4E8FA

Structural basis for the activity of a cytoplasmic rna terminal u-transferase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
343
structure length
327
Chain Sequence
PNSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Structural basis for the activity of a cytoplasmic RNA terminal uridylyl transferase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
molecule tags Transferase
total genus 106
structure length 327
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4e8fA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4e8fA02
4RQ0A 4I2IA 4NLNA 4DOAA 2BPFA 9ICBA 5J0YA 3AQNA 4LZDA 4KLSA 1F5AA 1HUOA 3AU6A 8ICYA 5J0TA 4X4PA 2NRKA 1ZQHA 8ICLA 3UPQA 8ICMA 1ZQYA 5J2JA 1MIWA 2P66A 4PHDA 4F5OA 4Z6CA 4UAYA 3LQCB 4O5CA 4DO9A 4X4UA 8ICFA 8ICKA 7ICLA 5HRIA 4ATBA 9ICEA 4XA5A 7ICPA 5J0RA 4FHXA 4PH5A 4I2AA 3MBYA 4PHEA 4FH3A 3H3AA 1UEUA 1ZQXA 4X4RA 4NLKA 4M9NA 4M9JA 1ZQRA 1TFWA 2PFOA 3WFOA 2ZH8A 1ZQAA 4X0AA 4R63A 4M5DA 2ZHAA 4RPZA 3RJJA 4QZBA 4QZCA 1MQ3A 3AQLA 4X4NA 3AQKA 3JPTA 1R8CA 1OU5A 4I2HA 1ZQVA 4AT7A 3PMLA 1UETA 4KLTA 4AT8B 1WOTA 4F5PA 4NKUA 4Z6FA 5HRKA 4XUSA 1VJ7A 1ZQOA 9ICRA 3UXOA 2ZH5A 4MF2A 4RWPA 4YCXA 2ZH6A 7ICTA 4UB4A 1XSLA 9ICWA 4X4TA 5CWRA 4M47A 3C66A 8ICVA 3C2KA 8ICQA 3HJ1A 4XQ7A 3RJIA 2DVIA 2ZH1A 3RJFA 4PGQA 1Q79A 3RH5A 4KLIA 2VANA 4DOCA 3C18A 4NM1A 3RJGA 1BPBA 1ZQZA 4PGXA 4ATBB 5HRGA 2BCQA 3RJHA 4PHAA 2BCSA 2FMSA 4O9MA 2PXIA 4QZIA 1ZQTA 5DB8A 1ZQMA 4RQ2A 5DBCA 3HJ4A 5J2HA 7ICEA 4LT6A 4NY8A 2DRAA 3OV7A 4JWNA 1TFYA 4R64A 8ICOA 4WC2A 2DR5A 3AQMA 1ZQIA 2ISOA 4KLOA 4E80A 5J2BA 4EP7A 9ICIA 4O5KA 5HC9A 4K4GA 4UB2A 5HRBA 4M04A 4YD2A 8ICXA 1MIYA 2PBEA 4UAWA 2M2WA 7ICIA 9ICGA 3NYBA 5J2GA 4IQWA 1NO5A 2BCUA 4KLDA 7ICMA 7ICSA 4MF8A 4GXIA 1MIVA 3B0YA 4RPXA 4X4OA 4TUPA 1HUZA 2ISPA 5IINA 1RZTA 3UQ2A 4QZ9A 4P2HA 9ICQA 3V7KA 4WC3A 9ICXA 5J0XA 4AT9B 4TUSA 1XSPA 8ICZA 4I27A 3OGUA 5DDYA 5IIJA 2PFQA 4NKTA 5HRHA 4M9LA 4NM2A 2M2TA 3RH6A 1ZQCA 4X4QA 2RFFA 4KLJA 5IIKA 4M0AA 5DB9A 7ICUA 1ZQBA 1YLQA 4KLFA 3RJEA 4FHPA 9ICAA 9ICSA 2PFNA 4KLGA 4RQ5A 4MFAA 4I2EA 4WCWA 9ICKA 3L9DA 5HRFA 4K4IA 3H38A 1BPYA 5D4BA 3OUYB 4I28A 1Q78A 1ZQSA 4RWQA 5IILA 1UEVA 2HHPA 4S3NA 9ICNA 5D46A 2ZH3A 4I2JA 4Z6DA 3MDAA 2DR7A 1ZQGA 5DB7A 2Q66A 1ZQKA 1R8AA 2IHMA 4UBBA 2ZH7A 3LK9A 5IIIA 5J2AA 5HHIA 1R89A 5J0PA 3C5GA 8ICWA 4RPYA 4R65A 1ZQJA 5IIOA 4RT2A 3MGIA 4RWNA 4M9GA 4X4SA 4KLUA 8ICCA 5DEDA 3C2LA 1ZQDA 4PPXA 9ICTA 4RQ3A 8ICAA 8ICHA 9ICLA 2ZH9A 4FH5A 4KLMA 5DBBA 7ICKA 3OVAA 4WC1A 4QZEA 1BPXA 7ICNA 2BPGA 3C2MA 1ZQUA 5CJ7A 1ZJMA 2I9GA 4TUQA 2BCRA 3JPQA 1JQRA 1ZJNA 4QZHA 3HWTA 3V7LA 4RQ4A 9ICCA 4UD4A 4TURA 3UQ0A 9ICJA 2ZHBA 3AUOA 2BCVA 8ICEA 4WC6A 2PFPA 4F5QA 1BPEA 4IG8A 4KLHA 2O5AA 4QZGA 4RT3A 4K4HA 5BOMA 1TV9A 4UB1A 5J29A 4F5RA 2W9MA 1MQ2A 5CP2A 3HX0A 4GXKA 3H39A 4YN4A 7ICHA 5DKWA 4AT7B 5HREA 2M2UA 4GXJA 5DB6A 2DR8A 1R8BA 4YMOA 2B51A 4EBKA 5DBAA 5J2IA 8ICPA 4I2DA 2DRBA 4O5EA 4AT8A 7ICFA 3RH4A 4FHVA 5CB1A 2FMQA 4UB5A 5J0OA 5HHHA 5J2DA 5J2FA 4MFCA 5HRDA 4QZDA 8ICUA 1FA0A 3UXPA 7ICOA 3ISBA 1BPDA 3JPSA 1ZQPA 4R66A 4DOBA 4QZFA 1ZQWA 5J2EA 4I2GA 3WFRE 1JN3A 7ICGA 4IQVA 9ICFA 1TVAA 3JPNA 4YD1A 4X5VA 4QZAA 4RQ1A 2BE3A 1V4AA 2FMPA 4FHWA 5J0UA 3UXNA 3ISDA 4KLEA 3GDXA 4JWMA 4IQUA 1KDHA 4UAZA 4WBYA 3JZ0A 7ICVA 5DDMA 4EBJA 5J0WA 5IIMA 5HR9A 4MFFA 7ICRA 4WC7A 2B56A 4LZGA 3WFPA 1VFGA 4PHPA 8ICNA 5J0SA 4RQ7A 8ICBA 5J2KA 1RPLA 4LVSA 4I2CA 3TFRA 2M2VA 5TZVA 4YMNA 4I29A 3V72A 5BPCA 3JPOA 3V7JA 4WC0A 2B4VA 1ZQFA 2ZH2A 1JAJA 4M9HA 4M2YA 1BPZA 8ICJA 4RQ6A 3B0XA 4F5NA 7ICJA 3PNCA 3TFSA 3MGHA 3RJKA 5DECA 4XRHA 4UB3A 4X4VA 5CR0A 9ICPA 5D49A 4RQ8A 5BOLA 2ZH4A 4I2BA 3WFQE 7ICQA 4X0BA 3C5FA 8ICSA 4I2FA 1ZQQA 9ICOA 3JPPA 3UPSA 4E7XA 4WBZA 4KLQA 3JPRA 4YMMA 5CHGA 3HW8A 8ICGA 3WFSC 4AT9A 2GWSA 3K75D 4P4MA 9ICMA 4Z6EA 4NLZA 5EOZA 1KEJA 1ZQLA 1PX5A 5HRLA 9ICHA 4IQTA 4XQ8A 4UD5A 3AU2A 4QZ8A 1ZQNA 1NOMA 3H37A 4WC4A 5J2CA 4P4PA 8ICRA 5J0QA 3MDCA 3ISCA 3JYYA 4NXZA 8ICTA 3OVSA 4UBCA 2ID1A 2DR9A 4WC5A 4PGYA 1XSNA 4FHYA 9ICVA 4KLLA 3HIYA 2O1PA 4RWOA 3PMNA 4P4OA 4FO6A 1ZQEA 1KNYA 5F2VO 5CA7A 3OUYA 3OVBA 2BPCA 4E8FA 9ICUA 8ICIA 1JMSA
