4E8EA

Structural characterization of bombyx mori glutathione transferase bmgstd1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
216
structure length
216
Chain Sequence
HMPVQPIKLYYLPPSPPCRAVMMTARVLELDLHLITTNIMNGEHMTPEYLKMNPQHTIPTMDDNGFILWESRAIQTYLVNAYGKDDSLYPKNPRQRAIIDQRLNFDLGTLYLRYLNLYTPILFRGEAYDQEKADKFDEALGWLNTFLDGRPFVAGENMTVADITIVVTITNIDAFGYDFSSHENIAKWFERTKKMLEPYGYDEIDVTGAKMLASFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione S-transferase
publication title Structural characterization of Bombyx mori glutathione transferase BmGSTD1
rcsb
source organism Bombyx mori
molecule tags Transferase
total genus 82
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4e8eA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4e8eA01
3HYPA 2MMAA 1UC7A 3BCKA 3LYPA 3IK7A 2OE1A 4F03A 3P7XA 3QAWA 1LJRA 1AUCA 3K8NA 4QL7A 1V98A 1GUMA 3UVHA 5IMZA 3WYWA 5IMVA 2E7PA 1YZXA 2IJYA 1OAZA 4EDYA 1XIYA 2PERA 2R4VA 4DEJA 4MJAA 2DJ0A 1XWGA 3FW2A 1EEJA 4EF0A 17GSA 4PUAA 4MJEA 3TJBA 3TUEA 5B6NA 3CSJA 3GYKA 1OKDA 3EVIA 2QSIA 1USBA 3GMFA 5G5FA 1THOA 2O8VB 1YKAA 3TKRA 1XW6A 3IDVA 2HZEA 4MZCA 2YJ7A 4POMA 1GWCA 2KHPA 4BPYA 2WDUA 2L57A 1PA3A 1TRVA 1AW9A 3ERFA 4L5OA 5JCGA 3UEMA 3C8EA 1T8EB 5D8IA 1MD4A 4LLRA 4BVXA 2TRCP 2X8HA 3G9BA 4DSSA 1W89A 4L0UA 4IP1A 4EXJA 4IKHA 1U3IA 1SJIA 2YZUA 3KCMA 3UOMA 2GGTA 4LMWA 5JWRB 3R3EA 3QOUA 5D9XA 1WJKA 1JZOA 4NV2A 1T4YA 2F8AA 2YPMA 3F4TA 4ECBA 1ABAA 4V2NA 3EC3A 1URMA 4IQAA 1QGVA 3QD9A 3VURA 2HNLA 3J7Yk 5ID2B 5CP1A 1TKDB 2PVOC 5LD0A 2B5XA 3QCPA 4O7HA 2H8LA 4MPGA 5LNKe 5DAKA 2FWEA 3W8JA 1ZGNA 4XS4B 1JZWA 5KN2A 1XW9A 1SJZA 6GSWA 5C00A 1YF1A 2LTKA 1K0CA 3TRPA 2B1KA 3FZ5A 1AC1A 4HS1A 3ZRDA 3F4RA 2AUVA 4ECCA 1GTUA 3NZNA 3QFAC 1QFNA 22GSA 2NBSA 2VLVA 2LQQA 1BG5A 3D5JA 2H72A 3TRQA 4GF0A 3FR3A 4WF5A 3NOFA 4GSTA 5ECLB 1EOGA 5DALB 3H79A 3IC4A 3PH9A 4N0VA 4TKYA 5DDLA 2KUCA 5B6MA 4MA9A 4GWRA 3Q74A 1O81A 3WD6A 2H6YA 3KGKA 1FG4A 3KIJA 6GSYA 3IBHA 1H4OA 4MABA 1PGTA 1ML6A 2X99A 3OR5A 1X5EA 3KP9A 3MWHA 1Z3EA 4KE3A 5GAPD 4MDCA 4V1Ap 2GTUA 2BJXA 2KP2A 1SYXA 2IMKA 4GSSA 1R5PA 1SD8A 4HEA2 1E6BA 3HVVA 4Q5FA 1VF4A 1A2MA 3IRAA 4TXOB 1I5GA 2PWJA 3G7IA 4MZWA 2H01A 4GSNA 4G2EA 2HSHA 2M72A 1JHBA 4DSRA 1T00A 5CYYA 2JZSA 2V6KA 3GX0A 4OFTA 3KTBA 4JEDA 5J9CA 2AAWA 4NWYA 1T4ZA 3DD3A 2R2JA 2PPTA 3DMLA 2L5LA 1AXDA 1M0UA 1TU8A 5IO2A 2CZ3A 3KH9A 5A4WA 1PD21 4AGSA 1IYIA 1FVKA 3UARA 7GSSA 1O7UA 3F0IA 2IMFA 3WT2A 4MF7A 4ZB8A 2XPDA 1TK0B 1TOFA 1A2LA 3HZ4A 1E2YA 5IO0A 3TOTA 4NPBA 1PL2A 1J08A 3GX8A 4WKWA 2HE3A 2YV9A 11GSA 1GSYA 5D93A 5CREA 5ECSA 1S3DA 3MNGA 1X5CA 2CVBA 3GH9A 3VFIA 3F6DA 1DSBA 2YWMA 1XOBA 2N5AA 1G7EA 1F9MA 1Y25A 3FK8A 4L0WA 5HFIA 2BMXA 1OE7A 4IHUA 4KSMA 4HJ2A 1PL1A 1TJDA 4MP4A 2AV4A 4ZL7A 1DUGA 5ID2A 5CRGA 3TKQA 2H66A 2IMDA 3DKSA 4YQUA 1IYHA 1SK1A 1Z6NA 3HJMA 1YEXA 2YN1A 4CDOA 2DJ2A 2KOKA 4AJ8A 1NHYA 2GZZA 12GSA 4TW5A 5HFKA 4TOPA 2H74A 1JLVA 2LQOA 2YOIA 3M3MA 2A2SA 4XS4A 4K1FA 3APOA 1TU7A 1GL8A 1V9WA 1SENA 1GRXA 2NPBA 4X43A 3H93A 2I81A 3DYRA 19GSA 3F9UA 2LV3A 4J57E 3I69A 1PKZA 3KJYA 2VL9A 1TRSA 3RHBA 4GXZA 1QMVA 3HVXA 1O8WA 1HNBA 2DIZA 2P0GA 2G0FA 3TDGA 1ACVA 3BD2A 3G7JA 3D4MA 4HQZA 3UMAA 3FKFA 2TRXA 4TR0A 4YAPA 2LUSA 4YQVA 2ES7A 3UAPA 2OE3A 3KM6A 4GTUA 1A23A 3MSZA 2F3MA 4ZBBA 3M9JA 4XS1A 1GLPA 4QQ7A 3VWVA 1A24A 4WR5A 4MPFA 2GSQA 4OFMA 3LG6A 2EC4A 2JADA 1U87A 3RHCA 1Z6MA 2E0QA 2GSRA 2YZHA 4P3YB 2C0DA 4EKZA 10GSA 5ABRA 3LGCA 4JZQA 3DEXA 2HRFA 4ML1A 1DE2A 1F2EA 3AY8A 4Q5NA 4KA0A 1JZDA 4G9HA 4KDXA 2JSZA 4TXOA 1SJ6A 5ECIB 5HFGA 3EMPA 1BYEA 2K18A 4PQIA 3WGXA 4F0CA 5IMCA 4MJCA 4HI7A 5G30A 4N30A 2WS2A 2AYTA 4E8HA 4MH2A 5AIXA 2N5FA 3ZMLA 1G6WA 3ZFLA 1WIKA 2RUEA 3C71A 2C0EA 2OADA 5J5NA 4EO3A 4O32A 4YH2A 2LJAA 5F06A 4KAEA 1GSUA 1HNAA 1M99A 2DBCA 5DVBA 4TR4A 3FEUA 4V1Ag 1VF2A 3VPTA 5AISA 5J41A 1ERTA 4POKA 2JU5A 2C4JA 2DC5A 2CQ9A 1NM3A 2VLUA 2M80A 1M7TA 2FY6A 2R6KA 2EIRA 2WCIA 1F37A 3UJ1A 4MMMA 4FH8A 3FRCA 3WT1A 2YP6A 2G2QA 1A0FA 2GZPA 4ILFA 2Z9SA 2VD0A 1SK0A 2K6VA 2MZCA 2BTOT 3LXTA 4TRXA 1XCCA 1CQHA 3N5OA 5HR2A 4V2LA 3UVTA 2DIYA 3SWLA 2ON5A 3VWXA 5J3RA 2O89A 2PMTA 2C0FA 3RPPA 1XBSA 2ALBA 3KZQA 2IPAA 3ERGA 3FZ9A 3MDKA 2GQMA 2VD1A 5JWOB 2P5RA 4ZB6A 1F3AA 1K0BA 3EMXA 1C72A 2YV7A 2HI7A 2MBSA 5IOXA 3Q6OA 4BVYB 6GSXA 3GH6A 4N10A 1R4WA 1R5AA 1V2AA 3E0UA 2C8UA 4K7NA 5G1KA 3IV4A 1XWKA 4RQXA 4MF5A 3GURA 3ZITA 5D9WA 3L9SA 3LQ7A 1SU9A 4EC0A 3D21A 2OBKA 4OCEA 3VPQA 5E4WA 4NMUA 1EWXA 1ERVA 2LNSA 1FB0A 3O76A 1F6MC 2GLRA 5DBQA 3RAZA 2CZ2A 2O7KA 2VL2A 3TKSC 3QAVA 2YANA 3LJRA 1M2BA 5AN1A 3TJJA 4WXTA 2NDOA 3EE2A 3A5WA 2E2GA 1GNEA 3UBKA 2GT5A 3U5RE 2HLSA 16GSA 1GUHA 1M2DA 1TRWA 3DRNA 4AF2A 2LJRA 2H30A 4IELA 2YWOA 1M9BA 4PNFA 1OYJA 4N0ZA 4F0BA 2FLSA 1VF3A 4K6XA 2VLTA 2CAIA 3WGDA 2XHFA 2UZ8A 2OBIA 4HZ2A 4KSOA 1KEBA 3CRTA 4RUVA 2OE0A 5IMDA 2CVDA 2VCXA 2IN3A 4PTSA 5EVOA 1PKWA 4K7IA 2H0GA 2HQTA 1MD3A 2H6XA 4EUYA 3M0FA 1FVJA 4PURA 3J7Yb 4XCSA 4EDZA 1JZRA 3QAGA 2H1DA 4KCEA 1CQGA 1MDKA 4ZL9A 4RQRA 2YWIA 1XWAA 1VF1A 3GNJA 5LCZA 4PX1A 1KNGA 2LS5A 1XVQA 3FR9A 5CRWA 4X0XA 2DMLA 3Q18A 2H0IA 1NW2A 4I5QA 5CRHA 1Y6EA 3TOUA 3GIXA 3GV1A 2WFCA 3PGTA 4KDUA 5IOWA 2VL3A 1U3AA 1K3OA 2WGRA 2HFDA 4G19A 1GTAA 1X0RA 1A8LA 1AQVA 2VCTA 5EL8A 5FWGA 2V2GA 2B6MA 4OO5A 2P31A 4Z7XA 2JACA 4FIWA 4I8BA 3GKKA 1OC8A 3LSZA 3ZVJA 2LRCA 3L78A 1SL1B 2KLXA 3GTUB 2VM1A 4H86A 1OVNA 2DLXA 5ECHB 1K0OA 4ISDA 1GLQA 3EWLA 1DBYA 1AIUA 2WULA 4X1UA 1T1VA 4HJMA 2MMNA 2X8GA 4TVEA 5C04A 1GSEA 3WGEA 3CYNA 2HSNB 3VI7A 2A4VA 4IGJA 3BBYA 2QGVA 2CV4A 2L4QA 5HR3A 3W6GA 1XOAA 5IMFA 5ECNB 3A2WA 2NVLA 2REMA 4BVYA 1X5DA 1TK5B 2IIYA 4NHWA 1ERUA 1MEKA 4ZXGA 2IFQA 3O3TA 4KF9A 1JLWA 4TXVA 2VCZA 2PU9C 1XW5A 3L9UA 3IOSA 2C3TA 4FYUA 3U6VA 2HSMB 2KP1A 3F63A 3HJOA 3TGZA 1OC9A 1YJ6A 5G5EA 3LYKA 1K3YA 3GRXA 5H5SA 3FY7A 2FGXA 1K3LA 1XFLA 4RI7A 4FQUA 4YQMA 4OWYA 4EVMA 3PPUA 5AIVA 4XRAA 2MMZA 2B5EA 4K0GA 3A2XA 1K0MA 5GSTA 2QKEA 3C7MA 1TP9A 2L59A 2V1MA 3GHAA 2OKAA 4LMVA 2P5QA 4PGTA 2J9HA 4IVFA 4IQ1A 2O87A 2CX3A 1KTEA 4POLA 1FOVA 4KNDA 4CHSA 2L5OA 4Q5QA 5ENUA 3ZL5A 1O73A 3BOAA 4GQCA 3FHKA 5J4UA 4OO4A 4JE1A 1FW1A 4IBPA 2R37A 1GUKA 2JZRA 4ZBAA 3F4SA 4K8MA 2V32A 1VGLA 3D6IA 2DSAA 2R5GA 5F07A 3LXZA 5GZZB 4TR1A 1DE1A 3NIVA 3LFLA 4ULXA 2C3QA 2I9HA 1XWBA 3EINA 4LL1B 2OACA 3US3A 4IN0A 1N2AA 5GSSA 2CA8A 2H70A 2CT6A 5H5QA 3IK9A 2VOCA 1GSQA 5IM9A 3F8UA 4MJBA 2CX4A 1GTIA 2MYGA 3FR6A 3ZREA 2HYXA 2ON7A 1BX9A 1G6YA 5FHIA 2F51A 4OFNA 1ZMAA 4BWSA 2LSTA 1GSDA 2VCVA 5HR1A 3GUSA 3Q19A 1NHOA 2M46A 4EE0A 13GSA 1Z9HA 2C0GA 2I3YA 2E2MA 2EIOA 1FAAA 3DGQA 1XPVA 6GSTA 3F3QA 2OA7A 4PUFC 1BEDA 1ZL9A 3ZIVA 4MCUA 1EGRA 2H73A 1TW9A 1J0FA 2MBTA 1TI1A 5IPHA 3LORA 4IJIA 4JR4A 1PSQA 1X9SB 3APQA 4KB3A 2ZUPA 5EPFA 2K8VA 3KEBA 3GTUA 1YQ1A 5A4UA 3HJPA 2MMOA 4FYCA 1B4QA 3HA9A 3O6TA 1FB6A 4HDEA 1G7OA 2DJKA 2FD3A 1EP8A 3A2VA 3VWUA 1V57A 5D73A 1S3CA 2HXKA 2XBQA 1LBKA 2HT9A 1SL2B 4USSA 5G31A 3CSIA 4WF4A 1B48A 4MZBA 1TRUA 2HRAA 5G1LA 5IMAA 5DJLA 4KGIA 1FHEA 1Z5YE 3ZMKA 4K7OA 3L9VA 2LRNA 1H75A 3ZLPA 4K9ZA 3QDNA 2HSMA 4CW9A 4NHZA 4OMVA 1I9DA 2IL3A 1OC3A 3CBUA 4KUNA 1BQ7A 2H0HA 2C80A 2R3XA 3HY2A 2PN8A 5DQSA 3P2AA 2WJUA 3PR8A 4KCAA 4TR3A 4I2UA 4ZBDA 3GFKA 2X8CA 3P90A 2RM6A 2OJLA 3GL3A 3R2QA 1XXUA 1AQWA 1GP1A 3BJ5A 3GSSA 1GNWA 4GCIA 1EV9A 3ED3A 2HZFA 5JWQB 3ZZXA 2JSYA 2IMEA 4NV5A 1X9MB 3L4NA 4HU7A 1EV4A 4KH7A 3G7YA 3C73A 2X64A 2PBJA 4WBJA 3UL3A 4ZIJA 1QQ2A 2IFQB 2FWGA 1OKTA 1GSFA 1WMJA 1OE8A 1YF0A 3I6AA 5ECMB 3IA1A 2FWFA 5ELAA 4FO5A 3C1RA 3FZAA 3W8SA 2V41A 1YEPA 3TJFA 1B4PA 3V1WA 5ECKB 3M8NA 2JZTA 1O6JA 2GS3A 1OC9B 3GA4A 3IE3A 4IW9A 4G0LA 1M9AA 1WP0A 2O85A 4LA1A 5D9TA 3N9JA 4DVCA 1HQOA 1SKWB 1Z7PA 3KMNA 4XTSA 1B9XC 3IR4A 2GT6A 3ME8A 2FNOA 4L5LA 1RK4A 5CNWA 2K9FA 2LJKA 3FYGA 1WE0A 3TJKA 4ZB9A 2FWHA 1AAZA 4ZL8A 5A5KA 1EEMA 3D22A 4G0KA 2F8FA 1RW1A 5DCGA 5DCHA 1SKRB 3EURA 1S3AA 5COHA 4BWQA 4HQSA 1YDKA 2B7KA 3RBTA 4DSQA 1TXXA 4L8EA 3IXRA 1ZYEA 3I43A 1O8XA 3EU4A 4PNGA 2FA8A 3QFBC 3L0HA 1SL0B 1XZOA 3ERWA 1RQMA 4WEYA 4V2MA 2GQKA 2B5YA 2A2RA 5EY6A 4TR1B 3GN3A 2F9SA 2GVPA 1ILOA 1A0RP 4MK3A 3ZVJD 4FYBA 1HD2A 1V58A 5KEJA 2H1GA 3TKSE 4XIHA 2VM2A 2ZCTA 2FA4A 3JCML 4KDYA 4ACSA 2PUKC 5AGYA 3GKXA 2GDRA 5IPGA 1V40A 3PINA 1R26A 2VCQA 2B7JA 2LNTA 2H19A 4J56E 4AJ6A 3IHQA 1TI3A 1Q98A 2L6DA 4HOJA 4WETA 1TK8B 5FT3A 4KW6A 2PGTA 4ID0A 3D4TA 5BMUA 4I97A 6GSUA 3F3RA 4GLTA 3EU3A 2YJHA 9GSSA 1F3BA 3VI5A 3ZFBA 2ZNMA 5ECQB 3CTGA 2H75A 1ZZYA 2I4AA 2LEGA 2WRTA 1ST9A 2H1BA 1FO5A 1WRYA 3VK9A 1SKSB 3F6FA 3RPNA 5IIZA 1PQNA 3GSTA 2WZ9A 4XS6A 4AJ7A 3HCZA 4D73B 1EOHA 4O92A 3GKNA 5F8BA 1THXA 2GSTA 2H1AA 3TRXA 1M2AA 5DQYA 3LWAA 3IPZA 1BAYA 1K0AA 4IP6A 2L4CA 3HHVA 3D0ZA 4K0NA 1WWJA 2HRNA 3UBLA 3VWWA 3DVWA 2DJJA 5B8AA 1GULA 1TTZA 3E9JB 3H4KA 1PX7A 4ML6A 3H8QA 2XBIA 5G2ZA 1GSSA 1LU4A 1WOUA 4OD7A 1QK8A 3ZYWA 2HRKB 2B3SA 2IMIA 5B8BA 4GQFA 14GSA 1SK2A 5KN1A 1ZYQB 4PQ1A 5INYA 3ME7A 18GSA 3M9KA 4GRFA 3CSHA 4MH3A 3TJGA 3C1SA 3LEFA 2HSYA 1PRXA 2GQLA 5F05A 4YAVA 3MAKA 1VRSD 3TB2A 1B8XA 4TN8A 3APSA 2VAFA 3IC8A 1QXHA 1X9WB 1UA5A 4WBRD 3I9V2 5D96A 5JCUA 4WR4A 3IAM2 2YCDA 4BL7B 4G0IA 3TKSA 8GSSA 3EYTA 4PXOA 3ZTLA 4I6XA 5ECRB 2DJ1A 1Q4JA 1TDIA 2TIRA 4LL4B 2D2ZA 1U6TA 2FHEA 2LKUA 4HUAA 4F82A 2AJQB 1G0TA 2IWTA 3HDCA 3ISOA 2DMMA 3RDWA 2H6ZA 1MTCA 4ECIA 3IAS2 2I1UA 4ZILA 3DXBA 5HR0A 5ECPB 4G10A 2CAQA 3KMOA 5HQPA 4F2IA 6GSSA 4ECJA 2RM5A 3HXSA 4KX4A 4PQHA 1A2JA 1QUWA 5L71A 1PMTA 2FUG2 1BJXA 2AB6A 4NXIA 2DJ3A 4MF6A 1GH2A 2EIQA 3BCIA 1A8YA 2RUFA 2VL2C 1K0DA 2K8SA 2B1LA 1W4VA 2HZEB 3GL5A 1XWCA 3KXOA 1EP7A 3DWVA 3FZ4A 2J23A 4I2TA 3QPMA 1O85A 2RLIA 2VIMA 1AQXA 2LRTA 2N5BA 3TKPA 3QMXA 3TCOA 4O5RA 4XHMA 4JR6A 5B7CA 3KP8A 3M1GA 4BVXB 2L6CA 3KD0A 1U88A 5ELGA 1PX6A 4JU5A 4DSSB 1HYUA 5KN0A 5DJMA 5H5RA 5F0GA 2C1YA 1T3BA 5IQYA 4QL9A 1UVZA 2WB9A 5A4VA 1B9YC 20GSA 1N8JA 5DALA 3CXGA 4Q5RA 4IS0A 4HZ4A 1NSWA 5CAXA 1KBNA 2GZYA 1YY7A 1HNCA 3E3EA 2RIIA 4BA7A 3DIEA 1ON4A 4MLYA 3QR6A 4JBBA 3P8WA 3GKMA 2XPEA 4K2DA 1EZKA 2VCWA 1XVWA 4EL1A 3CTFA 3DVXA 5DAKB 5JCWA 1SD9A 4RI6A 4D73A 4OCFA 1SYRA 5CO3A 5GAND 3H1NA 3SBCA 2V6OA 2YNXA 4XRDA 1UN2A 2C3NA 2PVQA 4HU9A 1ZCPA 2H76A 3HKRA 3KTLA 2NTOA 4E8EA 1EGOA 2FCHA 3VLNA 4F9ZA 3CMIA 5D9VA 3HZ8A 1J9BA 4JRRA 4J2FA 2CVKA 2VO4A 2JL4A 1ZOFA 2HRKA 2QC7A 1R7HA 3CRUA 3ZIJA 4NAXA 2YWNA 6GSVA 5E59A 3HVSA 1ERWA 3A3TA 4N11A 1MDJA 5J9BA 1WPIA 1K0NA 3S9FA 1Z7RA 5KN3A 2GSSA 2AHEA 5CRDA 3HD5A 4POBA 4IJ3A 2VUPA 1MDIA 1GTBA 1YKCA 5ECOB 1PN9A 2XC2A 1JFUA 1T7PB 4BL7A 3KH7A 2H71A 3UIWA
