA 4OFMA 5LNKe 4ECJA 1XWAA 2R3XA 1PGTA 1V98A 1XZOA 1OYJA 4GSNA 2IMFA 2B3SA 3ZYWA 1GSUA 3ERFA 3GFKA 1NSWA 1UVZA 2C8UA 1B4QA 3L9UA 1OE8A 2HI7A 4H86A 1Y6EA 3TCOA 1M0UA 3TKPA 3TRQA 4USSA 4EL1A 4LL1B 1WWJA 2C4JA 3IK7A 3PPUA 4KSOA 3I43A 5CAXA 4E8HA 2AYTA 3K8NA 1HYUA 3ZIVA 4OD7A 2AUVA 1YZXA 1J0FA 3GHAA 4RQRA 3ZMLA 1ON4A 1VGLA 2DJ1A 3TJFA 1PL1A 3UMAA 3LFLA 5JCGA 5EPFA 4XS4B 1X9MB 4TR3A 3P90A 4PURA 2IPAA 2PWJA 4N11A 3KGKA 3N9JA 2HSMB 1T4YA 3IBHA 1VF2A 1TK0B 5D93A 3GH9A 3KZQA 3ZTLA 5DCGA 4V2LA 2KHPA 3QMXA 1E6BA 1SK1A 3CRTA 4Q5QA 2CVBA 4MF6A 1EP7A 3UL3A 2C80A 2UZ8A 2PGTA 4ZBAA 3ED3A 2DJ2A 3HVVA 2R6KA 4RI6A 1XWBA 1ZL9A 2O7KA 3KIJA 1M9BA 4YH2A 2IFQA 4OMVA 3BJ5A 4JZQA 3LYKA 5EVOA 1SYRA 5DALA 6GSXA 2R4VA 1TRUA 1YF0A 4KDXA 2CVKA 3R2QA 3FK8A 3FRCA 4ZIJA 1XWKA 4HOJA 4IVFA 1EOGA 1O8WA 4MABA 2LS5A 4KAEA 2ZUPA 4WXTA 1T3BA 5ECHB 1V58A 4XIHA 4PQIA 1X5CA 2L6DA 2YPMA 3IV4A 3SBCA 4YQMA 4QL7A 2V1MA 1DBYA 5F0GA 2OACA 1M7TA 3ZIJA 2C1YA 2H75A 1S3DA 1OAZA 1SD8A 3RBTA 1XVQA 3KMOA 1S3CA 2NDOA 4K6XA 2FA4A 1GUMA 5ECNB 5DJLA 4OO4A 4DEJA 2LRTA 2L59A 2K18A 3LSZA 1Q98A 4GQFA 1MDIA 4NV5A 3GX8A 4CW9A 1O7UA 3TJJA 4GWRA 1JHBA 1HNAA 2FA8A 1T1VA 4IHUA 2CVDA 5HR2A 3F8UA 4MF5A 1XW9A 2VCXA 4Z7XA 2F8AA 2YWOA 2E7PA 2WDUA 5G1LA 16GSA 3O6TA 3KTLA 1R5PA 2LQOA 4X1UA 4YAVA 4ZXGA 1HNCA 4LLRA 1X0RA 1E2YA 4O5RA 5KN1A 3FZ9A 6GSSA 3GNJA 2B6MA 4N30A 4EUYA 2FLSA 2CX4A 2QGVA 4J56E 3HVSA 2MMNA 2HNLA 2CZ3A 5D9XA 5H5SA 5J3RA 2PERA 2MYGA 4JRRA 2AAWA 4G10A 4YQVA 3F9UA 3CYNA 4BVXB 1OC9B 3D22A 4WKWA 3G7JA 3TKSA 4KNDA 3G7YA 3A2VA 1NM3A 5GAPD 4KDYA 1GUKA 5KEJA 2VL3A 2IFQB 2VM2A 4F0BA 4K1FA 3C1RA 3ZMKA 4MMMA 4ULXA 1FB0A 4HZ4A 1VRSD 3BCIA 1GULA 2GLRA 4IGJA 1I9DA 1JFUA 1ZZYA 2TIRA 4PQ1A 4ECBA 2CQ9A 3F3QA 2HZEB 1LJRA 2JADA 4OO5A 4N0VA 2YANA 3LEFA 4KX4A 1YEXA 3VPTA 2B5XA 5CRWA 1XBSA 2X8HA 4PX1A 1O73A 3I69A 2H72A 2V6OA 3ME8A 1TRVA 2GZPA 4E8EA 1W89A 1IYHA 2GSQA 2RUFA 5DQSA 2VD0A 4K7NA 1EV4A 1B4PA 1JZOA 2N5BA 1WMJA 1A2MA 3E9JB 2NVLA 3UJ1A 3HJOA 1YF1A 3LYPA 5LD0A 4N10A 2O8VB 3L9VA 1Z3EA 2E0QA 3F3RA 3TKRA 3PH9A 1Z7RA 1GSEA 2F8FA 2A2RA 2LRNA 1PMTA 1PQNA 1QFNA 1GSSA 2A2SA 3P8WA 2J9HA 2B1KA 3EE2A 2NBSA 2H71A 4KSMA 1AQWA 3I6AA 1NHOA 1GTAA 3CSIA 3GIXA 4IQAA 1PX6A 4K0GA 3KJYA 3LQ7A 1MDJA 1M2BA 1TKDB 2LV3A 1BG5A 3IR4A 2MMAA 2X8GA 3PINA 1HNBA 3ZITA 1PX7A 3IPZA 3AY8A 3Q19A 3GKKA 5FWGA 3C7MA 3CMIA 2O89A 2YN1A 1THXA 1ZYQB 2V41A 1K3LA 4JBBA 3TOTA 3VI7A 5ECQB 4DSQA 4ILFA 1XW5A 5IMDA 5G5FA 1F37A 1SJ6A 2K9FA 5F8BA 4O92A 3GUSA 4LL4B 2CA8A 10GSA 1WE0A 1H4OA 3IRAA 4MK3A 4MH3A 3WYWA 1EEMA 2H66A 1XOAA 3GSSA 3L4NA 3HKRA 3EU4A 5IPHA 4CDOA 3LXZA 5EL8A 2YNXA 1JLWA 4X0XA 3QD9A 4I97A 4EDZA 2GTUA 1ERWA 1QK8A 2HRFA 2VIMA 1SJZA 3V1WA 2O85A 1J08A 1FG4A 1AAZA 5JCUA 3IC4A 5IPGA 3ZFLA 1EZKA 1BEDA 3US3A 4LA1A 3MAKA 1X9WB 3KM6A 4TOPA 2P31A 3UVHA 2H0HA 1YQ1A 2M46A 3U6VA 3TJGA 2GZZA 2WZ9A 2PPTA 2VL2C 5GZZB 4Q5RA 5B6NA 3KTBA 1Z7PA 1TI3A 1M2AA 1ABAA 2C3TA 5A4VA 5A4WA 1SL2B 1WJKA 1JZDA 1XIYA 3H4KA 5H5QA 2I3YA 3UIWA 4XS1A 3TRXA 2OBKA 2KOKA 1EP8A 3Q74A 2VUPA 2ON5A 1R4WA 2MBSA 4BL7A 1BJXA 4WR4A 1A8LA 20GSA 4PQHA 1K3YA 1U6TA 4TN8A 4JU5A 2GT6A 4TW5A 1YKCA 3LORA 3FR3A 2DJJA 3WGEA 4FYCA 2EIQA 2B1LA 2DJ3A 1FB6A 2VL9A 1WRYA 1QUWA 5IO2A 4QL9A 3CSHA 1ERUA 1DSBA 2HLSA 4IW9A 2WRTA 3F0IA 1G0TA 4WBRD 5CRHA 4XTSA 1O8XA 2LEGA 2H73A 2K6VA 4PGTA 4GF0A 1GWCA 4GSTA 4OFTA 2R5GA 5G2ZA 5G5EA 5D96A 5COHA 2H6XA 1M99A 3ME7A 1OKTA 3IOSA 2WFCA 4POBA 4V2NA 1EGOA 1C72A 3TKQA 2LRCA 4DVCA 2HYXA 5D8IA 1A23A 3FZ4A 2C0DA 5KN3A 2H6YA 2MMZA 3GRXA 3R3EA 2F51A 1G6WA 2R37A 4IELA 2REMA 4L8EA 1GSYA 3BCKA 2RM6A 3VURA 3F6FA 3HDCA 5IOXA 2VLTA 1I5GA 4K7IA 1T7PB 2ON7A 3W8JA 5DDLA 2FWHA 3NIVA 1FVKA 4ZB9A 1AXDA 1F3BA 1PD21 2ZNMA 1SL0B 4WF5A 2YJ7A 4WETA 14GSA 2ZCTA 2G0FA 5ECPB 2GSSA 3TOUA 1TK8B 1A24A 3EU3A 3KXOA 4AJ8A 4XRAA 3EVIA 4YQUA 17GSA 4LMVA 5GSTA 1ZYEA 4XHMA 2GSTA 4G0IA 3GTUA 2DBCA 1TW9A 4ACSA 3OR5A 4K7OA 2EC4A 2J23A 1X5DA 1U3IA 4QQ7A 4KF9A 4IP1A 2HXKA 1U3AA 4ZL9A 1KTEA 2IJYA 4GRFA 1GLPA 2YV9A 1LBKA 1VF3A 2BJXA 5IIZA 4GSSA 4ZILA 2TRXA 4K9ZA 1JZRA 5ID2A 2GQMA 1OC3A 2HZFA 1ZCPA 4HJMA 4MDCA 1PSQA 3BBYA 3F4SA 4POMA 5JWOB 1GSQA 1O81A 3DVXA 5A5KA 4KE3A 3D4TA 3DGQA 3A2XA 2P5RA 3SWLA 5DQYA 5ECIB 4K2DA 4KCAA 1GTBA 1GL8A 5DBQA 3EC3A 2ALBA 4PUFC 4OCEA 2HQTA 4PTSA 1X9SB 1VF1A 4G0KA 1K0MA 2GVPA 1UN2A 4P3YB 5CRDA 1GNEA 4IKHA 2MZCA 1R26A 3VPQA 4EVMA 1GSDA 1MDKA 5G30A 3GSTA 4XCSA 1H75A 3DMLA 3DYRA 8GSSA 3M1GA 4IJ3A 2V32A 5HR0A 2I9HA 1XOBA 3UEMA 3L0HA 4BWSA 1GH2A 3QFBC 3GX0A 3QOUA 3EWLA 3M9KA 2N5AA 3QAVA 2VL2A 3WT1A 3CRUA 4TVEA 5CP1A 5IMVA 2YWNA 4ZB8A 2H30A 4IS0A 4ID0A 2OE3A 1SK0A 2P0GA 4MJCA 2H0GA 3WD6A 4K0NA 1YEPA 5CREA 3ZL5A 2AHEA 1CQHA 4F2IA 3LJRA 1FO5A 2H8LA 2K8SA 1OVNA 1NHYA 1USBA 1SYXA 3CTFA 3HXSA 5CRGA 1KNGA 4HQSA 1EOHA 3C71A 4MZBA 3ERWA 4ZBDA 3IAS2 5ENUA 4MLYA 4D73A 3HYPA 6GSYA 1BX9A 1YY7A 3ERGA 5ID2B 5FT3A 2IMKA 1RW1A 5ELAA 1T4ZA 5DALB 4HU9A 4KA0A 2D2ZA 3FY7A 5B8BA 1KBNA 2VM1A 3HVXA 3DXBA 4MPFA 2LJAA 2M80A 2YWIA 3HA9A 5H5RA 3IAM2 4TR1A 5KN0A 3KH7A 3RPNA 1X5EA 5B6MA 2NPBA 1B48A 3W6GA 2AJQB 1A8YA 1SKSB 1XXUA 4BVYA 3KCMA 2AV4A 4I5QA 2IWTA 4X43A 3DWVA 1XWGA 2JZTA 4HQZA 2TRCP 2RUEA 4FH8A 2X8CA 3EINA 4ZB6A 2JU5A 3H79A 3FKFA 3QAGA 1F3AA 3NOFA 5D9WA 4L0WA 3VWVA 2PU9C 1K0NA 3GL5A 2QKEA 2HSHA 3TGZA 2O87A 2CZ2A 2H74A 5IO0A 3GN3A 3HD5A 5ECRB 3F4TA 2FNOA 4KH7A 2VOCA 4MJAA 7GSSA 3D5JA 2BTOT 3O76A 5E4WA 9GSSA 2FHEA 3VWXA 2KP1A 3DKSA 4EE0A 12GSA 1TOFA 1Z5YE 4MF7A 5EY6A 5IMFA 4I6XA 1Z9HA 4L5OA 2VCQA 4NMUA 1MD4A 2OBIA 2JSYA 4GQCA 2ES7A 2FWGA 1LU4A 2OJLA 1AC1A 3VLNA 1PL2A 2I1UA 2WCIA 3UARA 1QGVA 3M8NA 1IYIA 4WBJA 1WP0A 4NPBA 2H1GA 4TXOA 3EMPA 2X99A 1HD2A 1OC8A 1OKDA 4EDYA 5FHIA 1EV9A 3ZFBA 1NW2A 2BMXA 2FGXA 4Q5FA 3DD3A 3L9SA 1A0FA 5INYA 3GKNA 1FAAA 3L78A 5GSSA 3KP9A 2CAQA 2JL4A 2M72A 3GURA 4TKYA 3J7Yb 2L5LA 3G7IA 2H76A 3FYGA 4FIWA 2LJKA 2QC7A 1GSFA 2LTKA 5L71A 4JEDA 5DJMA 3MWHA 5ECMB 1FVJA 1GTUA 1DE2A 4PNFA 4BVYB 1QXHA 2L6CA 1URMA 3TDGA 2AB6A 2NTOA 4PXOA 4EC0A 3H93A 2LJRA 3PR8A 2DIYA 3PGTA 1SKWB 1TTZA 2VLVA 4DSRA 2B5YA 3TRPA 1ML6A 3FZAA 5HR1A 1AIUA 2YP6A 4IJIA 1GRXA 1A0RP 2GDRA 4Q5NA 2XBQA 4BA7A 4EF0A 1SK2A 1DUGA 5D9VA 5DVBA 3E3EA 4EXJA 2JZSA 2PBJA 11GSA 1EGRA 1GUHA 2L4CA 4XS4A 2YV7A 4MJBA 3A5WA 3HJMA 2HSMA 5F05A 1CQGA 3CSJA 4HDEA 1F6MC 1T00A 1ST9A 2K8VA 1SKRB 3GA4A 4RUVA 2VO4A 2OADA 1V40A 2XHFA 1GP1A 4GLTA 3TKSC 2YZHA 2L4QA 3P7XA 4FYUA 2VCZA 1U87A 3O3TA 2DMMA 1GNWA 4KW6A 4MJEA 1S3AA 2XPDA 3KD0A 1WOUA 4JR4A 2QSIA 1TJDA 5CYYA 3QR6A 3ZVJD 4TRXA 1N2AA 5J4UA 1G6YA 3UAPA 2FCHA 3FR9A 4NHWA 3D21A 2YZUA 6GSUA 1Z6MA 4L5LA 4GTUA 4FO5A 4DSSA 5B7CA 4IBPA 3ISOA 2EIRA 1GTIA 5ECSA 3EURA 4ZL7A 3CBUA 3GL3A 4ECIA 4V1Ap 2YWMA 4NAXA 5ECKB 5GAND 1B8XA 3CTGA 4WR5A 2HSNB 3MNGA 1OE7A 2HRAA 5ABRA 3QFAC 3VK9A 4JE1A 4MPGA 5IMAA 2LKUA 4FQUA 1Y25A 4NWYA 5IMCA 1BQ7A 4F0CA 3HHVA 2KUCA 5D9TA 3W8SA
chains in the Genus database with same CATH superfamily
2DSAA 2JACA 2WVXB 2C3NA 2VCVA 1XW6A 4IP6A 3ZREA 3J7Yk 4IQ1A 3IA1A 4EO3A 1K0BA 2G2QA 4YKFA 1JZWA 1G7OA 4I8BA 5B8AA 4OWYA 1Y1UA 1TRWA 4KGIA 4KB3A 2CV4A 2H0IA 1XG8A 4J2FA 3TJBA 4AGSA 3A2WA 3EMXA 4G2EA 1ZMAA 4FYBA 1PN9A 3N5OA 4BL7B 2DJKA 3VFIA 2YCDA 1J9BA 2V6KA 3M9JA 3TB2A 1FHEA 3LXTA 1B9XC 4K8MA 4O7HA 2YOIA 4HI7A 1FOVA 1EEJA 1V9WA 3UBKA 4F82A 2I4AA 3GKMA 4BVXA 1OC9A 2L5OA 2A2PA 4KDUA 1PA3A 3C8EA 4NV2A 5AISA 3HCZA 1TDIA 1A2JA 4TXVA 3UBLA 5ELGA 3IE3A 5IM9A 3DVWA 4WF4A 5F07A 1AQVA 2WGRA 2L57A 5KOXA 5DAKA 5J9CA 1M9AA 2HRKA 1SL1B 1TP9A 1TU8A 6GSTA 1O6JA 1QMVA 2F9SA 2P5QA 3DEXA 2LSTA 3RHBA 2XC2A 3ZVJA 4HS1A 2H1AA 13GSA 4OFNA 2HZEA 4LMWA 4A5PA 2H1DA 4XRDA 4ISDA 5AN1A 4DSSB 5HR3A 1BAYA 5BMUA 1R5AA 2F3MA 4F9ZA 2PVQA 4TR4A 1PKZA 1WPIA 5A34A 3GV1A 3D4MA 4MCUA 5G1KA 1YJ6A 5JCWA 1YDKA 3S9FA 2DKIA 1XWCA 3QDNA 4MZCA 4ML1A 2C0GA 1F9MA 1K0OA 1M3IA 1U88A 2DC5A 1TXXA 4AKGA 3LWAA 4L0UA 3FW2A 1B9YC 4V1Ag 4HU7A 3RPPA 2CAIA 2GSRA 3IK9A 3P2AA 3HZ4A 3QAWA 3M3MA 1QQ2A 1PFOA 3KP8A 1WIKA 2FWEA 2OA7A 4W66A 3WGDA 19GSA 4POLA 5J41A 3D6IA 1HQOA 3H8QA 2HE3A 2XPEA 1G7EA 2IMEA 3GTUB 4HUAA 2H6ZA 3C73A 3KEBA 3TKSE 3D0ZA 1N8JA 3F6DA 3MSZA 2OKAA 2HRNA 6GSVA 1KEBA 2XBIA 3A3TA 4ZBBA 3HMJG 1O85A 3DIEA 4EKZA 2LNSA 1TI1A 3HJPA 1V57A 4HJ2A 4IN0A 5HFIA 5J5NA 2WS2A 2A4HA 1XCCA 2E2MA 5ECLB 1XFLA 2OE0A 1YKAA 4JR6A 2X4AA 1SVMA 5DAKB 2JSZA 1AUCA 2HRKB 2PVOC 1VF4A 1ILOA 2DMLA 3TUEA 2OT3A 5KN2A 3RHCA 2DIZA 3WGXA 5CNWA 2EFCA 5IOWA 4MA9A 2IIYA 1XVWA 5E59A 2GQLA 3FR6A 3GYKA 3EYTA 4NHZA 1MD3A 2PUKC 4HEA2 4N3ZA 1R7HA 1PRXA 3VWUA 5C00A 1K3OA 2A4VA 2RIIA 4G01A 2E2GA 1TK5B 3RAZA 1BYEA 2GQKA 2YJHA 2IMDA 4BPYA 4RI7A 18GSA 2X64A 5AIVA 1XPVA 3MIXA 2C0EA 2WULA 3BOAA 5HQPA 2C0FA 4GCIA 3G9BA 3APSA 3IHGA 1Q4JA 1I1IP 3APQA 3DRNA 3GMFA 5JWQB 4YAPA 3Q18A 2VAFA 2WJUA 5F06A 3BD2A 2N5FA 1V2AA 4CHSA 1FW1A 3CQFA 5ECOB 2FUG2 1ACVA 3KH9A 4O32A 2CX3A 5J4YA 2FY6A 2GS3A 2KLXA 2FD3A 2Z9SA 3GH6A 1K0AA 2HSYA 3FZ5A 4XS6A 3HY2A 2V2GA 4I2UA 3FHKA 4PUAA 3H1NA 3C1SA 2MMOA 1W4VA 1UC7A 5AGYA 1Z6NA 5A1NA 1JLVA 4D73B 3I9V2 1ZGNA 2B7JA 1PKWA 2DJ0A 4KUNA 2VCTA 2R2JA 1SJIA 2O5VA 4V2MA 3M0FA 3E0UA 1EWXA 2IMIA 1RK4A 1ZOFA 2VLUA 4NXIA 3MDKA 2HT9A 1M2DA 3APOA 3NZNA 5LCZA 1SD9A 3IC8A 4AF2A 1K0CA 4OCFA 3JCML 