chains in the Genus database with same CATH superfamily
4RQ0A 4I2IA 4NLNA 4DOAA 2BPFA 9ICBA 5J0YA 4NXWA 3AQNA 4LZDA 4JLZA 4KLSA 1F5AA 1HUOA 3AU6A 4KM5A 8ICYA 5J0TA 4X4PA 2NRKA 1ZQHA 8ICLA 3UPQA 8ICMA 1ZQYA 5J2JA 1MIWA 2P66A 4PHDA 4F5OA 2GA9D 4EV6A 4LEWA 4Z6CA 4UAYA 3LQCB 4OAGA 4O5CA 4DO9A 4X4UA 8ICFA 8ICKA 7ICLA 5HRIA 4ATBA 4N7RA 4XA5A 9ICEA 7ICPA 5J0RA 4FHXA 4PH5A 4I2AA 3MBYA 4PHEA 4FH3A 3H3AA 1UEUA 4X4RA 1ZQXA 4NLKA 4M9NA 4M9JA 1ZQRA 1TFWA 2PFOA 3WFOA 2ZH8A 1ZQAA 4X0AA 4R63A 4LEVA 4M5DA 2ZHAA 4RPZA 3RJJA 4QZBA 4QZCA 1MQ3A 4X4NA 3AQLA 3AQKA 3JPTA 1R8CA 1OU5A 4I2HA 1ZQVA 4AT7A 3PMLA 1UETA 4KLTA 4AT8B 3ERCC 1WOTA 4F5PA 4NKUA 5HRKA 4Z6FA 4XUSA 1VJ7A 1ZQOA 9ICRA 3UXOA 2ZH5A 4MF2A 4RWPA 4YCXA 2ZH6A 7ICTA 4UB4A 3ER9B 5CHEA 1XSLA 9ICWA 4X4TA 5CWRA 4M47A 3C66A 8ICVA 3C2KA 8ICQA 3HJ1A 4XQ7A 3RJIA 2DVIA 2ZH1A 2EWRA 3RJFA 4PGQA 1Q79A 3RH5A 4KLIA 2VANA 4DOCA 3C18A 4K9AA 3K7DA 4NM1A 4FO1A 3JCFA 3RJGA 4WQKA 1BPBA 1ZQZA 4PGXA 4ATBB 5HRGA 2BCQA 3RJHA 4PHAA 2BCSA 2FMSA 4O9MA 2PXIA 4QZIA 1ZQTA 5DB8A 1ZQMA 4RQ2A 5DBCA 3HJ4A 5J2HA 7ICEA 4K97A 4LT6A 4NXTA 4NY8A 4O68A 2DRAA 3OV7A 1TFYA 4JWNA 4R64A 8ICOA 4WC2A 2DR5A 3AQMA 1ZQIA 2ISOA 4KLOA 5D63A 4E80A 4OAHA 3NKUA 5J2BA 4LEYA 4EP7A 9ICIA 4O5KA 5HC9A 4K4GA 4UB2A 5HRBA 4M04A 4YD2A 8ICXA 1MIYA 2PBEA 4UAWA 2M2WA 7ICIA 9ICGA 3NYBA 5J2GA 4IQWA 1NO5A 2BCUA 4KLDA 7ICMA 7ICSA 4MF8A 4GXIA 1MIVA 3B0YA 4RPXA 4X4OA 4TUPA 1HUZA 2ISPA 5IINA 1RZTA 3UQ2A 4QZ9A 4P2HA 9ICQA 3V7KA 4WC3A 9ICXA 5J0XA 4AT9B 4TUSA 1XSPA 8ICZA 4I27A 3OGUA 5DDYA 5IIJA 2PFQA 4NKTA 5HRHA 4M9LA 4NM2A 2M2TA 3RH6A 1ZQCA 4X4QA 2RFFA 4KLJA 5IIKA 4M0AA 5DB9A 7ICUA 1ZQBA 5CFTA 3PHZA 1YLQA 4KLFA 3RJEA 4FHPA 9ICAA 9ICSA 4JLXA 3NWIA 2PFNA 4KLGA 4RQ5A 4MFAA 4I2EA 4WCWA 9ICKA 3L9DA 4HX0A 5HRFA 4K4IA 3H38A 1BPYA 5D4BA 3OUYB 4I28A 1Q78A 1ZQSA 4RWQA 4OAIZ 5IILA 1UEVA 3OWGA 2HHPA 4S3NA 9ICNA 5D46A 2ZH3A 4I2JA 4Z6DA 2DR7A 3MDAA 1ZQGA 5DB7A 2Q66A 1ZQKA 1R8AA 2IHMA 4UBBA 2ZH7A 4K8VA 3LK9A 5IIIA 5J2AA 5HHIA 1R89A 5J0PA 3C5GA 8ICWA 4RPYA 4R65A 1ZQJA 5IIOA 4RT2A 3MGIA 4RWNA 4M9GA 4X4SA 4KLUA 8ICCA 5DEDA 4O6AA 3C2LA 1ZQDA 4PPXA 9ICTA 4RQ3A 4WH5A 8ICAA 8ICHA 9ICLA 2ZH9A 4FH5A 4KLMA 2BBJA 5DBBA 7ICKA 3OVAA 4WC1A 4QZEA 1BPXA 7ICNA 2BPGA 3C2MA 1ZQUA 5CJ7A 1ZJMA 2I9GA 4TUQA 4OAFA 2BCRA 3JPQA 1JQRA 1ZJNA 4QZHA 4EEDA 3HWTA 3V7LA 4RQ4A 9ICCA 4UD4A 4TURA 3UQ0A 5D61A 9ICJA 2ZHBA 3AUOA 2BCVA 8ICEA 4WC6A 2PFPA 4F5QA 1BPEA 3ER8C 4IG8A 5CFUA 4KLHA 2O5AA 4QZGA 4RT3A 4K4HA 5BOMA 1TV9A 4UB1A 5J29A 4F5RA 2W9MA 1MQ2A 3EF2A 5CP2A 3HX0A 4GXKA 3H39A 4YN4A 7ICHA 5DKWA 4AT7B 5HREA 2M2UA 4GXJA 5DB6A 2DR8A 1R8BA 4K96A 2B51A 4YMOA 4EBKA 3MCRA 5DBAA 5J2IA 4EEBA 4O69A 4XJEA 8ICPA 2HN1A 4I2DA 2DRBA 4O5EA 4AT8A 4NXVA 7ICFA 3RH4A 4FHVA 5CB1A 2FMQA 4UB5A 5J0OA 5HHHA 5J2DA 5J2FA 4MFCA 5HRDA 4QZDA 8ICUA 1FA0A 3UXPA 7ICOA 3ISBA 1BPDA 3JPSA 1ZQPA 4R66A 4DOBA 4K98A 4QZFA 1ZQWA 5J2EA 4I2GA 3WFRE 1JN3A 7ICGA 4IQVA 9ICFA 1TVAA 3JPNA 4YD1A 4X5VA 4QZAA 4K9BA 4RQ1A 2BE3A 1V4AA 2FMPA 4FHWA 5J0UA 3UXNA 3ISDA 4KLEA 4NXXA 3GDXA 4JWMA 4IQUA 1KDHA 4UAZA 4WBYA 3JZ0A 7ICVA 5DDMA 4EBJA 5J0WA 5IIMA 4LEZA 5HR9A 4MFFA 7ICRA 5D62A 4WC7A 2B56A 2GAFD 4LZGA 