chains in the Genus database with same CATH superfamily
3HYPA 2MMAA 1UC7A 3BCKA 3LYPA 3IK7A 2OE1A 4F03A 3P7XA 3IHGA 3QAWA 1LJRA 1AUCA 3K8NA 4QL7A 1V98A 1GUMA 3UVHA 5IMZA 3WYWA 5IMVA 2E7PA 1YZXA 2IJYA 4BIKA 1OAZA 4EDYA 1XIYA 2PERA 2R4VA 4DEJA 4MJAA 2DJ0A 1XWGA 3FW2A 1EEJA 4EF0A 17GSA 4PUAA 4MJEA 3TJBA 3TUEA 5B6NA 3CSJA 3GYKA 1OKDA 3EVIA 2QSIA 2A2PA 1USBA 3GMFA 5G5FA 1THOA 2O8VB 1YKAA 3TKRA 1XW6A 3IDVA 2HZEA 1TXUA 4MZCA 2YJ7A 4POMA 1GWCA 2KHPA 4BPYA 2WDUA 2L57A 1PA3A 1TRVA 1AW9A 3ERFA 4L5OA 5JCGA 3UEMA 3C8EA 1T8EB 5D8IA 1MD4A 4LLRA 4BVXA 2TRCP 2X8HA 3G9BA 4DSSA 1W89A 4L0UA 4IP1A 4EXJA 4IKHA 1U3IA 1SJIA 2YZUA 3KCMA 3UOMA 2GGTA 4LMWA 5JWRB 3R3EA 3QOUA 5D9XA 1WJKA 1JZOA 4NV2A 1T4YA 2F8AA 2YPMA 3F4TA 4ECBA 1ABAA 4V2NA 3EC3A 1URMA 4IQAA 1QGVA 3QD9A 3VURA 2HNLA 3J7Yk 5ID2B 5CP1A 1TKDB 2PVOC 5LD0A 2B5XA 3QCPA 4O7HA 2H8LA 4MPGA 5LNKe 5DAKA 1BF5A 2FWEA 3W8JA 1ZGNA 4XS4B 1JZWA 5KN2A 1XW9A 1SJZA 6GSWA 5C00A 1YF1A 2LTKA 2OT3A 1K0CA 5KOWA 3TRPA 2B1KA 3FZ5A 1AC1A 5J4VA 4HS1A 3ZRDA 3F4RA 2AUVA 4ECCA 1GTUA 3NZNA 3QFAC 1QFNA 22GSA 2NBSA 2VLVA 2LQQA 1BG5A 3D5JA 2H72A 3TRQA 4GF0A 3FR3A 4WF5A 3NOFA 4GSTA 5ECLB 1EOGA 5DALB 3H79A 3IC4A 3PH9A 4N0VA 4TKYA 5DDLA 2KUCA 3HMJG 5B6MA 4MA9A 4GWRA 4HSCX 3Q74A 1O81A 3WD6A 2H6YA 3KGKA 4Z2RA 1FG4A 3KIJA 6GSYA 3IBHA 1H4OA 4MABA 1PGTA 1ML6A 2X99A 3OR5A 1X5EA 3KP9A 3MWHA 1Z3EA 4KE3A 5GAPD 3CWGA 4MDCA 4V1Ap 2GTUA 2BJXA 2KP2A 1SYXA 2IMKA 2WW3A 4GSSA 1R5PA 1SD8A 4HEA2 1E6BA 3HVVA 4Q5FA 1VF4A 1A2MA 3IRAA 4TXOB 1I5GA 2PWJA 3G7IA 4MZWA 2H01A 4GSNA 5J4YA 4G2EA 2HSHA 2M72A 1JHBA 4DSRA 1T00A 5CYYA 2DKIA 2JZSA 2V6KA 3GX0A 4OFTA 3KTBA 4JEDA 5J9CA 2AAWA 4NWYA 2X4AA 1T4ZA 3DD3A 2R2JA 2PPTA 3DMLA 2L5LA 1AXDA 1M0UA 1TU8A 5IO2A 2CZ3A 3KH9A 5A4WA 1PD21 4AGSA 1IYIA 1FVKA 3UARA 4W66A 7GSSA 1O7UA 3F0IA 2IMFA 3WT2A 4O5UA 4MF7A 4ZB8A 2XPDA 1TK0B 4E68A 1TOFA 1A2LA 3HZ4A 1E2YA 5IO0A 3TOTA 4NPBA 1PL2A 1J08A 3GX8A 4WKWA 2HE3A 2YV9A 11GSA 1GSYA 5D93A 5CREA 5ECSA 1S3DA 3MNGA 1X5CA 2CVBA 3GH9A 3VFIA 3F6DA 1DSBA 2YWMA 1XOBA 2N5AA 1G7EA 1F9MA 1Y25A 3FK8A 4L0WA 5HFIA 2BMXA 1OE7A 4IHUA 4KSMA 4HJ2A 1PL1A 1TJDA 4MP4A 2AV4A 4ZL7A 1DUGA 5ID2A 5CRGA 3TKQA 2H66A 2IMDA 3DKSA 4YQUA 1IYHA 1SK1A 1Z6NA 3HJMA 1YEXA 2YN1A 4CDOA 2DJ2A 2KOKA 4AJ8A 1NHYA 2GZZA 12GSA 2H1LA 4TW5A 5HFKA 4TOPA 2H74A 1JLVA 2LQOA 2YOIA 3M3MA 2A2SA 4XS4A 4K1FA 3APOA 1TU7A 1GL8A 1V9WA 1SENA 1GRXA 2NPBA 1S4BP 4X43A 3H93A 2I81A 3DYRA 19GSA 3F9UA 2LV3A 4J57E 3I69A 1PKZA 3KJYA 2VL9A 1TRSA 3RHBA 4GXZA 1QMVA 3HVXA 1O8WA 1HNBA 2DIZA 2P0GA 2G0FA 3TDGA 1ACVA 3BD2A 3G7JA 3D4MA 4HQZA 3UMAA 3FKFA 2TRXA 4TR0A 4YAPA 2LUSA 4YQVA 2ES7A 3UAPA 2OE3A 3KM6A 4GTUA 1A23A 3MSZA 2F3MA 4ZBBA 3M9JA 4XS1A 1GLPA 4QQ7A 3VWVA 1A24A 4WR5A 4MPFA 2GSQA 4OFMA 3LG6A 2EC4A 2JADA 1U87A 3RHCA 1Z6MA 2E0QA 2GSRA 2YZHA 4P3YB 2C0DA 4EKZA 10GSA 5ABRA 3LGCA 4JZQA 3DEXA 3HVNA 2HRFA 4ML1A 1DE2A 1F2EA 3AY8A 4AKXB 4Q5NA 4KA0A 2WVZA 1JZDA 4G9HA 4KDXA 2JSZA 2O5VA 4TXOA 1SJ6A 5ECIB 5HFGA 4O5QA 3EMPA 1BYEA 2K18A 4PQIA 2HSNA 3WGXA 4F0CA 5IMCA 3RGBC 4MJCA 4HI7A 5G30A 4N30A 2WS2A 2AYTA 4E8HA 4MH2A 1ZYPA 5AIXA 2N5FA 3ZMLA 1G6WA 3ZFLA 1WIKA 4G01A 2RUEA 3C71A 2C0EA 2OADA 5J5NA 4EO3A 2EFDA 5A5HB 4O32A 4YH2A 2LJAA 5F06A 4KAEA 1GSUA 1HNAA 1M99A 2DBCA 5DVBA 4TR4A 3FEUA 4V1Ag 1VF2A 3VPTA 5AISA 5J41A 1ERTA 4POKA 2JU5A 2C4JA 2DC5A 2X49A 2CQ9A 1NM3A 2VLUA 2M80A 1M7TA 2FY6A 2R6KA 2EIRA 2WCIA 2O36A 1F37A 3UJ1A 4MMMA 3RFRC 3FRCA 4FH8A 3WT1A 2YP6A 2G2QA 1A0FA 2GZPA 4ILFA 2Z9SA 2VD0A 1SK0A 2K6VA 2MZCA 2BTOT 3LXTA 4TRXA 4PI2C 1XCCA 1CQHA 1XG8A 3N5OA 5HR2A 4V2LA 3UVTA 2DIYA 3SWLA 2ON5A 3VWXA 5J3RA 2O89A 2PMTA 2C0FA 3RPPA 1XBSA 2ALBA 3KZQA 2IPAA 3ERGA 3FZ9A 3MDKA 2GQMA 2VD1A 5JWOB 2P5RA 4ZB6A 1F3AA 1K0BA 3EMXA 1C72A 2YV7A 2HI7A 2MBSA 5IOXA 3Q6OA 4BVYB 6GSXA 1M3JA 3GH6A 4N10A 1R4WA 1R5AA 1V2AA 3E0UA 2C8UA 4K7NA 5G1KA 3IV4A 1XWKA 4RQXA 4MF5A 3GURA 3ZITA 5D9WA 3L9SA 3LQ7A 1SU9A 4EC0A 3D21A 2OBKA 4OCEA 3VPQA 5E4WA 4NMUA 1EWXA 1ERVA 2LNSA 4AI6A 1FB0A 3O76A 1F6MC 2GLRA 5DBQA 3RAZA 2CZ2A 2O7KA 2VL2A 3TKSC 3QAVA 2YANA 3LJRA 1M2BA 5AN1A 3TJJA 4WXTA 2NDOA 3EE2A 3A5WA 2E2GA 1GNEA 3UBKA 2GT5A 3U5RE 2HLSA 16GSA 1GUHA 1M2DA 2UV8G 1TRWA 3DRNA 4AF2A 2LJRA 2H30A 4IELA 2YWOA 1M9BA 4PNFA 2A4HA 1OYJA 5BRTA 4N0ZA 4F0BA 2FLSA 1VF3A 4K6XA 2VLTA 2CAIA 3WGDA 2XHFA 2UZ8A 2OBIA 4HZ2A 4KSOA 1KEBA 3CRTA 4RUVA 2OE0A 5IMDA 2CVDA 2VCXA 2IN3A 4PTSA 5EVOA 1PKWA 4K7IA 2H0GA 2HQTA 2DKHA 1MD3A 2H6XA 4EUYA 3M0FA 1FVJA 4PURA 3J7Yb 4XCSA 4EDZA 1JZRA 3QAGA 2H1DA 2WVXB 1PN0A 4KCEA 1CQGA 1MDKA 4ZL9A 4RQRA 2YWIA 1XWAA 1VF1A 3GNJA 5LCZA 4PX1A 1KNGA 2LS5A 1XVQA 3FR9A 5CRWA 4X0XA 2DMLA 3Q18A 5A5HA 2H0IA 1NW2A 4I5QA 5CRHA 1Y6EA 3TOUA 3GIXA 3GV1A 2WFCA 3PGTA 4KDUA 5IOWA 2VL3A 5A34B 1U3AA 1K3OA 2WGRA 2HFDA 4G19A 1GTAA 1X0RA 1A8LA 1AQVA 2VCTA 5EL8A 5FWGA 2V2GA 2B6MA 4OO5A 2P31A 2EFHA 2JACA 4Z7XA 1ZYNA 4FIWA 4I8BA 3GKKA 1OC8A 3LSZA 3ZVJA 2LRCA 3L78A 4EIPA 1SL1B 2KLXA 4YKFA 3GTUB 2VM1A 4H86A 1OVNA 2DLXA 5ECHB 1K0OA 4ISDA 1GLQA 3EWLA 1DBYA 1AIUA 2WULA 4X1UA 1T1VA 4HJMA 2MMNA 2X8GA 4TVEA 5C04A 1GSEA 3WGEA 3CYNA 2HSNB 3VI7A 2A4VA 4IGJA 3BBYA 2QGVA 2CV4A 2L4QA 5HR3A 3W6GA 1XOAA 5IMFA 5ECNB 3A2WA 2NVLA 2REMA 4BVYA 1X5DA 1TK5B 2IIYA 4NHWA 1ERUA 1MEKA 4ZXGA 2IFQA 3O3TA 4KF9A 1JLWA 4TXVA 2VCZA 2PU9C 1XW5A 3L9UA 3IOSA 2C3TA 4FYUA 3U6VA 2HSMB 2KP1A 3F63A 3HJOA 1YVLA 5A1NB 3TGZA 1OC9A 1YJ6A 5G5EA 3LYKA 1K3YA 3GRXA 5H5SA 3FY7A 2FGXA 1K3LA 1XFLA 4RI7A 4FQUA 4YQMA 4OWYA 4EVMA 3PPUA 5AIVA 4XRAA 4CY6A 2MMZA 2B5EA 4K0GA 3A2XA 1K0MA 5GSTA 2QKEA 3C7MA 1TP9A 2L59A 2V1MA 3GHAA 2OKAA 4LMVA 2P5QA 4PGTA 2J9HA 4IVFA 4IQ1A 2O87A 2CX3A 1KTEA 4POLA 1FOVA 4KNDA 4CHSA 2L5OA 4Q5QA 5ENUA 2EFCA 3EPTA 3ZL5A 4Z2TA 1O73A 3BOAA 4GQCA 3FHKA 5J4UA 4OO4A 4JE1A 3A5IA 4AKGA 1FW1A 4IBPA 2R37A 1GUKA 2JZRA 4ZBAA 3F4SA 4K8MA 2V32A 1VGLA 3D6IA 2DSAA 2R5GA 5F07A 3LXZA 5GZZB 4TR1A 1DE1A 3NIVA 4ZB7A 3LFLA 4ULXA 2C3QA 2I9HA 1XWBA 3EINA 4LL1B 4MNNA 2OACA 3US3A 4IN0A 1N2AA 1BG1A 5GSSA 2CA8A 2H70A 2CT6A 3LW9A 5H5QA 3IK9A 2WVXA 1GSQA 2VOCA 5IM9A 3F8UA 4MJBA 4AKHA 2CX4A 1GTIA 2MYGA 3FR6A 3ZREA 2HYXA 2ON7A 1BX9A 1G6YA 5FHIA 2F51A 4OFNA 1ZMAA 4BWSA 2LSTA 4CY8A 1GSDA 2VCVA 5HR1A 3GUSA 3Q19A 1NHOA 2M46A 4EE0A 13GSA 1Z9HA 2C0GA 2I3YA 2E2MA 2EIOA 1FAAA 3DGQA 5A34A 1XPVA 6GSTA 3F3QA 2OA7A 4PUFC 1BEDA 1ZL9A 3ZIVA 4MCUA 1EGRA 2H73A 1TW9A 1J0FA 2MBTA 1TI1A 5IPHA 3LORA 4IJIA 4JR4A 1PSQA 2EFEA 1X9SB 3APQA 4KB3A 2ZUPA 5EPFA 2K8VA 3KEBA 3GTUA 1YQ1A 5A4UA 3HJPA 2MMOA 4FYCA 1B4QA 3HA9A 3O6TA 1FB6A 4HDEA 1G7OA 2R0CA 2DJKA 2FD3A 1EP8A 3A2VA 2R0PA 3VWUA 4PHZC 1V57A 5D73A 2WVYA 1S3CA 2HXKA 2XBQA 1LBKA 2HT9A 3TU3B 1SL2B 4USSA 5G31A 3CSIA 4WF4A 2QA1A 1B48A 4MZBA 1TRUA 2HRAA 5G1LA 5IMAA 5DJLA 4KGIA 2QA2A 1FHEA 1Z5YE 3ZMKA 4K7OA 3L9VA 3FMWA 2LRNA 1H75A 3ZLPA 4K9ZA 3QDNA 2HSMA 4CW9A 4NHZA 4OMVA 1I9DA 2IL3A 5BMUB 1OC3A 3CBUA 4KUNA 1BQ7A 2H0HA 2C80A 2R3XA 3HY2A 5A1NA 2PN8A 5DQSA 3P2AA 2WJUA 1I1IP 3PR8A 4KCAA 4TR3A 4I2UA 4ZBDA 3GFKA 2X8CA 3P90A 2RM6A 2OJLA 3GL3A 3R2QA 1XXUA 1AQWA 1GP1A 3BJ5A 3GSSA 4AKIA 1GNWA 4GCIA 1EV9A 3ED3A 2HZFA 5JWQB 3ZZXA 2JSYA 2IMEA 4NV5A 1X9MB 3L4NA 4HU7A 1EV4A 3CQFA 4KH7A 3G7YA 3C73A 2X64A 2PBJA 4WBJA 3UL3A 4ZIJA 1QQ2A 2IFQB 2FWGA 1OKTA 1GSFA 1WMJA 1OE8A 1YF0A 3I6AA 5ECMB 3IA1A 2FWFA 5ELAA 4FO5A 3C1RA 1SVLA 3FZAA 3W8SA 2V41A 1YEPA 3TJFA 1B4PA 3V1WA 5ECKB 3M8NA 2JZTA 1O6JA 2GS3A 1OC9B 3GA4A 3IE3A 4IW9A 4G0LA 1M9AA 1WP0A 2O85A 4LA1A 5D9TA 3N9JA 4DVCA 1HQOA 1SKWB 1Z7PA 3KMNA 4XTSA 1B9XC 3IR4A 2GT6A 4N3ZA 3ME8A 2FNOA 4L5LA 1RK4A 5CNWA 2K9FA 2LJKA 3FYGA 1WE0A 3TJKA 4ZB9A 2FWHA 1AAZA 4ZL8A 5A5KA 1EEMA 3D22A 4G0KA 2F8FA 1RW1A 5DCGA 3CHXC 5DCHA 1SKRB 3EURA 3MIXA 4K2XA 1S3AA 5COHA 4BWQA 4HQSA 1YDKA 2B7KA 3RBTA 4DSQA 1TXXA 4L8EA 3IXRA 1ZYEA 3I43A 1O8XA 3EU4A 4PNGA 2FA8A 4ICYA 3QFBC 3L0HA 1SL0B 1XZOA 3ERWA 1RQMA 4WEYA 4V2MA 2GQKA 2B5YA 2A2RA 5EY6A 4TR1B 3GN3A 2F9SA 2GVPA 1ILOA 1A0RP 4MK3A 3ZVJD 4FYBA 1HD2A 1V58A 5KEJA 2H1GA 3TKSE 4XIHA 2VM2A 2ZCTA 2FA4A 3JCML 4KDYA 4ACSA 2PUKC 5AGYA 3GKXA 2GDRA 5IPGA 1V40A 3PINA 1R26A 2VCQA 1N25A 2B7JA 2LNTA 2H19A 4J56E 4AJ6A 3IHQA 1TI3A 1Q98A 2L6DA 4HOJA 4WETA 1TK8B 5FT3A 4QMKA 4KW6A 2PGTA 2O3EA 2WZSA 4ID0A 3D4TA 5BMUA 4I97A 6GSUA 3F3RA 4GLTA 3EU3A 2YJHA 9GSSA 1F3BA 3VI5A 3ZFBA 2ZNMA 5ECQB 4GDFA 1FOHA 3CTGA 2H75A 1ZZYA 2I4AA 2LEGA 2WRTA 1ST9A 2H1BA 1FO5A 1WRYA 3VK9A 1SKSB 3F6FA 3RPNA 5IIZA 1PQNA 3GSTA 2WZ9A 4XS6A 4AJ7A 3HCZA 4D73B 1EOHA 4O92A 3GKNA 5F8BA 1THXA 2GSTA 2H1AA 3TRXA 1M2AA 5DQYA 3LWAA 3IPZA 1BAYA 1K0AA 4IP6A 2L4CA 5J47A 3HHVA 4K5RA 3D0ZA 4K0NA 1WWJA 2HRNA 3UBLA 3VWWA 3DVWA 2DJJA 5B8AA 1GULA 1SVOA 1TTZA 3E9JB 3H4KA 1PX7A 4ML6A 3H8QA 2XBIA 5G2ZA 1GSSA 1LU4A 1WOUA 4OD7A 1QK8A 3ZYWA 2HRKB 2B3SA 2IMIA 5B8BA 4GQFA 14GSA 1SK2A 5KN1A 1ZYQB 4PQ1A 5INYA 3ME7A 5J40A 18GSA 3M9KA 4GRFA 