5J9BA 2IN3A 3LG6A 4TR1B 4EIPA 3LGCA 5DCHA 1TU7A 4G19A 4AJ7A 1GLQA 5C04A 2B7KA 3CWGA 1SU9A 3GKXA 3U5RE 5A5HB 2C3QA 4RQXA 5A4UA 3HZ8A 3VWWA 2PMTA 3IXRA 4MZWA 1F2EA 4ZL8A 3VI5A 6GSWA 2EIOA 4I2TA 4ECCA 3TJKA 2H01A 1ERTA 5G31A 4HSCX 2RM5A 3Q6OA 1DE1A 3WT2A 1ERVA 1SENA 5CO3A 2JZRA 4PNGA 4GXZA 1AW9A 1RQMA 2CT6A 3UVTA 2H19A 1A2LA 1UA5A 4G0LA 4POKA 2RLIA 1MTCA 5HFKA 3F4RA 1TRSA 4J57E 3IHQA 4KCEA 2FWFA 3RDWA 2MBTA 5HFGA 2B5EA 2HFDA 2I81A 2PN8A 2LQQA 4BWQA 3FEUA 1T8EB 4HZ2A 2KP2A 1K0DA 3A5IA 4TXOB 4MP4A 2WB9A 2H1BA 3KMNA 4F03A 3QPMA 2GGTA 2H70A 2VD1A 2GZYA 2GT5A 4K5RA 3ZZXA 2OE1A 4ML6A 1THOA 3CHXC 4MH2A 22GSA 5D73A 3ZRDA 4N0ZA 2DLXA 2IL3A 3UOMA 5IQYA 5JWRB 1AQXA 3F63A 2VCWA 4AJ6A 2LUSA 5IMZA 4TR0A 4G9HA 3IDVA 4WEYA 5AIXA 2LNTA 3ZLPA 3CXGA 3QCPA 1MEKA 2O36A 4OFMA 5LNKe 4ECJA 1XWAA 2R3XA 1PGTA 1V98A 1XZOA 1OYJA 4GSNA 2IMFA 2B3SA 3ZYWA 1GSUA 3ERFA 3GFKA 1NSWA 1UVZA 2C8UA 1B4QA 3L9UA 1OE8A 2HI7A 4H86A 1Y6EA 3TCOA 1M0UA 3TKPA 3TRQA 4USSA 4EL1A 4LL1B 1WWJA 2C4JA 3IK7A 3PPUA 4KSOA 1PN0A 3I43A 5CAXA 4E8HA 2AYTA 3K8NA 4Z2RA 1HYUA 3ZIVA 4OD7A 2AUVA 1YZXA 1J0FA 3GHAA 4QMKA 4RQRA 3ZMLA 1ON4A 2EFEA 1VGLA 2DJ1A 3TJFA 1PL1A 3UMAA 2R0CA 3LFLA 5JCGA 5EPFA 4XS4B 1X9MB 4TR3A 3P90A 4PURA 2IPAA 5J4VA 2PWJA 4N11A 3KGKA 3N9JA 2HSMB 1T4YA 3IBHA 1VF2A 1TK0B 5D93A 3GH9A 3KZQA 3ZTLA 5DCGA 4V2LA 2KHPA 3QMXA 1E6BA 1SK1A 3CRTA 4Q5QA 2CVBA 4MF6A 1EP7A 3UL3A 2C80A 1N25A 2UZ8A 2PGTA 4ZBAA 4Z2TA 3ED3A 2DJ2A 3HVVA 2R6KA 4RI6A 1XWBA 1ZL9A 2O7KA 3KIJA 1M9BA 4YH2A 2IFQA 4OMVA 3BJ5A 4JZQA 3LYKA 5EVOA 1SYRA 5DALA 6GSXA 2R4VA 1TRUA 1YF0A 4KDXA 2CVKA 3R2QA 3FK8A 3FRCA 4ZIJA 1XWKA 4HOJA 4IVFA 1EOGA 1O8WA 4MABA 2LS5A 4KAEA 2ZUPA 4WXTA 1T3BA 5ECHB 1V58A 4XIHA 4PQIA 1X5CA 2L6DA 2YPMA 3IV4A 4PI0C 3SBCA 4YQMA 4QL7A 2V1MA 1DBYA 5F0GA 2OACA 1M7TA 3ZIJA 2C1YA 4PI2C 2H75A 1S3DA 1OAZA 1SD8A 3RBTA 1XVQA 3KMOA 1S3CA 2NDOA 4CY8A 4K6XA 2FA4A 1GUMA 5ECNB 5DJLA 4OO4A 4DEJA 2LRTA 2L59A 2K18A 3LSZA 1Q98A 4GQFA 1MDIA 2X49A 4NV5A 3GX8A 4CW9A 1O7UA 3TJJA 4GWRA 1JHBA 1HNAA 2FA8A 1T1VA 4IHUA 2CVDA 5HR2A 3F8UA 4MF5A 1BG1A 1XW9A 2VCXA 4Z7XA 2F8AA 1ZYNA 2YWOA 3EPTA 2E7PA 2WDUA 2WW0A 5G1LA 16GSA 3O6TA 2WVZA 3KTLA 1R5PA 2LQOA 4X1UA 4YAVA 4ZXGA 1HNCA 4LLRA 1X0RA 1E2YA 4O5RA 5KN1A 3FZ9A 6GSSA 3GNJA 2B6MA 4AKXB 2WW3A 4N30A 4EUYA 2FLSA 2CX4A 4Z2UA 4O5UA 2QGVA 4J56E 3HVSA 2MMNA 2HNLA 2CZ3A 5D9XA 5H5SA 5J3RA 2PERA 2MYGA 4JRRA 2AAWA 4G10A 4YQVA 3F9UA 3CYNA 4BVXB 1OC9B 3D22A 4WKWA 3G7JA 3TKSA 4KNDA 3G7YA 3A2VA 1NM3A 5GAPD 4KDYA 1GUKA 5KEJA 2VL3A 2IFQB 2VM2A 4F0BA 4K1FA 3C1RA 3ZMKA 4MMMA 4PHZC 4ULXA 2WVYA 1FB0A 4HZ4A 1VRSD 3BCIA 1GULA 2GLRA 4IGJA 1I9DA 1JFUA 1ZZYA 2TIRA 4PQ1A 4ECBA 2CQ9A 3F3QA 2HZEB 1LJRA 2JADA 4OO5A 4N0VA 5BMUB 2YANA 3LEFA 4KX4A 1YEXA 3VPTA 2B5XA 5CRWA 1XBSA 2X8HA 4PX1A 1O73A 3I69A 3MYDA 5A34B 2H72A 2V6OA 2QA1A 1TRVA 3ME8A 2GZPA 4E8EA 1W89A 1IYHA 2GSQA 2RUFA 5DQSA 5J47A 2VD0A 4K7NA 1EV4A 1B4PA 2WZSA 1JZOA 4AI6A 2N5BA 1WMJA 1A2MA 3E9JB 2NVLA 3UJ1A 4EIQA 3HJOA 2O3EA 1YF1A 3LYPA 5LD0A 4N10A 2O8VB 3L9VA 1Z3EA 2E0QA 3F3RA 3TKRA 3PH9A 1Z7RA 1GSEA 2F8FA 2A2RA 2LRNA 3TU3B 1PMTA 1PQNA 1QFNA 1GSSA 2A2SA 3P8WA 2J9HA 2B1KA 3EE2A 2NBSA 2H71A 4KSMA 1AQWA 3I6AA 1NHOA 1GTAA 3CSIA 3GIXA 4IQAA 1PX6A 4K0GA 3KJYA 3LQ7A 1MDJA 1M2BA 1TKDB 5J40A 2LV3A 1BG5A 3IR4A 2MMAA 2X8GA 3PINA 1HNBA 3ZITA 1PX7A 3IPZA 3AY8A 4YKGA 3Q19A 3GKKA 5FWGA 3C7MA 3CMIA 2O89A 2YN1A 1THXA 1ZYQB 2V41A 1K3LA 4JBBA 4AKHA 3TOTA 3VI7A 5ECQB 4DSQA 4ILFA 1XW5A 5IMDA 5G5FA 1F37A 1SJ6A 2K9FA 5F8BA 4O92A 3GUSA 4LL4B 2CA8A 10GSA 1WE0A 1H4OA 3IRAA 4MK3A 4MH3A 3WYWA 1EEMA 2H66A 1XOAA 3GSSA 3L4NA 3HKRA 3EU4A 5IPHA 4CDOA 3LXZA 5EL8A 2YNXA 4CY6A 1JLWA 4X0XA 3QD9A 4I97A 3RFRC 4EDZA 2GTUA 1ERWA 1QK8A 2HRFA 2VIMA 1SJZA 3V1WA 2O85A 1J08A 1FG4A 2HSNA 1AAZA 5JCUA 3IC4A 4ICYA 5IPGA 3ZFLA 1EZKA 1BEDA 3US3A 4LA1A 3MAKA 1X9WB 3KM6A 4TOPA 2P31A 3UVHA 2H0HA 1YQ1A 2M46A 3U6VA 3TJGA 2GZZA 2WZ9A 1ZYPA 2PPTA 2VL2C 5GZZB 2WVXA 4Q5RA 1YVLA 5B6NA 3KTBA 1Z7PA 1TI3A 1M2AA 1ABAA 2C3TA 5A4VA 5A4WA 1SL2B 1WJKA 1JZDA 4GDFA 1XIYA 3H4KA 5H5QA 2I3YA 3UIWA 4XS1A 3TRXA 2OBKA 2KOKA 1EP8A 3Q74A 2VUPA 2DKHA 2ON5A 1R4WA 2MBSA 4BL7A 1BJXA 4WR4A 1A8LA 20GSA 4PQHA 1K3YA 1U6TA 4TN8A 4JU5A 2GT6A 5BRTA 4TW5A 1YKCA 3LORA 3FR3A 2DJJA 3WGEA 1S4BP 4FYCA 2EIQA 2B1LA 2DJ3A 1FB6A 2VL9A 1WRYA 1QUWA 5IO2A 4QL9A 3CSHA 5A1NB 1ERUA 1DSBA 2HLSA 4IW9A 2WRTA 3F0IA 1G0TA 4WBRD 5CRHA 4XTSA 1O8XA 2LEGA 2H73A 2K6VA 4PGTA 4GF0A 1GWCA 4GSTA 4OFTA 2R5GA 5G2ZA 5G5EA 5D96A 5COHA 5KOWA 2H6XA 1M99A 3ME7A 1OKTA 3IOSA 2WFCA 4AKIA 4POBA 4V2NA 1EGOA 1C72A 3TKQA 2LRCA 4DVCA 2HYXA 5D8IA 1A23A 3FZ4A 2C0DA 5KN3A 2H6YA 2MMZA 3GRXA 3R3EA 2F51A 1G6WA 2R37A 4IELA 2REMA 4L8EA 1GSYA 3BCKA 2RM6A 3VURA 3F6FA 3HDCA 5IOXA 2VLTA 1I5GA 4K7IA 1T7PB 2ON7A 3W8JA 5DDLA 2FWHA 3NIVA 1FVKA 4ZB9A 1AXDA 1F3BA 1PD21 2ZNMA 1SL0B 4WF5A 2YJ7A 4WETA 14GSA 2ZCTA 2G0FA 5ECPB 2GSSA 3TOUA 1TK8B 1A24A 3EU3A 3KXOA 4AJ8A 4XRAA 3EVIA 4YQUA 17GSA 4LMVA 5GSTA 1ZYEA 4XHMA 2GSTA 4G0IA 3GTUA 2DBCA 1TW9A 4ACSA 3OR5A 4K7OA 2EC4A 2J23A 1X5DA 1U3IA 4QQ7A 4KF9A 2HXKA 4IP1A 1U3AA 4ZB7A 4ZL9A 1KTEA 2IJYA 4GRFA 1GLPA 2YV9A 1LBKA 1VF3A 2BJXA 5IIZA 4GSSA 4ZILA 2TRXA 4K9ZA 1JZRA 5ID2A 2GQMA 1OC3A 2HZFA 1ZCPA 4HJMA 4MDCA 1PSQA 3BBYA 3F4SA 4POMA 5JWOB 1GSQA 1O81A 3DVXA 5A5KA 4KE3A 3D4TA 3DGQA 3A2XA 2P5RA 3SWLA 5DQYA 5ECIB 4K2DA 4KCAA 1GTBA 1GL8A 5DBQA 3EC3A 2ALBA 4PUFC 4OCEA 2HQTA 4PTSA 1X9SB 1VF1A 4G0KA 1K0MA 2GVPA 1UN2A 4P3YB 5CRDA 1GNEA 4IKHA 2MZCA 1R26A 3VPQA 4EVMA 1GSDA 1MDKA 5G30A 3GSTA 4XCSA 1H75A 2EFDA 3DMLA 3DYRA 8GSSA 3M1GA 1TXUA 4IJ3A 2V32A 5HR0A 2I9HA 1XOBA 3UEMA 3L0HA 4BWSA 1GH2A 3QFBC 3GX0A 3QOUA 3EWLA 3M9KA 2N5AA 3QAVA 2VL2A 3WT1A 3CRUA 4TVEA 5CP1A 5IMVA 2YWNA 4ZB8A 2H30A 4IS0A 4ID0A 2OE3A 1SK0A 2P0GA 4X4JA 4MJCA 2H0GA 3WD6A 4K0NA 1YEPA 5CREA 3ZL5A 2AHEA 1CQHA 4F2IA 3LJRA 1FO5A 2H8LA 2K8SA 1OVNA 1NHYA 1USBA 1SYXA 3CTFA 3HXSA 5CRGA 1KNGA 2WW1A 4HQSA 1EOHA 3C71A 4MZBA 3ERWA 4ZBDA 3IAS2 5ENUA 4MLYA 4D73A 3HYPA 6GSYA 1BX9A 1YY7A 3ERGA 5ID2B 5FT3A 2IMKA 1RW1A 5ELAA 4BIKA 1T4ZA 5DALB 4HU9A 4KA0A 2D2ZA 3FY7A 5B8BA 4K5SA 1KBNA 2VM1A 3HVXA 3DXBA 4MPFA 3LW9A 2LJAA 2M80A 2YWIA 3HA9A 5H5RA 3IAM2 4TR1A 5KN0A 3KH7A 3RPNA 1X5EA 5B6MA 2NPBA 1B48A 3W6GA 3HVNA 2H1LA 2AJQB 1A8YA 1SKSB 1XXUA 5A5HA 4BVYA 3KCMA 2AV4A 4I5QA 2IWTA 4X43A 3DWVA 1XWGA 2JZTA 4HQZA 2TRCP 2RUEA 4FH8A 2X8CA 3EINA 4ZB6A 2JU5A 3H79A 3FKFA 3QAGA 1F3AA 3NOFA 5D9WA 4L0WA 3VWVA 2PU9C 1K0NA 3GL5A 2QKEA 2HSHA 3TGZA 2O87A 2CZ2A 2H74A 5IO0A 3GN3A 3HD5A 5ECRB 3F4TA 2FNOA 4KH7A 2VOCA 4MJAA 7GSSA 3D5JA 2BTOT 3O76A 5E4WA 9GSSA 2FHEA 3VWXA 2KP1A 3DKSA 4EE0A 12GSA 1TOFA 1Z5YE 4MF7A 5EY6A 5IMFA 4I6XA 1Z9HA 4L5OA 2VCQA 4NMUA 1MD4A 2OBIA 2WW2A 2JSYA 4GQCA 2ES7A 2FWGA 1LU4A 2OJLA 1AC1A 3VLNA 4MNNA 1PL2A 2I1UA 2WCIA 3UARA 1QGVA 3M8NA 1IYIA 4WBJA 1WP0A 4NPBA 2H1GA 4TXOA 3EMPA 4K2XA 2X99A 1HD2A 1OC8A 1OKDA 4EDYA 5FHIA 1EV9A 3ZFBA 1NW2A 2BMXA 2FGXA 4Q5FA 3DD3A 3L9SA 1A0FA 5INYA 3FMWA 1SVLA 3GKNA 1FAAA 3L78A 5GSSA 1YEWC 3KP9A 2CAQA 2JL4A 2M72A 3GURA 4TKYA 3J7Yb 2L5LA 3G7IA 2H76A 3FYGA 4FIWA 2LJKA 2QC7A 1GSFA 2LTKA 5L71A 4JEDA 5DJMA 3MWHA 5ECMB 1FVJA 1GTUA 1DE2A 4PNFA 4BVYB 1QXHA 2L6CA 1URMA 3TDGA 2AB6A 2R0GA 2NTOA 4PXOA 4EC0A 3H93A 2LJRA 3PR8A 2DIYA 4E68A 3PGTA 1SKWB 1M3JA 1TTZA 2VLVA 4DSRA 2B5YA 1SVOA 3TRPA 1ML6A 1BF5A 3FZAA 5HR1A 1AIUA 2EFHA 2YP6A 4IJIA 1GRXA 1A0RP 2GDRA 4Q5NA 2XBQA 4BA7A 4EF0A 1SK2A 1DUGA 5D9VA 1S3RA 5DVBA 3E3EA 4O5QA 4EXJA 2JZSA 2PBJA 2VKZG 11GSA 1EGRA 1GUHA 2L4CA 4XS4A 2YV7A 4MJBA 3A5WA 3HJMA 2HSMA 5F05A 1CQGA 3CSJA 4HDEA 1F6MC 1T00A 1ST9A 2K8VA 1SKRB 3GA4A 4RUVA 2VO4A 2OADA 1V40A 2XHFA 1GP1A 4GLTA 3TKSC 2YZHA 2L4QA 3P7XA 4FYUA 2VCZA 1U87A 3O3TA 2DMMA 1GNWA 4KW6A 4MJEA 3RGBC 1S3AA 4FXYP 2XPDA 3KD0A 1WOUA 4JR4A 2QSIA 1TJDA 5CYYA 3QR6A 3ZVJD 4TRXA 1N2AA 1FOHA 5J4UA 1G6YA 3UAPA 2FCHA 3FR9A 4NHWA 3D21A 2YZUA 6GSUA 1Z6MA 2QA2A 4L5LA 4GTUA 4FO5A 4DSSA 5B7CA 4IBPA 3ISOA 2EIRA 1GTIA 5ECSA 3EURA 4ZL7A 3CBUA 3GL3A 4ECIA 4V1Ap 2YWMA 2R0PA 4NAXA 5ECKB 5GAND 1B8XA 3CTGA 4WR5A 2HSNB 3MNGA 1OE7A 2HRAA 5ABRA 3QFAC 3VK9A 4JE1A 4MPGA 5IMAA 2LKUA 4FQUA 1Y25A 4NWYA 2UV8G 5IMCA 1BQ7A 4F0CA 3HHVA 2KUCA 5D9TA 3W8SA
chains in the Genus database with same CATH topology