3WFPA 1VFGA 4PHPA 8ICNA 5J0SA 4RQ7A 5B3QA 8ICBA 4KB6A 5J2KA 1RPLA 4LVSA 4I2CA 3TFRA 2IUBA 2M2VA 5TZVA 4YMNA 4O67A 4K99A 4I29A 3V72A 5BPCA 3JPOA 3V7JA 2BBHA 2B4VA 4WC0A 1ZQFA 2ZH2A 1JAJA 4M9HA 4M2YA 1BPZA 8ICJA 4RQ6A 3B0XA 4F5NA 2HN2A 7ICJA 3PNCA 3TFSA 3MGHA 3RJKA 5DECA 4NXUA 4XRHA 4X4VA 4UB3A 5CR0A 4I0UA 5D49A 9ICPA 4RQ8A 2FCLA 5BOLA 2ZH4A 4I2BA 3WFQE 7ICQA 4X0BA 5JTGA 3C5FA 8ICSA 4I2FA 4WOYA 1ZQQA 4MKPA 9ICOA 3JPPA 3UPSA 4E7XA 4WBZA 4KLQA 3JPRA 4YMMA 5CHGA 3HW8A 8ICGA 3WFSC 4AT9A 2GWSA 3K75D 4EGWA 4P4MA 9ICMA 4Z6EA 4NLZA 5EOZA 1KEJA 1ZQLA 1PX5A 5HRLA 9ICHA 4IQTA 4XQ8A 4UD5A 3CK6A 3AU2A 4QZ8A 4WQLA 1ZQNA 5B3PA 1NOMA 3H37A 4WC4A 2IHOA 5J2CA 4P4PA 8ICRA 5J0QA 3MDCA 3ISCA 3JYYA 4NXZA 8ICTA 3OVSA 4UBCA 2ID1A 2DR9A 4WC5A 4PGYA 1XSNA 4FHYA 9ICVA 4KLLA 3NVOA 3HIYA 2O1PA 4RWOA 3PMNA 4P4OA 4FO6A 1ZQEA 1KNYA 3OUYA 5CFSA 5F2VO 5CA7A 3OVBA 2BPCA 4E8FA 9ICUA 8ICIA 1GPJA 1JMSA
chains in the Genus database with same CATH topology
4RQ0A 4I2IA 4NLNA 4DOAA 2BPFA 9ICBA 5J0YA 4NXWA 3AQNA 4LZDA 4JLZA 4KLSA 1F5AA 1HUOA 3AU6A 4KM5A 8ICYA 5J0TA 4X4PA 2NRKA 1ZQHA 8ICLA 3UPQA 8ICMA 1ZQYA 5J2JA 1MIWA 2P66A 4PHDA 4F5OA 4LEWA 4Z6CA 4UAYA 3LQCB 4OAGA 4O5CA 4DO9A 4X4UA 8ICFA 8ICKA 7ICLA 5HRIA 4ATBA 9ICEA 4XA5A 7ICPA 5J0RA 4FHXA 4PH5A 4I2AA 3MBYA 4PHEA 4FH3A 3H3AA 1UEUA 4X4RA 1ZQXA 4NLKA 4M9NA 4M9JA 1ZQRA 1TFWA 2PFOA 3WFOA 2ZH8A 1ZQAA 4X0AA 4R63A 4LEVA 4M5DA 2ZHAA 4RPZA 3RJJA 4QZBA 4QZCA 1MQ3A 4X4NA 3AQLA 3AQKA 3JPTA 1R8CA 1OU5A 4I2HA 1ZQVA 4AT7A 3PMLA 1UETA 4KLTA 4AT8B 1WOTA 4F5PA 4NKUA 4Z6FA 5HRKA 4XUSA 1VJ7A 1ZQOA 9ICRA 3UXOA 2ZH5A 4MF2A 4RWPA 4YCXA 2ZH6A 7ICTA 4UB4A 1XSLA 9ICWA 4X4TA 5CWRA 4M47A 3C66A 8ICVA 3C2KA 8ICQA 3HJ1A 4XQ7A 3RJIA 2DVIA 2ZH1A 3RJFA 4PGQA 1Q79A 3RH5A 4KLIA 2VANA 4DOCA 3C18A 4K9AA 4NM1A 3RJGA 1BPBA 1ZQZA 4PGXA 4ATBB 5HRGA 2BCQA 3RJHA 4PHAA 2BCSA 2FMSA 4O9MA 2PXIA 4QZIA 1ZQTA 5DB8A 1ZQMA 4RQ2A 5DBCA 3HJ4A 5J2HA 7ICEA 4K97A 4LT6A 4NXTA 4NY8A 4O68A 2DRAA 3OV7A 1TFYA 4JWNA 4R64A 8ICOA 4WC2A 2DR5A 3AQMA 1ZQIA 2ISOA 4KLOA 4E80A 4OAHA 5J2BA 4LEYA 4EP7A 9ICIA 4O5KA 5HC9A 4K4GA 4UB2A 5HRBA 4M04A 4YD2A 8ICXA 1MIYA 2PBEA 4UAWA 2M2WA 7ICIA 9ICGA 3NYBA 5J2GA 4IQWA 1NO5A 2BCUA 4KLDA 7ICMA 7ICSA 4MF8A 4GXIA 1MIVA 3B0YA 4RPXA 4X4OA 4TUPA 1HUZA 2ISPA 5IINA 1RZTA 3UQ2A 4QZ9A 4P2HA 9ICQA 3V7KA 4WC3A 9ICXA 5J0XA 4AT9B 4TUSA 1XSPA 8ICZA 4I27A 3OGUA 5DDYA 5IIJA 2PFQA 4NKTA 5HRHA 4M9LA 4NM2A 2M2TA 3RH6A 1ZQCA 4X4QA 2RFFA 4KLJA 5IIKA 4M0AA 5DB9A 7ICUA 1ZQBA 1YLQA 4KLFA 3RJEA 4FHPA 9ICAA 9ICSA 4JLXA 2PFNA 4KLGA 4RQ5A 4MFAA 4I2EA 4WCWA 9ICKA 3L9DA 5HRFA 4K4IA 3H38A 1BPYA 5D4BA 3OUYB 4I28A 1Q78A 1ZQSA 4RWQA 4OAIZ 5IILA 1UEVA 2HHPA 4S3NA 9ICNA 5D46A 2ZH3A 4I2JA 4Z6DA 2DR7A 3MDAA 1ZQGA 5DB7A 2Q66A 1ZQKA 1R8AA 2IHMA 4UBBA 2ZH7A 4K8VA 3LK9A 5IIIA 5J2AA 5HHIA 1R89A 5J0PA 3C5GA 8ICWA 4RPYA 4R65A 1ZQJA 5IIOA 4RT2A 3MGIA 4RWNA 4M9GA 4X4SA 4KLUA 8ICCA 5DEDA 4O6AA 3C2LA 1ZQDA 4PPXA 9ICTA 4RQ3A 8ICAA 8ICHA 9ICLA 2ZH9A 4FH5A 4KLMA 5DBBA 7ICKA 3OVAA 4WC1A 4QZEA 1BPXA 7ICNA 2BPGA 3C2MA 1ZQUA 5CJ7A 1ZJMA 2I9GA 4TUQA 4OAFA 2BCRA 3JPQA 1JQRA 1ZJNA 4QZHA 3HWTA 3V7LA 4RQ4A 9ICCA 4UD4A 4TURA 3UQ0A 9ICJA 2ZHBA 3AUOA 2BCVA 8ICEA 4WC6A 2PFPA 4F5QA 1BPEA 4IG8A 4KLHA 2O5AA 4QZGA 4RT3A 4K4HA 5BOMA 1TV9A 4UB1A 5J29A 4F5RA 2W9MA 1MQ2A 5CP2A 3HX0A 4GXKA 3H39A 4YN4A 7ICHA 5DKWA 4AT7B 5HREA 2M2UA 4GXJA 5DB6A 2DR8A 1R8BA 4K96A 2B51A 4YMOA 4EBKA 5DBAA 5J2IA 4O69A 8ICPA 4I2DA 2DRBA 4O5EA 4AT8A 4NXVA 7ICFA 3RH4A 4FHVA 5CB1A 2FMQA 4UB5A 5J0OA 5HHHA 5J2DA 5J2FA 4MFCA 5HRDA 4QZDA 8ICUA 1FA0A 3UXPA 7ICOA 3ISBA 1BPDA 3JPSA 1ZQPA 4R66A 4DOBA 4K98A 4QZFA 1ZQWA 5J2EA 4I2GA 3WFRE 1JN3A 7ICGA 