3CSHA 4MH3A 3TJGA 3C1SA 3LEFA 2HSYA 1PRXA 2GQLA 5F05A 4YAVA 3MAKA 1VRSD 3TB2A 1B8XA 4TN8A 2R0GA 4X4JA 3APSA 2VAFA 3IC8A 1QXHA 1X9WB 1UA5A 1PFOA 4WBRD 3I9V2 5D96A 5JCUA 4WR4A 3IAM2 2YCDA 4BL7B 4G0IA 3TKSA 8GSSA 3EYTA 4PXOA 3ZTLA 4I6XA 5ECRB 2DJ1A 1Q4JA 1TDIA 2TIRA 4LL4B 2D2ZA 1U6TA 2FHEA 2LKUA 4HUAA 4F82A 2AJQB 1G0TA 2IWTA 3HDCA 3ISOA 2DMMA 3RDWA 2H6ZA 1MTCA 4ECIA 3IAS2 1M3IA 2I1UA 4ZILA 3DXBA 5HR0A 5ECPB 4G10A 2CAQA 3KMOA 5HQPA 3MYDA 4F2IA 6GSSA 4ECJA 2RM5A 3HXSA 4KX4A 4PQHA 1A2JA 1QUWA 1SVMA 5L71A 1PMTA 2FUG2 1BJXA 2AB6A 4NXIA 2DJ3A 4MF6A 1GH2A 2EIQA 3BCIA 1A8YA 2RUFA 2VL2C 1K0DA 2K8SA 2B1LA 1W4VA 2HZEB 3GL5A 1XWCA 3KXOA 1EP7A 4EIQA 3DWVA 3FZ4A 2J23A 4I2TA 3QPMA 1O85A 2RLIA 2VIMA 1AQXA 2LRTA 2N5BA 3TKPA 3QMXA 3TCOA 2WW0A 4O5RA 4XHMA 4JR6A 2WW2A 5B7CA 3KP8A 3M1GA 4BVXB 2L6CA 3KD0A 1U88A 5ELGA 1PX6A 4JU5A 4DSSB 1HYUA 5KN0A 5DJMA 5H5RA 5F0GA 2C1YA 1T3BA 5IQYA 4QL9A 1YEWC 1UVZA 2WB9A 5A4VA 1B9YC 20GSA 1N8JA 5DALA 3CXGA 4Q5RA 4IS0A 4HZ4A 1NSWA 5CAXA 1KBNA 2GZYA 4Z2UA 1YY7A 1HNCA 3E3EA 2RIIA 4BA7A 3DIEA 1ON4A 4MLYA 3QR6A 4JBBA 4K5SA 3P8WA 4FXYP 3GKMA 2XPEA 4K2DA 1EZKA 2VCWA 1XVWA 4EL1A 3CTFA 3DVXA 5DAKB 5JCWA 1SD9A 4RI6A 4D73A 4OCFA 1SYRA 5CO3A 5GAND 3H1NA 4A5PA 3SBCA 2V6OA 2YNXA 1S3RA 5KOXA 4XRDA 1UN2A 2C3NA 2VKZG 2PVQA 4HU9A 1ZCPA 2H76A 3HKRA 2WW1A 3KTLA 4PI0C 2NTOA 4E8EA 1EGOA 2FCHA 3VLNA 4F9ZA 3CMIA 4YKGA 5D9VA 3HZ8A 1J9BA 4JRRA 4J2FA 2CVKA 2VO4A 2JL4A 1ZOFA 2HRKA 1Y1UA 2QC7A 1R7HA 3CRUA 3ZIJA 4NAXA 2YWNA 6GSVA 5E59A 3HVSA 1ERWA 3A3TA 4N11A 1MDJA 5J9BA 1WPIA 1K0NA 3S9FA 1Z7RA 5KN3A 2GSSA 2AHEA 5CRDA 3HD5A 4POBA 4IJ3A 2VUPA 1MDIA 1GTBA 1YKCA 5ECOB 1PN9A 2XC2A 1JFUA 1T7PB 4BL7A 3KH7A 2H71A 3UIWA
chains in the Genus database with same CATH topology
3HYPA 2MMAA 1UC7A 3BCKA 3LYPA 3IK7A 2OE1A 4F03A 3P7XA 3IHGA 3QAWA 1LJRA 1AUCA 3K8NA 4QL7A 1V98A 1GUMA 3UVHA 5IMZA 3WYWA 5IMVA 2E7PA 1YZXA 2IJYA 1OAZA 4EDYA 1XIYA 2PERA 2R4VA 4DEJA 4MJAA 2DJ0A 1XWGA 3FW2A 1EEJA 4EF0A 17GSA 4PUAA 4MJEA 3TJBA 3TUEA 5B6NA 3CSJA 3GYKA 1OKDA 3EVIA 2QSIA 2A2PA 1USBA 3GMFA 5G5FA 1THOA 2O8VB 1YKAA 3TKRA 1XW6A 3IDVA 2HZEA 1TXUA 4MZCA 2YJ7A 4POMA 1GWCA 2KHPA 4BPYA 2WDUA 2L57A 1PA3A 1TRVA 1AW9A 3ERFA 4L5OA 5JCGA 3UEMA 3C8EA 1T8EB 5D8IA 1MD4A 4LLRA 4BVXA 2TRCP 2X8HA 3G9BA 4DSSA 1W89A 4L0UA 4IP1A 4EXJA 4IKHA 1U3IA 1SJIA 2YZUA 3KCMA 3UOMA 2GGTA 4LMWA 5JWRB 3R3EA 3QOUA 5D9XA 1WJKA 1JZOA 4NV2A 1T4YA 2F8AA 2YPMA 3F4TA 4ECBA 1ABAA 4V2NA 3EC3A 1URMA 4IQAA 1QGVA 3QD9A 3VURA 2HNLA 3J7Yk 5ID2B 5CP1A 1TKDB 2PVOC 5LD0A 2B5XA 3QCPA 4O7HA 2H8LA 4MPGA 5LNKe 5DAKA 1BF5A 2FWEA 3W8JA 1ZGNA 4XS4B 1JZWA 5KN2A 1XW9A 1SJZA 6GSWA 5C00A 1YF1A 2LTKA 2OT3A 1K0CA 5KOWA 3TRPA 2B1KA 3FZ5A 1AC1A 5J4VA 4HS1A 3ZRDA 3F4RA 2AUVA 4ECCA 1GTUA 3NZNA 3QFAC 1QFNA 22GSA 2NBSA 2VLVA 2LQQA 1BG5A 3D5JA 2H72A 3TRQA 4GF0A 3FR3A 4WF5A 3NOFA 4GSTA 5ECLB 1EOGA 5DALB 3H79A 3IC4A 3PH9A 4N0VA 4TKYA 5DDLA 2KUCA 3HMJG 5B6MA 4MA9A 4GWRA 3Q74A 1O81A 3WD6A 2H6YA 3KGKA 4Z2RA 1FG4A 3KIJA 6GSYA 3IBHA 1H4OA 4MABA 1PGTA 1ML6A 2X99A 3OR5A 1X5EA 3KP9A 3MWHA 1Z3EA 4KE3A 5GAPD 3CWGA 4MDCA 4V1Ap 2GTUA 2BJXA 2KP2A 1SYXA 2IMKA 4GSSA 1R5PA 1SD8A 4HEA2 1E6BA 3HVVA 4Q5FA 1VF4A 1A2MA 3IRAA 4TXOB 1I5GA 2PWJA 3G7IA 4MZWA 2H01A 4GSNA 5J4YA 4G2EA 2HSHA 2M72A 1JHBA 4DSRA 1T00A 5CYYA 2DKIA 2JZSA 2V6KA 3GX0A 4OFTA 3KTBA 4JEDA 5J9CA 2AAWA 4NWYA 2X4AA 1T4ZA 3DD3A 2R2JA 2PPTA 3DMLA 2L5LA 1AXDA 1M0UA 1TU8A 5IO2A 2CZ3A 3KH9A 5A4WA 1PD21 4AGSA 1IYIA 1FVKA 3UARA 4W66A 7GSSA 1O7UA 3F0IA 2IMFA 3WT2A 4O5UA 4MF7A 4ZB8A 2XPDA 1TK0B 4E68A 1TOFA 1A2LA 3HZ4A 1E2YA 5IO0A 3TOTA 4NPBA 1PL2A 1J08A 3GX8A 4WKWA 2HE3A 2YV9A 11GSA 1GSYA 5D93A 5CREA 5ECSA 1S3DA 3MNGA 1X5CA 2CVBA 3GH9A 3VFIA 3F6DA 1DSBA 2YWMA 1XOBA 2N5AA 1G7EA 1F9MA 1Y25A 3FK8A 4L0WA 5HFIA 2BMXA 1OE7A 4IHUA 4KSMA 4HJ2A 1PL1A 1TJDA 4MP4A 2AV4A 4ZL7A 1DUGA 5ID2A 5CRGA 3TKQA 2H66A 2IMDA 3DKSA 4YQUA 1IYHA 1SK1A 1Z6NA 3HJMA 1YEXA 2YN1A 4CDOA 2DJ2A 2KOKA 4AJ8A 1NHYA 2GZZA 12GSA 2H1LA 4TW5A 5HFKA 4TOPA 2H74A 1JLVA 2LQOA 2YOIA 3M3MA 2A2SA 4XS4A 4K1FA 3APOA 1TU7A 1GL8A 1V9WA 1SENA 1GRXA 2NPBA 4X43A 3H93A 2I81A 3DYRA 19GSA 3F9UA 2LV3A 4J57E 3I69A 1PKZA 3KJYA 2VL9A 1TRSA 3RHBA 4GXZA 1QMVA 3HVXA 1O8WA 1HNBA 2DIZA 2P0GA 2G0FA 3TDGA 1ACVA 3BD2A 3G7JA 3D4MA 4HQZA 3UMAA 3FKFA 2TRXA 4TR0A 4YAPA 2LUSA 4YQVA 2ES7A 3UAPA 2OE3A 3KM6A 4GTUA 1A23A 3MSZA 2F3MA 4ZBBA 3M9JA 4XS1A 1GLPA 4QQ7A 3VWVA 1A24A 4WR5A 4MPFA 2GSQA 4OFMA 3LG6A 2EC4A 2JADA 1U87A 3RHCA 1Z6MA 2E0QA 2GSRA 2YZHA 4P3YB 2C0DA 4EKZA 10GSA 5ABRA 3LGCA 4JZQA 3DEXA 2HRFA 4ML1A 1DE2A 1F2EA 3AY8A 4AKXB 4Q5NA 4KA0A 1JZDA 4G9HA 4KDXA 2JSZA 2O5VA 4TXOA 1SJ6A 5ECIB 5HFGA 4O5QA 3EMPA 1BYEA 2K18A 4PQIA 2HSNA 3WGXA 4F0CA 5IMCA 4MJCA 4HI7A 5G30A 4N30A 2WS2A 2AYTA 4E8HA 4MH2A 1ZYPA 5AIXA 2N5FA 3ZMLA 1G6WA 3ZFLA 1WIKA 4G01A 2RUEA 3C71A 2C0EA 2OADA 5J5NA 4EO3A 2EFDA 5A5HB 4O32A 4YH2A 2LJAA 5F06A 4KAEA 1GSUA 1HNAA 1M99A 2DBCA 5DVBA 4TR4A 3FEUA 4V1Ag 1VF2A 3VPTA 5AISA 5J41A 1ERTA 4POKA 2JU5A 2C4JA 2DC5A 2X49A 2CQ9A 1NM3A 2VLUA 2M80A 1M7TA 2FY6A 2R6KA 2EIRA 2WCIA 1F37A 3UJ1A 4MMMA 4FH8A 3FRCA 3WT1A 2YP6A 2G2QA 1A0FA 2GZPA 4ILFA 2Z9SA 2VD0A 1SK0A 2K6VA 2MZCA 2BTOT 3LXTA 4TRXA 1XCCA 1CQHA 3N5OA 5HR2A 4V2LA 3UVTA 2DIYA 3SWLA 2ON5A 3VWXA 5J3RA 2O89A 2PMTA 2C0FA 3RPPA 1XBSA 2ALBA 3KZQA 2IPAA 3ERGA 3FZ9A 3MDKA 2GQMA 2VD1A 5JWOB 2P5RA 4ZB6A 1F3AA 1K0BA 3EMXA 1C72A 2YV7A 2HI7A 2MBSA 5IOXA 3Q6OA 4BVYB 6GSXA 3GH6A 4N10A 1R4WA 1R5AA 1V2AA 3E0UA 2C8UA 4K7NA 5G1KA 3IV4A 1XWKA 4RQXA 4MF5A 3GURA 3ZITA 5D9WA 3L9SA 3LQ7A 1SU9A 4EC0A 3D21A 2OBKA 4OCEA 3VPQA 5E4WA 4NMUA 1EWXA 1ERVA 2LNSA 4AI6A 1FB0A 3O76A 1F6MC 2GLRA 5DBQA 3RAZA 2CZ2A 2O7KA 2VL2A 3TKSC 3QAVA 2YANA 3LJRA 1M2BA 5AN1A 3TJJA 4WXTA 2NDOA 3EE2A 3A5WA 2E2GA 1GNEA 3UBKA 2GT5A 3U5RE 2HLSA 16GSA 1GUHA 1M2DA 2UV8G 1TRWA 3DRNA 4AF2A 2LJRA 2H30A 4IELA 2YWOA 1M9BA 4PNFA 2A4HA 1OYJA 5BRTA 4N0ZA 4F0BA 2FLSA 1VF3A 4K6XA 2VLTA 2CAIA 3WGDA 2XHFA 2UZ8A 2OBIA 4HZ2A 4KSOA 1KEBA 3CRTA 4RUVA 2OE0A 5IMDA 2CVDA 2VCXA 2IN3A 4PTSA 5EVOA 1PKWA 4K7IA 2H0GA 2HQTA 2DKHA 1MD3A 2H6XA 4EUYA 3M0FA 1FVJA 4PURA 3J7Yb 4XCSA 4EDZA 1JZRA 3QAGA 2H1DA 1PN0A 4KCEA 1CQGA 1MDKA 4ZL9A 4RQRA 2YWIA 1XWAA 1VF1A 3GNJA 5LCZA 4PX1A 1KNGA 2LS5A 1XVQA 3FR9A 5CRWA 4X0XA 2DMLA 3Q18A 5A5HA 2H0IA 1NW2A 4I5QA 5CRHA 1Y6EA 3TOUA 3GIXA 3GV1A 2WFCA 3PGTA 4KDUA 5IOWA 2VL3A 5A34B 1U3AA 1K3OA 2WGRA 2HFDA 4G19A 1GTAA 1X0RA 1A8LA 1AQVA 2VCTA 5EL8A 5FWGA 2V2GA 2B6MA 4OO5A 2P31A 2EFHA 2JACA 4Z7XA 1ZYNA 4FIWA 4I8BA 3GKKA 1OC8A 3LSZA 3ZVJA 2LRCA 3L78A 4EIPA 1SL1B 2KLXA 4YKFA 3GTUB 2VM1A 4H86A 1OVNA 2DLXA 5ECHB 1K0OA 4ISDA 1GLQA 3EWLA 1DBYA 1AIUA 2WULA 4X1UA 1T1VA 4HJMA 2MMNA 2X8GA 4TVEA 5C04A 1GSEA 3WGEA 3CYNA 2HSNB 3VI7A 2A4VA 4IGJA 3BBYA 2QGVA 2CV4A 2L4QA 5HR3A 3W6GA 1XOAA 5IMFA 5ECNB 3A2WA 2NVLA 2REMA 4BVYA 1X5DA 1TK5B 2IIYA 4NHWA 1ERUA 1MEKA 4ZXGA 2IFQA 3O3TA 4KF9A 1JLWA 4TXVA 2VCZA 2PU9C 1XW5A 3L9UA 3IOSA 2C3TA 4FYUA 3U6VA 2HSMB 2KP1A 3F63A 3HJOA 1YVLA 5A1NB 3TGZA 1OC9A 1YJ6A 5G5EA 3LYKA 1K3YA 3GRXA 5H5SA 3FY7A 2FGXA 1K3LA 1XFLA 4RI7A 4FQUA 4YQMA 4OWYA 4EVMA 3PPUA 5AIVA 4XRAA 4CY6A 2MMZA 2B5EA 4K0GA 3A2XA 1K0MA 5GSTA 2QKEA 3C7MA 1TP9A 2L59A 2V1MA 3GHAA 2OKAA 4LMVA 2P5QA 4PGTA 2J9HA 4IVFA 4IQ1A 2O87A 2CX3A 1KTEA 4POLA 1FOVA 4KNDA 4CHSA 2L5OA 4Q5QA 5ENUA 2EFCA 3EPTA 3ZL5A 4Z2TA 1O73A 3BOAA 4GQCA 3FHKA 5J4UA 4OO4A 4JE1A 3A5IA 4AKGA 1FW1A 4IBPA 2R37A 1GUKA 2JZRA 4ZBAA 3F4SA 4K8MA 2V32A 1VGLA 3D6IA 2DSAA 2R5GA 5F07A 3LXZA 5GZZB 4TR1A 1DE1A 3NIVA 4ZB7A 3LFLA 4ULXA 2C3QA 2I9HA 1XWBA 3EINA 4LL1B 4MNNA 2OACA 3US3A 4IN0A 1N2AA 1BG1A 5GSSA 2CA8A 2H70A 2CT6A 3LW9A 5H5QA 3IK9A 2VOCA 1GSQA 5IM9A 3F8UA 4MJBA 4AKHA 2CX4A 1GTIA 2MYGA 3FR6A 3ZREA 2HYXA 2ON7A 1BX9A 1G6YA 5FHIA 2F51A 4OFNA 1ZMAA 4BWSA 2LSTA 4CY8A 1GSDA 2VCVA 5HR1A 3GUSA 3Q19A 1NHOA 2M46A 4EE0A 13GSA 1Z9HA 2C0GA 2I3YA 2E2MA 2EIOA 1FAAA 3DGQA 5A34A 1XPVA 6GSTA 3F3QA 2OA7A 4PUFC 1BEDA 1ZL9A 3ZIVA 4MCUA 1EGRA 2H73A 1TW9A 1J0FA 2MBTA 1TI1A 5IPHA 3LORA 4IJIA 4JR4A 1PSQA 2EFEA 1X9SB 3APQA 4KB3A 2ZUPA 5EPFA 2K8VA 3KEBA 3GTUA 1YQ1A 5A4UA 3HJPA 2MMOA 4FYCA 1B4QA 3HA9A 3O6TA 1FB6A 4HDEA 1G7OA 2R0CA 2DJKA 2FD3A 1EP8A 3A2VA 2R0PA 3VWUA 1V57A 5D73A 1S3CA 2HXKA 2XBQA 1LBKA 2HT9A 3TU3B 1SL2B 4USSA 5G31A 3CSIA 4WF4A 2QA1A 1B48A 4MZBA 1TRUA 2HRAA 5G1LA 5IMAA 5DJLA 4KGIA 2QA2A 1FHEA 1Z5YE 3ZMKA 4K7OA 3L9VA 3FMWA 2LRNA 1H75A 3ZLPA 4K9ZA 3QDNA 2HSMA 4CW9A 4NHZA 4OMVA 1I9DA 2IL3A 5BMUB 1OC3A 3CBUA 4KUNA 1BQ7A 2H0HA 2C80A 2R3XA 3HY2A 5A1NA 2PN8A 5DQSA 3P2AA 2WJUA 3PR8A 4KCAA 4TR3A 4I2UA 4ZBDA 3GFKA 2X8CA 3P90A 2RM6A 2OJLA 3GL3A 3R2QA 1XXUA 1AQWA 1GP1A 3BJ5A 3GSSA 4AKIA 1GNWA 4GCIA 1EV9A 3ED3A 2HZFA 5JWQB 3ZZXA 2JSYA 2IMEA 4NV5A 1X9MB 3L4NA 4HU7A 1EV4A 4KH7A 3G7YA 3C73A 2X64A 2PBJA 4WBJA 3UL3A 4ZIJA 1QQ2A 2IFQB 2FWGA 1OKTA 1GSFA 1WMJA 1OE8A 1YF0A 3I6AA 5ECMB 3IA1A 2FWFA 5ELAA 4FO5A 3C1RA 1SVLA 3FZAA 3W8SA 2V41A 1YEPA 3TJFA 1B4PA 3V1WA 5ECKB 3M8NA 2JZTA 1O6JA 2GS3A 1OC9B 3GA4A 3IE3A 4IW9A 4G0LA 1M9AA 1WP0A 2O85A 4LA1A 5D9TA 3N9JA 4DVCA 1HQOA 1SKWB 1Z7PA 3KMNA 4XTSA 1B9XC 3IR4A 2GT6A 4N3ZA 3ME8A 2FNOA 4L5LA 1RK4A 5CNWA 2K9FA 2LJKA 3FYGA 1WE0A 3TJKA 4ZB9A 2FWHA 1AAZA 4ZL8A 5A5KA 1EEMA 3D22A 4G0KA 2F8FA 1RW1A 5DCGA 5DCHA 1SKRB 3EURA 3MIXA 4K2XA 1S3AA 5COHA 4BWQA 4HQSA 1YDKA 2B7KA 3RBTA 4DSQA 1TXXA 4L8EA 3IXRA 1ZYEA 3I43A 1O8XA 3EU4A 4PNGA 2FA8A 4ICYA 3QFBC 3L0HA 1SL0B 1XZOA 3ERWA 1RQMA 4WEYA 4V2MA 2GQKA 2B5YA 2A2RA 5EY6A 4TR1B 3GN3A 2F9SA 2GVPA 1ILOA 1A0RP 4MK3A 3ZVJD 4FYBA 1HD2A 1V58A 5KEJA 2H1GA 3TKSE 4XIHA 2VM2A 2ZCTA 2FA4A 3JCML 4KDYA 4ACSA 2PUKC 5AGYA 3GKXA 2GDRA 5IPGA 1V40A 3PINA 1R26A 2VCQA 1N25A 