2DSAA 2JACA 2C3NA 2VCVA 1XW6A 4IP6A 3ZREA 3J7Yk 4IQ1A 3IA1A 4EO3A 1K0BA 2G2QA 4YKFA 1JZWA 1G7OA 4I8BA 5B8AA 4OWYA 1Y1UA 1TRWA 4KGIA 4KB3A 2CV4A 2H0IA 3TJBA 4J2FA 4AGSA 3A2WA 3EMXA 4G2EA 1ZMAA 4FYBA 1PN9A 3N5OA 4BL7B 2DJKA 3VFIA 2YCDA 1J9BA 2V6KA 3M9JA 3TB2A 1FHEA 3LXTA 1B9XC 4K8MA 4O7HA 2YOIA 4HI7A 1FOVA 1EEJA 1V9WA 3UBKA 4F82A 2I4AA 3GKMA 4BVXA 1OC9A 2L5OA 2A2PA 4KDUA 1PA3A 3C8EA 4NV2A 5AISA 3HCZA 1TDIA 1A2JA 4TXVA 3UBLA 5ELGA 3IE3A 5IM9A 3DVWA 4WF4A 5F07A 1AQVA 2WGRA 2L57A 5KOXA 5DAKA 5J9CA 1M9AA 2HRKA 1SL1B 1TP9A 1TU8A 6GSTA 1O6JA 1QMVA 2F9SA 2P5QA 3DEXA 2LSTA 3RHBA 2XC2A 3ZVJA 4HS1A 2H1AA 13GSA 4OFNA 2HZEA 4LMWA 4A5PA 2H1DA 4XRDA 4ISDA 5AN1A 4DSSB 5HR3A 1BAYA 5BMUA 1R5AA 2F3MA 4F9ZA 2PVQA 4TR4A 1PKZA 1WPIA 5A34A 3GV1A 3D4MA 4MCUA 5G1KA 1YJ6A 5JCWA 1YDKA 3S9FA 2DKIA 1XWCA 3QDNA 4MZCA 4ML1A 2C0GA 1F9MA 1K0OA 1U88A 2DC5A 1TXXA 4AKGA 3LWAA 4L0UA 3FW2A 1B9YC 4V1Ag 4HU7A 3RPPA 2CAIA 2GSRA 3IK9A 3P2AA 3HZ4A 3QAWA 3M3MA 1QQ2A 3KP8A 1WIKA 2FWEA 2OA7A 4W66A 3WGDA 19GSA 4POLA 5J41A 3D6IA 1HQOA 3H8QA 2HE3A 2XPEA 1G7EA 2IMEA 3GTUB 4HUAA 2H6ZA 3C73A 3KEBA 3TKSE 3D0ZA 1N8JA 3F6DA 3MSZA 2OKAA 2HRNA 6GSVA 1KEBA 2XBIA 3A3TA 4ZBBA 3HMJG 1O85A 3DIEA 4EKZA 2LNSA 1TI1A 3HJPA 1V57A 4HJ2A 4IN0A 5HFIA 5J5NA 2WS2A 2A4HA 1XCCA 2E2MA 5ECLB 1XFLA 2OE0A 1YKAA 4JR6A 2X4AA 1SVMA 5DAKB 2JSZA 1AUCA 2HRKB 2PVOC 1VF4A 1ILOA 2DMLA 3TUEA 2OT3A 5KN2A 3RHCA 2DIZA 3WGXA 5CNWA 2EFCA 5IOWA 4MA9A 2IIYA 1XVWA 5E59A 2GQLA 3FR6A 3GYKA 3EYTA 4NHZA 1MD3A 2PUKC 4HEA2 4N3ZA 1R7HA 1PRXA 3VWUA 5C00A 1K3OA 2A4VA 2RIIA 4G01A 2E2GA 1TK5B 3RAZA 1BYEA 2GQKA 2YJHA 2IMDA 4BPYA 4RI7A 18GSA 2X64A 5AIVA 1XPVA 3MIXA 2C0EA 2WULA 3BOAA 5HQPA 2C0FA 4GCIA 3G9BA 3APSA 3IHGA 1Q4JA 3APQA 3DRNA 3GMFA 5JWQB 4YAPA 3Q18A 2VAFA 2WJUA 5F06A 3BD2A 2N5FA 1V2AA 4CHSA 1FW1A 5ECOB 2FUG2 1ACVA 3KH9A 4O32A 2CX3A 5J4YA 2FY6A 2GS3A 2KLXA 2FD3A 2Z9SA 3GH6A 1K0AA 2HSYA 3FZ5A 4XS6A 3HY2A 2V2GA 4I2UA 3FHKA 4PUAA 3H1NA 3C1SA 2MMOA 1W4VA 1UC7A 5AGYA 1Z6NA 5A1NA 1JLVA 4D73B 3I9V2 1ZGNA 2B7JA 1PKWA 2DJ0A 4KUNA 2VCTA 2R2JA 1SJIA 2O5VA 4V2MA 3M0FA 3E0UA 1EWXA 2IMIA 1RK4A 1ZOFA 2VLUA 4NXIA 3MDKA 2HT9A 1M2DA 3APOA 3NZNA 5LCZA 1SD9A 3IC8A 4AF2A 1K0CA 4OCFA 3JCML 5J9BA 2IN3A 3LG6A 4TR1B 4EIPA 3LGCA 5DCHA 1TU7A 4G19A 4AJ7A 1GLQA 5C04A 2B7KA 3CWGA 1SU9A 3GKXA 3U5RE 5A5HB 2C3QA 4RQXA 5A4UA 3HZ8A 3VWWA 2PMTA 3IXRA 4MZWA 1F2EA 4ZL8A 3VI5A 6GSWA 2EIOA 4I2TA 4ECCA 3TJKA 2H01A 1ERTA 5G31A 2RM5A 3Q6OA 1DE1A 3WT2A 1ERVA 1SENA 5CO3A 2JZRA 4PNGA 4GXZA 1AW9A 1RQMA 2CT6A 3UVTA 2H19A 1A2LA 1UA5A 4G0LA 4POKA 2RLIA 1MTCA 5HFKA 3F4RA 1TRSA 4J57E 3IHQA 4KCEA 2FWFA 3RDWA 2MBTA 5HFGA 2B5EA 2HFDA 2I81A 2PN8A 2LQQA 4BWQA 3FEUA 1T8EB 4HZ2A 2KP2A 1K0DA 3A5IA 4TXOB 4MP4A 2WB9A 2H1BA 3KMNA 4F03A 3QPMA 2GGTA 2H70A 2VD1A 2GZYA 2GT5A 4K5RA 3ZZXA 2OE1A 4ML6A 1THOA 4MH2A 22GSA 5D73A 3ZRDA 4N0ZA 2DLXA 2IL3A 3UOMA 5IQYA 5JWRB 1AQXA 3F63A 2VCWA 4AJ6A 2LUSA 5IMZA 4TR0A 4G9HA 3IDVA 4WEYA 5AIXA 2LNTA 3ZLPA 3CXGA 3QCPA 1MEKA 4OFMA 5LNKe 4ECJA 1XWAA 2R3XA 1PGTA 1V98A 1XZOA 1OYJA 4GSNA 2IMFA 2B3SA 3ZYWA 1GSUA 3ERFA 3GFKA 1NSWA 1UVZA 2C8UA 1B4QA 3L9UA 1OE8A 2HI7A 4H86A 1Y6EA 3TCOA 1M0UA 3TKPA 3TRQA 4USSA 4EL1A 4LL1B 1WWJA 2C4JA 3IK7A 3PPUA 4KSOA 1PN0A 3I43A 5CAXA 4E8HA 2AYTA 3K8NA 4Z2RA 1HYUA 3ZIVA 4OD7A 2AUVA 1YZXA 1J0FA 3GHAA 4QMKA 4RQRA 3ZMLA 1ON4A 2EFEA 1VGLA 2DJ1A 3TJFA 1PL1A 3UMAA 2R0CA 3LFLA 5JCGA 5EPFA 4XS4B 1X9MB 4TR3A 3P90A 4PURA 2IPAA 5J4VA 2PWJA 4N11A 3KGKA 3N9JA 2HSMB 1T4YA 3IBHA 1VF2A 1TK0B 5D93A 3GH9A 3KZQA 3ZTLA 5DCGA 4V2LA 2KHPA 3QMXA 1E6BA 1SK1A 3CRTA 4Q5QA 2CVBA 4MF6A 1EP7A 3UL3A 2C80A 1N25A 2UZ8A 2PGTA 4ZBAA 4Z2TA 3ED3A 2DJ2A 3HVVA 2R6KA 4RI6A 1XWBA 1ZL9A 2O7KA 3KIJA 1M9BA 4YH2A 2IFQA 4OMVA 3BJ5A 4JZQA 3LYKA 5EVOA 1SYRA 5DALA 6GSXA 2R4VA 1TRUA 1YF0A 4KDXA 2CVKA 3R2QA 3FK8A 3FRCA 4ZIJA 1XWKA 4HOJA 4IVFA 1EOGA 1O8WA 4MABA 2LS5A 4KAEA 2ZUPA 4WXTA 1T3BA 5ECHB 1V58A 4XIHA 4PQIA 1X5CA 2L6DA 2YPMA 3IV4A 3SBCA 4YQMA 4QL7A 2V1MA 1DBYA 5F0GA 2OACA 1M7TA 3ZIJA 2C1YA 2H75A 1S3DA 1OAZA 1SD8A 3RBTA 1XVQA 3KMOA 1S3CA 2NDOA 4CY8A 4K6XA 2FA4A 1GUMA 5ECNB 5DJLA 4OO4A 4DEJA 2LRTA 2L59A 2K18A 3LSZA 1Q98A 4GQFA 1MDIA 2X49A 4NV5A 3GX8A 4CW9A 1O7UA 3TJJA 4GWRA 1JHBA 1HNAA 2FA8A 1T1VA 4IHUA 2CVDA 5HR2A 3F8UA 4MF5A 1BG1A 1XW9A 2VCXA 4Z7XA 2F8AA 1ZYNA 2YWOA 3EPTA 2E7PA 2WDUA 5G1LA 16GSA 3O6TA 3KTLA 1R5PA 2LQOA 4X1UA 4YAVA 4ZXGA 1HNCA 4LLRA 1X0RA 1E2YA 4O5RA 5KN1A 3FZ9A 6GSSA 3GNJA 2B6MA 4AKXB 4N30A 4EUYA 2FLSA 2CX4A 4Z2UA 4O5UA 2QGVA 4J56E 3HVSA 2MMNA 2HNLA 2CZ3A 5D9XA 5H5SA 5J3RA 2PERA 2MYGA 4JRRA 2AAWA 4G10A 4YQVA 3F9UA 3CYNA 4BVXB 1OC9B 3D22A 4WKWA 3G7JA 3TKSA 4KNDA 3G7YA 3A2VA 1NM3A 5GAPD 4KDYA 1GUKA 5KEJA 2VL3A 2IFQB 2VM2A 4F0BA 4K1FA 3C1RA 3ZMKA 4MMMA 4ULXA 1FB0A 4HZ4A 1VRSD 3BCIA 1GULA 2GLRA 4IGJA 1I9DA 1JFUA 1ZZYA 2TIRA 4PQ1A 4ECBA 2CQ9A 3F3QA 2HZEB 1LJRA 2JADA 4OO5A 4N0VA 5BMUB 2YANA 3LEFA 4KX4A 1YEXA 3VPTA 2B5XA 5CRWA 1XBSA 2X8HA 4PX1A 1O73A 3I69A 3MYDA 5A34B 2H72A 2V6OA 2QA1A 1TRVA 3ME8A 2GZPA 4E8EA 1W89A 1IYHA 2GSQA 2RUFA 5DQSA 5J47A 2VD0A 4K7NA 1EV4A 1B4PA 1JZOA 4AI6A 2N5BA 1WMJA 1A2MA 3E9JB 2NVLA 3UJ1A 4EIQA 3HJOA 1YF1A 3LYPA 5LD0A 4N10A 2O8VB 3L9VA 1Z3EA 2E0QA 3F3RA 3TKRA 3PH9A 1Z7RA 1GSEA 2F8FA 2A2RA 2LRNA 3TU3B 1PMTA 1PQNA 1QFNA 1GSSA 2A2SA 3P8WA 2J9HA 2B1KA 3EE2A 2NBSA 2H71A 4KSMA 1AQWA 3I6AA 1NHOA 1GTAA 3CSIA 3GIXA 4IQAA 1PX6A 4K0GA 3KJYA 3LQ7A 1MDJA 1M2BA 1TKDB 5J40A 2LV3A 1BG5A 3IR4A 2MMAA 2X8GA 3PINA 1HNBA 3ZITA 1PX7A 3IPZA 3AY8A 4YKGA 3Q19A 3GKKA 5FWGA 3C7MA 3CMIA 2O89A 2YN1A 1THXA 1ZYQB 2V41A 1K3LA 4JBBA 4AKHA 3TOTA 3VI7A 5ECQB 4DSQA 4ILFA 1XW5A 5IMDA 5G5FA 1F37A 1SJ6A 2K9FA 5F8BA 4O92A 3GUSA 4LL4B 2CA8A 10GSA 1WE0A 1H4OA 3IRAA 4MK3A 4MH3A 3WYWA 1EEMA 2H66A 1XOAA 3GSSA 3L4NA 3HKRA 3EU4A 5IPHA 4CDOA 3LXZA 5EL8A 2YNXA 4CY6A 1JLWA 4X0XA 3QD9A 4I97A 4EDZA 2GTUA 1ERWA 1QK8A 2HRFA 2VIMA 1SJZA 3V1WA 2O85A 1J08A 1FG4A 2HSNA 1AAZA 5JCUA 3IC4A 4ICYA 5IPGA 3ZFLA 1EZKA 1BEDA 3US3A 4LA1A 3MAKA 1X9WB 3KM6A 4TOPA 2P31A 3UVHA 2H0HA 1YQ1A 2M46A 3U6VA 3TJGA 2GZZA 2WZ9A 1ZYPA 2PPTA 2VL2C 5GZZB 4Q5RA 1YVLA 5B6NA 3KTBA 1Z7PA 1TI3A 1M2AA 1ABAA 2C3TA 5A4VA 5A4WA 1SL2B 1WJKA 1JZDA 4GDFA 1XIYA 3H4KA 5H5QA 2I3YA 3UIWA 4XS1A 3TRXA 2OBKA 2KOKA 1EP8A 3Q74A 2VUPA 2DKHA 2ON5A 1R4WA 2MBSA 4BL7A 1BJXA 4WR4A 1A8LA 20GSA 4PQHA 1K3YA 1U6TA 4TN8A 4JU5A 2GT6A 5BRTA 4TW5A 1YKCA 3LORA 3FR3A 2DJJA 3WGEA 4FYCA 2EIQA 2B1LA 2DJ3A 1FB6A 2VL9A 1WRYA 1QUWA 5IO2A 4QL9A 3CSHA 5A1NB 1ERUA 1DSBA 2HLSA 4IW9A 2WRTA 3F0IA 1G0TA 4WBRD 5CRHA 4XTSA 1O8XA 2LEGA 2H73A 2K6VA 4PGTA 4GF0A 1GWCA 4GSTA 4OFTA 2R5GA 5G2ZA 5G5EA 5D96A 5COHA 5KOWA 2H6XA 1M99A 3ME7A 1OKTA 3IOSA 2WFCA 4AKIA 4POBA 4V2NA 1EGOA 1C72A 3TKQA 2LRCA 4DVCA 2HYXA 5D8IA 1A23A 3FZ4A 2C0DA 5KN3A 2H6YA 2MMZA 3GRXA 3R3EA 2F51A 1G6WA 2R37A 4IELA 2REMA 4L8EA 1GSYA 3BCKA 2RM6A 3VURA 3F6FA 3HDCA 5IOXA 2VLTA 1I5GA 4K7IA 1T7PB 2ON7A 3W8JA 5DDLA 2FWHA 3NIVA 1FVKA 4ZB9A 1AXDA 1F3BA 1PD21 2ZNMA 1SL0B 4WF5A 2YJ7A 4WETA 14GSA 2ZCTA 2G0FA 5ECPB 2GSSA 3TOUA 1TK8B 1A24A 3EU3A 3KXOA 4AJ8A 4XRAA 3EVIA 4YQUA 17GSA 4LMVA 5GSTA 1ZYEA 4XHMA 2GSTA 4G0IA 3GTUA 2DBCA 1TW9A 4ACSA 3OR5A 4K7OA 2EC4A 2J23A 1X5DA 1U3IA 4QQ7A 4KF9A 2HXKA 4IP1A 1U3AA 4ZB7A 4ZL9A 1KTEA 2IJYA 4GRFA 1GLPA 2YV9A 1LBKA 1VF3A 2BJXA 5IIZA 4GSSA 4ZILA 2TRXA 4K9ZA 1JZRA 5ID2A 2GQMA 1OC3A 2HZFA 1ZCPA 4HJMA 4MDCA 1PSQA 3BBYA 3F4SA 4POMA 5JWOB 1GSQA 1O81A 3DVXA 5A5KA 4KE3A 3D4TA 3DGQA 3A2XA 2P5RA 3SWLA 5DQYA 5ECIB 4K2DA 4KCAA 1GTBA 1GL8A 5DBQA 3EC3A 2ALBA 4PUFC 4OCEA 2HQTA 4PTSA 1X9SB 1VF1A 4G0KA 1K0MA 2GVPA 1UN2A 4P3YB 5CRDA 1GNEA 4IKHA 2MZCA 1R26A 3VPQA 4EVMA 1GSDA 1MDKA 5G30A 3GSTA 4XCSA 1H75A 2EFDA 3DMLA 3DYRA 8GSSA 3M1GA 1TXUA 4IJ3A 2V32A 5HR0A 2I9HA 1XOBA 3UEMA 3L0HA 4BWSA 1GH2A 3QFBC 3GX0A 3QOUA 3EWLA 3M9KA 2N5AA 3QAVA 2VL2A 3WT1A 3CRUA 4TVEA 5CP1A 5IMVA 2YWNA 4ZB8A 2H30A 4IS0A 4ID0A 2OE3A 1SK0A 2P0GA 4X4JA 4MJCA 2H0GA 3WD6A 4K0NA 1YEPA 5CREA 3ZL5A 2AHEA 1CQHA 4F2IA 3LJRA 1FO5A 2H8LA 2K8SA 1OVNA 1NHYA 1USBA 1SYXA 3CTFA 3HXSA 5CRGA 1KNGA 4HQSA 1EOHA 3C71A 4MZBA 3ERWA 4ZBDA 3IAS2 5ENUA 4MLYA 4D73A 3HYPA 6GSYA 1BX9A 1YY7A 3ERGA 5ID2B 5FT3A 2IMKA 1RW1A 5ELAA 1T4ZA 5DALB 4HU9A 4KA0A 2D2ZA 3FY7A 5B8BA 4K5SA 1KBNA 2VM1A 3HVXA 3DXBA 4MPFA 3LW9A 2LJAA 2M80A 2YWIA 3HA9A 5H5RA 3IAM2 4TR1A 5KN0A 3KH7A 3RPNA 1X5EA 5B6MA 2NPBA 1B48A 3W6GA 2AJQB 2H1LA 1A8YA 1SKSB 1XXUA 5A5HA 4BVYA 3KCMA 2AV4A 4I5QA 2IWTA 4X43A 3DWVA 1XWGA 2JZTA 4HQZA 2TRCP 2RUEA 4FH8A 2X8CA 3EINA 4ZB6A 2JU5A 3H79A 3FKFA 3QAGA 1F3AA 3NOFA 5D9WA 4L0WA 3VWVA 2PU9C 1K0NA 3GL5A 2QKEA 2HSHA 3TGZA 2O87A 2CZ2A 2H74A 5IO0A 3GN3A 3HD5A 5ECRB 3F4TA 2FNOA 4KH7A 2VOCA 4MJAA 7GSSA 3D5JA 2BTOT 3O76A 5E4WA 9GSSA 2FHEA 3VWXA 2KP1A 3DKSA 4EE0A 12GSA 1TOFA 1Z5YE 4MF7A 5EY6A 5IMFA 4I6XA 1Z9HA 4L5OA 2VCQA 4NMUA 1MD4A 2OBIA 2JSYA 4GQCA 2ES7A 2FWGA 1LU4A 2OJLA 1AC1A 3VLNA 4MNNA 1PL2A 2I1UA 2WCIA 3UARA 1QGVA 3M8NA 1IYIA 4WBJA 1WP0A 4NPBA 2H1GA 4TXOA 3EMPA 4K2XA 2X99A 1HD2A 1OC8A 1OKDA 4EDYA 5FHIA 1EV9A 3ZFBA 1NW2A 2BMXA 2FGXA 4Q5FA 3DD3A 3L9SA 1A0FA 5INYA 3FMWA 1SVLA 3GKNA 1FAAA 3L78A 5GSSA 3KP9A 2CAQA 2JL4A 2M72A 3GURA 4TKYA 3J7Yb 2L5LA 3G7IA 2H76A 3FYGA 4FIWA 2LJKA 2QC7A 1GSFA 2LTKA 5L71A 4JEDA 5DJMA 3MWHA 5ECMB 1FVJA 1GTUA 1DE2A 4PNFA 4BVYB 1QXHA 2L6CA 1URMA 3TDGA 2AB6A 2R0GA 2NTOA 4PXOA 4EC0A 3H93A 2LJRA 3PR8A 2DIYA 4E68A 3PGTA 1SKWB 1TTZA 2VLVA 4DSRA 2B5YA 1SVOA 3TRPA 1ML6A 1BF5A 3FZAA 5HR1A 1AIUA 2EFHA 2YP6A 4IJIA 1GRXA 1A0RP 2GDRA 4Q5NA 2XBQA 4BA7A 4EF0A 1SK2A 1DUGA 5D9VA 5DVBA 3E3EA 4O5QA 4EXJA 2JZSA 2PBJA 2VKZG 11GSA 1EGRA 1GUHA 2L4CA 4XS4A 2YV7A 4MJBA 3A5WA 3HJMA 2HSMA 5F05A 1CQGA 3CSJA 4HDEA 1F6MC 1T00A 1ST9A 2K8VA 1SKRB 3GA4A 4RUVA 2VO4A 2OADA 1V40A 2XHFA 1GP1A 4GLTA 3TKSC 2YZHA 2L4QA 3P7XA 4FYUA 2VCZA 1U87A 3O3TA 2DMMA 1GNWA 4KW6A 4MJEA 1S3AA 2XPDA 3KD0A 1WOUA 4JR4A 2QSIA 1TJDA 5CYYA 3QR6A 3ZVJD 4TRXA 1N2AA 1FOHA 5J4UA 1G6YA 3UAPA 2FCHA 3FR9A 4NHWA 3D21A 2YZUA 6GSUA 1Z6MA 2QA2A 4L5LA 4GTUA 4FO5A 4DSSA 5B7CA 4IBPA 3ISOA 2EIRA 1GTIA 5ECSA 3EURA 4ZL7A 3CBUA 3GL3A 4ECIA 4V1Ap 2YWMA 2R0PA 4NAXA 5ECKB 5GAND 1B8XA 3CTGA 4WR5A 2HSNB 3MNGA 1OE7A 