4IQVA 9ICFA 1TVAA 3JPNA 4YD1A 4X5VA 4QZAA 4K9BA 4RQ1A 2BE3A 1V4AA 2FMPA 4FHWA 5J0UA 3UXNA 3ISDA 4KLEA 4NXXA 3GDXA 4JWMA 4IQUA 1KDHA 4UAZA 4WBYA 3JZ0A 7ICVA 5DDMA 4EBJA 5J0WA 5IIMA 4LEZA 5HR9A 4MFFA 7ICRA 4WC7A 2B56A 4LZGA 3WFPA 1VFGA 4PHPA 8ICNA 5J0SA 4RQ7A 8ICBA 4KB6A 5J2KA 1RPLA 4LVSA 4I2CA 3TFRA 2M2VA 5TZVA 4YMNA 4O67A 4K99A 4I29A 3V72A 5BPCA 3JPOA 3V7JA 4WC0A 2B4VA 1ZQFA 2ZH2A 1JAJA 4M9HA 4M2YA 1BPZA 8ICJA 4RQ6A 3B0XA 4F5NA 7ICJA 3PNCA 3TFSA 3MGHA 3RJKA 5DECA 4NXUA 4XRHA 4X4VA 4UB3A 5CR0A 9ICPA 5D49A 4RQ8A 5BOLA 2ZH4A 4I2BA 3WFQE 7ICQA 4X0BA 3C5FA 8ICSA 4I2FA 4WOYA 1ZQQA 4MKPA 9ICOA 3JPPA 3UPSA 4E7XA 4WBZA 4KLQA 3JPRA 4YMMA 5CHGA 3HW8A 8ICGA 3WFSC 4AT9A 2GWSA 3K75D 4P4MA 9ICMA 4Z6EA 4NLZA 5EOZA 1KEJA 1ZQLA 1PX5A 5HRLA 9ICHA 4IQTA 4XQ8A 4UD5A 3AU2A 4QZ8A 1ZQNA 1NOMA 3H37A 4WC4A 5J2CA 4P4PA 8ICRA 5J0QA 3MDCA 3ISCA 3JYYA 4NXZA 8ICTA 3OVSA 4UBCA 2ID1A 2DR9A 4WC5A 4PGYA 1XSNA 4FHYA 9ICVA 4KLLA 3HIYA 2O1PA 4RWOA 3PMNA 4P4OA 4FO6A 1ZQEA 1KNYA 3OUYA 5F2VO 5CA7A 3OVBA 2BPCA 4E8FA 9ICUA 8ICIA 1JMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ0 A;  4I2I A;  4NLN A;  4DOA A;  2BPF A;  9ICB A;  5J0Y A;  3AQN A;  4LZD A;  4KLS A;  1F5A A;  1HUO A;  3AU6 A;  8ICY A;  5J0T A;  4X4P A;  2NRK A;  1ZQH A;  8ICL A;  3UPQ A;  8ICM A;  1ZQY A;  5J2J A;  1MIW A;  2P66 A;  4PHD A;  4F5O A;  4Z6C A;  4UAY A;  3LQC B;  4O5C A;  4DO9 A;  4X4U A;  8ICF A;  8ICK A;  7ICL A;  5HRI A;  4ATB A;  9ICE A;  4XA5 A;  7ICP A;  5J0R A;  4FHX A;  4PH5 A;  4I2A A;  3MBY A;  4PHE A;  4FH3 A;  3H3A A;  1UEU A;  1ZQX A;  4X4R A;  4NLK A;  4M9N A;  4M9J A;  1ZQR A;  1TFW A;  2PFO A;  3WFO A;  2ZH8 A;  1ZQA A;  4X0A A;  4R63 A;  4M5D A;  2ZHA A;  4RPZ A;  3RJJ A;  4QZB A;  4QZC A;  1MQ3 A;  3AQL A;  4X4N A;  3AQK A;  3JPT A;  1R8C A;  1OU5 A;  4I2H A;  1ZQV A;  4AT7 A;  3PML A;  1UET A;  4KLT A;  4AT8 B;  1WOT A;  4F5P A;  4NKU A;  4Z6F A;  5HRK A;  4XUS A;  1VJ7 A;  1ZQO A;  9ICR A;  3UXO A;  2ZH5 A;  4MF2 A;  4RWP A;  4YCX A;  2ZH6 A;  7ICT A;  4UB4 A;  1XSL A;  9ICW A;  4X4T A;  5CWR A;  4M47 A;  3C66 A;  8ICV A;  3C2K A;  8ICQ A;  3HJ1 A;  4XQ7 A;  3RJI A;  2DVI A;  2ZH1 A;  3RJF A;  4PGQ A;  1Q79 A;  3RH5 A;  4KLI A;  2VAN A;  4DOC A;  3C18 A;  4NM1 A;  3RJG A;  1BPB A;  1ZQZ A;  4PGX A;  4ATB B;  5HRG A;  2BCQ A;  3RJH A;  4PHA A;  2BCS A;  2FMS A;  4O9M A;  2PXI A;  4QZI A;  1ZQT A;  5DB8 A;  1ZQM A;  4RQ2 A;  5DBC A;  3HJ4 A;  5J2H A;  7ICE A;  4LT6 A;  4NY8 A;  2DRA A;  3OV7 A;  4JWN A;  1TFY A;  4R64 A;  8ICO A;  4WC2 A;  2DR5 A;  3AQM A;  1ZQI A;  2ISO A;  4KLO A;  4E80 A;  5J2B A;  4EP7 A;  9ICI A;  4O5K A;  5HC9 A;  4K4G A;  4UB2 A;  5HRB A;  4M04 A;  4YD2 A;  8ICX A;  1MIY A;  2PBE A;  4UAW A;  2M2W A;  7ICI A;  9ICG A;  3NYB A;  5J2G A;  4IQW A;  1NO5 A;  2BCU A;  4KLD A;  7ICM A;  7ICS A;  4MF8 A;  4GXI A;  1MIV A;  3B0Y A;  4RPX A;  4X4O A;  4TUP A;  1HUZ A;  2ISP A;  5IIN A;  1RZT A;  3UQ2 A;  4QZ9 A;  4P2H A;  9ICQ A;  3V7K A;  4WC3 A;  9ICX A;  5J0X A;  4AT9 B;  4TUS A;  1XSP A;  8ICZ A;  4I27 A;  3OGU A;  5DDY A;  5IIJ A;  2PFQ A;  4NKT A;  5HRH A;  4M9L A;  4NM2 A;  2M2T A;  3RH6 A;  1ZQC A;  4X4Q A;  2RFF A;  4KLJ A;  5IIK A;  4M0A A;  5DB9 A;  7ICU A;  1ZQB A;  1YLQ A;  4KLF A;  3RJE A;  4FHP A;  9ICA A;  9ICS A;  2PFN A;  4KLG A;  4RQ5 A;  4MFA A;  4I2E A;  4WCW A;  9ICK A;  3L9D A;  5HRF A;  4K4I A;  3H38 A;  1BPY A;  5D4B A;  3OUY B;  4I28 A;  1Q78 A;  1ZQS A;  4RWQ A;  5IIL A;  1UEV A;  2HHP A;  4S3N A;  9ICN A;  5D46 A;  2ZH3 A;  4I2J A;  4Z6D A;  3MDA A;  2DR7 A;  1ZQG A;  5DB7 A;  2Q66 A;  1ZQK A;  1R8A A;  2IHM