2B7JA 2LNTA 2H19A 4J56E 4AJ6A 3IHQA 1TI3A 1Q98A 2L6DA 4HOJA 4WETA 1TK8B 5FT3A 4QMKA 4KW6A 2PGTA 4ID0A 3D4TA 5BMUA 4I97A 6GSUA 3F3RA 4GLTA 3EU3A 2YJHA 9GSSA 1F3BA 3VI5A 3ZFBA 2ZNMA 5ECQB 4GDFA 1FOHA 3CTGA 2H75A 1ZZYA 2I4AA 2LEGA 2WRTA 1ST9A 2H1BA 1FO5A 1WRYA 3VK9A 1SKSB 3F6FA 3RPNA 5IIZA 1PQNA 3GSTA 2WZ9A 4XS6A 4AJ7A 3HCZA 4D73B 1EOHA 4O92A 3GKNA 5F8BA 1THXA 2GSTA 2H1AA 3TRXA 1M2AA 5DQYA 3LWAA 3IPZA 1BAYA 1K0AA 4IP6A 2L4CA 5J47A 3HHVA 4K5RA 3D0ZA 4K0NA 1WWJA 2HRNA 3UBLA 3VWWA 3DVWA 2DJJA 5B8AA 1GULA 1SVOA 1TTZA 3E9JB 3H4KA 1PX7A 4ML6A 3H8QA 2XBIA 5G2ZA 1GSSA 1LU4A 1WOUA 4OD7A 1QK8A 3ZYWA 2HRKB 2B3SA 2IMIA 5B8BA 4GQFA 14GSA 1SK2A 5KN1A 1ZYQB 4PQ1A 5INYA 3ME7A 5J40A 18GSA 3M9KA 4GRFA 3CSHA 4MH3A 3TJGA 3C1SA 3LEFA 2HSYA 1PRXA 2GQLA 5F05A 4YAVA 3MAKA 1VRSD 3TB2A 1B8XA 4TN8A 2R0GA 4X4JA 3APSA 2VAFA 3IC8A 1QXHA 1X9WB 1UA5A 4WBRD 3I9V2 5D96A 5JCUA 4WR4A 3IAM2 2YCDA 4BL7B 4G0IA 3TKSA 8GSSA 3EYTA 4PXOA 3ZTLA 4I6XA 5ECRB 2DJ1A 1Q4JA 1TDIA 2TIRA 4LL4B 2D2ZA 1U6TA 2FHEA 2LKUA 4HUAA 4F82A 2AJQB 1G0TA 2IWTA 3HDCA 3ISOA 2DMMA 3RDWA 2H6ZA 1MTCA 4ECIA 3IAS2 2I1UA 4ZILA 3DXBA 5HR0A 5ECPB 4G10A 2CAQA 3KMOA 5HQPA 3MYDA 4F2IA 6GSSA 4ECJA 2RM5A 3HXSA 4KX4A 4PQHA 1A2JA 1QUWA 1SVMA 5L71A 1PMTA 2FUG2 1BJXA 2AB6A 4NXIA 2DJ3A 4MF6A 1GH2A 2EIQA 3BCIA 1A8YA 2RUFA 2VL2C 1K0DA 2K8SA 2B1LA 1W4VA 2HZEB 3GL5A 1XWCA 3KXOA 1EP7A 4EIQA 3DWVA 3FZ4A 2J23A 4I2TA 3QPMA 1O85A 2RLIA 2VIMA 1AQXA 2LRTA 2N5BA 3TKPA 3QMXA 3TCOA 4O5RA 4XHMA 4JR6A 5B7CA 3KP8A 3M1GA 4BVXB 2L6CA 3KD0A 1U88A 5ELGA 1PX6A 4JU5A 4DSSB 1HYUA 5KN0A 5DJMA 5H5RA 5F0GA 2C1YA 1T3BA 5IQYA 4QL9A 1UVZA 2WB9A 5A4VA 1B9YC 20GSA 1N8JA 5DALA 3CXGA 4Q5RA 4IS0A 4HZ4A 1NSWA 5CAXA 1KBNA 2GZYA 4Z2UA 1YY7A 1HNCA 3E3EA 2RIIA 4BA7A 3DIEA 1ON4A 4MLYA 3QR6A 4JBBA 4K5SA 3P8WA 3GKMA 2XPEA 4K2DA 1EZKA 2VCWA 1XVWA 4EL1A 3CTFA 3DVXA 5DAKB 5JCWA 1SD9A 4RI6A 4D73A 4OCFA 1SYRA 5CO3A 5GAND 3H1NA 4A5PA 3SBCA 2V6OA 2YNXA 5KOXA 4XRDA 1UN2A 2C3NA 2VKZG 2PVQA 4HU9A 1ZCPA 2H76A 3HKRA 3KTLA 2NTOA 4E8EA 1EGOA 2FCHA 3VLNA 4F9ZA 3CMIA 4YKGA 5D9VA 3HZ8A 1J9BA 4JRRA 4J2FA 2CVKA 2VO4A 2JL4A 1ZOFA 2HRKA 1Y1UA 2QC7A 1R7HA 3CRUA 3ZIJA 4NAXA 2YWNA 6GSVA 5E59A 3HVSA 1ERWA 3A3TA 4N11A 1MDJA 5J9BA 1WPIA 1K0NA 3S9FA 1Z7RA 5KN3A 2GSSA 2AHEA 5CRDA 3HD5A 4POBA 4IJ3A 2VUPA 1MDIA 1GTBA 1YKCA 5ECOB 1PN9A 2XC2A 1JFUA 1T7PB 4BL7A 3KH7A 2H71A 3UIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYP A;  2MMA A;  1UC7 A;  3BCK A;  3LYP A;  3IK7 A;  2OE1 A;  4F03 A;  3P7X A;  3QAW A;  1LJR A;  1AUC A;  3K8N A;  4QL7 A;  1V98 A;  1GUM A;  3UVH A;  5IMZ A;  3WYW A;  5IMV A;  2E7P A;  1YZX A;  2IJY A;  1OAZ A;  4EDY A;  1XIY A;  2PER A;  2R4V A;  4DEJ A;  4MJA A;  2DJ0 A;  1XWG A;  3FW2 A;  1EEJ A;  4EF0 A;  17GS A;  4PUA A;  4MJE A;  3TJB A;  3TUE A;  5B6N A;  3CSJ A;  3GYK A;  1OKD A;  3EVI A;  2QSI A;  1USB A;  3GMF A;  5G5F A;  1THO A;  2O8V B;  1YKA A;  3TKR A;  1XW6 A;  3IDV A;  2HZE A;  4MZC A;  2YJ7 A;  4POM A;  1GWC A;  2KHP A;  4BPY A;  2WDU A;  2L57 A;  1PA3 A;  1TRV A;  1AW9 A;  3ERF A;  4L5O A;  5JCG A;  3UEM A;  3C8E A;  1T8E B;  5D8I A;  1MD4 A;  4LLR A;  4BVX A;  2TRC P;  2X8H A;  3G9B A;  4DSS A;  1W89 A;  4L0U A;  4IP1 A;  4EXJ A;  4IKH A;  1U3I A;  1SJI A;  2YZU A;  3KCM A;  3UOM A;  2GGT A;  4LMW A;  5JWR B;  3R3E A;  3QOU A;  5D9X A;  1WJK A;  1JZO A;  4NV2 A;  1T4Y A;  2F8A A;  2YPM A;  3F4T A;  4ECB A;  1ABA A;  4V2N A;  3EC3 A;  1URM A;  4IQA A;  1QGV A;  3QD9 A;  3VUR A;  2HNL A;  3J7Y k;  5ID2 B;  5CP1 A;  1TKD B;  2PVO C;  5LD0 A;  2B5X A;  3QCP A;  4O7H A;  2H8L A;  4MPG A;  5LNK e;  5DAK A;  2FWE A;  3W8J A;  1ZGN A;  4XS4 B;  1JZW A;  5KN2 A;  1XW9 A;  1SJZ A;  6GSW A;  5C00 A;  1YF1 A;  2LTK A;  1K0C A;  3TRP A;  2B1K A;  3FZ5 A;  1AC1 A;  4HS1 A;  3ZRD A;  3F4R A;  2AUV A;  4ECC A;  1GTU A;  3NZN A;  3QFA C;  1QFN A;  22GS A;  2NBS A;  2VLV A;  2LQQ A;  1BG5 A;  3D5J A;  2H72 A;  3TRQ A;  4GF0 A;  3FR3 A;  4WF5 A;  3NOF A;  4GST A;  5ECL B;  1EOG A;  5DAL B;  3H79 A;  3IC4 A;  3PH9 A;  4N0V A;  4TKY A;  5DDL A;  2KUC A;  5B6M A;  4MA9 A;  4GWR A;  3Q74 A;  1O81 A;  3WD6 A;  2H6Y A;  3KGK A;  1FG4 A;  3KIJ A;  6GSY A;  3IBH A;  1H4O A;  4MAB A;  1PGT A;  1ML6 A;  2X99 A;  3OR5 A;  1X5E A;  3KP9 A;  3MWH A;  1Z3E A;  4KE3 A;  5GAP D;  4MDC A;  4V1A p;  2GTU A;  2BJX A;  2KP2 A;  1SYX A;  2IMK A;  4GSS A;  1R5P A;  1SD8 A;  4HEA 2;  1E6B A;  3HVV A;  4Q5F A;  1VF4 A;  1A2M A;  3IRA A;  4TXO B;  1I5G A;  2PWJ A;  3G7I A;  4MZW A;  2H01 A;  4GSN A;  4G2E A;  2HSH A;  2M72 A;  1JHB A;  4DSR A;  1T00 A;  5CYY A;  2JZS A;  2V6K A;  3GX0 A;  4OFT A;  3KTB A;  4JED A;  5J9C A;  2AAW A;  4NWY A;  1T4Z A;  3DD3 A;  2R2J A;  2PPT A;  3DML A;  2L5L A;  1AXD A;  1M0U A;  1TU8 A;  5IO2 A;  2CZ3 A;  3KH9 A;  5A4W A;  1PD2 1;  4AGS A;  1IYI A;  1FVK A;  3UAR A;  7GSS A;  1O7U A;  3F0I A;  2IMF A;  3WT2 A;  4MF7 A;  4ZB8 A;  2XPD A;  1TK0 B;  1TOF A;  1A2L A;  3HZ4 A;  1E2Y A;  5IO0 A;  3TOT A;  4NPB A;  1PL2 A;  1J08 A;  3GX8 A;  4WKW A;  2HE3 A;  2YV9 A;  11GS A;  1GSY A;  5D93 A;  5CRE A;  5ECS A;  1S3D A;  3MNG A;  1X5C A;  2CVB A;  3GH9 A;  3VFI A;  3F6D A;  1DSB A;  2YWM A;  1XOB A;  2N5A A;  1G7E A;  1F9M A;  1Y25 A;  3FK8 A;  4L0W A;  5HFI A;  2BMX A;  1OE7 A;  4IHU A;  4KSM A;  4HJ2 A;  1PL1 A;  1TJD A;  4MP4 A;  2AV4 A;  4ZL7 A;  1DUG A;  5ID2 A;  5CRG A;  3TKQ A;  2H66 A;  2IMD A;  3DKS A;  4YQU A;  1IYH A;  1SK1 A;  1Z6N A;  3HJM A;  1YEX A;  2YN1 A;  4CDO A;  2DJ2 A;  2KOK A;  4AJ8 A;  1NHY A;  2GZZ A;  12GS A;  4TW5 A;  5HFK A;  4TOP A;  2H74 A;  1JLV A;  2LQO A;  2YOI A;  3M3M A;  2A2S A;  4XS4 A;  4K1F A;  3APO A;  1TU7 A;  1GL8 A;  1V9W A;  1SEN A;  1GRX A;  2NPB A;  4X43 A;  3H93 A;  2I81 A;  3DYR A;  19GS A;  3F9U A;  2LV3 A;  4J57 E;  3I69 A;  1PKZ A;  3KJY A;  2VL9 A;  1TRS A;  3RHB A;  4GXZ A;  1QMV A;  3HVX A;  1O8W A;  1HNB A;  2DIZ A;  2P0G A;  2G0F A;  3TDG A;  1ACV A;  3BD2 A;  3G7J A;  3D4M A;  4HQZ A;  3UMA A;  3FKF A;  2TRX A;  4TR0 A;  4YAP A;  2LUS A;  4YQV A;  2ES7 A;  3UAP A;  2OE3 A;  3KM6 A;  4GTU A;  1A23 A;  3MSZ A;  2F3M A;  4ZBB A;  3M9J A;  4XS1 A;  1GLP A;  4QQ7 A;  3VWV A;  1A24 A;  4WR5 A;  4MPF A;  2GSQ A;  4OFM A;  3LG6 A;  2EC4 A;  2JAD A;  1U87 A;  3RHC A;  1Z6M A;  2E0Q A;  2GSR A;  2YZH A;  4P3Y B;  2C0D A;  4EKZ A;  10GS A;  5ABR A;  3LGC A;  4JZQ A;  3DEX A;  2HRF A;  4ML1 A;  1DE2 A;  1F2E A;  3AY8 A;  4Q5N A;  4KA0 A;  1JZD A;  4G9H A;  4KDX A;  2JSZ A;  4TXO A;  1SJ6 A;  5ECI B;  5HFG A;  3EMP A;  1BYE A;  2K18 A;  4PQI A;  3WGX A;  4F0C A;  5IMC A;  4MJC A;  4HI7 A;  5G30 A;  4N30 A;  2WS2 A;  2AYT A;  4E8H A;  4MH2 A;  5AIX A;  2N5F A;  3ZML A;  1G6W A;  3ZFL A;  1WIK A;  2RUE A;  3C71 A;  2C0E A;  2OAD A;  5J5N A;  4EO3 A;  4O32 A;  4YH2 A;  2LJA A;  5F06 A;  4KAE A;  1GSU A;  1HNA A;  1M99 A;  2DBC A;  5DVB A;  4TR4 A;  3FEU A;  4V1A g;  1VF2 A;  3VPT A;  5AIS A;  5J41 A;  1ERT A;  4POK A;  2JU5 A;  2C4J A;  2DC5 A;  2CQ9 A;  1NM3 A;  2VLU A;  2M80 A;  1M7T A;  2FY6 A;  2R6K A;  2EIR A;  2WCI A;  1F37 A;  3UJ1 A;  4MMM A;  4FH8 A;  3FRC A;  3WT1 A;  2YP6 A;  2G2Q A;  1A0F A;  2GZP A;  4ILF A;  2Z9S A;  2VD0 A;  1SK0 A;  2K6V A;  2MZC A;  2BTO T;  3LXT A;  4TRX A;  1XCC A;  1CQH A;  3N5O A;  5HR2 A;  4V2L A;  3UVT A;  2DIY A;  3SWL A;  2ON5 A;  3VWX A;  5J3R A;  2O89 A;  2PMT A;  2C0F A;  3RPP A;  1XBS A;  2ALB A;  3KZQ A;  2IPA A;  3ERG A;  3FZ9 A;  3MDK A;  2GQM A;  2VD1 A;  5JWO B;  2P5R A;  4ZB6 A;  1F3A A;  1K0B A;  3EMX A;  1C72 A;  2YV7 A;  2HI7 A;  2MBS A;  5IOX A;  3Q6O A;  4BVY B;  6GSX A;  3GH6 A;  4N10 A;  1R4W A;  1R5A A;  1V2A A;  3E0U A;  2C8U A;  4K7N A;  5G1K A;  3IV4 A;  1XWK A;  4RQX A;  4MF5 A;  3GUR A;  3ZIT A;  5D9W A;  3L9S A;  3LQ7 A;  1SU9 A;  4EC0 A;  3D21 A;  2OBK A;  4OCE A;  3VPQ A;  5E4W A;  4NMU A;  1EWX A;  1ERV A;  2LNS A;  1FB0 A;  3O76 A;  1F6M C;  2GLR A;  5DBQ A;  3RAZ A;  2CZ2 A;  2O7K A;  2VL2 A;  3TKS C;  3QAV A;  2YAN A;  3LJR A;  1M2B A;  5AN1 A;  3TJJ A;  4WXT A;  2NDO A;  3EE2 A;  3A5W A;  2E2G A;  1GNE A;  3UBK A;  2GT5 A;  3U5R E;  2HLS A;  16GS A;  1GUH A;  1M2D A;  1TRW A;  3DRN A;  4AF2 A;  2LJR A;  2H30 A;  4IEL A;  2YWO A;  1M9B A;  4PNF A;  1OYJ A;  4N0Z A;  4F0B A;  2FLS A;  1VF3 A;  4K6X A;  2VLT A;  2CAI A;  3WGD A;  2XHF A;  2UZ8 A;  2OBI A;  4HZ2 A;  4KSO A;  1KEB A;  3CRT A;  4RUV A;  2OE0 A;  5IMD A;  2CVD A;  2VCX A;  2IN3 A;  4PTS A;  5EVO A;  1PKW A;  4K7I A;  2H0G A;  2HQT A;  1MD3 A;  2H6X A;  4EUY A;  3M0F A;  1FVJ A;  4PUR A;  3J7Y b;  4XCS A;  4EDZ A;  1JZR A;  3QAG A;  2H1D A;  4KCE A;  1CQG A;  1MDK A;  4ZL9 A;  4RQR A;  2YWI A;  1XWA A;  1VF1 A;  3GNJ A;  5LCZ A;  4PX1 A;  1KNG A;  2LS5 A;  1XVQ A;  3FR9 A;  5CRW A;  4X0X A;  2DML A;  3Q18 A;  2H0I A;  1NW2 A;  4I5Q A;  5CRH A;  1Y6E A;  3TOU A;  3GIX A;  3GV1 A;  2WFC A;  3PGT A;  4KDU A;  5IOW A;  2VL3 A;  1U3A A;  1K3O A;  2WGR A;  2HFD A;  4G19 A;  1GTA A;  1X0R A;  1A8L A;  1AQV A;  2VCT A;  5EL8 A;  5FWG A;  2V2G A;  2B6M A;  4OO5 A;  2P31 A;  4Z7X A;  2JAC A;  4FIW A;  4I8B A;  3GKK A;  1OC8 A;  3LSZ A;  3ZVJ A;  2LRC A;  3L78 A;  1SL1 B;  2KLX A;  3GTU B;  2VM1 A;  4H86 A;  1OVN A;  2DLX A;  5ECH B;  1K0O A;  4ISD A;  1GLQ A;  3EWL A;  1DBY A;  1AIU A;  2WUL A;  4X1U A;  1T1V A;  4HJM A;  2MMN A;  2X8G A;  4TVE A;  5C04 A;  1GSE A;  3WGE A;  3CYN A;  2HSN B;  3VI7 A;  2A4V A;  4IGJ A;  3BBY A;  2QGV A;  2CV4 A;  2L4Q A;  5HR3 A;  3W6G A;  1XOA A;  5IMF A;  5ECN B;  3A2W A;  2NVL A;  2REM A;  