2HRAA 5ABRA 3QFAC 3VK9A 4JE1A 4MPGA 5IMAA 2LKUA 4FQUA 1Y25A 4NWYA 2UV8G 5IMCA 1BQ7A 4F0CA 3HHVA 2KUCA 5D9TA 3W8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSA A;  2JAC A;  2C3N A;  2VCV A;  1XW6 A;  4IP6 A;  3ZRE A;  3J7Y k;  4IQ1 A;  3IA1 A;  4EO3 A;  1K0B A;  2G2Q A;  1JZW A;  1G7O A;  4I8B A;  5B8A A;  4OWY A;  1TRW A;  4KGI A;  4KB3 A;  2CV4 A;  2H0I A;  3TJB A;  4J2F A;  4AGS A;  3A2W A;  3EMX A;  4G2E A;  1ZMA A;  4FYB A;  1PN9 A;  3N5O A;  4BL7 B;  2DJK A;  3VFI A;  2YCD A;  1J9B A;  2V6K A;  3M9J A;  3TB2 A;  1FHE A;  3LXT A;  1B9X C;  4K8M A;  4O7H A;  2YOI A;  4HI7 A;  1FOV A;  1EEJ A;  1V9W A;  3UBK A;  4F82 A;  2I4A A;  3GKM A;  4BVX A;  1OC9 A;  2L5O A;  4KDU A;  1PA3 A;  3C8E A;  4NV2 A;  5AIS A;  3HCZ A;  1TDI A;  1A2J A;  4TXV A;  3UBL A;  5ELG A;  3IE3 A;  5IM9 A;  3DVW A;  4WF4 A;  5F07 A;  1AQV A;  2WGR A;  2L57 A;  5DAK A;  5J9C A;  1M9A A;  2HRK A;  1SL1 B;  1TP9 A;  1TU8 A;  6GST A;  1O6J A;  1QMV A;  2F9S A;  2P5Q A;  3DEX A;  2LST A;  3RHB A;  2XC2 A;  3ZVJ A;  4HS1 A;  2H1A A;  13GS A;  4OFN A;  2HZE A;  4LMW A;  2H1D A;  4XRD A;  4ISD A;  5AN1 A;  4DSS B;  5HR3 A;  1BAY A;  5BMU A;  1R5A A;  2F3M A;  4F9Z A;  2PVQ A;  4TR4 A;  1PKZ A;  1WPI A;  3GV1 A;  3D4M A;  4MCU A;  5G1K A;  1YJ6 A;  5JCW A;  1YDK A;  3S9F A;  1XWC A;  3QDN A;  4MZC A;  4ML1 A;  2C0G A;  1F9M A;  1K0O A;  1U88 A;  2DC5 A;  1TXX A;  3LWA A;  4L0U A;  3FW2 A;  1B9Y C;  4V1A g;  4HU7 A;  3RPP A;  2CAI A;  2GSR A;  3IK9 A;  3P2A A;  3HZ4 A;  3QAW A;  3M3M A;  1QQ2 A;  3KP8 A;  1WIK A;  2FWE A;  2OA7 A;  3WGD A;  19GS A;  4POL A;  5J41 A;  3D6I A;  1HQO A;  3H8Q A;  2HE3 A;  2XPE A;  1G7E A;  2IME A;  3GTU B;  4HUA A;  2H6Z A;  3C73 A;  3KEB A;  3TKS E;  3D0Z A;  1N8J A;  3F6D A;  3MSZ A;  2OKA A;  2HRN A;  6GSV A;  1KEB A;  2XBI A;  3A3T A;  4ZBB A;  1O85 A;  3DIE A;  4EKZ A;  2LNS A;  1TI1 A;  3HJP A;  1V57 A;  4HJ2 A;  4IN0 A;  5HFI A;  5J5N A;  2WS2 A;  1XCC A;  2E2M A;  5ECL B;  1XFL A;  2OE0 A;  1YKA A;  4JR6 A;  5DAK B;  2JSZ A;  1AUC A;  2HRK B;  2PVO C;  1VF4 A;  1ILO A;  2DML A;  3TUE A;  5KN2 A;  3RHC A;  2DIZ A;  3WGX A;  5CNW A;  5IOW A;  4MA9 A;  2IIY A;  1XVW A;  5E59 A;  2GQL A;  3FR6 A;  3GYK A;  3EYT A;  4NHZ A;  1MD3 A;  2PUK C;  4HEA 2;  1R7H A;  1PRX A;  3VWU A;  5C00 A;  1K3O A;  2A4V A;  2RII A;  2E2G A;  1TK5 B;  3RAZ A;  1BYE A;  2GQK A;  2YJH A;  2IMD A;  4BPY A;  4RI7 A;  18GS A;  2X64 A;  5AIV A;  1XPV A;  2C0E A;  2WUL A;  3BOA A;  5HQP A;  2C0F A;  4GCI A;  3G9B A;  3APS A;  1Q4J A;  3APQ A;  3DRN A;  3GMF A;  5JWQ B;  4YAP A;  3Q18 A;  2VAF A;  2WJU A;  5F06 A;  3BD2 A;  2N5F A;  1V2A A;  4CHS A;  1FW1 A;  5ECO B;  2FUG 2;  1ACV A;  3KH9 A;  4O32 A;  2CX3 A;  2FY6 A;  2GS3 A;  2KLX A;  2FD3 A;  2Z9S A;  3GH6 A;  1K0A A;  2HSY A;  3FZ5 A;  4XS6 A;  3HY2 A;  2V2G A;  4I2U A;  3FHK A;  4PUA A;  3H1N A;  3C1S A;  2MMO A;  1W4V A;  1UC7 A;  5AGY A;  1Z6N A;  1JLV A;  4D73 B;  3I9V 2;  1ZGN A;  2B7J A;  1PKW A;  2DJ0 A;  4KUN A;  2VCT A;  2R2J A;  1SJI A;  4V2M A;  3M0F A;  3E0U A;  1EWX A;  2IMI A;  1RK4 A;  1ZOF A;  2VLU A;  4NXI A;  3MDK A;  2HT9 A;  1M2D A;  3APO A;  3NZN A;  5LCZ A;  1SD9 A;  3IC8 A;  4AF2 A;  1K0C A;  4OCF A;  3JCM L;  5J9B A;  2IN3 A;  3LG6 A;  4TR1 B;  3LGC A;  5DCH A;  1TU7 A;  4G19 A;  4AJ7 A;  1GLQ A;  5C04 A;  2B7K A;  1SU9 A;  3GKX A;  3U5R E;  2C3Q A;  4RQX A;  5A4U A;  3HZ8 A;  3VWW A;  2PMT A;  3IXR A;  4MZW A;  1F2E A;  4ZL8 A;  3VI5 A;  6GSW A;  2EIO A;  4I2T A;  4ECC A;  3TJK A;  2H01 A;  1ERT A;  5G31 A;  2RM5 A;  3Q6O A;  1DE1 A;  3WT2 A;  1ERV A;  1SEN A;  5CO3 A;  2JZR A;  4PNG A;  4GXZ A;  1AW9 A;  1RQM A;  2CT6 A;  3UVT A;  2H19 A;  1A2L A;  1UA5 A;  4G0L A;  4POK A;  2RLI A;  1MTC A;  5HFK A;  3F4R A;  1TRS A;  4J57 E;  3IHQ A;  4KCE A;  2FWF A;  3RDW A;  2MBT A;  5HFG A;  2B5E A;  2HFD A;  2I81 A;  2PN8 A;  2LQQ A;  4BWQ A;  3FEU A;  1T8E B;  4HZ2 A;  2KP2 A;  1K0D A;  4TXO B;  4MP4 A;  2WB9 A;  2H1B A;  3KMN A;  4F03 A;  3QPM A;  2GGT A;  2H70 A;  2VD1 A;  2GZY A;  2GT5 A;  3ZZX A;  2OE1 A;  4ML6 A;  1THO A;  4MH2 A;  22GS A;  5D73 A;  3ZRD A;  4N0Z A;  2DLX A;  2IL3 A;  3UOM A;  5IQY A;  5JWR B;  1AQX A;  3F63 A;  2VCW A;  4AJ6 A;  2LUS A;  5IMZ A;  4TR0 A;  4G9H A;  3IDV A;  4WEY A;  5AIX A;  2LNT A;  3ZLP A;  3CXG A;  3QCP A;  1MEK A;  4OFM A;  5LNK e;  4ECJ A;  1XWA A;  2R3X A;  1PGT A;  1V98 A;  1XZO A;  1OYJ A;  4GSN A;  2IMF A;  2B3S A;  3ZYW A;  1GSU A;  3ERF A;  3GFK A;  1NSW A;  1UVZ A;  2C8U A;  1B4Q A;  3L9U A;  1OE8 A;  2HI7 A;  4H86 A;  1Y6E A;  3TCO A;  1M0U A;  3TKP A;  3TRQ A;  4USS A;  4EL1 A;  4LL1 B;  1WWJ A;  2C4J A;  3IK7 A;  3PPU A;  4KSO A;  3I43 A;  5CAX A;  4E8H A;  2AYT A;  3K8N A;  1HYU A;  3ZIV A;  4OD7 A;  2AUV A;  1YZX A;  1J0F A;  3GHA A;  4RQR A;  3ZML A;  1ON4 A;  1VGL A;  2DJ1 A;  3TJF A;  1PL1 A;  3UMA A;  3LFL A;  5JCG A;  5EPF A;  4XS4 B;  1X9M B;  4TR3 A;  3P90 A;  4PUR A;  2IPA A;  2PWJ A;  4N11 A;  3KGK A;  3N9J A;  2HSM B;  1T4Y A;  3IBH A;  1VF2 A;  1TK0 B;  5D93 A;  3GH9 A;  3KZQ A;  3ZTL A;  5DCG A;  4V2L A;  2KHP A;  3QMX A;  1E6B A;  1SK1 A;  3CRT A;  4Q5Q A;  2CVB A;  4MF6 A;  1EP7 A;  3UL3 A;  2C80 A;  2UZ8 A;  2PGT A;  4ZBA A;  3ED3 A;  2DJ2 A;  3HVV A;  2R6K A;  4RI6 A;  1XWB A;  1ZL9 A;  2O7K A;  3KIJ A;  1M9B A;  4YH2 A;  2IFQ A;  4OMV A;  3BJ5 A;  4JZQ A;  3LYK A;  5EVO A;  1SYR A;  5DAL A;  6GSX A;  2R4V A;  1TRU A;  1YF0 A;  4KDX A;  2CVK A;  3R2Q A;  3FK8 A;  3FRC A;  4ZIJ A;  1XWK A;  4HOJ A;  4IVF A;  1EOG A;  1O8W A;  4MAB A;  2LS5 A;  4KAE A;  2ZUP A;  4WXT A;  1T3B A;  5ECH B;  1V58 A;  4XIH A;  4PQI A;  1X5C A;  2L6D A;  2YPM A;  3IV4 A;  3SBC A;  4YQM A;  4QL7 A;  2V1M A;  1DBY A;  5F0G A;  2OAC A;  1M7T A;  3ZIJ A;  2C1Y A;  2H75 A;  1S3D A;  1OAZ A;  1SD8 A;  3RBT A;  1XVQ A;  3KMO A;  1S3C A;  2NDO A;  4K6X A;  2FA4 A;  1GUM A;  5ECN B;  5DJL A;  4OO4 A;  4DEJ A;  2LRT A;  2L59 A;  2K18 A;  3LSZ A;  1Q98 A;  4GQF A;  1MDI A;  4NV5 A;  3GX8 A;  4CW9 A;  1O7U A;  3TJJ A;  4GWR A;  1JHB A;  1HNA A;  2FA8 A;  1T1V A;  4IHU A;  2CVD A;  5HR2 A;  3F8U A;  4MF5 A;  1XW9 A;  2VCX A;  4Z7X A;  2F8A A;  2YWO A;  2E7P A;  2WDU A;  5G1L A;  16GS A;  3O6T A;  3KTL A;  1R5P A;  2LQO A;  4X1U A;  4YAV A;  4ZXG A;  1HNC A;  4LLR A;  1X0R A;  1E2Y A;  4O5R A;  5KN1 A;  3FZ9 A;  6GSS A;  3GNJ A;  2B6M A;  4N30 A;  4EUY A;  2FLS A;  2CX4 A;  2QGV A;  4J56 E;  3HVS A;  2MMN A;  2HNL A;  2CZ3 A;  5D9X A;  5H5S A;  5J3R A;  2PER A;  2MYG A;  4JRR A;  2AAW A;  4G10 A;  4YQV A;  3F9U A;  3CYN A;  4BVX B;  1OC9 B;  3D22 A;  4WKW A;  3G7J A;  3TKS A;  4KND A;  3G7Y A;  3A2V A;  1NM3 A;  5GAP D;  4KDY A;  1GUK A;  5KEJ A;  2VL3 A;  2IFQ B;  2VM2 A;  4F0B A;  4K1F A;  3C1R A;  3ZMK A;  4MMM A;  4ULX A;  1FB0 A;  4HZ4 A;  1VRS D;  3BCI A;  1GUL A;  2GLR A;  4IGJ A;  1I9D A;  1JFU A;  1ZZY A;  2TIR A;  4PQ1 A;  4ECB A;  2CQ9 A;  3F3Q A;  2HZE B;  1LJR A;  2JAD A;  4OO5 A;  4N0V A;  2YAN A;  3LEF A;  4KX4 A;  1YEX A;  3VPT A;  2B5X A;  5CRW A;  1XBS A;  2X8H A;  4PX1 A;  1O73 A;  3I69 A;  2H72 A;  2V6O A;  3ME8 A;  1TRV A;  2GZP A;  4E8E A;  1W89 A;  1IYH A;  2GSQ A;  2RUF A;  5DQS A;  2VD0 A;  4K7N A;  1EV4 A;  1B4P A;  1JZO A;  2N5B A;  1WMJ A;  1A2M A;  3E9J B;  2NVL A;  3UJ1 A;  3HJO A;  1YF1 A;  3LYP A;  5LD0 A;  4N10 A;  2O8V B;  3L9V A;  1Z3E A;  2E0Q A;  3F3R A;  3TKR A;  3PH9 A;  1Z7R A;  1GSE A;  2F8F A;  2A2R A;  2LRN A;  1PMT A;  1PQN A;  1QFN A;  1GSS A;  2A2S A;  3P8W A;  2J9H A;  2B1K A;  3EE2 A;  2NBS A;  2H71 A;  4KSM A;  1AQW A;  3I6A A;  1NHO A;  1GTA A;  3CSI A;  3GIX A;  4IQA A;  1PX6 A;  4K0G A;  3KJY A;  3LQ7 A;  1MDJ A;  1M2B A;  1TKD B;  2LV3 A;  1BG5 A;  3IR4 A;  2MMA A;  2X8G A;  3PIN A;  1HNB A;  3ZIT A;  1PX7 A;  3IPZ A;  3AY8 A;  3Q19 A;  3GKK A;  5FWG A;  3C7M A;  3CMI A;  2O89 A;  2YN1 A;  1THX A;  1ZYQ B;  2V41 A;  1K3L A;  4JBB A;  3TOT A;  3VI7 A;  5ECQ B;  4DSQ A;  4ILF A;  1XW5 A;  5IMD A;  5G5F A;  1F37 A;  1SJ6 A;  2K9F A;  5F8B A;  4O92 A;  3GUS A;  4LL4 B;  2CA8 A;  10GS A;  1WE0 A;  1H4O A;  3IRA A;  4MK3 A;  4MH3 A;  3WYW A;  1EEM A;  2H66 A;  1XOA A;  3GSS A;  3L4N A;  3HKR A;  3EU4 A;  5IPH A;  4CDO A;  3LXZ A;  5EL8 A;  2YNX A;  1JLW A;  4X0X A;  3QD9 A;  4I97 A;  4EDZ A;  2GTU A;  1ERW A;  1QK8 A;  2HRF A;  2VIM A;  1SJZ A;  3V1W A;  2O85 A;  1J08 A;  1FG4 A;  1AAZ A;  5JCU A;  3IC4 A;  5IPG A;  3ZFL A;  1EZK A;  1BED A;  3US3 A;  4LA1 A;  3MAK A;  1X9W B;  3KM6 A;  4TOP A;  2P31 A;  3UVH A;  2H0H A;  1YQ1 A;  2M46 A;  3U6V A;  3TJG A;  2GZZ A;  2WZ9 A;  2PPT A;  2VL2 C;  5GZZ B;  4Q5R A;  5B6N A;  3KTB A;  1Z7P A;  1TI3 A;  1M2A A;  1ABA A;  2C3T A;  5A4V A;  5A4W A;  1SL2 B;  1WJK A;  1JZD A;  1XIY A;  3H4K A;  5H5Q A;  2I3Y A;  3UIW A;  4XS1 A;  3TRX A;  2OBK A;  2KOK A;  1EP8 A;  3Q74 A;  2VUP A;  2ON5 A;  1R4W A;  2MBS A;  4BL7 A;  1BJX A;  4WR4 A;  1A8L A;  20GS A;  4PQH A;  1K3Y A;  1U6T A;  4TN8 A;  4JU5 A;  2GT6 A;  4TW5 A;  1YKC A;  3LOR A;  3FR3 A;  2DJJ A;  3WGE A;  4FYC