A;  4UBB A;  2ZH7 A;  3LK9 A;  5III A;  5J2A A;  5HHI A;  1R89 A;  5J0P A;  3C5G A;  8ICW A;  4RPY A;  4R65 A;  1ZQJ A;  5IIO A;  4RT2 A;  3MGI A;  4RWN A;  4M9G A;  4X4S A;  4KLU A;  8ICC A;  5DED A;  3C2L A;  1ZQD A;  4PPX A;  9ICT A;  4RQ3 A;  8ICA A;  8ICH A;  9ICL A;  2ZH9 A;  4FH5 A;  4KLM A;  5DBB A;  7ICK A;  3OVA A;  4WC1 A;  4QZE A;  1BPX A;  7ICN A;  2BPG A;  3C2M A;  1ZQU A;  5CJ7 A;  1ZJM A;  2I9G A;  4TUQ A;  2BCR A;  3JPQ A;  1JQR A;  1ZJN A;  4QZH A;  3HWT A;  3V7L A;  4RQ4 A;  9ICC A;  4UD4 A;  4TUR A;  3UQ0 A;  9ICJ A;  2ZHB A;  3AUO A;  2BCV A;  8ICE A;  4WC6 A;  2PFP A;  4F5Q A;  1BPE A;  4IG8 A;  4KLH A;  2O5A A;  4QZG A;  4RT3 A;  4K4H A;  5BOM A;  1TV9 A;  4UB1 A;  5J29 A;  4F5R A;  2W9M A;  1MQ2 A;  5CP2 A;  3HX0 A;  4GXK A;  3H39 A;  4YN4 A;  7ICH A;  5DKW A;  4AT7 B;  5HRE A;  2M2U A;  4GXJ A;  5DB6 A;  2DR8 A;  1R8B A;  4YMO A;  2B51 A;  4EBK A;  5DBA A;  5J2I A;  8ICP A;  4I2D A;  2DRB A;  4O5E A;  4AT8 A;  7ICF A;  3RH4 A;  4FHV A;  5CB1 A;  2FMQ A;  4UB5 A;  5J0O A;  5HHH A;  5J2D A;  5J2F A;  4MFC A;  5HRD A;  4QZD A;  8ICU A;  1FA0 A;  3UXP A;  7ICO A;  3ISB A;  1BPD A;  3JPS A;  1ZQP A;  4R66 A;  4DOB A;  4QZF A;  1ZQW A;  5J2E A;  4I2G A;  3WFR E;  1JN3 A;  7ICG A;  4IQV A;  9ICF A;  1TVA A;  3JPN A;  4YD1 A;  4X5V A;  4QZA A;  4RQ1 A;  2BE3 A;  1V4A A;  2FMP A;  4FHW A;  5J0U A;  3UXN A;  3ISD A;  4KLE A;  3GDX A;  4JWM A;  4IQU A;  1KDH A;  4UAZ A;  4WBY A;  3JZ0 A;  7ICV A;  5DDM A;  4EBJ A;  5J0W A;  5IIM A;  5HR9 A;  4MFF A;  7ICR A;  4WC7 A;  2B56 A;  4LZG A;  3WFP A;  1VFG A;  4PHP A;  8ICN A;  5J0S A;  4RQ7 A;  8ICB A;  5J2K A;  1RPL A;  4LVS A;  4I2C A;  3TFR A;  2M2V A;  5TZV A;  4YMN A;  4I29 A;  3V72 A;  5BPC A;  3JPO A;  3V7J A;  4WC0 A;  2B4V A;  1ZQF A;  2ZH2 A;  1JAJ A;  4M9H A;  4M2Y A;  1BPZ A;  8ICJ A;  4RQ6 A;  3B0X A;  4F5N A;  7ICJ A;  3PNC A;  3TFS A;  3MGH A;  3RJK A;  5DEC A;  4XRH A;  4UB3 A;  4X4V A;  5CR0 A;  9ICP A;  5D49 A;  4RQ8 A;  5BOL A;  2ZH4 A;  4I2B A;  3WFQ E;  7ICQ A;  4X0B A;  3C5F A;  8ICS A;  4I2F A;  1ZQQ A;  9ICO A;  3JPP A;  3UPS A;  4E7X A;  4WBZ A;  4KLQ A;  3JPR A;  4YMM A;  5CHG A;  3HW8 A;  8ICG A;  3WFS C;  4AT9 A;  2GWS A;  3K75 D;  4P4M A;  9ICM A;  4Z6E A;  4NLZ A;  5EOZ A;  1KEJ A;  1ZQL A;  1PX5 A;  5HRL A;  9ICH A;  4IQT A;  4XQ8 A;  4UD5 A;  3AU2 A;  4QZ8 A;  1ZQN A;  1NOM A;  3H37 A;  4WC4 A;  5J2C A;  4P4P A;  8ICR A;  5J0Q A;  3MDC A;  3ISC A;  3JYY A;  4NXZ A;  8ICT A;  3OVS A;  4UBC A;  2ID1 A;  2DR9 A;  4WC5 A;  4PGY A;  1XSN A;  4FHY A;  9ICV A;  4KLL A;  3HIY A;  2O1P A;  4RWO A;  3PMN A;  4P4O A;  4FO6 A;  1ZQE A;  1KNY A;  5F2V O;  5CA7 A;  3OUY A;  3OVB A;  2BPC A;  4E8F A;  9ICU A;  8ICI A;  1JMS A; 
#chains in the Genus database with same CATH topology
 4RQ0 A;  4I2I A;  4NLN A;  4DOA A;  2BPF A;  9ICB A;  5J0Y A;  4NXW A;  3AQN A;  4LZD A;  4JLZ A;  4KLS A;  1F5A A;  1HUO A;  3AU6 A;  4KM5 A;  8ICY A;  5J0T A;  4X4P A;  2NRK A;  1ZQH A;  8ICL A;  3UPQ A;  8ICM A;  1ZQY A;  5J2J A;  1MIW A;  2P66 A;  4PHD A;  4F5O A;  2GA9 D;  4EV6 A;  4LEW A;  4Z6C A;  4UAY A;  3LQC B;  4OAG A;  4O5C A;  4DO9 A;  4X4U A;  8ICF A;  8ICK A;  7ICL A;  5HRI A;  4ATB A;  4N7R A;  4XA5 A;  9ICE A;  7ICP A;  5J0R A;  4FHX A;  4PH5 A;  4I2A A;  3MBY A;  4PHE A;  4FH3 A;  3H3A A;  1UEU A;  4X4R A;  1ZQX A;  4NLK A;  4M9N A;  4M9J A;  1ZQR A;  1TFW A;  2PFO A;  3WFO A;  2ZH8 A;  1ZQA A;  4X0A A;  4R63 A;  4LEV A;  4M5D A;  2ZHA A;  4RPZ A;  3RJJ A;  4QZB A;  4QZC A;  1MQ3 A;  4X4N A;  3AQL A;  3AQK A;  3JPT A;  1R8C A;  1OU5 A;  4I2H