4BVY A;  1X5D A;  1TK5 B;  2IIY A;  4NHW A;  1ERU A;  1MEK A;  4ZXG A;  2IFQ A;  3O3T A;  4KF9 A;  1JLW A;  4TXV A;  2VCZ A;  2PU9 C;  1XW5 A;  3L9U A;  3IOS A;  2C3T A;  4FYU A;  3U6V A;  2HSM B;  2KP1 A;  3F63 A;  3HJO A;  3TGZ A;  1OC9 A;  1YJ6 A;  5G5E A;  3LYK A;  1K3Y A;  3GRX A;  5H5S A;  3FY7 A;  2FGX A;  1K3L A;  1XFL A;  4RI7 A;  4FQU A;  4YQM A;  4OWY A;  4EVM A;  3PPU A;  5AIV A;  4XRA A;  2MMZ A;  2B5E A;  4K0G A;  3A2X A;  1K0M A;  5GST A;  2QKE A;  3C7M A;  1TP9 A;  2L59 A;  2V1M A;  3GHA A;  2OKA A;  4LMV A;  2P5Q A;  4PGT A;  2J9H A;  4IVF A;  4IQ1 A;  2O87 A;  2CX3 A;  1KTE A;  4POL A;  1FOV A;  4KND A;  4CHS A;  2L5O A;  4Q5Q A;  5ENU A;  3ZL5 A;  1O73 A;  3BOA A;  4GQC A;  3FHK A;  5J4U A;  4OO4 A;  4JE1 A;  1FW1 A;  4IBP A;  2R37 A;  1GUK A;  2JZR A;  4ZBA A;  3F4S A;  4K8M A;  2V32 A;  1VGL A;  3D6I A;  2DSA A;  2R5G A;  5F07 A;  3LXZ A;  5GZZ B;  4TR1 A;  1DE1 A;  3NIV A;  3LFL A;  4ULX A;  2C3Q A;  2I9H A;  1XWB A;  3EIN A;  4LL1 B;  2OAC A;  3US3 A;  4IN0 A;  1N2A A;  5GSS A;  2CA8 A;  2H70 A;  2CT6 A;  5H5Q A;  3IK9 A;  2VOC A;  1GSQ A;  5IM9 A;  3F8U A;  4MJB A;  2CX4 A;  1GTI A;  2MYG A;  3FR6 A;  3ZRE A;  2HYX A;  2ON7 A;  1BX9 A;  1G6Y A;  5FHI A;  2F51 A;  4OFN A;  1ZMA A;  4BWS A;  2LST A;  1GSD A;  2VCV A;  5HR1 A;  3GUS A;  3Q19 A;  1NHO A;  2M46 A;  4EE0 A;  13GS A;  1Z9H A;  2C0G A;  2I3Y A;  2E2M A;  2EIO A;  1FAA A;  3DGQ A;  1XPV A;  6GST A;  3F3Q A;  2OA7 A;  4PUF C;  1BED A;  1ZL9 A;  3ZIV A;  4MCU A;  1EGR A;  2H73 A;  1TW9 A;  1J0F A;  2MBT A;  1TI1 A;  5IPH A;  3LOR A;  4IJI A;  4JR4 A;  1PSQ A;  1X9S B;  3APQ A;  4KB3 A;  2ZUP A;  5EPF A;  2K8V A;  3KEB A;  3GTU A;  1YQ1 A;  5A4U A;  3HJP A;  2MMO A;  4FYC A;  1B4Q A;  3HA9 A;  3O6T A;  1FB6 A;  4HDE A;  1G7O A;  2DJK A;  2FD3 A;  1EP8 A;  3A2V A;  3VWU A;  1V57 A;  5D73 A;  1S3C A;  2HXK A;  2XBQ A;  1LBK A;  2HT9 A;  1SL2 B;  4USS A;  5G31 A;  3CSI A;  4WF4 A;  1B48 A;  4MZB A;  1TRU A;  2HRA A;  5G1L A;  5IMA A;  5DJL A;  4KGI A;  1FHE A;  1Z5Y E;  3ZMK A;  4K7O A;  3L9V A;  2LRN A;  1H75 A;  3ZLP A;  4K9Z A;  3QDN A;  2HSM A;  4CW9 A;  4NHZ A;  4OMV A;  1I9D A;  2IL3 A;  1OC3 A;  3CBU A;  4KUN A;  1BQ7 A;  2H0H A;  2C80 A;  2R3X A;  3HY2 A;  2PN8 A;  5DQS A;  3P2A A;  2WJU A;  3PR8 A;  4KCA A;  4TR3 A;  4I2U A;  4ZBD A;  3GFK A;  2X8C A;  3P90 A;  2RM6 A;  2OJL A;  3GL3 A;  3R2Q A;  1XXU A;  1AQW A;  1GP1 A;  3BJ5 A;  3GSS A;  1GNW A;  4GCI A;  1EV9 A;  3ED3 A;  2HZF A;  5JWQ B;  3ZZX A;  2JSY A;  2IME A;  4NV5 A;  1X9M B;  3L4N A;  4HU7 A;  1EV4 A;  4KH7 A;  3G7Y A;  3C73 A;  2X64 A;  2PBJ A;  4WBJ A;  3UL3 A;  4ZIJ A;  1QQ2 A;  2IFQ B;  2FWG A;  1OKT A;  1GSF A;  1WMJ A;  1OE8 A;  1YF0 A;  3I6A A;  5ECM B;  3IA1 A;  2FWF A;  5ELA A;  4FO5 A;  3C1R A;  3FZA A;  3W8S A;  2V41 A;  1YEP A;  3TJF A;  1B4P A;  3V1W A;  5ECK B;  3M8N A;  2JZT A;  1O6J A;  2GS3 A;  1OC9 B;  3GA4 A;  3IE3 A;  4IW9 A;  4G0L A;  1M9A A;  1WP0 A;  2O85 A;  4LA1 A;  5D9T A;  3N9J A;  4DVC A;  1HQO A;  1SKW B;  1Z7P A;  3KMN A;  4XTS A;  1B9X C;  3IR4 A;  2GT6 A;  3ME8 A;  2FNO A;  4L5L A;  1RK4 A;  5CNW A;  2K9F A;  2LJK A;  3FYG A;  1WE0 A;  3TJK A;  4ZB9 A;  2FWH A;  1AAZ A;  4ZL8 A;  5A5K A;  1EEM A;  3D22 A;  4G0K A;  2F8F A;  1RW1 A;  5DCG A;  5DCH A;  1SKR B;  3EUR A;  1S3A A;  5COH A;  4BWQ A;  4HQS A;  1YDK A;  2B7K A;  3RBT A;  4DSQ A;  1TXX A;  4L8E A;  3IXR A;  1ZYE A;  3I43 A;  1O8X A;  3EU4 A;  4PNG A;  2FA8 A;  3QFB C;  3L0H A;  1SL0 B;  1XZO A;  3ERW A;  1RQM A;  4WEY A;  4V2M A;  2GQK A;  2B5Y A;  2A2R A;  5EY6 A;  4TR1 B;  3GN3 A;  2F9S A;  2GVP A;  1ILO A;  1A0R P;  4MK3 A;  3ZVJ D;  4FYB A;  1HD2 A;  1V58 A;  5KEJ A;  2H1G A;  3TKS E;  4XIH A;  2VM2 A;  2ZCT A;  2FA4 A;  3JCM L;  4KDY A;  4ACS A;  2PUK C;  5AGY A;  3GKX A;  2GDR A;  5IPG A;  1V40 A;  3PIN A;  1R26 A;  2VCQ A;  2B7J A;  2LNT A;  2H19 A;  4J56 E;  4AJ6 A;  3IHQ A;  1TI3 A;  1Q98 A;  2L6D A;  4HOJ A;  4WET A;  1TK8 B;  5FT3 A;  4KW6 A;  2PGT A;  4ID0 A;  3D4T A;  5BMU A;  4I97 A;  6GSU A;  3F3R A;  4GLT A;  3EU3 A;  2YJH A;  9GSS A;  1F3B A;  3VI5 A;  3ZFB A;  2ZNM A;  5ECQ B;  3CTG A;  2H75 A;  1ZZY A;  2I4A A;  2LEG A;  2WRT A;  1ST9 A;  2H1B A;  1FO5 A;  1WRY A;  3VK9 A;  1SKS B;  3F6F A;  3RPN A;  5IIZ A;  1PQN A;  3GST A;  2WZ9 A;  4XS6 A;  4AJ7 A;  3HCZ A;  4D73 B;  1EOH A;  4O92 A;  3GKN A;  5F8B A;  1THX A;  2GST A;  2H1A A;  3TRX A;  1M2A A;  5DQY A;  3LWA A;  3IPZ A;  1BAY A;  1K0A A;  4IP6 A;  2L4C A;  3HHV A;  3D0Z A;  4K0N A;  1WWJ A;  2HRN A;  3UBL A;  3VWW A;  3DVW A;  2DJJ A;  5B8A A;  1GUL A;  1TTZ A;  3E9J B;  3H4K A;  1PX7 A;  4ML6 A;  3H8Q A;  2XBI A;  5G2Z A;  1GSS A;  1LU4 A;  1WOU A;  4OD7 A;  1QK8 A;  3ZYW A;  2HRK B;  2B3S A;  2IMI A;  5B8B A;  4GQF A;  14GS A;  1SK2 A;  5KN1 A;  1ZYQ B;  4PQ1 A;  5INY A;  3ME7 A;  18GS A;  3M9K A;  4GRF A;  3CSH A;  4MH3 A;  3TJG A;  3C1S A;  3LEF A;  2HSY A;  1PRX A;  2GQL A;  5F05 A;  4YAV A;  3MAK A;  1VRS D;  3TB2 A;  1B8X A;  4TN8 A;  3APS A;  2VAF A;  3IC8 A;  1QXH A;  1X9W B;  1UA5 A;  4WBR D;  3I9V 2;  5D96 A;  5JCU A;  4WR4 A;  3IAM 2;  2YCD A;  4BL7 B;  4G0I A;  3TKS A;  8GSS A;  3EYT A;  4PXO A;  3ZTL A;  4I6X A;  5ECR B;  2DJ1 A;  1Q4J A;  1TDI A;  2TIR A;  4LL4 B;  2D2Z A;  1U6T A;  2FHE A;  2LKU A;  4HUA A;  4F82 A;  2AJQ B;  1G0T A;  2IWT A;  3HDC A;  3ISO A;  2DMM A;  3RDW A;  2H6Z A;  1MTC A;  4ECI A;  3IAS 2;  2I1U A;  4ZIL A;  3DXB A;  5HR0 A;  5ECP B;  4G10 A;  2CAQ A;  3KMO A;  5HQP A;  4F2I A;  6GSS A;  4ECJ A;  2RM5 A;  3HXS A;  4KX4 A;  4PQH A;  1A2J A;  1QUW A;  5L71 A;  1PMT A;  2FUG 2;  1BJX A;  2AB6 A;  4NXI A;  2DJ3 A;  4MF6 A;  1GH2 A;  2EIQ A;  3BCI A;  1A8Y A;  2RUF A;  2VL2 C;  1K0D A;  2K8S A;  2B1L A;  1W4V A;  2HZE B;  3GL5 A;  1XWC A;  3KXO A;  1EP7 A;  3DWV A;  3FZ4 A;  2J23 A;  4I2T A;  3QPM A;  1O85 A;  2RLI A;  2VIM A;  1AQX A;  2LRT A;  2N5B A;  3TKP A;  3QMX A;  3TCO A;  4O5R A;  4XHM A;  4JR6 A;  5B7C A;  3KP8 A;  3M1G A;  4BVX B;  2L6C A;  3KD0 A;  1U88 A;  5ELG A;  1PX6 A;  4JU5 A;  4DSS B;  1HYU A;  5KN0 A;  5DJM A;  5H5R A;  5F0G A;  2C1Y A;  1T3B A;  5IQY A;  4QL9 A;  1UVZ A;  2WB9 A;  5A4V A;  1B9Y C;  20GS A;  1N8J A;  5DAL A;  3CXG A;  4Q5R A;  4IS0 A;  4HZ4 A;  1NSW A;  5CAX A;  1KBN A;  2GZY A;  1YY7 A;  1HNC A;  3E3E A;  2RII A;  4BA7 A;  3DIE A;  1ON4 A;  4MLY A;  3QR6 A;  4JBB A;  3P8W A;  3GKM A;  2XPE A;  4K2D A;  1EZK A;  2VCW A;  1XVW A;  4EL1 A;  3CTF A;  3DVX A;  5DAK B;  5JCW A;  1SD9 A;  4RI6 A;  4D73 A;  4OCF A;  1SYR A;  5CO3 A;  5GAN D;  3H1N A;  3SBC A;  2V6O A;  2YNX A;  4XRD A;  1UN2 A;  2C3N A;  2PVQ A;  4HU9 A;  1ZCP A;  2H76 A;  3HKR A;  3KTL A;  2NTO A;  4E8E A;  1EGO A;  2FCH A;  3VLN A;  4F9Z A;  3CMI A;  5D9V A;  3HZ8 A;  1J9B A;  4JRR A;  4J2F A;  2CVK A;  2VO4 A;  2JL4 A;  1ZOF A;  2HRK A;  2QC7 A;  1R7H A;  3CRU A;  3ZIJ A;  4NAX A;  2YWN A;  6GSV A;  5E59 A;  3HVS A;  1ERW A;  3A3T A;  4N11 A;  1MDJ A;  5J9B A;  1WPI A;  1K0N A;  3S9F A;  1Z7R A;  5KN3 A;  2GSS A;  2AHE A;  5CRD A;  3HD5 A;  4POB A;  4IJ3 A;  2VUP A;  1MDI A;  1GTB A;  1YKC A;  5ECO B;  1PN9 A;  2XC2 A;  1JFU A;  1T7P B;  4BL7 A;  3KH7 A;  2H71 A;  3UIW A; 
#chains in the Genus database with same CATH topology
 3HYP A;  2MMA A;  1UC7 A;  3BCK A;  3LYP A;  3IK7 A;  2OE1 A;  4F03 A;  3P7X A;  3IHG A;  3QAW A;  1LJR A;  1AUC A;  3K8N A;  4QL7 A;  1V98 A;  1GUM A;  3UVH A;  5IMZ A;  3WYW A;  5IMV A;  2E7P A;  1YZX A;  2IJY A;  4BIK A;  1OAZ A;  4EDY A;  1XIY A;  2PER A;  2R4V A;  4DEJ A;  4MJA A;  2DJ0 A;  1XWG A;  3FW2 A;  1EEJ A;  4EF0 A;  17GS A;  4PUA A;  4MJE A;  3TJB A;  3TUE A;  5B6N A;  3CSJ A;  3GYK A;  1OKD A;  3EVI A;  2QSI A;  2A2P A;  1USB A;  3GMF A;  5G5F A;  1THO A;  2O8V B;  1YKA A;  3TKR A;  1XW6 A;  3IDV A;  2HZE A;  1TXU A;  4MZC A;  2YJ7 A;  4POM A;  1GWC A;  2KHP A;  4BPY A;  2WDU A;  2L57 A;  1PA3 A;  1TRV A;  1AW9 A;  3ERF A;  4L5O A;  5JCG A;  3UEM A;  3C8E A;  1T8E B;  5D8I A;  1MD4 A;  4LLR A;  4BVX A;  2TRC P;  2X8H A;  3G9B A;  4DSS A;  1W89 A;  4L0U A;  4IP1 A;  4EXJ A;  4IKH A;  1U3I A;  1SJI A;  2YZU A;  3KCM A;  3UOM A;  2GGT A;  4LMW A;  5JWR B;  3R3E A;  3QOU A;  5D9X A;  1WJK A;  1JZO A;  4NV2 A;  1T4Y A;  2F8A A;  2YPM A;  3F4T A;  4ECB A;  1ABA A;  4V2N A;  3EC3 A;  1URM A;  4IQA A;  1QGV A;  3QD9 A;  3VUR A;  2HNL A;  3J7Y k;  5ID2 B;  5CP1 A;  1TKD B;  2PVO C;  5LD0 A;  2B5X A;  3QCP A;  4O7H A;  2H8L A;  4MPG A;  5LNK e;  5DAK A;  1BF5 A;  2FWE A;  3W8J A;  1ZGN A;  4XS4 B;  1JZW A;  5KN2 A;  1XW9 A;  1SJZ A;  6GSW A;  5C00 A;  1YF1 A;  2LTK A;  2OT3 A;  1K0C A;  5KOW A;  3TRP A;  2B1K A;  3FZ5 A;  1AC1 A;  5J4V A;  4HS1 A;  3ZRD A;  3F4R A;  2AUV A;  4ECC A;  1GTU A;  3NZN A;  3QFA C;  1QFN A;  22GS A;  2NBS A;  2VLV A;  2LQQ A;  1BG5 A;  3D5J A;  2H72 A;  3TRQ A;  4GF0 A;  3FR3 A;  4WF5 A;  3NOF A;  4GST A;  5ECL B;  1EOG A;  5DAL B;  3H79 A;  3IC4 A;  3PH9 A;  4N0V A;  4TKY A;  5DDL A;  2KUC A;  3HMJ G;  5B6M A;  4MA9 A;  4GWR A;  4HSC X;  3Q74 A;  1O81 A;  3WD6 A;  2H6Y A;  3KGK A;  4Z2R A;  1FG4 A;  3KIJ A;  6GSY A;  3IBH A;  1H4O A;  4MAB A;  1PGT A;  1ML6 A;  2X99 A;  3OR5 A;  1X5E A;  3KP9 A;  3MWH A;  1Z3E A;  4KE3 A;  5GAP D;  3CWG A;  4MDC A;  4V1A p;  2GTU A;  2BJX A;  2KP2 A;  1SYX A;  2IMK A;  2WW3 A;  4GSS A;  1R5P A;  1SD8 A;  4HEA 2;  1E6B A;  3HVV A;  4Q5F A;  1VF4 A;  1A2M A;  3IRA A;  4TXO B;  1I5G A;  2PWJ A;  3G7I A;  4MZW A;  2H01 A;  