A;  2EIQ A;  2B1L A;  2DJ3 A;  1FB6 A;  2VL9 A;  1WRY A;  1QUW A;  5IO2 A;  4QL9 A;  3CSH A;  1ERU A;  1DSB A;  2HLS A;  4IW9 A;  2WRT A;  3F0I A;  1G0T A;  4WBR D;  5CRH A;  4XTS A;  1O8X A;  2LEG A;  2H73 A;  2K6V A;  4PGT A;  4GF0 A;  1GWC A;  4GST A;  4OFT A;  2R5G A;  5G2Z A;  5G5E A;  5D96 A;  5COH A;  2H6X A;  1M99 A;  3ME7 A;  1OKT A;  3IOS A;  2WFC A;  4POB A;  4V2N A;  1EGO A;  1C72 A;  3TKQ A;  2LRC A;  4DVC A;  2HYX A;  5D8I A;  1A23 A;  3FZ4 A;  2C0D A;  5KN3 A;  2H6Y A;  2MMZ A;  3GRX A;  3R3E A;  2F51 A;  1G6W A;  2R37 A;  4IEL A;  2REM A;  4L8E A;  1GSY A;  3BCK A;  2RM6 A;  3VUR A;  3F6F A;  3HDC A;  5IOX A;  2VLT A;  1I5G A;  4K7I A;  1T7P B;  2ON7 A;  3W8J A;  5DDL A;  2FWH A;  3NIV A;  1FVK A;  4ZB9 A;  1AXD A;  1F3B A;  1PD2 1;  2ZNM A;  1SL0 B;  4WF5 A;  2YJ7 A;  4WET A;  14GS A;  2ZCT A;  2G0F A;  5ECP B;  2GSS A;  3TOU A;  1TK8 B;  1A24 A;  3EU3 A;  3KXO A;  4AJ8 A;  4XRA A;  3EVI A;  4YQU A;  17GS A;  4LMV A;  5GST A;  1ZYE A;  4XHM A;  2GST A;  4G0I A;  3GTU A;  2DBC A;  1TW9 A;  4ACS A;  3OR5 A;  4K7O A;  2EC4 A;  2J23 A;  1X5D A;  1U3I A;  4QQ7 A;  4KF9 A;  4IP1 A;  2HXK A;  1U3A A;  4ZL9 A;  1KTE A;  2IJY A;  4GRF A;  1GLP A;  2YV9 A;  1LBK A;  1VF3 A;  2BJX A;  5IIZ A;  4GSS A;  4ZIL A;  2TRX A;  4K9Z A;  1JZR A;  5ID2 A;  2GQM A;  1OC3 A;  2HZF A;  1ZCP A;  4HJM A;  4MDC A;  1PSQ A;  3BBY A;  3F4S A;  4POM A;  5JWO B;  1GSQ A;  1O81 A;  3DVX A;  5A5K A;  4KE3 A;  3D4T A;  3DGQ A;  3A2X A;  2P5R A;  3SWL A;  5DQY A;  5ECI B;  4K2D A;  4KCA A;  1GTB A;  1GL8 A;  5DBQ A;  3EC3 A;  2ALB A;  4PUF C;  4OCE A;  2HQT A;  4PTS A;  1X9S B;  1VF1 A;  4G0K A;  1K0M A;  2GVP A;  1UN2 A;  4P3Y B;  5CRD A;  1GNE A;  4IKH A;  2MZC A;  1R26 A;  3VPQ A;  4EVM A;  1GSD A;  1MDK A;  5G30 A;  3GST A;  4XCS A;  1H75 A;  3DML A;  3DYR A;  8GSS A;  3M1G A;  4IJ3 A;  2V32 A;  5HR0 A;  2I9H A;  1XOB A;  3UEM A;  3L0H A;  4BWS A;  1GH2 A;  3QFB C;  3GX0 A;  3QOU A;  3EWL A;  3M9K A;  2N5A A;  3QAV A;  2VL2 A;  3WT1 A;  3CRU A;  4TVE A;  5CP1 A;  5IMV A;  2YWN A;  4ZB8 A;  2H30 A;  4IS0 A;  4ID0 A;  2OE3 A;  1SK0 A;  2P0G A;  4MJC A;  2H0G A;  3WD6 A;  4K0N A;  1YEP A;  5CRE A;  3ZL5 A;  2AHE A;  1CQH A;  4F2I A;  3LJR A;  1FO5 A;  2H8L A;  2K8S A;  1OVN A;  1NHY A;  1USB A;  1SYX A;  3CTF A;  3HXS A;  5CRG A;  1KNG A;  4HQS A;  1EOH A;  3C71 A;  4MZB A;  3ERW A;  4ZBD A;  3IAS 2;  5ENU A;  4MLY A;  4D73 A;  3HYP A;  6GSY A;  1BX9 A;  1YY7 A;  3ERG A;  5ID2 B;  5FT3 A;  2IMK A;  1RW1 A;  5ELA A;  1T4Z A;  5DAL B;  4HU9 A;  4KA0 A;  2D2Z A;  3FY7 A;  5B8B A;  1KBN A;  2VM1 A;  3HVX A;  3DXB A;  4MPF A;  2LJA A;  2M80 A;  2YWI A;  3HA9 A;  5H5R A;  3IAM 2;  4TR1 A;  5KN0 A;  3KH7 A;  3RPN A;  1X5E A;  5B6M A;  2NPB A;  1B48 A;  3W6G A;  2AJQ B;  1A8Y A;  1SKS B;  1XXU A;  4BVY A;  3KCM A;  2AV4 A;  4I5Q A;  2IWT A;  4X43 A;  3DWV A;  1XWG A;  2JZT A;  4HQZ A;  2TRC P;  2RUE A;  4FH8 A;  2X8C A;  3EIN A;  4ZB6 A;  2JU5 A;  3H79 A;  3FKF A;  3QAG A;  1F3A A;  3NOF A;  5D9W A;  4L0W A;  3VWV A;  2PU9 C;  1K0N A;  3GL5 A;  2QKE A;  2HSH A;  3TGZ A;  2O87 A;  2CZ2 A;  2H74 A;  5IO0 A;  3GN3 A;  3HD5 A;  5ECR B;  3F4T A;  2FNO A;  4KH7 A;  2VOC A;  4MJA A;  7GSS A;  3D5J A;  2BTO T;  3O76 A;  5E4W A;  9GSS A;  2FHE A;  3VWX A;  2KP1 A;  3DKS A;  4EE0 A;  12GS A;  1TOF A;  1Z5Y E;  4MF7 A;  5EY6 A;  5IMF A;  4I6X A;  1Z9H A;  4L5O A;  2VCQ A;  4NMU A;  1MD4 A;  2OBI A;  2JSY A;  4GQC A;  2ES7 A;  2FWG A;  1LU4 A;  2OJL A;  1AC1 A;  3VLN A;  1PL2 A;  2I1U A;  2WCI A;  3UAR A;  1QGV A;  3M8N A;  1IYI A;  4WBJ A;  1WP0 A;  4NPB A;  2H1G A;  4TXO A;  3EMP A;  2X99 A;  1HD2 A;  1OC8 A;  1OKD A;  4EDY A;  5FHI A;  1EV9 A;  3ZFB A;  1NW2 A;  2BMX A;  2FGX A;  4Q5F A;  3DD3 A;  3L9S A;  1A0F A;  5INY A;  3GKN A;  1FAA A;  3L78 A;  5GSS A;  3KP9 A;  2CAQ A;  2JL4 A;  2M72 A;  3GUR A;  4TKY A;  3J7Y b;  2L5L A;  3G7I A;  2H76 A;  3FYG A;  4FIW A;  2LJK A;  2QC7 A;  1GSF A;  2LTK A;  5L71 A;  4JED A;  5DJM A;  3MWH A;  5ECM B;  1FVJ A;  1GTU A;  1DE2 A;  4PNF A;  4BVY B;  1QXH A;  2L6C A;  1URM A;  3TDG A;  2AB6 A;  2NTO A;  4PXO A;  4EC0 A;  3H93 A;  2LJR A;  3PR8 A;  2DIY A;  3PGT A;  1SKW B;  1TTZ A;  2VLV A;  4DSR A;  2B5Y A;  3TRP A;  1ML6 A;  3FZA A;  5HR1 A;  1AIU A;  2YP6 A;  4IJI A;  1GRX A;  1A0R P;  2GDR A;  4Q5N A;  2XBQ A;  4BA7 A;  4EF0 A;  1SK2 A;  1DUG A;  5D9V A;  5DVB A;  3E3E A;  4EXJ A;  2JZS A;  2PBJ A;  11GS A;  1EGR A;  1GUH A;  2L4C A;  4XS4 A;  2YV7 A;  4MJB A;  3A5W A;  3HJM A;  2HSM A;  5F05 A;  1CQG A;  3CSJ A;  4HDE A;  1F6M C;  1T00 A;  1ST9 A;  2K8V A;  1SKR B;  3GA4 A;  4RUV A;  2VO4 A;  2OAD A;  1V40 A;  2XHF A;  1GP1 A;  4GLT A;  3TKS C;  2YZH A;  2L4Q A;  3P7X A;  4FYU A;  2VCZ A;  1U87 A;  3O3T A;  2DMM A;  1GNW A;  4KW6 A;  4MJE A;  1S3A A;  2XPD A;  3KD0 A;  1WOU A;  4JR4 A;  2QSI A;  1TJD A;  5CYY A;  3QR6 A;  3ZVJ D;  4TRX A;  1N2A A;  5J4U A;  1G6Y A;  3UAP A;  2FCH A;  3FR9 A;  4NHW A;  3D21 A;  2YZU A;  6GSU A;  1Z6M A;  4L5L A;  4GTU A;  4FO5 A;  4DSS A;  5B7C A;  4IBP A;  3ISO A;  2EIR A;  1GTI A;  5ECS A;  3EUR A;  4ZL7 A;  3CBU A;  3GL3 A;  4ECI A;  4V1A p;  2YWM A;  4NAX A;  5ECK B;  5GAN D;  1B8X A;  3CTG A;  4WR5 A;  2HSN B;  3MNG A;  1OE7 A;  2HRA A;  5ABR A;  3QFA C;  3VK9 A;  4JE1 A;  4MPG A;  5IMA A;  2LKU A;  4FQU A;  1Y25 A;  4NWY A;  5IMC A;  1BQ7 A;  4F0C A;  3HHV A;  2KUC A;  5D9T A;  3W8S A; 
#chains in the Genus database with same CATH topology
 2DSA A;  2JAC A;  2WVX B;  2C3N A;  2VCV A;  1XW6 A;  4IP6 A;  3ZRE A;  3J7Y k;  4IQ1 A;  3IA1 A;  4EO3 A;  1K0B A;  2G2Q A;  4YKF A;  1JZW A;  1G7O A;  4I8B A;  5B8A A;  4OWY A;  1Y1U A;  1TRW A;  4KGI A;  4KB3 A;  2CV4 A;  2H0I A;  1XG8 A;  4J2F A;  3TJB A;  4AGS A;  3A2W A;  3EMX A;  4G2E A;  1ZMA A;  4FYB A;  1PN9 A;  3N5O A;  4BL7 B;  2DJK A;  3VFI A;  2YCD A;  1J9B A;  2V6K A;  3M9J A;  3TB2 A;  1FHE A;  3LXT A;  1B9X C;  4K8M A;  4O7H A;  2YOI A;  4HI7 A;  1FOV A;  1EEJ A;  1V9W A;  3UBK A;  4F82 A;  2I4A A;  3GKM A;  4BVX A;  1OC9 A;  2L5O A;  2A2P A;  4KDU A;  1PA3 A;  3C8E A;  4NV2 A;  5AIS A;  3HCZ A;  1TDI A;  1A2J A;  4TXV A;  3UBL A;  5ELG A;  3IE3 A;  5IM9 A;  3DVW A;  4WF4 A;  5F07 A;  1AQV A;  2WGR A;  2L57 A;  5KOX A;  5DAK A;  5J9C A;  1M9A A;  2HRK A;  1SL1 B;  1TP9 A;  1TU8 A;  6GST A;  1O6J A;  1QMV A;  2F9S A;  2P5Q A;  3DEX A;  2LST A;  3RHB A;  2XC2 A;  3ZVJ A;  4HS1 A;  2H1A A;  13GS A;  4OFN A;  2HZE A;  4LMW A;  4A5P A;  2H1D A;  4XRD A;  4ISD A;  5AN1 A;  4DSS B;  5HR3 A;  1BAY A;  5BMU A;  1R5A A;  2F3M A;  4F9Z A;  2PVQ A;  4TR4 A;  1PKZ A;  1WPI A;  5A34 A;  3GV1 A;  3D4M A;  4MCU A;  5G1K A;  1YJ6 A;  5JCW A;  1YDK A;  3S9F A;  2DKI A;  1XWC A;  3QDN A;  4MZC A;  4ML1 A;  2C0G A;  1F9M A;  1K0O A;  1M3I A;  1U88 A;  2DC5 A;  1TXX A;  4AKG A;  3LWA A;  4L0U A;  3FW2 A;  1B9Y C;  4V1A g;  4HU7 A;  3RPP A;  2CAI A;  2GSR A;  3IK9 A;  3P2A A;  3HZ4 A;  3QAW A;  3M3M A;  1QQ2 A;  1PFO A;  3KP8 A;  1WIK A;  2FWE A;  2OA7 A;  4W66 A;  3WGD A;  19GS A;  4POL A;  5J41 A;  3D6I A;  1HQO A;  3H8Q A;  2HE3 A;  2XPE A;  1G7E A;  2IME A;  3GTU B;  4HUA A;  2H6Z A;  3C73 A;  3KEB A;  3TKS E;  3D0Z A;  1N8J A;  3F6D A;  3MSZ A;  2OKA A;  2HRN A;  6GSV A;  1KEB A;  2XBI A;  3A3T A;  4ZBB A;  3HMJ G;  1O85 A;  3DIE A;  4EKZ A;  2LNS A;  1TI1 A;  3HJP A;  1V57 A;  4HJ2 A;  4IN0 A;  5HFI A;  5J5N A;  2WS2 A;  2A4H A;  1XCC A;  2E2M A;  5ECL B;  1XFL A;  2OE0 A;  1YKA A;  4JR6 A;  2X4A A;  1SVM A;  5DAK B;  2JSZ A;  1AUC A;  2HRK B;  2PVO C;  1VF4 A;  1ILO A;  2DML A;  3TUE A;  2OT3 A;  5KN2 A;  3RHC A;  2DIZ A;  3WGX A;  5CNW A;  2EFC A;  5IOW A;  4MA9 A;  2IIY A;  1XVW A;  5E59 A;  2GQL A;  3FR6 A;  3GYK A;  3EYT A;  4NHZ A;  1MD3 A;  2PUK C;  4HEA 2;  4N3Z A;  1R7H A;  1PRX A;  3VWU A;  5C00 A;  1K3O A;  2A4V A;  2RII A;  4G01 A;  2E2G A;  1TK5 B;  3RAZ A;  1BYE A;  2GQK A;  2YJH A;  2IMD A;  4BPY A;  4RI7 A;  18GS A;  2X64 A;  5AIV A;  1XPV A;  3MIX A;  2C0E A;  2WUL A;  3BOA A;  5HQP A;  2C0F A;  4GCI A;  3G9B A;  3APS A;  3IHG A;  1Q4J A;  1I1I P;  3APQ A;  3DRN A;  3GMF A;  5JWQ B;  4YAP A;  3Q18 A;  2VAF A;  2WJU A;  5F06 A;  3BD2 A;  2N5F A;  1V2A A;  4CHS A;  1FW1 A;  3CQF A;  5ECO B;  2FUG 2;  1ACV A;  3KH9 A;  4O32 A;  2CX3 A;  5J4Y A;  2FY6 A;  2GS3 A;  2KLX A;  2FD3 A;  2Z9S A;  3GH6 A;  1K0A A;  2HSY A;  3FZ5 A;  4XS6 A;  3HY2 A;  2V2G A;  4I2U A;  3FHK A;  4PUA A;  3H1N A;  3C1S A;  2MMO A;  1W4V A;  1UC7 A;  5AGY A;  1Z6N A;  5A1N A;  1JLV A;  4D73 B;  3I9V 2;  1ZGN A;  2B7J A;  1PKW A;  2DJ0 A;  4KUN A;  2VCT A;  2R2J A;  1SJI A;  2O5V A;  4V2M A;  3M0F A;  3E0U A;  1EWX A;  2IMI A;  1RK4 A;  1ZOF A;  2VLU A;  4NXI A;  3MDK A;  2HT9 A;  1M2D A;  3APO A;  3NZN A;  5LCZ A;  1SD9 A;  3IC8 A;  4AF2 A;  1K0C A;  4OCF A;  3JCM L;  5J9B A;  2IN3 A;  3LG6 A;  4TR1 B;  4EIP A;  3LGC A;  5DCH A;  1TU7 A;  4G19 A;  4AJ7 A;  1GLQ A;  5C04 A;  2B7K A;  3CWG A;  1SU9 A;  3GKX A;  3U5R E;  5A5H B;  2C3Q A;  4RQX A;  5A4U A;  3HZ8 