A;  1ZQV A;  4AT7 A;  3PML A;  1UET A;  4KLT A;  4AT8 B;  3ERC C;  1WOT A;  4F5P A;  4NKU A;  5HRK A;  4Z6F A;  4XUS A;  1VJ7 A;  1ZQO A;  9ICR A;  3UXO A;  2ZH5 A;  4MF2 A;  4RWP A;  4YCX A;  2ZH6 A;  7ICT A;  4UB4 A;  3ER9 B;  5CHE A;  1XSL A;  9ICW A;  4X4T A;  5CWR A;  4M47 A;  3C66 A;  8ICV A;  3C2K A;  8ICQ A;  3HJ1 A;  4XQ7 A;  3RJI A;  2DVI A;  2ZH1 A;  2EWR A;  3RJF A;  4PGQ A;  1Q79 A;  3RH5 A;  4KLI A;  2VAN A;  4DOC A;  3C18 A;  4K9A A;  3K7D A;  4NM1 A;  4FO1 A;  3JCF A;  3RJG A;  4WQK A;  1BPB A;  1ZQZ A;  4PGX A;  4ATB B;  5HRG A;  2BCQ A;  3RJH A;  4PHA A;  2BCS A;  2FMS A;  4O9M A;  2PXI A;  4QZI A;  1ZQT A;  5DB8 A;  1ZQM A;  4RQ2 A;  5DBC A;  3HJ4 A;  5J2H A;  7ICE A;  4K97 A;  4LT6 A;  4NXT A;  4NY8 A;  4O68 A;  2DRA A;  3OV7 A;  1TFY A;  4JWN A;  4R64 A;  8ICO A;  4WC2 A;  2DR5 A;  3AQM A;  1ZQI A;  2ISO A;  4KLO A;  5D63 A;  4E80 A;  4OAH A;  3NKU A;  5J2B A;  4LEY A;  4EP7 A;  9ICI A;  4O5K A;  5HC9 A;  4K4G A;  4UB2 A;  5HRB A;  4M04 A;  4YD2 A;  8ICX A;  1MIY A;  2PBE A;  4UAW A;  2M2W A;  7ICI A;  9ICG A;  3NYB A;  5J2G A;  4IQW A;  1NO5 A;  2BCU A;  4KLD A;  7ICM A;  7ICS A;  4MF8 A;  4GXI A;  1MIV A;  3B0Y A;  4RPX A;  4X4O A;  4TUP A;  1HUZ A;  2ISP A;  5IIN A;  1RZT A;  3UQ2 A;  4QZ9 A;  4P2H A;  9ICQ A;  3V7K A;  4WC3 A;  9ICX A;  5J0X A;  4AT9 B;  4TUS A;  1XSP A;  8ICZ A;  4I27 A;  3OGU A;  5DDY A;  5IIJ A;  2PFQ A;  4NKT A;  5HRH A;  4M9L A;  4NM2 A;  2M2T A;  3RH6 A;  1ZQC A;  4X4Q A;  2RFF A;  4KLJ A;  5IIK A;  4M0A A;  5DB9 A;  7ICU A;  1ZQB A;  5CFT A;  3PHZ A;  1YLQ A;  4KLF A;  3RJE A;  4FHP A;  9ICA A;  9ICS A;  4JLX A;  3NWI A;  2PFN A;  4KLG A;  4RQ5 A;  4MFA A;  4I2E A;  4WCW A;  9ICK A;  3L9D A;  4HX0 A;  5HRF A;  4K4I A;  3H38 A;  1BPY A;  5D4B A;  3OUY B;  4I28 A;  1Q78 A;  1ZQS A;  4RWQ A;  4OAI Z;  5IIL A;  1UEV A;  3OWG A;  2HHP A;  4S3N A;  9ICN A;  5D46 A;  2ZH3 A;  4I2J A;  4Z6D A;  2DR7 A;  3MDA A;  1ZQG A;  5DB7 A;  2Q66 A;  1ZQK A;  1R8A A;  2IHM A;  4UBB A;  2ZH7 A;  4K8V A;  3LK9 A;  5III A;  5J2A A;  5HHI A;  1R89 A;  5J0P A;  3C5G A;  8ICW A;  4RPY A;  4R65 A;  1ZQJ A;  5IIO A;  4RT2 A;  3MGI A;  4RWN A;  4M9G A;  4X4S A;  4KLU A;  8ICC A;  5DED A;  4O6A A;  3C2L A;  1ZQD A;  4PPX A;  9ICT A;  4RQ3 A;  4WH5 A;  8ICA A;  8ICH A;  9ICL A;  2ZH9 A;  4FH5 A;  4KLM A;  2BBJ A;  5DBB A;  7ICK A;  3OVA A;  4WC1 A;  4QZE A;  1BPX A;  7ICN A;  2BPG A;  3C2M A;  1ZQU A;  5CJ7 A;  1ZJM A;  2I9G A;  4TUQ A;  4OAF A;  2BCR A;  3JPQ A;  1JQR A;  1ZJN A;  4QZH A;  4EED A;  3HWT A;  3V7L A;  4RQ4 A;  9ICC A;  4UD4 A;  4TUR A;  3UQ0 A;  5D61 A;  9ICJ A;  2ZHB A;  3AUO A;  2BCV A;  8ICE A;  4WC6 A;  2PFP A;  4F5Q A;  1BPE A;  3ER8 C;  4IG8 A;  5CFU A;  4KLH A;  2O5A A;  4QZG A;  4RT3 A;  4K4H A;  5BOM A;  1TV9 A;  4UB1 A;  5J29 A;  4F5R A;  2W9M A;  1MQ2 A;  3EF2 A;  5CP2 A;  3HX0 A;  4GXK A;  3H39 A;  4YN4 A;  7ICH A;  5DKW A;  4AT7 B;  5HRE A;  2M2U A;  4GXJ A;  5DB6 A;  2DR8 A;  1R8B A;  4K96 A;  2B51 A;  4YMO A;  4EBK A;  3MCR A;  5DBA A;  5J2I A;  4EEB A;  4O69 A;  4XJE A;  8ICP A;  2HN1 A;  4I2D A;  2DRB A;  4O5E A;  4AT8 A;  4NXV A;  7ICF A;  3RH4 A;  4FHV A;  5CB1 A;  2FMQ A;  4UB5 A;  5J0O A;  5HHH A;  5J2D A;  5J2F A;  4MFC A;  5HRD A;  4QZD A;  8ICU A;  1FA0 A;  3UXP A;  7ICO A;  3ISB A;  1BPD A;  3JPS A;  1ZQP A;  4R66 A;  4DOB A;  4K98 A;  4QZF A;  1ZQW A;  5J2E A;  4I2G A;  3WFR E;  1JN3 A;  7ICG A;  4IQV A;  9ICF A;  1TVA A;  3JPN A;  4YD1 A;  4X5V A;  4QZA A;  4K9B A;  4RQ1 A;  2BE3 A;  1V4A A;  2FMP A;  4FHW A;  5J0U A;  3UXN A;  3ISD A;  4KLE A;  4NXX