4GSN A;  5J4Y A;  4G2E A;  2HSH A;  2M72 A;  1JHB A;  4DSR A;  1T00 A;  5CYY A;  2DKI A;  2JZS A;  2V6K A;  3GX0 A;  4OFT A;  3KTB A;  4JED A;  5J9C A;  2AAW A;  4NWY A;  2X4A A;  1T4Z A;  3DD3 A;  2R2J A;  2PPT A;  3DML A;  2L5L A;  1AXD A;  1M0U A;  1TU8 A;  5IO2 A;  2CZ3 A;  3KH9 A;  5A4W A;  1PD2 1;  4AGS A;  1IYI A;  1FVK A;  3UAR A;  4W66 A;  7GSS A;  1O7U A;  3F0I A;  2IMF A;  3WT2 A;  4O5U A;  4MF7 A;  4ZB8 A;  2XPD A;  1TK0 B;  4E68 A;  1TOF A;  1A2L A;  3HZ4 A;  1E2Y A;  5IO0 A;  3TOT A;  4NPB A;  1PL2 A;  1J08 A;  3GX8 A;  4WKW A;  2HE3 A;  2YV9 A;  11GS A;  1GSY A;  5D93 A;  5CRE A;  5ECS A;  1S3D A;  3MNG A;  1X5C A;  2CVB A;  3GH9 A;  3VFI A;  3F6D A;  1DSB A;  2YWM A;  1XOB A;  2N5A A;  1G7E A;  1F9M A;  1Y25 A;  3FK8 A;  4L0W A;  5HFI A;  2BMX A;  1OE7 A;  4IHU A;  4KSM A;  4HJ2 A;  1PL1 A;  1TJD A;  4MP4 A;  2AV4 A;  4ZL7 A;  1DUG A;  5ID2 A;  5CRG A;  3TKQ A;  2H66 A;  2IMD A;  3DKS A;  4YQU A;  1IYH A;  1SK1 A;  1Z6N A;  3HJM A;  1YEX A;  2YN1 A;  4CDO A;  2DJ2 A;  2KOK A;  4AJ8 A;  1NHY A;  2GZZ A;  12GS A;  2H1L A;  4TW5 A;  5HFK A;  4TOP A;  2H74 A;  1JLV A;  2LQO A;  2YOI A;  3M3M A;  2A2S A;  4XS4 A;  4K1F A;  3APO A;  1TU7 A;  1GL8 A;  1V9W A;  1SEN A;  1GRX A;  2NPB A;  1S4B P;  4X43 A;  3H93 A;  2I81 A;  3DYR A;  19GS A;  3F9U A;  2LV3 A;  4J57 E;  3I69 A;  1PKZ A;  3KJY A;  2VL9 A;  1TRS A;  3RHB A;  4GXZ A;  1QMV A;  3HVX A;  1O8W A;  1HNB A;  2DIZ A;  2P0G A;  2G0F A;  3TDG A;  1ACV A;  3BD2 A;  3G7J A;  3D4M A;  4HQZ A;  3UMA A;  3FKF A;  2TRX A;  4TR0 A;  4YAP A;  2LUS A;  4YQV A;  2ES7 A;  3UAP A;  2OE3 A;  3KM6 A;  4GTU A;  1A23 A;  3MSZ A;  2F3M A;  4ZBB A;  3M9J A;  4XS1 A;  1GLP A;  4QQ7 A;  3VWV A;  1A24 A;  4WR5 A;  4MPF A;  2GSQ A;  4OFM A;  3LG6 A;  2EC4 A;  2JAD A;  1U87 A;  3RHC A;  1Z6M A;  2E0Q A;  2GSR A;  2YZH A;  4P3Y B;  2C0D A;  4EKZ A;  10GS A;  5ABR A;  3LGC A;  4JZQ A;  3DEX A;  3HVN A;  2HRF A;  4ML1 A;  1DE2 A;  1F2E A;  3AY8 A;  4AKX B;  4Q5N A;  4KA0 A;  2WVZ A;  1JZD A;  4G9H A;  4KDX A;  2JSZ A;  2O5V A;  4TXO A;  1SJ6 A;  5ECI B;  5HFG A;  4O5Q A;  3EMP A;  1BYE A;  2K18 A;  4PQI A;  2HSN A;  3WGX A;  4F0C A;  5IMC A;  3RGB C;  4MJC A;  4HI7 A;  5G30 A;  4N30 A;  2WS2 A;  2AYT A;  4E8H A;  4MH2 A;  1ZYP A;  5AIX A;  2N5F A;  3ZML A;  1G6W A;  3ZFL A;  1WIK A;  4G01 A;  2RUE A;  3C71 A;  2C0E A;  2OAD A;  5J5N A;  4EO3 A;  2EFD A;  5A5H B;  4O32 A;  4YH2 A;  2LJA A;  5F06 A;  4KAE A;  1GSU A;  1HNA A;  1M99 A;  2DBC A;  5DVB A;  4TR4 A;  3FEU A;  4V1A g;  1VF2 A;  3VPT A;  5AIS A;  5J41 A;  1ERT A;  4POK A;  2JU5 A;  2C4J A;  2DC5 A;  2X49 A;  2CQ9 A;  1NM3 A;  2VLU A;  2M80 A;  1M7T A;  2FY6 A;  2R6K A;  2EIR A;  2WCI A;  2O36 A;  1F37 A;  3UJ1 A;  4MMM A;  3RFR C;  3FRC A;  4FH8 A;  3WT1 A;  2YP6 A;  2G2Q A;  1A0F A;  2GZP A;  4ILF A;  2Z9S A;  2VD0 A;  1SK0 A;  2K6V A;  2MZC A;  2BTO T;  3LXT A;  4TRX A;  4PI2 C;  1XCC A;  1CQH A;  1XG8 A;  3N5O A;  5HR2 A;  4V2L A;  3UVT A;  2DIY A;  3SWL A;  2ON5 A;  3VWX A;  5J3R A;  2O89 A;  2PMT A;  2C0F A;  3RPP A;  1XBS A;  2ALB A;  3KZQ A;  2IPA A;  3ERG A;  3FZ9 A;  3MDK A;  2GQM A;  2VD1 A;  5JWO B;  2P5R A;  4ZB6 A;  1F3A A;  1K0B A;  3EMX A;  1C72 A;  2YV7 A;  2HI7 A;  2MBS A;  5IOX A;  3Q6O A;  4BVY B;  6GSX A;  1M3J A;  3GH6 A;  4N10 A;  1R4W A;  1R5A A;  1V2A A;  3E0U A;  2C8U A;  4K7N A;  5G1K A;  3IV4 A;  1XWK A;  4RQX A;  4MF5 A;  3GUR A;  3ZIT A;  5D9W A;  3L9S A;  3LQ7 A;  1SU9 A;  4EC0 A;  3D21 A;  2OBK A;  4OCE A;  3VPQ A;  5E4W A;  4NMU A;  1EWX A;  1ERV A;  2LNS A;  4AI6 A;  1FB0 A;  3O76 A;  1F6M C;  2GLR A;  5DBQ A;  3RAZ A;  2CZ2 A;  2O7K A;  2VL2 A;  3TKS C;  3QAV A;  2YAN A;  3LJR A;  1M2B A;  5AN1 A;  3TJJ A;  4WXT A;  2NDO A;  3EE2 A;  3A5W A;  2E2G A;  1GNE A;  3UBK A;  2GT5 A;  3U5R E;  2HLS A;  16GS A;  1GUH A;  1M2D A;  2UV8 G;  1TRW A;  3DRN A;  4AF2 A;  2LJR A;  2H30 A;  4IEL A;  2YWO A;  1M9B A;  4PNF A;  2A4H A;  1OYJ A;  5BRT A;  4N0Z A;  4F0B A;  2FLS A;  1VF3 A;  4K6X A;  2VLT A;  2CAI A;  3WGD A;  2XHF A;  2UZ8 A;  2OBI A;  4HZ2 A;  4KSO A;  1KEB A;  3CRT A;  4RUV A;  2OE0 A;  5IMD A;  2CVD A;  2VCX A;  2IN3 A;  4PTS A;  5EVO A;  1PKW A;  4K7I A;  2H0G A;  2HQT A;  2DKH A;  1MD3 A;  2H6X A;  4EUY A;  3M0F A;  1FVJ A;  4PUR A;  3J7Y b;  4XCS A;  4EDZ A;  1JZR A;  3QAG A;  2H1D A;  2WVX B;  1PN0 A;  4KCE A;  1CQG A;  1MDK A;  4ZL9 A;  4RQR A;  2YWI A;  1XWA A;  1VF1 A;  3GNJ A;  5LCZ A;  4PX1 A;  1KNG A;  2LS5 A;  1XVQ A;  3FR9 A;  5CRW A;  4X0X A;  2DML A;  3Q18 A;  5A5H A;  2H0I A;  1NW2 A;  4I5Q A;  5CRH A;  1Y6E A;  3TOU A;  3GIX A;  3GV1 A;  2WFC A;  3PGT A;  4KDU A;  5IOW A;  2VL3 A;  5A34 B;  1U3A A;  1K3O A;  2WGR A;  2HFD A;  4G19 A;  1GTA A;  1X0R A;  1A8L A;  1AQV A;  2VCT A;  5EL8 A;  5FWG A;  2V2G A;  2B6M A;  4OO5 A;  2P31 A;  2EFH A;  2JAC A;  4Z7X A;  1ZYN A;  4FIW A;  4I8B A;  3GKK A;  1OC8 A;  3LSZ A;  3ZVJ A;  2LRC A;  3L78 A;  4EIP A;  1SL1 B;  2KLX A;  4YKF A;  3GTU B;  2VM1 A;  4H86 A;  1OVN A;  2DLX A;  5ECH B;  1K0O A;  4ISD A;  1GLQ A;  3EWL A;  1DBY A;  1AIU A;  2WUL A;  4X1U A;  1T1V A;  4HJM A;  2MMN A;  2X8G A;  4TVE A;  5C04 A;  1GSE A;  3WGE A;  3CYN A;  2HSN B;  3VI7 A;  2A4V A;  4IGJ A;  3BBY A;  2QGV A;  2CV4 A;  2L4Q A;  5HR3 A;  3W6G A;  1XOA A;  5IMF A;  5ECN B;  3A2W A;  2NVL A;  2REM A;  4BVY A;  1X5D A;  1TK5 B;  2IIY A;  4NHW A;  1ERU A;  1MEK A;  4ZXG A;  2IFQ A;  3O3T A;  4KF9 A;  1JLW A;  4TXV A;  2VCZ A;  2PU9 C;  1XW5 A;  3L9U A;  3IOS A;  2C3T A;  4FYU A;  3U6V A;  2HSM B;  2KP1 A;  3F63 A;  3HJO A;  1YVL A;  5A1N B;  3TGZ A;  1OC9 A;  1YJ6 A;  5G5E A;  3LYK A;  1K3Y A;  3GRX A;  5H5S A;  3FY7 A;  2FGX A;  1K3L A;  1XFL A;  4RI7 A;  4FQU A;  4YQM A;  4OWY A;  4EVM A;  3PPU A;  5AIV A;  4XRA A;  4CY6 A;  2MMZ A;  2B5E A;  4K0G A;  3A2X A;  1K0M A;  5GST A;  2QKE A;  3C7M A;  1TP9 A;  2L59 A;  2V1M A;  3GHA A;  2OKA A;  4LMV A;  2P5Q A;  4PGT A;  2J9H A;  4IVF A;  4IQ1 A;  2O87 A;  2CX3 A;  1KTE A;  4POL A;  1FOV A;  4KND A;  4CHS A;  2L5O A;  4Q5Q A;  5ENU A;  2EFC A;  3EPT A;  3ZL5 A;  4Z2T A;  1O73 A;  3BOA A;  4GQC A;  3FHK A;  5J4U A;  4OO4 A;  4JE1 A;  3A5I A;  4AKG A;  1FW1 A;  4IBP A;  2R37 A;  1GUK A;  2JZR A;  4ZBA A;  3F4S A;  4K8M A;  2V32 A;  1VGL A;  3D6I A;  2DSA A;  2R5G A;  5F07 A;  3LXZ A;  5GZZ B;  4TR1 A;  1DE1 A;  3NIV A;  4ZB7 A;  3LFL A;  4ULX A;  2C3Q A;  2I9H A;  1XWB A;  3EIN A;  4LL1 B;  4MNN A;  2OAC A;  3US3 A;  4IN0 A;  1N2A A;  1BG1 A;  5GSS A;  2CA8 A;  2H70 A;  2CT6 A;  3LW9 A;  5H5Q A;  3IK9 A;  2WVX A;  1GSQ A;  2VOC A;  5IM9 A;  3F8U A;  4MJB A;  4AKH A;  2CX4 A;  1GTI A;  2MYG A;  3FR6 A;  3ZRE A;  2HYX A;  2ON7 A;  1BX9 A;  1G6Y A;  5FHI A;  2F51 A;  4OFN A;  1ZMA A;  4BWS A;  2LST A;  4CY8 A;  1GSD A;  2VCV A;  5HR1 A;  3GUS A;  3Q19 A;  1NHO A;  2M46 A;  4EE0 A;  13GS A;  1Z9H A;  2C0G A;  2I3Y A;  2E2M A;  2EIO A;  1FAA A;  3DGQ A;  5A34 A;  1XPV A;  6GST A;  3F3Q A;  2OA7 A;  4PUF C;  1BED A;  1ZL9 A;  3ZIV A;  4MCU A;  1EGR A;  2H73 A;  1TW9 A;  1J0F A;  2MBT A;  1TI1 A;  5IPH A;  3LOR A;  4IJI A;  4JR4 A;  1PSQ A;  2EFE A;  1X9S B;  3APQ A;  4KB3 A;  2ZUP A;  5EPF A;  2K8V A;  3KEB A;  3GTU A;  1YQ1 A;  5A4U A;  3HJP A;  2MMO A;  4FYC A;  1B4Q A;  3HA9 A;  3O6T A;  1FB6 A;  4HDE A;  1G7O A;  2R0C A;  2DJK A;  2FD3 A;  1EP8 A;  3A2V A;  2R0P A;  3VWU A;  4PHZ C;  1V57 A;  5D73 A;  2WVY A;  1S3C A;  2HXK A;  2XBQ A;  1LBK A;  2HT9 A;  3TU3 B;  1SL2 B;  4USS A;  5G31 A;  3CSI A;  4WF4 A;  2QA1 A;  1B48 A;  4MZB A;  1TRU A;  2HRA A;  5G1L A;  5IMA A;  5DJL A;  4KGI A;  2QA2 A;  1FHE A;  1Z5Y E;  3ZMK A;  4K7O A;  3L9V A;  3FMW A;  2LRN A;  1H75 A;  3ZLP A;  4K9Z A;  3QDN A;  2HSM A;  4CW9 A;  4NHZ A;  4OMV A;  1I9D A;  2IL3 A;  5BMU B;  1OC3 A;  3CBU A;  4KUN A;  1BQ7 A;  2H0H A;  2C80 A;  2R3X A;  3HY2 A;  5A1N A;  2PN8 A;  5DQS A;  3P2A A;  2WJU A;  1I1I P;  3PR8 A;  4KCA A;  4TR3 A;  4I2U A;  4ZBD A;  3GFK A;  2X8C A;  3P90 A;  2RM6 A;  2OJL A;  3GL3 A;  3R2Q A;  1XXU A;  1AQW A;  1GP1 A;  3BJ5 A;  3GSS A;  4AKI A;  1GNW A;  4GCI A;  1EV9 A;  3ED3 A;  2HZF A;  5JWQ B;  3ZZX A;  2JSY A;  2IME A;  4NV5 A;  1X9M B;  3L4N A;  4HU7 A;  1EV4 A;  3CQF A;  4KH7 A;  3G7Y A;  3C73 A;  2X64 A;  2PBJ A;  4WBJ A;  3UL3 A;  4ZIJ A;  1QQ2 A;  2IFQ B;  2FWG A;  1OKT A;  1GSF A;  1WMJ A;  1OE8 A;  1YF0 A;  3I6A A;  5ECM B;  3IA1 A;  2FWF A;  5ELA A;  4FO5 A;  3C1R A;  1SVL A;  3FZA A;  3W8S A;  2V41 A;  1YEP A;  3TJF A;  1B4P A;  3V1W A;  5ECK B;  3M8N A;  2JZT A;  1O6J A;  2GS3 A;  1OC9 B;  3GA4 A;  3IE3 A;  4IW9 A;  4G0L A;  1M9A A;  1WP0 A;  2O85 A;  4LA1 A;  5D9T A;  3N9J A;  4DVC A;  1HQO A;  1SKW B;  1Z7P A;  3KMN A;  4XTS A;  1B9X C;  3IR4 A;  2GT6 A;  4N3Z A;  3ME8 A;  2FNO A;  4L5L A;  1RK4 A;  5CNW A;  2K9F A;  2LJK A;  3FYG A;  1WE0 A;  3TJK A;  4ZB9 A;  2FWH A;  1AAZ A;  4ZL8 A;  5A5K A;  1EEM A;  3D22 A;  4G0K A;  2F8F A;  1RW1 A;  5DCG A;  3CHX C;  5DCH A;  1SKR B;  3EUR A;  3MIX A;  4K2X A;  1S3A A;  5COH A;  4BWQ A;  4HQS A;  1YDK A;  2B7K A;  3RBT A;  4DSQ A;  1TXX A;  4L8E A;  3IXR A;  1ZYE A;  3I43 A;  1O8X A;  3EU4 A;  4PNG A;  2FA8 A;  4ICY A;  3QFB C;  3L0H A;  1SL0 B;  1XZO A;  3ERW A;  1RQM A;  4WEY A;  4V2M A;  2GQK A;  2B5Y A;  2A2R A;  5EY6 A;  4TR1 B;  3GN3 A;  2F9S A;  2GVP A;  1ILO A;  1A0R P;  4MK3 A;  3ZVJ D;  4FYB A;  1HD2 A;  1V58 A;  5KEJ A;  2H1G A;  3TKS E;  4XIH A;  2VM2 A;  2ZCT A;  2FA4 A;  3JCM L;  4KDY