A;  3VWW A;  2PMT A;  3IXR A;  4MZW A;  1F2E A;  4ZL8 A;  3VI5 A;  6GSW A;  2EIO A;  4I2T A;  4ECC A;  3TJK A;  2H01 A;  1ERT A;  5G31 A;  4HSC X;  2RM5 A;  3Q6O A;  1DE1 A;  3WT2 A;  1ERV A;  1SEN A;  5CO3 A;  2JZR A;  4PNG A;  4GXZ A;  1AW9 A;  1RQM A;  2CT6 A;  3UVT A;  2H19 A;  1A2L A;  1UA5 A;  4G0L A;  4POK A;  2RLI A;  1MTC A;  5HFK A;  3F4R A;  1TRS A;  4J57 E;  3IHQ A;  4KCE A;  2FWF A;  3RDW A;  2MBT A;  5HFG A;  2B5E A;  2HFD A;  2I81 A;  2PN8 A;  2LQQ A;  4BWQ A;  3FEU A;  1T8E B;  4HZ2 A;  2KP2 A;  1K0D A;  3A5I A;  4TXO B;  4MP4 A;  2WB9 A;  2H1B A;  3KMN A;  4F03 A;  3QPM A;  2GGT A;  2H70 A;  2VD1 A;  2GZY A;  2GT5 A;  4K5R A;  3ZZX A;  2OE1 A;  4ML6 A;  1THO A;  3CHX C;  4MH2 A;  22GS A;  5D73 A;  3ZRD A;  4N0Z A;  2DLX A;  2IL3 A;  3UOM A;  5IQY A;  5JWR B;  1AQX A;  3F63 A;  2VCW A;  4AJ6 A;  2LUS A;  5IMZ A;  4TR0 A;  4G9H A;  3IDV A;  4WEY A;  5AIX A;  2LNT A;  3ZLP A;  3CXG A;  3QCP A;  1MEK A;  2O36 A;  4OFM A;  5LNK e;  4ECJ A;  1XWA A;  2R3X A;  1PGT A;  1V98 A;  1XZO A;  1OYJ A;  4GSN A;  2IMF A;  2B3S A;  3ZYW A;  1GSU A;  3ERF A;  3GFK A;  1NSW A;  1UVZ A;  2C8U A;  1B4Q A;  3L9U A;  1OE8 A;  2HI7 A;  4H86 A;  1Y6E A;  3TCO A;  1M0U A;  3TKP A;  3TRQ A;  4USS A;  4EL1 A;  4LL1 B;  1WWJ A;  2C4J A;  3IK7 A;  3PPU A;  4KSO A;  1PN0 A;  3I43 A;  5CAX A;  4E8H A;  2AYT A;  3K8N A;  4Z2R A;  1HYU A;  3ZIV A;  4OD7 A;  2AUV A;  1YZX A;  1J0F A;  3GHA A;  4QMK A;  4RQR A;  3ZML A;  1ON4 A;  2EFE A;  1VGL A;  2DJ1 A;  3TJF A;  1PL1 A;  3UMA A;  2R0C A;  3LFL A;  5JCG A;  5EPF A;  4XS4 B;  1X9M B;  4TR3 A;  3P90 A;  4PUR A;  2IPA A;  5J4V A;  2PWJ A;  4N11 A;  3KGK A;  3N9J A;  2HSM B;  1T4Y A;  3IBH A;  1VF2 A;  1TK0 B;  5D93 A;  3GH9 A;  3KZQ A;  3ZTL A;  5DCG A;  4V2L A;  2KHP A;  3QMX A;  1E6B A;  1SK1 A;  3CRT A;  4Q5Q A;  2CVB A;  4MF6 A;  1EP7 A;  3UL3 A;  2C80 A;  1N25 A;  2UZ8 A;  2PGT A;  4ZBA A;  4Z2T A;  3ED3 A;  2DJ2 A;  3HVV A;  2R6K A;  4RI6 A;  1XWB A;  1ZL9 A;  2O7K A;  3KIJ A;  1M9B A;  4YH2 A;  2IFQ A;  4OMV A;  3BJ5 A;  4JZQ A;  3LYK A;  5EVO A;  1SYR A;  5DAL A;  6GSX A;  2R4V A;  1TRU A;  1YF0 A;  4KDX A;  2CVK A;  3R2Q A;  3FK8 A;  3FRC A;  4ZIJ A;  1XWK A;  4HOJ A;  4IVF A;  1EOG A;  1O8W A;  4MAB A;  2LS5 A;  4KAE A;  2ZUP A;  4WXT A;  1T3B A;  5ECH B;  1V58 A;  4XIH A;  4PQI A;  1X5C A;  2L6D A;  2YPM A;  3IV4 A;  4PI0 C;  3SBC A;  4YQM A;  4QL7 A;  2V1M A;  1DBY A;  5F0G A;  2OAC A;  1M7T A;  3ZIJ A;  2C1Y A;  4PI2 C;  2H75 A;  1S3D A;  1OAZ A;  1SD8 A;  3RBT A;  1XVQ A;  3KMO A;  1S3C A;  2NDO A;  4CY8 A;  4K6X A;  2FA4 A;  1GUM A;  5ECN B;  5DJL A;  4OO4 A;  4DEJ A;  2LRT A;  2L59 A;  2K18 A;  3LSZ A;  1Q98 A;  4GQF A;  1MDI A;  2X49 A;  4NV5 A;  3GX8 A;  4CW9 A;  1O7U A;  3TJJ A;  4GWR A;  1JHB A;  1HNA A;  2FA8 A;  1T1V A;  4IHU A;  2CVD A;  5HR2 A;  3F8U A;  4MF5 A;  1BG1 A;  1XW9 A;  2VCX A;  4Z7X A;  2F8A A;  1ZYN A;  2YWO A;  3EPT A;  2E7P A;  2WDU A;  2WW0 A;  5G1L A;  16GS A;  3O6T A;  2WVZ A;  3KTL A;  1R5P A;  2LQO A;  4X1U A;  4YAV A;  4ZXG A;  1HNC A;  4LLR A;  1X0R A;  1E2Y A;  4O5R A;  5KN1 A;  3FZ9 A;  6GSS A;  3GNJ A;  2B6M A;  4AKX B;  2WW3 A;  4N30 A;  4EUY A;  2FLS A;  2CX4 A;  4Z2U A;  4O5U A;  2QGV A;  4J56 E;  3HVS A;  2MMN A;  2HNL A;  2CZ3 A;  5D9X A;  5H5S A;  5J3R A;  2PER A;  2MYG A;  4JRR A;  2AAW A;  4G10 A;  4YQV A;  3F9U A;  3CYN A;  4BVX B;  1OC9 B;  3D22 A;  4WKW A;  3G7J A;  3TKS A;  4KND A;  3G7Y A;  3A2V A;  1NM3 A;  5GAP D;  4KDY A;  1GUK A;  5KEJ A;  2VL3 A;  2IFQ B;  2VM2 A;  4F0B A;  4K1F A;  3C1R A;  3ZMK A;  4MMM A;  4PHZ C;  4ULX A;  2WVY A;  1FB0 A;  4HZ4 A;  1VRS D;  3BCI A;  1GUL A;  2GLR A;  4IGJ A;  1I9D A;  1JFU A;  1ZZY A;  2TIR A;  4PQ1 A;  4ECB A;  2CQ9 A;  3F3Q A;  2HZE B;  1LJR A;  2JAD A;  4OO5 A;  4N0V A;  5BMU B;  2YAN A;  3LEF A;  4KX4 A;  1YEX A;  3VPT A;  2B5X A;  5CRW A;  1XBS A;  2X8H A;  4PX1 A;  1O73 A;  3I69 A;  3MYD A;  5A34 B;  2H72 A;  2V6O A;  2QA1 A;  1TRV A;  3ME8 A;  2GZP A;  4E8E A;  1W89 A;  1IYH A;  2GSQ A;  2RUF A;  5DQS A;  5J47 A;  2VD0 A;  4K7N A;  1EV4 A;  1B4P A;  2WZS A;  1JZO A;  4AI6 A;  2N5B A;  1WMJ A;  1A2M A;  3E9J B;  2NVL A;  3UJ1 A;  4EIQ A;  3HJO A;  2O3E A;  1YF1 A;  3LYP A;  5LD0 A;  4N10 A;  2O8V B;  3L9V A;  1Z3E A;  2E0Q A;  3F3R A;  3TKR A;  3PH9 A;  1Z7R A;  1GSE A;  2F8F A;  2A2R A;  2LRN A;  3TU3 B;  1PMT A;  1PQN A;  1QFN A;  1GSS A;  2A2S A;  3P8W A;  2J9H A;  2B1K A;  3EE2 A;  2NBS A;  2H71 A;  4KSM A;  1AQW A;  3I6A A;  1NHO A;  1GTA A;  3CSI A;  3GIX A;  4IQA A;  1PX6 A;  4K0G A;  3KJY A;  3LQ7 A;  1MDJ A;  1M2B A;  1TKD B;  5J40 A;  2LV3 A;  1BG5 A;  3IR4 A;  2MMA A;  2X8G A;  3PIN A;  1HNB A;  3ZIT A;  1PX7 A;  3IPZ A;  3AY8 A;  4YKG A;  3Q19 A;  3GKK A;  5FWG A;  3C7M A;  3CMI A;  2O89 A;  2YN1 A;  1THX A;  1ZYQ B;  2V41 A;  1K3L A;  4JBB A;  4AKH A;  3TOT A;  3VI7 A;  5ECQ B;  4DSQ A;  4ILF A;  1XW5 A;  5IMD A;  5G5F A;  1F37 A;  1SJ6 A;  2K9F A;  5F8B A;  4O92 A;  3GUS A;  4LL4 B;  2CA8 A;  10GS A;  1WE0 A;  1H4O A;  3IRA A;  4MK3 A;  4MH3 A;  3WYW A;  1EEM A;  2H66 A;  1XOA A;  3GSS A;  3L4N A;  3HKR A;  3EU4 A;  5IPH A;  4CDO A;  3LXZ A;  5EL8 A;  2YNX A;  4CY6 A;  1JLW A;  4X0X A;  3QD9 A;  4I97 A;  3RFR C;  4EDZ A;  2GTU A;  1ERW A;  1QK8 A;  2HRF A;  2VIM A;  1SJZ A;  3V1W A;  2O85 A;  1J08 A;  1FG4 A;  2HSN A;  1AAZ A;  5JCU A;  3IC4 A;  4ICY A;  5IPG A;  3ZFL A;  1EZK A;  1BED A;  3US3 A;  4LA1 A;  3MAK A;  1X9W B;  3KM6 A;  4TOP A;  2P31 A;  3UVH A;  2H0H A;  1YQ1 A;  2M46 A;  3U6V A;  3TJG A;  2GZZ A;  2WZ9 A;  1ZYP A;  2PPT A;  2VL2 C;  5GZZ B;  2WVX A;  4Q5R A;  1YVL A;  5B6N A;  3KTB A;  1Z7P A;  1TI3 A;  1M2A A;  1ABA A;  2C3T A;  5A4V A;  5A4W A;  1SL2 B;  1WJK A;  1JZD A;  4GDF A;  1XIY A;  3H4K A;  5H5Q A;  2I3Y A;  3UIW A;  4XS1 A;  3TRX A;  2OBK A;  2KOK A;  1EP8 A;  3Q74 A;  2VUP A;  2DKH A;  2ON5 A;  1R4W A;  2MBS A;  4BL7 A;  1BJX A;  4WR4 A;  1A8L A;  20GS A;  4PQH A;  1K3Y A;  1U6T A;  4TN8 A;  4JU5 A;  2GT6 A;  5BRT A;  4TW5 A;  1YKC A;  3LOR A;  3FR3 A;  2DJJ A;  3WGE A;  1S4B P;  4FYC A;  2EIQ A;  2B1L A;  2DJ3 A;  1FB6 A;  2VL9 A;  1WRY A;  1QUW A;  5IO2 A;  4QL9 A;  3CSH A;  5A1N B;  1ERU A;  1DSB A;  2HLS A;  4IW9 A;  2WRT A;  3F0I A;  1G0T A;  4WBR D;  5CRH A;  4XTS A;  1O8X A;  2LEG A;  2H73 A;  2K6V A;  4PGT A;  4GF0 A;  1GWC A;  4GST A;  4OFT A;  2R5G A;  5G2Z A;  5G5E A;  5D96 A;  5COH A;  5KOW A;  2H6X A;  1M99 A;  3ME7 A;  1OKT A;  3IOS A;  2WFC A;  4AKI A;  4POB A;  4V2N A;  1EGO A;  1C72 A;  3TKQ A;  2LRC A;  4DVC A;  2HYX A;  5D8I A;  1A23 A;  3FZ4 A;  2C0D A;  5KN3 A;  2H6Y A;  2MMZ A;  3GRX A;  3R3E A;  2F51 A;  1G6W A;  2R37 A;  4IEL A;  2REM A;  4L8E A;  1GSY A;  3BCK A;  2RM6 A;  3VUR A;  3F6F A;  3HDC A;  5IOX A;  2VLT A;  1I5G A;  4K7I A;  1T7P B;  2ON7 A;  3W8J A;  5DDL A;  2FWH A;  3NIV A;  1FVK A;  4ZB9 A;  1AXD A;  1F3B A;  1PD2 1;  2ZNM A;  1SL0 B;  4WF5 A;  2YJ7 A;  4WET A;  14GS A;  2ZCT A;  2G0F A;  5ECP B;  2GSS A;  3TOU A;  1TK8 B;  1A24 A;  3EU3 A;  3KXO A;  4AJ8 A;  4XRA A;  3EVI A;  4YQU A;  17GS A;  4LMV A;  5GST A;  1ZYE A;  4XHM A;  2GST A;  4G0I A;  3GTU A;  2DBC A;  1TW9 A;  4ACS A;  3OR5 A;  4K7O A;  2EC4 A;  2J23 A;  1X5D A;  1U3I A;  4QQ7 A;  4KF9 A;  2HXK A;  4IP1 A;  1U3A A;  4ZB7 A;  4ZL9 A;  1KTE A;  2IJY A;  4GRF A;  1GLP A;  2YV9 A;  1LBK A;  1VF3 A;  2BJX A;  5IIZ A;  4GSS A;  4ZIL A;  2TRX A;  4K9Z A;  1JZR A;  5ID2 A;  2GQM A;  1OC3 A;  2HZF A;  1ZCP A;  4HJM A;  4MDC A;  1PSQ A;  3BBY A;  3F4S A;  4POM A;  5JWO B;  1GSQ A;  1O81 A;  3DVX A;  5A5K A;  4KE3 A;  3D4T A;  3DGQ A;  3A2X A;  2P5R A;  3SWL A;  5DQY A;  5ECI B;  4K2D A;  4KCA A;  1GTB A;  1GL8 A;  5DBQ A;  3EC3 A;  2ALB A;  4PUF C;  4OCE A;  2HQT A;  4PTS A;  1X9S B;  1VF1 A;  4G0K A;  1K0M A;  2GVP A;  1UN2 A;  4P3Y B;  5CRD A;  1GNE A;  4IKH A;  2MZC A;  1R26 A;  3VPQ A;  4EVM A;  1GSD A;  1MDK A;  5G30 A;  3GST A;  4XCS A;  1H75 A;  2EFD A;  3DML A;  3DYR A;  8GSS A;  3M1G A;  1TXU A;  4IJ3 A;  2V32 A;  5HR0 A;  2I9H A;  1XOB A;  3UEM A;  3L0H A;  4BWS A;  1GH2 A;  3QFB C;  3GX0 A;  3QOU A;  3EWL A;  3M9K A;  2N5A A;  3QAV A;  2VL2 A;  3WT1 A;  3CRU A;  4TVE A;  5CP1 A;  5IMV A;  2YWN A;  4ZB8 A;  2H30 A;  4IS0 A;  4ID0 A;  2OE3 A;  1SK0 A;  2P0G A;  4X4J A;  4MJC A;  2H0G A;  3WD6 A;  4K0N A;  1YEP A;  5CRE A;  3ZL5 A;  2AHE A;  1CQH A;  4F2I A;  3LJR A;  1FO5 A;  2H8L A;  2K8S A;  1OVN A;  1NHY A;  1USB A;  1SYX A;  3CTF A;  3HXS A;  5CRG A;  1KNG A;  2WW1 A;  4HQS A;  1EOH A;  3C71 A;  4MZB A;  3ERW A;  4ZBD A;  3IAS 2;  5ENU A;  4MLY A;  4D73 A;  3HYP A;  6GSY A;  1BX9 A;  1YY7 A;  3ERG A;  5ID2 B;  5FT3 A;  2IMK A;  1RW1 A;  5ELA A;  4BIK A;  1T4Z A;  5DAL B;  4HU9 A;  4KA0 A;  2D2Z A;  3FY7 A;  5B8B A;  4K5S A;  1KBN A;  2VM1 A;  3HVX A;  3DXB A;  4MPF A;  3LW9 A;  2LJA A;  2M80 A;  2YWI A;  3HA9 A;  5H5R A;  3IAM 2;  4TR1 A;  5KN0 A;  3KH7 A;  3RPN A;  1X5E A;  5B6M A;  2NPB A;  1B48 A;  3W6G A;  3HVN A;  2H1L A;  2AJQ B;  1A8Y A;  