A;  3GDX A;  4JWM A;  4IQU A;  1KDH A;  4UAZ A;  4WBY A;  3JZ0 A;  7ICV A;  5DDM A;  4EBJ A;  5J0W A;  5IIM A;  4LEZ A;  5HR9 A;  4MFF A;  7ICR A;  5D62 A;  4WC7 A;  2B56 A;  2GAF D;  4LZG A;  3WFP A;  1VFG A;  4PHP A;  8ICN A;  5J0S A;  4RQ7 A;  5B3Q A;  8ICB A;  4KB6 A;  5J2K A;  1RPL A;  4LVS A;  4I2C A;  3TFR A;  2IUB A;  2M2V A;  5TZV A;  4YMN A;  4O67 A;  4K99 A;  4I29 A;  3V72 A;  5BPC A;  3JPO A;  3V7J A;  2BBH A;  2B4V A;  4WC0 A;  1ZQF A;  2ZH2 A;  1JAJ A;  4M9H A;  4M2Y A;  1BPZ A;  8ICJ A;  4RQ6 A;  3B0X A;  4F5N A;  2HN2 A;  7ICJ A;  3PNC A;  3TFS A;  3MGH A;  3RJK A;  5DEC A;  4NXU A;  4XRH A;  4X4V A;  4UB3 A;  5CR0 A;  4I0U A;  5D49 A;  9ICP A;  4RQ8 A;  2FCL A;  5BOL A;  2ZH4 A;  4I2B A;  3WFQ E;  7ICQ A;  4X0B A;  5JTG A;  3C5F A;  8ICS A;  4I2F A;  4WOY A;  1ZQQ A;  4MKP A;  9ICO A;  3JPP A;  3UPS A;  4E7X A;  4WBZ A;  4KLQ A;  3JPR A;  4YMM A;  5CHG A;  3HW8 A;  8ICG A;  3WFS C;  4AT9 A;  2GWS A;  3K75 D;  4EGW A;  4P4M A;  9ICM A;  4Z6E A;  4NLZ A;  5EOZ A;  1KEJ A;  1ZQL A;  1PX5 A;  5HRL A;  9ICH A;  4IQT A;  4XQ8 A;  4UD5 A;  3CK6 A;  3AU2 A;  4QZ8 A;  4WQL A;  1ZQN A;  5B3P A;  1NOM A;  3H37 A;  4WC4 A;  2IHO A;  5J2C A;  4P4P A;  8ICR A;  5J0Q A;  3MDC A;  3ISC A;  3JYY A;  4NXZ A;  8ICT A;  3OVS A;  4UBC A;  2ID1 A;  2DR9 A;  4WC5 A;  4PGY A;  1XSN A;  4FHY A;  9ICV A;  4KLL A;  3NVO A;  3HIY A;  2O1P A;  4RWO A;  3PMN A;  4P4O A;  4FO6 A;  1ZQE A;  1KNY A;  3OUY A;  5CFS A;  5F2V O;  5CA7 A;  3OVB A;  2BPC A;  4E8F A;  9ICU A;  8ICI A;  1GPJ A;  1JMS A; 
#chains in the Genus database with same CATH homology
 4RQ0 A;  4I2I A;  4NLN A;  4DOA A;  2BPF A;  9ICB A;  5J0Y A;  4NXW A;  3AQN A;  4LZD A;  4JLZ A;  4KLS A;  1F5A A;  1HUO A;  3AU6 A;  4KM5 A;  8ICY A;  5J0T A;  4X4P A;  2NRK A;  1ZQH A;  8ICL A;  3UPQ A;  8ICM A;  1ZQY A;  5J2J A;  1MIW A;  2P66 A;  4PHD A;  4F5O A;  4LEW A;  4Z6C A;  4UAY A;  3LQC B;  4OAG A;  4O5C A;  4DO9 A;  4X4U A;  8ICF A;  8ICK A;  7ICL A;  5HRI A;  4ATB A;  9ICE A;  4XA5 A;  7ICP A;  5J0R A;  4FHX A;  4PH5 A;  4I2A A;  3MBY A;  4PHE A;  4FH3 A;  3H3A A;  1UEU A;  4X4R A;  1ZQX A;  4NLK A;  4M9N A;  4M9J A;  1ZQR A;  1TFW A;  2PFO A;  3WFO A;  2ZH8 A;  1ZQA A;  4X0A A;  4R63 A;  4LEV A;  4M5D A;  2ZHA A;  4RPZ A;  3RJJ A;  4QZB A;  4QZC A;  1MQ3 A;  4X4N A;  3AQL A;  3AQK A;  3JPT A;  1R8C A;  1OU5 A;  4I2H A;  1ZQV A;  4AT7 A;  3PML A;  1UET A;  4KLT A;  4AT8 B;  1WOT A;  4F5P A;  4NKU A;  4Z6F A;  5HRK A;  4XUS A;  1VJ7 A;  1ZQO A;  9ICR A;  3UXO A;  2ZH5 A;  4MF2 A;  4RWP A;  4YCX A;  2ZH6 A;  7ICT A;  4UB4 A;  1XSL A;  9ICW A;  4X4T A;  5CWR A;  4M47 A;  3C66 A;  8ICV A;  3C2K A;  8ICQ A;  3HJ1 A;  4XQ7 A;  3RJI A;  2DVI A;  2ZH1 A;  3RJF A;  4PGQ A;  1Q79 A;  3RH5 A;  4KLI A;  2VAN A;  4DOC A;  3C18 A;  4K9A A;  4NM1 A;  3RJG A;  1BPB A;  1ZQZ A;  4PGX A;  4ATB B;  5HRG A;  2BCQ A;  3RJH A;  4PHA A;  2BCS A;  2FMS A;  4O9M A;  2PXI A;  4QZI A;  1ZQT A;  5DB8 A;  1ZQM A;  4RQ2 A;  5DBC A;  3HJ4 A;  5J2H A;  7ICE A;  4K97 A;  4LT6 A;  4NXT A;  4NY8 A;  4O68 A;  2DRA A;  3OV7 A;  1TFY A;  4JWN A;  4R64 A;  8ICO A;  4WC2 A;  2DR5 A;  3AQM A;  1ZQI A;  2ISO A;  4KLO A;  4E80 A;  4OAH A;  5J2B A;  4LEY A;  4EP7 A;  9ICI A;  4O5K A;  5HC9 A;  4K4G A;  4UB2 A;  5HRB A;  4M04 A;  4YD2 A;  8ICX A;  1MIY A;  2PBE A;  4UAW A;  2M2W A;  7ICI A;  9ICG A;  3NYB A;  5J2G A;  4IQW A;  1NO5 A;  2BCU A;  4KLD A;  7ICM A;  7ICS A;  4MF8 A;  4GXI A;  1MIV A;  3B0Y A;  4RPX A;  4X4O A;  4TUP A;  1HUZ A;  2ISP A;  5IIN A;  1RZT A;  3UQ2 A;  4QZ9 A;  4P2H A;  9ICQ A;  3V7K