A;  4ACS A;  2PUK C;  5AGY A;  3GKX A;  2GDR A;  5IPG A;  1V40 A;  3PIN A;  1R26 A;  2VCQ A;  1N25 A;  2B7J A;  2LNT A;  2H19 A;  4J56 E;  4AJ6 A;  3IHQ A;  1TI3 A;  1Q98 A;  2L6D A;  4HOJ A;  4WET A;  1TK8 B;  5FT3 A;  4QMK A;  4KW6 A;  2PGT A;  2O3E A;  2WZS A;  4ID0 A;  3D4T A;  5BMU A;  4I97 A;  6GSU A;  3F3R A;  4GLT A;  3EU3 A;  2YJH A;  9GSS A;  1F3B A;  3VI5 A;  3ZFB A;  2ZNM A;  5ECQ B;  4GDF A;  1FOH A;  3CTG A;  2H75 A;  1ZZY A;  2I4A A;  2LEG A;  2WRT A;  1ST9 A;  2H1B A;  1FO5 A;  1WRY A;  3VK9 A;  1SKS B;  3F6F A;  3RPN A;  5IIZ A;  1PQN A;  3GST A;  2WZ9 A;  4XS6 A;  4AJ7 A;  3HCZ A;  4D73 B;  1EOH A;  4O92 A;  3GKN A;  5F8B A;  1THX A;  2GST A;  2H1A A;  3TRX A;  1M2A A;  5DQY A;  3LWA A;  3IPZ A;  1BAY A;  1K0A A;  4IP6 A;  2L4C A;  5J47 A;  3HHV A;  4K5R A;  3D0Z A;  4K0N A;  1WWJ A;  2HRN A;  3UBL A;  3VWW A;  3DVW A;  2DJJ A;  5B8A A;  1GUL A;  1SVO A;  1TTZ A;  3E9J B;  3H4K A;  1PX7 A;  4ML6 A;  3H8Q A;  2XBI A;  5G2Z A;  1GSS A;  1LU4 A;  1WOU A;  4OD7 A;  1QK8 A;  3ZYW A;  2HRK B;  2B3S A;  2IMI A;  5B8B A;  4GQF A;  14GS A;  1SK2 A;  5KN1 A;  1ZYQ B;  4PQ1 A;  5INY A;  3ME7 A;  5J40 A;  18GS A;  3M9K A;  4GRF A;  3CSH A;  4MH3 A;  3TJG A;  3C1S A;  3LEF A;  2HSY A;  1PRX A;  2GQL A;  5F05 A;  4YAV A;  3MAK A;  1VRS D;  3TB2 A;  1B8X A;  4TN8 A;  2R0G A;  4X4J A;  3APS A;  2VAF A;  3IC8 A;  1QXH A;  1X9W B;  1UA5 A;  1PFO A;  4WBR D;  3I9V 2;  5D96 A;  5JCU A;  4WR4 A;  3IAM 2;  2YCD A;  4BL7 B;  4G0I A;  3TKS A;  8GSS A;  3EYT A;  4PXO A;  3ZTL A;  4I6X A;  5ECR B;  2DJ1 A;  1Q4J A;  1TDI A;  2TIR A;  4LL4 B;  2D2Z A;  1U6T A;  2FHE A;  2LKU A;  4HUA A;  4F82 A;  2AJQ B;  1G0T A;  2IWT A;  3HDC A;  3ISO A;  2DMM A;  3RDW A;  2H6Z A;  1MTC A;  4ECI A;  3IAS 2;  1M3I A;  2I1U A;  4ZIL A;  3DXB A;  5HR0 A;  5ECP B;  4G10 A;  2CAQ A;  3KMO A;  5HQP A;  3MYD A;  4F2I A;  6GSS A;  4ECJ A;  2RM5 A;  3HXS A;  4KX4 A;  4PQH A;  1A2J A;  1QUW A;  1SVM A;  5L71 A;  1PMT A;  2FUG 2;  1BJX A;  2AB6 A;  4NXI A;  2DJ3 A;  4MF6 A;  1GH2 A;  2EIQ A;  3BCI A;  1A8Y A;  2RUF A;  2VL2 C;  1K0D A;  2K8S A;  2B1L A;  1W4V A;  2HZE B;  3GL5 A;  1XWC A;  3KXO A;  1EP7 A;  4EIQ A;  3DWV A;  3FZ4 A;  2J23 A;  4I2T A;  3QPM A;  1O85 A;  2RLI A;  2VIM A;  1AQX A;  2LRT A;  2N5B A;  3TKP A;  3QMX A;  3TCO A;  2WW0 A;  4O5R A;  4XHM A;  4JR6 A;  2WW2 A;  5B7C A;  3KP8 A;  3M1G A;  4BVX B;  2L6C A;  3KD0 A;  1U88 A;  5ELG A;  1PX6 A;  4JU5 A;  4DSS B;  1HYU A;  5KN0 A;  5DJM A;  5H5R A;  5F0G A;  2C1Y A;  1T3B A;  5IQY A;  4QL9 A;  1YEW C;  1UVZ A;  2WB9 A;  5A4V A;  1B9Y C;  20GS A;  1N8J A;  5DAL A;  3CXG A;  4Q5R A;  4IS0 A;  4HZ4 A;  1NSW A;  5CAX A;  1KBN A;  2GZY A;  4Z2U A;  1YY7 A;  1HNC A;  3E3E A;  2RII A;  4BA7 A;  3DIE A;  1ON4 A;  4MLY A;  3QR6 A;  4JBB A;  4K5S A;  3P8W A;  4FXY P;  3GKM A;  2XPE A;  4K2D A;  1EZK A;  2VCW A;  1XVW A;  4EL1 A;  3CTF A;  3DVX A;  5DAK B;  5JCW A;  1SD9 A;  4RI6 A;  4D73 A;  4OCF A;  1SYR A;  5CO3 A;  5GAN D;  3H1N A;  4A5P A;  3SBC A;  2V6O A;  2YNX A;  1S3R A;  5KOX A;  4XRD A;  1UN2 A;  2C3N A;  2VKZ G;  2PVQ A;  4HU9 A;  1ZCP A;  2H76 A;  3HKR A;  2WW1 A;  3KTL A;  4PI0 C;  2NTO A;  4E8E A;  1EGO A;  2FCH A;  3VLN A;  4F9Z A;  3CMI A;  4YKG A;  5D9V A;  3HZ8 A;  1J9B A;  4JRR A;  4J2F A;  2CVK A;  2VO4 A;  2JL4 A;  1ZOF A;  2HRK A;  1Y1U A;  2QC7 A;  1R7H A;  3CRU A;  3ZIJ A;  4NAX A;  2YWN A;  6GSV A;  5E59 A;  3HVS A;  1ERW A;  3A3T A;  4N11 A;  1MDJ A;  5J9B A;  1WPI A;  1K0N A;  3S9F A;  1Z7R A;  5KN3 A;  2GSS A;  2AHE A;  5CRD A;  3HD5 A;  4POB A;  4IJ3 A;  2VUP A;  1MDI A;  1GTB A;  1YKC A;  5ECO B;  1PN9 A;  2XC2 A;  1JFU A;  1T7P B;  4BL7 A;  3KH7 A;  2H71 A;  3UIW A; 
#chains in the Genus database with same CATH homology
 3HYP A;  2MMA A;  1UC7 A;  3BCK A;  3LYP A;  3IK7 A;  2OE1 A;  4F03 A;  3P7X A;  3IHG A;  3QAW A;  1LJR A;  1AUC A;  3K8N A;  4QL7 A;  1V98 A;  1GUM A;  3UVH A;  5IMZ A;  3WYW A;  5IMV A;  2E7P A;  1YZX A;  2IJY A;  1OAZ A;  4EDY A;  1XIY A;  2PER A;  2R4V A;  4DEJ A;  4MJA A;  2DJ0 A;  1XWG A;  3FW2 A;  1EEJ A;  4EF0 A;  17GS A;  4PUA A;  4MJE A;  3TJB A;  3TUE A;  5B6N A;  3CSJ A;  3GYK A;  1OKD A;  3EVI A;  2QSI A;  2A2P A;  1USB A;  3GMF A;  5G5F A;  1THO A;  2O8V B;  1YKA A;  3TKR A;  1XW6 A;  3IDV A;  2HZE A;  1TXU A;  4MZC A;  2YJ7 A;  4POM A;  1GWC A;  2KHP A;  4BPY A;  2WDU A;  2L57 A;  1PA3 A;  1TRV A;  1AW9 A;  3ERF A;  4L5O A;  5JCG A;  3UEM A;  3C8E A;  1T8E B;  5D8I A;  1MD4 A;  4LLR A;  4BVX A;  2TRC P;  2X8H A;  3G9B A;  4DSS A;  1W89 A;  4L0U A;  4IP1 A;  4EXJ A;  4IKH A;  1U3I A;  1SJI A;  2YZU A;  3KCM A;  3UOM A;  2GGT A;  4LMW A;  5JWR B;  3R3E A;  3QOU A;  5D9X A;  1WJK A;  1JZO A;  4NV2 A;  1T4Y A;  2F8A A;  2YPM A;  3F4T A;  4ECB A;  1ABA A;  4V2N A;  3EC3 A;  1URM A;  4IQA A;  1QGV A;  3QD9 A;  3VUR A;  2HNL A;  3J7Y k;  5ID2 B;  5CP1 A;  1TKD B;  2PVO C;  5LD0 A;  2B5X A;  3QCP A;  4O7H A;  2H8L A;  4MPG A;  5LNK e;  5DAK A;  1BF5 A;  2FWE A;  3W8J A;  1ZGN A;  4XS4 B;  1JZW A;  5KN2 A;  1XW9 A;  1SJZ A;  6GSW A;  5C00 A;  1YF1 A;  2LTK A;  2OT3 A;  1K0C A;  5KOW A;  3TRP A;  2B1K A;  3FZ5 A;  1AC1 A;  5J4V A;  4HS1 A;  3ZRD A;  3F4R A;  2AUV A;  4ECC A;  1GTU A;  3NZN A;  3QFA C;  1QFN A;  22GS A;  2NBS A;  2VLV A;  2LQQ A;  1BG5 A;  3D5J A;  2H72 A;  3TRQ A;  4GF0 A;  3FR3 A;  4WF5 A;  3NOF A;  4GST A;  5ECL B;  1EOG A;  5DAL B;  3H79 A;  3IC4 A;  3PH9 A;  4N0V A;  4TKY A;  5DDL A;  2KUC A;  3HMJ G;  5B6M A;  4MA9 A;  4GWR A;  3Q74 A;  1O81 A;  3WD6 A;  2H6Y A;  3KGK A;  4Z2R A;  1FG4 A;  3KIJ A;  6GSY A;  3IBH A;  1H4O A;  4MAB A;  1PGT A;  1ML6 A;  2X99 A;  3OR5 A;  1X5E A;  3KP9 A;  3MWH A;  1Z3E A;  4KE3 A;  5GAP D;  3CWG A;  4MDC A;  4V1A p;  2GTU A;  2BJX A;  2KP2 A;  1SYX A;  2IMK A;  4GSS A;  1R5P A;  1SD8 A;  4HEA 2;  1E6B A;  3HVV A;  4Q5F A;  1VF4 A;  1A2M A;  3IRA A;  4TXO B;  1I5G A;  2PWJ A;  3G7I A;  4MZW A;  2H01 A;  4GSN A;  5J4Y A;  4G2E A;  2HSH A;  2M72 A;  1JHB A;  4DSR A;  1T00 A;  5CYY A;  2DKI A;  2JZS A;  2V6K A;  3GX0 A;  4OFT A;  3KTB A;  4JED A;  5J9C A;  2AAW A;  4NWY A;  2X4A A;  1T4Z A;  3DD3 A;  2R2J A;  2PPT A;  3DML A;  2L5L A;  1AXD A;  1M0U A;  1TU8 A;  5IO2 A;  2CZ3 A;  3KH9 A;  5A4W A;  1PD2 1;  4AGS A;  1IYI A;  1FVK A;  3UAR A;  4W66 A;  7GSS A;  1O7U A;  3F0I A;  2IMF A;  3WT2 A;  4O5U A;  4MF7 A;  4ZB8 A;  2XPD A;  1TK0 B;  4E68 A;  1TOF A;  1A2L A;  3HZ4 A;  1E2Y A;  5IO0 A;  3TOT A;  4NPB A;  1PL2 A;  1J08 A;  3GX8 A;  4WKW A;  2HE3 A;  2YV9 A;  11GS A;  1GSY A;  5D93 A;  5CRE A;  5ECS A;  1S3D A;  3MNG A;  1X5C A;  2CVB A;  3GH9 A;  3VFI A;  3F6D A;  1DSB A;  2YWM A;  1XOB A;  2N5A A;  1G7E A;  1F9M A;  1Y25 A;  3FK8 A;  4L0W A;  5HFI A;  2BMX A;  1OE7 A;  4IHU A;  4KSM A;  4HJ2 A;  1PL1 A;  1TJD A;  4MP4 A;  2AV4 A;  4ZL7 A;  1DUG A;  5ID2 A;  5CRG A;  3TKQ A;  2H66 A;  2IMD A;  3DKS A;  4YQU A;  1IYH A;  1SK1 A;  1Z6N A;  3HJM A;  1YEX A;  2YN1 A;  4CDO A;  2DJ2 A;  2KOK A;  4AJ8 A;  1NHY A;  2GZZ A;  12GS A;  2H1L A;  4TW5 A;  5HFK A;  4TOP A;  2H74 A;  1JLV A;  2LQO A;  2YOI A;  3M3M A;  2A2S A;  4XS4 A;  4K1F A;  3APO A;  1TU7 A;  1GL8 A;  1V9W A;  1SEN A;  1GRX A;  2NPB A;  4X43 A;  3H93 A;  2I81 A;  3DYR A;  19GS A;  3F9U A;  2LV3 A;  4J57 E;  3I69 A;  1PKZ A;  3KJY A;  2VL9 A;  1TRS A;  3RHB A;  4GXZ A;  1QMV A;  3HVX A;  1O8W A;  1HNB A;  2DIZ A;  2P0G A;  2G0F A;  3TDG A;  1ACV A;  3BD2 A;  3G7J A;  3D4M A;  4HQZ A;  3UMA A;  3FKF A;  2TRX A;  4TR0 A;  4YAP A;  2LUS A;  4YQV A;  2ES7 A;  3UAP A;  2OE3 A;  3KM6 A;  4GTU A;  1A23 A;  3MSZ A;  2F3M A;  4ZBB A;  3M9J A;  4XS1 A;  1GLP A;  4QQ7 A;  3VWV A;  1A24 A;  4WR5 A;  4MPF A;  2GSQ A;  4OFM A;  3LG6 A;  2EC4 A;  2JAD A;  1U87 A;  3RHC A;  1Z6M A;  2E0Q A;  2GSR A;  2YZH A;  4P3Y B;  2C0D A;  4EKZ A;  10GS A;  5ABR A;  3LGC A;  4JZQ A;  3DEX A;  2HRF A;  4ML1 A;  1DE2 A;  1F2E A;  3AY8 A;  4AKX B;  4Q5N A;  4KA0 A;  1JZD A;  4G9H A;  4KDX A;  2JSZ A;  2O5V A;  4TXO A;  1SJ6 A;  5ECI B;  5HFG A;  4O5Q A;  3EMP A;  1BYE A;  2K18 A;  4PQI A;  2HSN A;  3WGX A;  4F0C A;  5IMC A;  4MJC A;  4HI7 A;  5G30 A;  4N30 A;  2WS2 A;  2AYT A;  4E8H A;  4MH2 A;  1ZYP A;  5AIX A;  2N5F A;  3ZML A;  1G6W A;  3ZFL A;  1WIK A;  4G01 A;  2RUE A;  3C71 A;  2C0E A;  2OAD A;  5J5N A;  4EO3 A;  2EFD A;  5A5H B;  4O32 A;  4YH2 A;  2LJA A;  5F06 A;  4KAE A;  1GSU A;  1HNA A;  1M99 A;  2DBC A;  5DVB A;  4TR4 A;  3FEU A;  4V1A g;  1VF2 A;  3VPT A;  5AIS A;  5J41 A;  1ERT A;  4POK A;  2JU5 A;  2C4J A;  2DC5 A;  2X49 A;  2CQ9 A;  1NM3 A;  2VLU A;  2M80 A;  1M7T A;  2FY6 A;  2R6K A;  2EIR A;  2WCI A;  1F37 A;  3UJ1 A;  4MMM A;  4FH8 A;  3FRC A;  3WT1 A;  2YP6 A;  2G2Q A;  1A0F A;  2GZP A;  4ILF A;  2Z9S A;  2VD0 A;  1SK0 A;  2K6V A;  2MZC A;  2BTO T;  3LXT A;  4TRX A;  1XCC A;  1CQH A;  3N5O A;  5HR2 A;  4V2L A;  3UVT A;  2DIY A;  3SWL A;  2ON5 A;  3VWX A;  5J3R A;  2O89 A;  2PMT A;  2C0F A;  3RPP A;  1XBS A;  2ALB A;  3KZQ A;  2IPA A;  3ERG A;  3FZ9 A;  3MDK A;  2GQM A;  2VD1 A;  5JWO B;  2P5R A;  4ZB6 A;  1F3A A;  1K0B A;  3EMX A;  1C72 A;  2YV7 A;  2HI7 A;  2MBS A;  5IOX A;  3Q6O A;  4BVY B;  6GSX A;  3GH6 A;  4N10 A;  1R4W A;  1R5A A;  1V2A A;  3E0U A;  2C8U A;  4K7N A;  5G1K A;  3IV4 A;  1XWK A;  4RQX A;  4MF5 A;  3GUR A;  3ZIT A;  5D9W A;  3L9S A;  3LQ7 A;  1SU9 A;  4EC0 A;  3D21 A;  2OBK A;  4OCE A;  3VPQ A;  5E4W A;  4NMU A;  1EWX A;  1ERV A;  2LNS A;  4AI6 A;  1FB0 A;  3O76 