1SKS B;  1XXU A;  5A5H A;  4BVY A;  3KCM A;  2AV4 A;  4I5Q A;  2IWT A;  4X43 A;  3DWV A;  1XWG A;  2JZT A;  4HQZ A;  2TRC P;  2RUE A;  4FH8 A;  2X8C A;  3EIN A;  4ZB6 A;  2JU5 A;  3H79 A;  3FKF A;  3QAG A;  1F3A A;  3NOF A;  5D9W A;  4L0W A;  3VWV A;  2PU9 C;  1K0N A;  3GL5 A;  2QKE A;  2HSH A;  3TGZ A;  2O87 A;  2CZ2 A;  2H74 A;  5IO0 A;  3GN3 A;  3HD5 A;  5ECR B;  3F4T A;  2FNO A;  4KH7 A;  2VOC A;  4MJA A;  7GSS A;  3D5J A;  2BTO T;  3O76 A;  5E4W A;  9GSS A;  2FHE A;  3VWX A;  2KP1 A;  3DKS A;  4EE0 A;  12GS A;  1TOF A;  1Z5Y E;  4MF7 A;  5EY6 A;  5IMF A;  4I6X A;  1Z9H A;  4L5O A;  2VCQ A;  4NMU A;  1MD4 A;  2OBI A;  2WW2 A;  2JSY A;  4GQC A;  2ES7 A;  2FWG A;  1LU4 A;  2OJL A;  1AC1 A;  3VLN A;  4MNN A;  1PL2 A;  2I1U A;  2WCI A;  3UAR A;  1QGV A;  3M8N A;  1IYI A;  4WBJ A;  1WP0 A;  4NPB A;  2H1G A;  4TXO A;  3EMP A;  4K2X A;  2X99 A;  1HD2 A;  1OC8 A;  1OKD A;  4EDY A;  5FHI A;  1EV9 A;  3ZFB A;  1NW2 A;  2BMX A;  2FGX A;  4Q5F A;  3DD3 A;  3L9S A;  1A0F A;  5INY A;  3FMW A;  1SVL A;  3GKN A;  1FAA A;  3L78 A;  5GSS A;  1YEW C;  3KP9 A;  2CAQ A;  2JL4 A;  2M72 A;  3GUR A;  4TKY A;  3J7Y b;  2L5L A;  3G7I A;  2H76 A;  3FYG A;  4FIW A;  2LJK A;  2QC7 A;  1GSF A;  2LTK A;  5L71 A;  4JED A;  5DJM A;  3MWH A;  5ECM B;  1FVJ A;  1GTU A;  1DE2 A;  4PNF A;  4BVY B;  1QXH A;  2L6C A;  1URM A;  3TDG A;  2AB6 A;  2R0G A;  2NTO A;  4PXO A;  4EC0 A;  3H93 A;  2LJR A;  3PR8 A;  2DIY A;  4E68 A;  3PGT A;  1SKW B;  1M3J A;  1TTZ A;  2VLV A;  4DSR A;  2B5Y A;  1SVO A;  3TRP A;  1ML6 A;  1BF5 A;  3FZA A;  5HR1 A;  1AIU A;  2EFH A;  2YP6 A;  4IJI A;  1GRX A;  1A0R P;  2GDR A;  4Q5N A;  2XBQ A;  4BA7 A;  4EF0 A;  1SK2 A;  1DUG A;  5D9V A;  1S3R A;  5DVB A;  3E3E A;  4O5Q A;  4EXJ A;  2JZS A;  2PBJ A;  2VKZ G;  11GS A;  1EGR A;  1GUH A;  2L4C A;  4XS4 A;  2YV7 A;  4MJB A;  3A5W A;  3HJM A;  2HSM A;  5F05 A;  1CQG A;  3CSJ A;  4HDE A;  1F6M C;  1T00 A;  1ST9 A;  2K8V A;  1SKR B;  3GA4 A;  4RUV A;  2VO4 A;  2OAD A;  1V40 A;  2XHF A;  1GP1 A;  4GLT A;  3TKS C;  2YZH A;  2L4Q A;  3P7X A;  4FYU A;  2VCZ A;  1U87 A;  3O3T A;  2DMM A;  1GNW A;  4KW6 A;  4MJE A;  3RGB C;  1S3A A;  4FXY P;  2XPD A;  3KD0 A;  1WOU A;  4JR4 A;  2QSI A;  1TJD A;  5CYY A;  3QR6 A;  3ZVJ D;  4TRX A;  1N2A A;  1FOH A;  5J4U A;  1G6Y A;  3UAP A;  2FCH A;  3FR9 A;  4NHW A;  3D21 A;  2YZU A;  6GSU A;  1Z6M A;  2QA2 A;  4L5L A;  4GTU A;  4FO5 A;  4DSS A;  5B7C A;  4IBP A;  3ISO A;  2EIR A;  1GTI A;  5ECS A;  3EUR A;  4ZL7 A;  3CBU A;  3GL3 A;  4ECI A;  4V1A p;  2YWM A;  2R0P A;  4NAX A;  5ECK B;  5GAN D;  1B8X A;  3CTG A;  4WR5 A;  2HSN B;  3MNG A;  1OE7 A;  2HRA A;  5ABR A;  3QFA C;  3VK9 A;  4JE1 A;  4MPG A;  5IMA A;  2LKU A;  4FQU A;  1Y25 A;  4NWY A;  2UV8 G;  5IMC A;  1BQ7 A;  4F0C A;  3HHV A;  2KUC A;  5D9T A;  3W8S A; 
#chains in the Genus database with same CATH homology
 2DSA A;  2JAC A;  2C3N A;  2VCV A;  1XW6 A;  4IP6 A;  3ZRE A;  3J7Y k;  4IQ1 A;  3IA1 A;  4EO3 A;  1K0B A;  2G2Q A;  4YKF A;  1JZW A;  1G7O A;  4I8B A;  5B8A A;  4OWY A;  1Y1U A;  1TRW A;  4KGI A;  4KB3 A;  2CV4 A;  2H0I A;  3TJB A;  4J2F A;  4AGS A;  3A2W A;  3EMX A;  4G2E A;  1ZMA A;  4FYB A;  1PN9 A;  3N5O A;  4BL7 B;  2DJK A;  3VFI A;  2YCD A;  1J9B A;  2V6K A;  3M9J A;  3TB2 A;  1FHE A;  3LXT A;  1B9X C;  4K8M A;  4O7H A;  2YOI A;  4HI7 A;  1FOV A;  1EEJ A;  1V9W A;  3UBK A;  4F82 A;  2I4A A;  3GKM A;  4BVX A;  1OC9 A;  2L5O A;  2A2P A;  4KDU A;  1PA3 A;  3C8E A;  4NV2 A;  5AIS A;  3HCZ A;  1TDI A;  1A2J A;  4TXV A;  3UBL A;  5ELG A;  3IE3 A;  5IM9 A;  3DVW A;  4WF4 A;  5F07 A;  1AQV A;  2WGR A;  2L57 A;  5KOX A;  5DAK A;  5J9C A;  1M9A A;  2HRK A;  1SL1 B;  1TP9 A;  1TU8 A;  6GST A;  1O6J A;  1QMV A;  2F9S A;  2P5Q A;  3DEX A;  2LST A;  3RHB A;  2XC2 A;  3ZVJ A;  4HS1 A;  2H1A A;  13GS A;  4OFN A;  2HZE A;  4LMW A;  4A5P A;  2H1D A;  4XRD A;  4ISD A;  5AN1 A;  4DSS B;  5HR3 A;  1BAY A;  5BMU A;  1R5A A;  2F3M A;  4F9Z A;  2PVQ A;  4TR4 A;  1PKZ A;  1WPI A;  5A34 A;  3GV1 A;  3D4M A;  4MCU A;  5G1K A;  1YJ6 A;  5JCW A;  1YDK A;  3S9F A;  2DKI A;  1XWC A;  3QDN A;  4MZC A;  4ML1 A;  2C0G A;  1F9M A;  1K0O A;  1U88 A;  2DC5 A;  1TXX A;  4AKG A;  3LWA A;  4L0U A;  3FW2 A;  1B9Y C;  4V1A g;  4HU7 A;  3RPP A;  2CAI A;  2GSR A;  3IK9 A;  3P2A A;  3HZ4 A;  3QAW A;  3M3M A;  1QQ2 A;  3KP8 A;  1WIK A;  2FWE A;  2OA7 A;  4W66 A;  3WGD A;  19GS A;  4POL A;  5J41 A;  3D6I A;  1HQO A;  3H8Q A;  2HE3 A;  2XPE A;  1G7E A;  2IME A;  3GTU B;  4HUA A;  2H6Z A;  3C73 A;  3KEB A;  3TKS E;  3D0Z A;  1N8J A;  3F6D A;  3MSZ A;  2OKA A;  2HRN A;  6GSV A;  1KEB A;  2XBI A;  3A3T A;  4ZBB A;  3HMJ G;  1O85 A;  3DIE A;  4EKZ A;  2LNS A;  1TI1 A;  3HJP A;  1V57 A;  4HJ2 A;  4IN0 A;  5HFI A;  5J5N A;  2WS2 A;  2A4H A;  1XCC A;  2E2M A;  5ECL B;  1XFL A;  2OE0 A;  1YKA A;  4JR6 A;  2X4A A;  1SVM A;  5DAK B;  2JSZ A;  1AUC A;  2HRK B;  2PVO C;  1VF4 A;  1ILO A;  2DML A;  3TUE A;  2OT3 A;  5KN2 A;  3RHC A;  2DIZ A;  3WGX A;  5CNW A;  2EFC A;  5IOW A;  4MA9 A;  2IIY A;  1XVW A;  5E59 A;  2GQL A;  3FR6 A;  3GYK A;  3EYT A;  4NHZ A;  1MD3 A;  2PUK C;  4HEA 2;  4N3Z A;  1R7H A;  1PRX A;  3VWU A;  5C00 A;  1K3O A;  2A4V A;  2RII A;  4G01 A;  2E2G A;  1TK5 B;  3RAZ A;  1BYE A;  2GQK A;  2YJH A;  2IMD A;  4BPY A;  4RI7 A;  18GS A;  2X64 A;  5AIV A;  1XPV A;  3MIX A;  2C0E A;  2WUL A;  3BOA A;  5HQP A;  2C0F A;  4GCI A;  3G9B A;  3APS A;  3IHG A;  1Q4J A;  3APQ A;  3DRN A;  3GMF A;  5JWQ B;  4YAP A;  3Q18 A;  2VAF A;  2WJU A;  5F06 A;  3BD2 A;  2N5F A;  1V2A A;  4CHS A;  1FW1 A;  5ECO B;  2FUG 2;  1ACV A;  3KH9 A;  4O32 A;  2CX3 A;  5J4Y A;  2FY6 A;  2GS3 A;  2KLX A;  2FD3 A;  2Z9S A;  3GH6 A;  1K0A A;  2HSY A;  3FZ5 A;  4XS6 A;  3HY2 A;  2V2G A;  4I2U A;  3FHK A;  4PUA A;  3H1N A;  3C1S A;  2MMO A;  1W4V A;  1UC7 A;  5AGY A;  1Z6N A;  5A1N A;  1JLV A;  4D73 B;  3I9V 2;  1ZGN A;  2B7J A;  1PKW A;  2DJ0 A;  4KUN A;  2VCT A;  2R2J A;  1SJI A;  2O5V A;  4V2M A;  3M0F A;  3E0U A;  1EWX A;  2IMI A;  1RK4 A;  1ZOF A;  2VLU A;  4NXI A;  3MDK A;  2HT9 A;  1M2D A;  3APO A;  3NZN A;  5LCZ A;  1SD9 A;  3IC8 A;  4AF2 A;  1K0C A;  4OCF A;  3JCM L;  5J9B A;  2IN3 A;  3LG6 A;  4TR1 B;  4EIP A;  3LGC A;  5DCH A;  1TU7 A;  4G19 A;  4AJ7 A;  1GLQ A;  5C04 A;  2B7K A;  3CWG A;  1SU9 A;  3GKX A;  3U5R E;  5A5H B;  2C3Q A;  4RQX A;  5A4U A;  3HZ8 A;  3VWW A;  2PMT A;  3IXR A;  4MZW A;  1F2E A;  4ZL8 A;  3VI5 A;  6GSW A;  2EIO A;  4I2T A;  4ECC A;  3TJK A;  2H01 A;  1ERT A;  5G31 A;  2RM5 A;  3Q6O A;  1DE1 A;  3WT2 A;  1ERV A;  1SEN A;  5CO3 A;  2JZR A;  4PNG A;  4GXZ A;  1AW9 A;  1RQM A;  2CT6 A;  3UVT A;  2H19 A;  1A2L A;  1UA5 A;  4G0L A;  4POK A;  2RLI A;  1MTC A;  5HFK A;  3F4R A;  1TRS A;  4J57 E;  3IHQ A;  4KCE A;  2FWF A;  3RDW A;  2MBT A;  5HFG A;  2B5E A;  2HFD A;  2I81 A;  2PN8 A;  2LQQ A;  4BWQ A;  3FEU A;  1T8E B;  4HZ2 A;  2KP2 A;  1K0D A;  3A5I A;  4TXO B;  4MP4 A;  2WB9 A;  2H1B A;  3KMN A;  4F03 A;  3QPM A;  2GGT A;  2H70 A;  2VD1 A;  2GZY A;  2GT5 A;  4K5R A;  3ZZX A;  2OE1 A;  4ML6 A;  1THO A;  4MH2 A;  22GS A;  5D73 A;  3ZRD A;  4N0Z A;  2DLX A;  2IL3 A;  3UOM A;  5IQY A;  5JWR B;  1AQX A;  3F63 A;  2VCW A;  4AJ6 A;  2LUS A;  5IMZ A;  4TR0 A;  4G9H A;  3IDV A;  4WEY A;  5AIX A;  2LNT A;  3ZLP A;  3CXG A;  3QCP A;  1MEK A;  4OFM A;  5LNK e;  4ECJ A;  1XWA A;  2R3X A;  1PGT A;  1V98 A;  1XZO A;  1OYJ A;  4GSN A;  2IMF A;  2B3S A;  3ZYW A;  1GSU A;  3ERF A;  3GFK A;  1NSW A;  1UVZ A;  2C8U A;  1B4Q A;  3L9U A;  1OE8 A;  2HI7 A;  4H86 A;  1Y6E A;  3TCO A;  1M0U A;  3TKP A;  3TRQ A;  4USS A;  4EL1 A;  4LL1 B;  1WWJ A;  2C4J A;  3IK7 A;  3PPU A;  4KSO A;  1PN0 A;  3I43 A;  5CAX A;  4E8H A;  2AYT A;  3K8N A;  4Z2R A;  1HYU A;  3ZIV A;  4OD7 A;  2AUV A;  1YZX A;  1J0F A;  3GHA A;  4QMK A;  4RQR A;  3ZML A;  1ON4 A;  2EFE A;  1VGL A;  2DJ1 A;  3TJF A;  1PL1 A;  3UMA A;  2R0C A;  3LFL A;  5JCG A;  5EPF A;  4XS4 B;  1X9M B;  4TR3 A;  3P90 A;  4PUR A;  2IPA A;  5J4V A;  2PWJ A;  4N11 A;  3KGK A;  3N9J A;  2HSM B;  1T4Y A;  3IBH A;  1VF2 A;  1TK0 B;  5D93 A;  3GH9 A;  3KZQ A;  3ZTL A;  5DCG A;  4V2L A;  2KHP A;  3QMX A;  1E6B A;  1SK1 A;  3CRT A;  4Q5Q A;  2CVB A;  4MF6 A;  1EP7 A;  3UL3 A;  2C80 A;  1N25 A;  2UZ8 A;  2PGT A;  4ZBA A;  4Z2T A;  3ED3 A;  2DJ2 A;  3HVV A;  2R6K A;  4RI6 A;  1XWB A;  1ZL9 A;  2O7K A;  3KIJ A;  1M9B A;  4YH2 A;  2IFQ A;  4OMV A;  3BJ5 A;  4JZQ A;  3LYK A;  5EVO A;  1SYR A;  5DAL A;  6GSX A;  2R4V A;  1TRU A;  1YF0 A;  4KDX A;  2CVK A;  3R2Q A;  3FK8 A;  3FRC A;  4ZIJ A;  1XWK A;  4HOJ A;  4IVF A;  1EOG A;  1O8W A;  4MAB A;  2LS5 A;  4KAE A;  2ZUP A;  4WXT A;  1T3B A;  5ECH B;  1V58 A;  4XIH A;  4PQI A;  1X5C A;  2L6D A;  2YPM A;  3IV4 A;  3SBC A;  4YQM A;  4QL7 A;  2V1M A;  1DBY A;  5F0G A;  2OAC A;  1M7T A;  3ZIJ A;  2C1Y A;  2H75 A;  1S3D A;  1OAZ A;  1SD8 A;  3RBT A;  1XVQ A;  3KMO A;  1S3C A;  2NDO A;  4CY8 A;  4K6X A;  2FA4 A;  1GUM A;  5ECN B;  5DJL A;  4OO4 A;  4DEJ A;  2LRT A;  2L59 A;  2K18 A;  3LSZ A;  1Q98 A;  