A;  4WC3 A;  9ICX A;  5J0X A;  4AT9 B;  4TUS A;  1XSP A;  8ICZ A;  4I27 A;  3OGU A;  5DDY A;  5IIJ A;  2PFQ A;  4NKT A;  5HRH A;  4M9L A;  4NM2 A;  2M2T A;  3RH6 A;  1ZQC A;  4X4Q A;  2RFF A;  4KLJ A;  5IIK A;  4M0A A;  5DB9 A;  7ICU A;  1ZQB A;  1YLQ A;  4KLF A;  3RJE A;  4FHP A;  9ICA A;  9ICS A;  4JLX A;  2PFN A;  4KLG A;  4RQ5 A;  4MFA A;  4I2E A;  4WCW A;  9ICK A;  3L9D A;  5HRF A;  4K4I A;  3H38 A;  1BPY A;  5D4B A;  3OUY B;  4I28 A;  1Q78 A;  1ZQS A;  4RWQ A;  4OAI Z;  5IIL A;  1UEV A;  2HHP A;  4S3N A;  9ICN A;  5D46 A;  2ZH3 A;  4I2J A;  4Z6D A;  2DR7 A;  3MDA A;  1ZQG A;  5DB7 A;  2Q66 A;  1ZQK A;  1R8A A;  2IHM A;  4UBB A;  2ZH7 A;  4K8V A;  3LK9 A;  5III A;  5J2A A;  5HHI A;  1R89 A;  5J0P A;  3C5G A;  8ICW A;  4RPY A;  4R65 A;  1ZQJ A;  5IIO A;  4RT2 A;  3MGI A;  4RWN A;  4M9G A;  4X4S A;  4KLU A;  8ICC A;  5DED A;  4O6A A;  3C2L A;  1ZQD A;  4PPX A;  9ICT A;  4RQ3 A;  8ICA A;  8ICH A;  9ICL A;  2ZH9 A;  4FH5 A;  4KLM A;  5DBB A;  7ICK A;  3OVA A;  4WC1 A;  4QZE A;  1BPX A;  7ICN A;  2BPG A;  3C2M A;  1ZQU A;  5CJ7 A;  1ZJM A;  2I9G A;  4TUQ A;  4OAF A;  2BCR A;  3JPQ A;  1JQR A;  1ZJN A;  4QZH A;  3HWT A;  3V7L A;  4RQ4 A;  9ICC A;  4UD4 A;  4TUR A;  3UQ0 A;  9ICJ A;  2ZHB A;  3AUO A;  2BCV A;  8ICE A;  4WC6 A;  2PFP A;  4F5Q A;  1BPE A;  4IG8 A;  4KLH A;  2O5A A;  4QZG A;  4RT3 A;  4K4H A;  5BOM A;  1TV9 A;  4UB1 A;  5J29 A;  4F5R A;  2W9M A;  1MQ2 A;  5CP2 A;  3HX0 A;  4GXK A;  3H39 A;  4YN4 A;  7ICH A;  5DKW A;  4AT7 B;  5HRE A;  2M2U A;  4GXJ A;  5DB6 A;  2DR8 A;  1R8B A;  4K96 A;  2B51 A;  4YMO A;  4EBK A;  5DBA A;  5J2I A;  4O69 A;  8ICP A;  4I2D A;  2DRB A;  4O5E A;  4AT8 A;  4NXV A;  7ICF A;  3RH4 A;  4FHV A;  5CB1 A;  2FMQ A;  4UB5 A;  5J0O A;  5HHH A;  5J2D A;  5J2F A;  4MFC A;  5HRD A;  4QZD A;  8ICU A;  1FA0 A;  3UXP A;  7ICO A;  3ISB A;  1BPD A;  3JPS A;  1ZQP A;  4R66 A;  4DOB A;  4K98 A;  4QZF A;  1ZQW A;  5J2E A;  4I2G A;  3WFR E;  1JN3 A;  7ICG A;  4IQV A;  9ICF A;  1TVA A;  3JPN A;  4YD1 A;  4X5V A;  4QZA A;  4K9B A;  4RQ1 A;  2BE3 A;  1V4A A;  2FMP A;  4FHW A;  5J0U A;  3UXN A;  3ISD A;  4KLE A;  4NXX A;  3GDX A;  4JWM A;  4IQU A;  1KDH A;  4UAZ A;  4WBY A;  3JZ0 A;  7ICV A;  5DDM A;  4EBJ A;  5J0W A;  5IIM A;  4LEZ A;  5HR9 A;  4MFF A;  7ICR A;  4WC7 A;  2B56 A;  4LZG A;  3WFP A;  1VFG A;  4PHP A;  8ICN A;  5J0S A;  4RQ7 A;  8ICB A;  4KB6 A;  5J2K A;  1RPL A;  4LVS A;  4I2C A;  3TFR A;  2M2V A;  5TZV A;  4YMN A;  4O67 A;  4K99 A;  4I29 A;  3V72 A;  5BPC A;  3JPO A;  3V7J A;  4WC0 A;  2B4V A;  1ZQF A;  2ZH2 A;  1JAJ A;  4M9H A;  4M2Y A;  1BPZ A;  8ICJ A;  4RQ6 A;  3B0X A;  4F5N A;  7ICJ A;  3PNC A;  3TFS A;  3MGH A;  3RJK A;  5DEC A;  4NXU A;  4XRH A;  4X4V A;  4UB3 A;  5CR0 A;  9ICP A;  5D49 A;  4RQ8 A;  5BOL A;  2ZH4 A;  4I2B A;  3WFQ E;  7ICQ A;  4X0B A;  3C5F A;  8ICS A;  4I2F A;  4WOY A;  1ZQQ A;  4MKP A;  9ICO A;  3JPP A;  3UPS A;  4E7X A;  4WBZ A;  4KLQ A;  3JPR A;  4YMM A;  5CHG A;  3HW8 A;  8ICG A;  3WFS C;  4AT9 A;  2GWS A;  3K75 D;  4P4M A;  9ICM A;  4Z6E A;  4NLZ A;  5EOZ A;  1KEJ A;  1ZQL A;  1PX5 A;  5HRL A;  9ICH A;  4IQT A;  4XQ8 A;  4UD5 A;  3AU2 A;  4QZ8 A;  1ZQN A;  1NOM A;  3H37 A;  4WC4 A;  5J2C A;  4P4P A;  8ICR A;  5J0Q A;  3MDC A;  3ISC A;  3JYY A;  4NXZ A;  8ICT A;  3OVS A;  4UBC A;  2ID1 A;  2DR9 A;  4WC5 A;  4PGY A;  1XSN A;  4FHY A;  9ICV A;  4KLL A;  3HIY A;  2O1P A;  4RWO A;  3PMN A;  4P4O A;  4FO6 A;  1ZQE A;  1KNY A;  3OUY A;  5F2V O;  5CA7 A;  3OVB A;  2BPC A;  4E8F A;  9ICU A;  8ICI A;  1JMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...