A;  1F6M C;  2GLR A;  5DBQ A;  3RAZ A;  2CZ2 A;  2O7K A;  2VL2 A;  3TKS C;  3QAV A;  2YAN A;  3LJR A;  1M2B A;  5AN1 A;  3TJJ A;  4WXT A;  2NDO A;  3EE2 A;  3A5W A;  2E2G A;  1GNE A;  3UBK A;  2GT5 A;  3U5R E;  2HLS A;  16GS A;  1GUH A;  1M2D A;  2UV8 G;  1TRW A;  3DRN A;  4AF2 A;  2LJR A;  2H30 A;  4IEL A;  2YWO A;  1M9B A;  4PNF A;  2A4H A;  1OYJ A;  5BRT A;  4N0Z A;  4F0B A;  2FLS A;  1VF3 A;  4K6X A;  2VLT A;  2CAI A;  3WGD A;  2XHF A;  2UZ8 A;  2OBI A;  4HZ2 A;  4KSO A;  1KEB A;  3CRT A;  4RUV A;  2OE0 A;  5IMD A;  2CVD A;  2VCX A;  2IN3 A;  4PTS A;  5EVO A;  1PKW A;  4K7I A;  2H0G A;  2HQT A;  2DKH A;  1MD3 A;  2H6X A;  4EUY A;  3M0F A;  1FVJ A;  4PUR A;  3J7Y b;  4XCS A;  4EDZ A;  1JZR A;  3QAG A;  2H1D A;  1PN0 A;  4KCE A;  1CQG A;  1MDK A;  4ZL9 A;  4RQR A;  2YWI A;  1XWA A;  1VF1 A;  3GNJ A;  5LCZ A;  4PX1 A;  1KNG A;  2LS5 A;  1XVQ A;  3FR9 A;  5CRW A;  4X0X A;  2DML A;  3Q18 A;  5A5H A;  2H0I A;  1NW2 A;  4I5Q A;  5CRH A;  1Y6E A;  3TOU A;  3GIX A;  3GV1 A;  2WFC A;  3PGT A;  4KDU A;  5IOW A;  2VL3 A;  5A34 B;  1U3A A;  1K3O A;  2WGR A;  2HFD A;  4G19 A;  1GTA A;  1X0R A;  1A8L A;  1AQV A;  2VCT A;  5EL8 A;  5FWG A;  2V2G A;  2B6M A;  4OO5 A;  2P31 A;  2EFH A;  2JAC A;  4Z7X A;  1ZYN A;  4FIW A;  4I8B A;  3GKK A;  1OC8 A;  3LSZ A;  3ZVJ A;  2LRC A;  3L78 A;  4EIP A;  1SL1 B;  2KLX A;  4YKF A;  3GTU B;  2VM1 A;  4H86 A;  1OVN A;  2DLX A;  5ECH B;  1K0O A;  4ISD A;  1GLQ A;  3EWL A;  1DBY A;  1AIU A;  2WUL A;  4X1U A;  1T1V A;  4HJM A;  2MMN A;  2X8G A;  4TVE A;  5C04 A;  1GSE A;  3WGE A;  3CYN A;  2HSN B;  3VI7 A;  2A4V A;  4IGJ A;  3BBY A;  2QGV A;  2CV4 A;  2L4Q A;  5HR3 A;  3W6G A;  1XOA A;  5IMF A;  5ECN B;  3A2W A;  2NVL A;  2REM A;  4BVY A;  1X5D A;  1TK5 B;  2IIY A;  4NHW A;  1ERU A;  1MEK A;  4ZXG A;  2IFQ A;  3O3T A;  4KF9 A;  1JLW A;  4TXV A;  2VCZ A;  2PU9 C;  1XW5 A;  3L9U A;  3IOS A;  2C3T A;  4FYU A;  3U6V A;  2HSM B;  2KP1 A;  3F63 A;  3HJO A;  1YVL A;  5A1N B;  3TGZ A;  1OC9 A;  1YJ6 A;  5G5E A;  3LYK A;  1K3Y A;  3GRX A;  5H5S A;  3FY7 A;  2FGX A;  1K3L A;  1XFL A;  4RI7 A;  4FQU A;  4YQM A;  4OWY A;  4EVM A;  3PPU A;  5AIV A;  4XRA A;  4CY6 A;  2MMZ A;  2B5E A;  4K0G A;  3A2X A;  1K0M A;  5GST A;  2QKE A;  3C7M A;  1TP9 A;  2L59 A;  2V1M A;  3GHA A;  2OKA A;  4LMV A;  2P5Q A;  4PGT A;  2J9H A;  4IVF A;  4IQ1 A;  2O87 A;  2CX3 A;  1KTE A;  4POL A;  1FOV A;  4KND A;  4CHS A;  2L5O A;  4Q5Q A;  5ENU A;  2EFC A;  3EPT A;  3ZL5 A;  4Z2T A;  1O73 A;  3BOA A;  4GQC A;  3FHK A;  5J4U A;  4OO4 A;  4JE1 A;  3A5I A;  4AKG A;  1FW1 A;  4IBP A;  2R37 A;  1GUK A;  2JZR A;  4ZBA A;  3F4S A;  4K8M A;  2V32 A;  1VGL A;  3D6I A;  2DSA A;  2R5G A;  5F07 A;  3LXZ A;  5GZZ B;  4TR1 A;  1DE1 A;  3NIV A;  4ZB7 A;  3LFL A;  4ULX A;  2C3Q A;  2I9H A;  1XWB A;  3EIN A;  4LL1 B;  4MNN A;  2OAC A;  3US3 A;  4IN0 A;  1N2A A;  1BG1 A;  5GSS A;  2CA8 A;  2H70 A;  2CT6 A;  3LW9 A;  5H5Q A;  3IK9 A;  2VOC A;  1GSQ A;  5IM9 A;  3F8U A;  4MJB A;  4AKH A;  2CX4 A;  1GTI A;  2MYG A;  3FR6 A;  3ZRE A;  2HYX A;  2ON7 A;  1BX9 A;  1G6Y A;  5FHI A;  2F51 A;  4OFN A;  1ZMA A;  4BWS A;  2LST A;  4CY8 A;  1GSD A;  2VCV A;  5HR1 A;  3GUS A;  3Q19 A;  1NHO A;  2M46 A;  4EE0 A;  13GS A;  1Z9H A;  2C0G A;  2I3Y A;  2E2M A;  2EIO A;  1FAA A;  3DGQ A;  5A34 A;  1XPV A;  6GST A;  3F3Q A;  2OA7 A;  4PUF C;  1BED A;  1ZL9 A;  3ZIV A;  4MCU A;  1EGR A;  2H73 A;  1TW9 A;  1J0F A;  2MBT A;  1TI1 A;  5IPH A;  3LOR A;  4IJI A;  4JR4 A;  1PSQ A;  2EFE A;  1X9S B;  3APQ A;  4KB3 A;  2ZUP A;  5EPF A;  2K8V A;  3KEB A;  3GTU A;  1YQ1 A;  5A4U A;  3HJP A;  2MMO A;  4FYC A;  1B4Q A;  3HA9 A;  3O6T A;  1FB6 A;  4HDE A;  1G7O A;  2R0C A;  2DJK A;  2FD3 A;  1EP8 A;  3A2V A;  2R0P A;  3VWU A;  1V57 A;  5D73 A;  1S3C A;  2HXK A;  2XBQ A;  1LBK A;  2HT9 A;  3TU3 B;  1SL2 B;  4USS A;  5G31 A;  3CSI A;  4WF4 A;  2QA1 A;  1B48 A;  4MZB A;  1TRU A;  2HRA A;  5G1L A;  5IMA A;  5DJL A;  4KGI A;  2QA2 A;  1FHE A;  1Z5Y E;  3ZMK A;  4K7O A;  3L9V A;  3FMW A;  2LRN A;  1H75 A;  3ZLP A;  4K9Z A;  3QDN A;  2HSM A;  4CW9 A;  4NHZ A;  4OMV A;  1I9D A;  2IL3 A;  5BMU B;  1OC3 A;  3CBU A;  4KUN A;  1BQ7 A;  2H0H A;  2C80 A;  2R3X A;  3HY2 A;  5A1N A;  2PN8 A;  5DQS A;  3P2A A;  2WJU A;  3PR8 A;  4KCA A;  4TR3 A;  4I2U A;  4ZBD A;  3GFK A;  2X8C A;  3P90 A;  2RM6 A;  2OJL A;  3GL3 A;  3R2Q A;  1XXU A;  1AQW A;  1GP1 A;  3BJ5 A;  3GSS A;  4AKI A;  1GNW A;  4GCI A;  1EV9 A;  3ED3 A;  2HZF A;  5JWQ B;  3ZZX A;  2JSY A;  2IME A;  4NV5 A;  1X9M B;  3L4N A;  4HU7 A;  1EV4 A;  4KH7 A;  3G7Y A;  3C73 A;  2X64 A;  2PBJ A;  4WBJ A;  3UL3 A;  4ZIJ A;  1QQ2 A;  2IFQ B;  2FWG A;  1OKT A;  1GSF A;  1WMJ A;  1OE8 A;  1YF0 A;  3I6A A;  5ECM B;  3IA1 A;  2FWF A;  5ELA A;  4FO5 A;  3C1R A;  1SVL A;  3FZA A;  3W8S A;  2V41 A;  1YEP A;  3TJF A;  1B4P A;  3V1W A;  5ECK B;  3M8N A;  2JZT A;  1O6J A;  2GS3 A;  1OC9 B;  3GA4 A;  3IE3 A;  4IW9 A;  4G0L A;  1M9A A;  1WP0 A;  2O85 A;  4LA1 A;  5D9T A;  3N9J A;  4DVC A;  1HQO A;  1SKW B;  1Z7P A;  3KMN A;  4XTS A;  1B9X C;  3IR4 A;  2GT6 A;  4N3Z A;  3ME8 A;  2FNO A;  4L5L A;  1RK4 A;  5CNW A;  2K9F A;  2LJK A;  3FYG A;  1WE0 A;  3TJK A;  4ZB9 A;  2FWH A;  1AAZ A;  4ZL8 A;  5A5K A;  1EEM A;  3D22 A;  4G0K A;  2F8F A;  1RW1 A;  5DCG A;  5DCH A;  1SKR B;  3EUR A;  3MIX A;  4K2X A;  1S3A A;  5COH A;  4BWQ A;  4HQS A;  1YDK A;  2B7K A;  3RBT A;  4DSQ A;  1TXX A;  4L8E A;  3IXR A;  1ZYE A;  3I43 A;  1O8X A;  3EU4 A;  4PNG A;  2FA8 A;  4ICY A;  3QFB C;  3L0H A;  1SL0 B;  1XZO A;  3ERW A;  1RQM A;  4WEY A;  4V2M A;  2GQK A;  2B5Y A;  2A2R A;  5EY6 A;  4TR1 B;  3GN3 A;  2F9S A;  2GVP A;  1ILO A;  1A0R P;  4MK3 A;  3ZVJ D;  4FYB A;  1HD2 A;  1V58 A;  5KEJ A;  2H1G A;  3TKS E;  4XIH A;  2VM2 A;  2ZCT A;  2FA4 A;  3JCM L;  4KDY A;  4ACS A;  2PUK C;  5AGY A;  3GKX A;  2GDR A;  5IPG A;  1V40 A;  3PIN A;  1R26 A;  2VCQ A;  1N25 A;  2B7J A;  2LNT A;  2H19 A;  4J56 E;  4AJ6 A;  3IHQ A;  1TI3 A;  1Q98 A;  2L6D A;  4HOJ A;  4WET A;  1TK8 B;  5FT3 A;  4QMK A;  4KW6 A;  2PGT A;  4ID0 A;  3D4T A;  5BMU A;  4I97 A;  6GSU A;  3F3R A;  4GLT A;  3EU3 A;  2YJH A;  9GSS A;  1F3B A;  3VI5 A;  3ZFB A;  2ZNM A;  5ECQ B;  4GDF A;  1FOH A;  3CTG A;  2H75 A;  1ZZY A;  2I4A A;  2LEG A;  2WRT A;  1ST9 A;  2H1B A;  1FO5 A;  1WRY A;  3VK9 A;  1SKS B;  3F6F A;  3RPN A;  5IIZ A;  1PQN A;  3GST A;  2WZ9 A;  4XS6 A;  4AJ7 A;  3HCZ A;  4D73 B;  1EOH A;  4O92 A;  3GKN A;  5F8B A;  1THX A;  2GST A;  2H1A A;  3TRX A;  1M2A A;  5DQY A;  3LWA A;  3IPZ A;  1BAY A;  1K0A A;  4IP6 A;  2L4C A;  5J47 A;  3HHV A;  4K5R A;  3D0Z A;  4K0N A;  1WWJ A;  2HRN A;  3UBL A;  3VWW A;  3DVW A;  2DJJ A;  5B8A A;  1GUL A;  1SVO A;  1TTZ A;  3E9J B;  3H4K A;  1PX7 A;  4ML6 A;  3H8Q A;  2XBI A;  5G2Z A;  1GSS A;  1LU4 A;  1WOU A;  4OD7 A;  1QK8 A;  3ZYW A;  2HRK B;  2B3S A;  2IMI A;  5B8B A;  4GQF A;  14GS A;  1SK2 A;  5KN1 A;  1ZYQ B;  4PQ1 A;  5INY A;  3ME7 A;  5J40 A;  18GS A;  3M9K A;  4GRF A;  3CSH A;  4MH3 A;  3TJG A;  3C1S A;  3LEF A;  2HSY A;  1PRX A;  2GQL A;  5F05 A;  4YAV A;  3MAK A;  1VRS D;  3TB2 A;  1B8X A;  4TN8 A;  2R0G A;  4X4J A;  3APS A;  2VAF A;  3IC8 A;  1QXH A;  1X9W B;  1UA5 A;  4WBR D;  3I9V 2;  5D96 A;  5JCU A;  4WR4 A;  3IAM 2;  2YCD A;  4BL7 B;  4G0I A;  3TKS A;  8GSS A;  3EYT A;  4PXO A;  3ZTL A;  4I6X A;  5ECR B;  2DJ1 A;  1Q4J A;  1TDI A;  2TIR A;  4LL4 B;  2D2Z A;  1U6T A;  2FHE A;  2LKU A;  4HUA A;  4F82 A;  2AJQ B;  1G0T A;  2IWT A;  3HDC A;  3ISO A;  2DMM A;  3RDW A;  2H6Z A;  1MTC A;  4ECI A;  3IAS 2;  2I1U A;  4ZIL A;  3DXB A;  5HR0 A;  5ECP B;  4G10 A;  2CAQ A;  3KMO A;  5HQP A;  3MYD A;  4F2I A;  6GSS A;  4ECJ A;  2RM5 A;  3HXS A;  4KX4 A;  4PQH A;  1A2J A;  1QUW A;  1SVM A;  5L71 A;  1PMT A;  2FUG 2;  1BJX A;  2AB6 A;  4NXI A;  2DJ3 A;  4MF6 A;  1GH2 A;  2EIQ A;  3BCI A;  1A8Y A;  2RUF A;  2VL2 C;  1K0D A;  2K8S A;  2B1L A;  1W4V A;  2HZE B;  3GL5 A;  1XWC A;  3KXO A;  1EP7 A;  4EIQ A;  3DWV A;  3FZ4 A;  2J23 A;  4I2T A;  3QPM A;  1O85 A;  2RLI A;  2VIM A;  1AQX A;  2LRT A;  2N5B A;  3TKP A;  3QMX A;  3TCO A;  4O5R A;  4XHM A;  4JR6 A;  5B7C A;  3KP8 A;  3M1G A;  4BVX B;  2L6C A;  3KD0 A;  1U88 A;  5ELG A;  1PX6 A;  4JU5 A;  4DSS B;  1HYU A;  5KN0 A;  5DJM A;  5H5R A;  5F0G A;  2C1Y A;  1T3B A;  5IQY A;  4QL9 A;  1UVZ A;  2WB9 A;  5A4V A;  1B9Y C;  20GS A;  1N8J A;  5DAL A;  3CXG A;  4Q5R A;  4IS0 A;  4HZ4 A;  1NSW A;  5CAX A;  1KBN A;  2GZY A;  4Z2U A;  1YY7 A;  1HNC A;  3E3E A;  2RII A;  4BA7 A;  3DIE A;  1ON4 A;  4MLY A;  3QR6 A;  4JBB A;  4K5S A;  3P8W A;  3GKM A;  2XPE A;  4K2D A;  1EZK A;  2VCW A;  1XVW A;  4EL1 A;  3CTF A;  3DVX A;  5DAK B;  5JCW A;  1SD9 A;  4RI6 A;  4D73 A;  4OCF A;  1SYR A;  5CO3 A;  5GAN D;  3H1N A;  4A5P A;  3SBC A;  2V6O A;  2YNX A;  5KOX A;  4XRD A;  1UN2 A;  2C3N A;  2VKZ G;  2PVQ A;  4HU9 A;  1ZCP A;  2H76 A;  3HKR A;  3KTL A;  2NTO A;  4E8E A;  1EGO A;  2FCH A;  3VLN A;  4F9Z A;  3CMI A;  4YKG A;  5D9V A;  3HZ8 A;  1J9B A;  4JRR A;  4J2F A;  2CVK A;  2VO4 A;  2JL4 A;  1ZOF A;  2HRK A;  1Y1U A;  2QC7 A;  1R7H A;  3CRU A;  3ZIJ A;  4NAX A;  2YWN A;  6GSV A;  5E59 A;  3HVS A;  1ERW A;  3A3T A;  4N11 A;  1MDJ A;  5J9B A;  1WPI A;  1K0N A;  3S9F A;  1Z7R A;  5KN3 A;  2GSS A;  2AHE A;  5CRD A;  3HD5 A;  4POB A;  4IJ3 A;  2VUP A;  1MDI A;  1GTB A;  1YKC A;  5ECO B;  1PN9 A;  2XC2 A;  1JFU A;  1T7P B;  4BL7 A;  3KH7 A;  2H71 A;  3UIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...