4GQF A;  1MDI A;  2X49 A;  4NV5 A;  3GX8 A;  4CW9 A;  1O7U A;  3TJJ A;  4GWR A;  1JHB A;  1HNA A;  2FA8 A;  1T1V A;  4IHU A;  2CVD A;  5HR2 A;  3F8U A;  4MF5 A;  1BG1 A;  1XW9 A;  2VCX A;  4Z7X A;  2F8A A;  1ZYN A;  2YWO A;  3EPT A;  2E7P A;  2WDU A;  5G1L A;  16GS A;  3O6T A;  3KTL A;  1R5P A;  2LQO A;  4X1U A;  4YAV A;  4ZXG A;  1HNC A;  4LLR A;  1X0R A;  1E2Y A;  4O5R A;  5KN1 A;  3FZ9 A;  6GSS A;  3GNJ A;  2B6M A;  4AKX B;  4N30 A;  4EUY A;  2FLS A;  2CX4 A;  4Z2U A;  4O5U A;  2QGV A;  4J56 E;  3HVS A;  2MMN A;  2HNL A;  2CZ3 A;  5D9X A;  5H5S A;  5J3R A;  2PER A;  2MYG A;  4JRR A;  2AAW A;  4G10 A;  4YQV A;  3F9U A;  3CYN A;  4BVX B;  1OC9 B;  3D22 A;  4WKW A;  3G7J A;  3TKS A;  4KND A;  3G7Y A;  3A2V A;  1NM3 A;  5GAP D;  4KDY A;  1GUK A;  5KEJ A;  2VL3 A;  2IFQ B;  2VM2 A;  4F0B A;  4K1F A;  3C1R A;  3ZMK A;  4MMM A;  4ULX A;  1FB0 A;  4HZ4 A;  1VRS D;  3BCI A;  1GUL A;  2GLR A;  4IGJ A;  1I9D A;  1JFU A;  1ZZY A;  2TIR A;  4PQ1 A;  4ECB A;  2CQ9 A;  3F3Q A;  2HZE B;  1LJR A;  2JAD A;  4OO5 A;  4N0V A;  5BMU B;  2YAN A;  3LEF A;  4KX4 A;  1YEX A;  3VPT A;  2B5X A;  5CRW A;  1XBS A;  2X8H A;  4PX1 A;  1O73 A;  3I69 A;  3MYD A;  5A34 B;  2H72 A;  2V6O A;  2QA1 A;  1TRV A;  3ME8 A;  2GZP A;  4E8E A;  1W89 A;  1IYH A;  2GSQ A;  2RUF A;  5DQS A;  5J47 A;  2VD0 A;  4K7N A;  1EV4 A;  1B4P A;  1JZO A;  4AI6 A;  2N5B A;  1WMJ A;  1A2M A;  3E9J B;  2NVL A;  3UJ1 A;  4EIQ A;  3HJO A;  1YF1 A;  3LYP A;  5LD0 A;  4N10 A;  2O8V B;  3L9V A;  1Z3E A;  2E0Q A;  3F3R A;  3TKR A;  3PH9 A;  1Z7R A;  1GSE A;  2F8F A;  2A2R A;  2LRN A;  3TU3 B;  1PMT A;  1PQN A;  1QFN A;  1GSS A;  2A2S A;  3P8W A;  2J9H A;  2B1K A;  3EE2 A;  2NBS A;  2H71 A;  4KSM A;  1AQW A;  3I6A A;  1NHO A;  1GTA A;  3CSI A;  3GIX A;  4IQA A;  1PX6 A;  4K0G A;  3KJY A;  3LQ7 A;  1MDJ A;  1M2B A;  1TKD B;  5J40 A;  2LV3 A;  1BG5 A;  3IR4 A;  2MMA A;  2X8G A;  3PIN A;  1HNB A;  3ZIT A;  1PX7 A;  3IPZ A;  3AY8 A;  4YKG A;  3Q19 A;  3GKK A;  5FWG A;  3C7M A;  3CMI A;  2O89 A;  2YN1 A;  1THX A;  1ZYQ B;  2V41 A;  1K3L A;  4JBB A;  4AKH A;  3TOT A;  3VI7 A;  5ECQ B;  4DSQ A;  4ILF A;  1XW5 A;  5IMD A;  5G5F A;  1F37 A;  1SJ6 A;  2K9F A;  5F8B A;  4O92 A;  3GUS A;  4LL4 B;  2CA8 A;  10GS A;  1WE0 A;  1H4O A;  3IRA A;  4MK3 A;  4MH3 A;  3WYW A;  1EEM A;  2H66 A;  1XOA A;  3GSS A;  3L4N A;  3HKR A;  3EU4 A;  5IPH A;  4CDO A;  3LXZ A;  5EL8 A;  2YNX A;  4CY6 A;  1JLW A;  4X0X A;  3QD9 A;  4I97 A;  4EDZ A;  2GTU A;  1ERW A;  1QK8 A;  2HRF A;  2VIM A;  1SJZ A;  3V1W A;  2O85 A;  1J08 A;  1FG4 A;  2HSN A;  1AAZ A;  5JCU A;  3IC4 A;  4ICY A;  5IPG A;  3ZFL A;  1EZK A;  1BED A;  3US3 A;  4LA1 A;  3MAK A;  1X9W B;  3KM6 A;  4TOP A;  2P31 A;  3UVH A;  2H0H A;  1YQ1 A;  2M46 A;  3U6V A;  3TJG A;  2GZZ A;  2WZ9 A;  1ZYP A;  2PPT A;  2VL2 C;  5GZZ B;  4Q5R A;  1YVL A;  5B6N A;  3KTB A;  1Z7P A;  1TI3 A;  1M2A A;  1ABA A;  2C3T A;  5A4V A;  5A4W A;  1SL2 B;  1WJK A;  1JZD A;  4GDF A;  1XIY A;  3H4K A;  5H5Q A;  2I3Y A;  3UIW A;  4XS1 A;  3TRX A;  2OBK A;  2KOK A;  1EP8 A;  3Q74 A;  2VUP A;  2DKH A;  2ON5 A;  1R4W A;  2MBS A;  4BL7 A;  1BJX A;  4WR4 A;  1A8L A;  20GS A;  4PQH A;  1K3Y A;  1U6T A;  4TN8 A;  4JU5 A;  2GT6 A;  5BRT A;  4TW5 A;  1YKC A;  3LOR A;  3FR3 A;  2DJJ A;  3WGE A;  4FYC A;  2EIQ A;  2B1L A;  2DJ3 A;  1FB6 A;  2VL9 A;  1WRY A;  1QUW A;  5IO2 A;  4QL9 A;  3CSH A;  5A1N B;  1ERU A;  1DSB A;  2HLS A;  4IW9 A;  2WRT A;  3F0I A;  1G0T A;  4WBR D;  5CRH A;  4XTS A;  1O8X A;  2LEG A;  2H73 A;  2K6V A;  4PGT A;  4GF0 A;  1GWC A;  4GST A;  4OFT A;  2R5G A;  5G2Z A;  5G5E A;  5D96 A;  5COH A;  5KOW A;  2H6X A;  1M99 A;  3ME7 A;  1OKT A;  3IOS A;  2WFC A;  4AKI A;  4POB A;  4V2N A;  1EGO A;  1C72 A;  3TKQ A;  2LRC A;  4DVC A;  2HYX A;  5D8I A;  1A23 A;  3FZ4 A;  2C0D A;  5KN3 A;  2H6Y A;  2MMZ A;  3GRX A;  3R3E A;  2F51 A;  1G6W A;  2R37 A;  4IEL A;  2REM A;  4L8E A;  1GSY A;  3BCK A;  2RM6 A;  3VUR A;  3F6F A;  3HDC A;  5IOX A;  2VLT A;  1I5G A;  4K7I A;  1T7P B;  2ON7 A;  3W8J A;  5DDL A;  2FWH A;  3NIV A;  1FVK A;  4ZB9 A;  1AXD A;  1F3B A;  1PD2 1;  2ZNM A;  1SL0 B;  4WF5 A;  2YJ7 A;  4WET A;  14GS A;  2ZCT A;  2G0F A;  5ECP B;  2GSS A;  3TOU A;  1TK8 B;  1A24 A;  3EU3 A;  3KXO A;  4AJ8 A;  4XRA A;  3EVI A;  4YQU A;  17GS A;  4LMV A;  5GST A;  1ZYE A;  4XHM A;  2GST A;  4G0I A;  3GTU A;  2DBC A;  1TW9 A;  4ACS A;  3OR5 A;  4K7O A;  2EC4 A;  2J23 A;  1X5D A;  1U3I A;  4QQ7 A;  4KF9 A;  2HXK A;  4IP1 A;  1U3A A;  4ZB7 A;  4ZL9 A;  1KTE A;  2IJY A;  4GRF A;  1GLP A;  2YV9 A;  1LBK A;  1VF3 A;  2BJX A;  5IIZ A;  4GSS A;  4ZIL A;  2TRX A;  4K9Z A;  1JZR A;  5ID2 A;  2GQM A;  1OC3 A;  2HZF A;  1ZCP A;  4HJM A;  4MDC A;  1PSQ A;  3BBY A;  3F4S A;  4POM A;  5JWO B;  1GSQ A;  1O81 A;  3DVX A;  5A5K A;  4KE3 A;  3D4T A;  3DGQ A;  3A2X A;  2P5R A;  3SWL A;  5DQY A;  5ECI B;  4K2D A;  4KCA A;  1GTB A;  1GL8 A;  5DBQ A;  3EC3 A;  2ALB A;  4PUF C;  4OCE A;  2HQT A;  4PTS A;  1X9S B;  1VF1 A;  4G0K A;  1K0M A;  2GVP A;  1UN2 A;  4P3Y B;  5CRD A;  1GNE A;  4IKH A;  2MZC A;  1R26 A;  3VPQ A;  4EVM A;  1GSD A;  1MDK A;  5G30 A;  3GST A;  4XCS A;  1H75 A;  2EFD A;  3DML A;  3DYR A;  8GSS A;  3M1G A;  1TXU A;  4IJ3 A;  2V32 A;  5HR0 A;  2I9H A;  1XOB A;  3UEM A;  3L0H A;  4BWS A;  1GH2 A;  3QFB C;  3GX0 A;  3QOU A;  3EWL A;  3M9K A;  2N5A A;  3QAV A;  2VL2 A;  3WT1 A;  3CRU A;  4TVE A;  5CP1 A;  5IMV A;  2YWN A;  4ZB8 A;  2H30 A;  4IS0 A;  4ID0 A;  2OE3 A;  1SK0 A;  2P0G A;  4X4J A;  4MJC A;  2H0G A;  3WD6 A;  4K0N A;  1YEP A;  5CRE A;  3ZL5 A;  2AHE A;  1CQH A;  4F2I A;  3LJR A;  1FO5 A;  2H8L A;  2K8S A;  1OVN A;  1NHY A;  1USB A;  1SYX A;  3CTF A;  3HXS A;  5CRG A;  1KNG A;  4HQS A;  1EOH A;  3C71 A;  4MZB A;  3ERW A;  4ZBD A;  3IAS 2;  5ENU A;  4MLY A;  4D73 A;  3HYP A;  6GSY A;  1BX9 A;  1YY7 A;  3ERG A;  5ID2 B;  5FT3 A;  2IMK A;  1RW1 A;  5ELA A;  1T4Z A;  5DAL B;  4HU9 A;  4KA0 A;  2D2Z A;  3FY7 A;  5B8B A;  4K5S A;  1KBN A;  2VM1 A;  3HVX A;  3DXB A;  4MPF A;  3LW9 A;  2LJA A;  2M80 A;  2YWI A;  3HA9 A;  5H5R A;  3IAM 2;  4TR1 A;  5KN0 A;  3KH7 A;  3RPN A;  1X5E A;  5B6M A;  2NPB A;  1B48 A;  3W6G A;  2AJQ B;  2H1L A;  1A8Y A;  1SKS B;  1XXU A;  5A5H A;  4BVY A;  3KCM A;  2AV4 A;  4I5Q A;  2IWT A;  4X43 A;  3DWV A;  1XWG A;  2JZT A;  4HQZ A;  2TRC P;  2RUE A;  4FH8 A;  2X8C A;  3EIN A;  4ZB6 A;  2JU5 A;  3H79 A;  3FKF A;  3QAG A;  1F3A A;  3NOF A;  5D9W A;  4L0W A;  3VWV A;  2PU9 C;  1K0N A;  3GL5 A;  2QKE A;  2HSH A;  3TGZ A;  2O87 A;  2CZ2 A;  2H74 A;  5IO0 A;  3GN3 A;  3HD5 A;  5ECR B;  3F4T A;  2FNO A;  4KH7 A;  2VOC A;  4MJA A;  7GSS A;  3D5J A;  2BTO T;  3O76 A;  5E4W A;  9GSS A;  2FHE A;  3VWX A;  2KP1 A;  3DKS A;  4EE0 A;  12GS A;  1TOF A;  1Z5Y E;  4MF7 A;  5EY6 A;  5IMF A;  4I6X A;  1Z9H A;  4L5O A;  2VCQ A;  4NMU A;  1MD4 A;  2OBI A;  2JSY A;  4GQC A;  2ES7 A;  2FWG A;  1LU4 A;  2OJL A;  1AC1 A;  3VLN A;  4MNN A;  1PL2 A;  2I1U A;  2WCI A;  3UAR A;  1QGV A;  3M8N A;  1IYI A;  4WBJ A;  1WP0 A;  4NPB A;  2H1G A;  4TXO A;  3EMP A;  4K2X A;  2X99 A;  1HD2 A;  1OC8 A;  1OKD A;  4EDY A;  5FHI A;  1EV9 A;  3ZFB A;  1NW2 A;  2BMX A;  2FGX A;  4Q5F A;  3DD3 A;  3L9S A;  1A0F A;  5INY A;  3FMW A;  1SVL A;  3GKN A;  1FAA A;  3L78 A;  5GSS A;  3KP9 A;  2CAQ A;  2JL4 A;  2M72 A;  3GUR A;  4TKY A;  3J7Y b;  2L5L A;  3G7I A;  2H76 A;  3FYG A;  4FIW A;  2LJK A;  2QC7 A;  1GSF A;  2LTK A;  5L71 A;  4JED A;  5DJM A;  3MWH A;  5ECM B;  1FVJ A;  1GTU A;  1DE2 A;  4PNF A;  4BVY B;  1QXH A;  2L6C A;  1URM A;  3TDG A;  2AB6 A;  2R0G A;  2NTO A;  4PXO A;  4EC0 A;  3H93 A;  2LJR A;  3PR8 A;  2DIY A;  4E68 A;  3PGT A;  1SKW B;  1TTZ A;  2VLV A;  4DSR A;  2B5Y A;  1SVO A;  3TRP A;  1ML6 A;  1BF5 A;  3FZA A;  5HR1 A;  1AIU A;  2EFH A;  2YP6 A;  4IJI A;  1GRX A;  1A0R P;  2GDR A;  4Q5N A;  2XBQ A;  4BA7 A;  4EF0 A;  1SK2 A;  1DUG A;  5D9V A;  5DVB A;  3E3E A;  4O5Q A;  4EXJ A;  2JZS A;  2PBJ A;  2VKZ G;  11GS A;  1EGR A;  1GUH A;  2L4C A;  4XS4 A;  2YV7 A;  4MJB A;  3A5W A;  3HJM A;  2HSM A;  5F05 A;  1CQG A;  3CSJ A;  4HDE A;  1F6M C;  1T00 A;  1ST9 A;  2K8V A;  1SKR B;  3GA4 A;  4RUV A;  2VO4 A;  2OAD A;  1V40 A;  2XHF A;  1GP1 A;  4GLT A;  3TKS C;  2YZH A;  2L4Q A;  3P7X A;  4FYU A;  2VCZ A;  1U87 A;  3O3T A;  2DMM A;  1GNW A;  4KW6 A;  4MJE A;  1S3A A;  2XPD A;  3KD0 A;  1WOU A;  4JR4 A;  2QSI A;  1TJD A;  5CYY A;  3QR6 A;  3ZVJ D;  4TRX A;  1N2A A;  1FOH A;  5J4U A;  1G6Y A;  3UAP A;  2FCH A;  3FR9 A;  4NHW A;  3D21 A;  2YZU A;  6GSU A;  1Z6M A;  2QA2 A;  4L5L A;  4GTU A;  4FO5 A;  4DSS A;  5B7C A;  4IBP A;  3ISO A;  2EIR A;  1GTI A;  5ECS A;  3EUR A;  4ZL7 A;  3CBU A;  3GL3 A;  4ECI A;  4V1A p;  2YWM A;  2R0P A;  4NAX A;  5ECK B;  5GAN D;  1B8X A;  3CTG A;  4WR5 A;  2HSN B;  3MNG A;  1OE7 A;  2HRA A;  5ABR A;  3QFA C;  3VK9 A;  4JE1 A;  4MPG A;  5IMA A;  2LKU A;  4FQU A;  1Y25 A;  4NWY A;  2UV8 G;  5IMC A;  1BQ7 A;  4F0C A;  3HHV A;  2KUC A;  5D9T A;  3W8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...