4E8FA

Structural basis for the activity of a cytoplasmic rna terminal u-transferase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
343
structure length
327
Chain Sequence
PNSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the activity of a cytoplasmic RNA terminal uridylyl transferase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 106
structure length 327
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4e8fA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4e8fA02
4KLLA 4PHPA 2PBEA 1ZQKA 9ICIA 1VJ7A 5J2AA 5J0WA 4RPYA 2HHPA 1R8CA 2DR9A 5DB9A 4X4NA 9ICUA 3WFPA 5J2FA 5J0YA 4QZHA 1BPEA 5DBCA 3C2MA 2M2VA 3UPSA 7ICOA 3H3AA 5J2IA 4WC3A 3ISCA 2Q66A 4RQ3A 5DB7A 8ICAA 7ICHA 5DB8A 3WFOA 4FHWA 4AT8B 8ICRA 4I2IA 3JPPA 4O5EA 1ZQXA 5EOZA 4X4TA 4QZ9A 5HC9A 4M0AA 5IIOA 4QZDA 4TUSA 4F5QA 5J0PA 3ISDA 5IINA 4R66A 4Z6FA 3JZ0A 4IQUA 4XA5A 1MQ2A 2BPGA 4FHXA 1ZQFA 3RJKA 2BCSA 4O5CA 1R8AA 2ZH4A 5DKWA 8ICZA 4UB3A 9ICGA 4F5OA 1JN3A 3H39A 5HREA 3HJ4A 4FHYA 8ICIA 4I2GA 3RH4A 4M2YA 8ICSA 3RJEA 4WC6A 1HUZA 4MFCA 2ZH3A 4F5PA 3V7KA 1ZQMA 5J0TA 1ZQGA 4PGXA 4KLTA 2BCQA 1ZQCA 4EP7A 4KLUA 3AQMA 3JPSA 5IIIA 4LZGA 4QZEA 5D46A 4PGQA 3OVAA 3C66A 7ICSA 4NLZA 4P4OA 8ICCA 2BCUA 9ICJA 4M5DA 4RT3A 3JPQA 1ZQDA 2O5AA 4KLIA 5HRLA 5DBAA 5J2GA 4I29A 1ZQUA 2DR7A 4PHDA 5BOLA 9ICRA 1BPDA 5D49A 4UAYA 4XQ8A 4MFFA 3OVBA 3UXOA 2BCRA 3ISBA 7ICMA 8ICUA 1KNYA 4Z6CA 3WFQE 4RQ7A 5HHIA 1ZQVA 4XRHA 3MDAA 4K4GA 2DRAA 1ZQWA 2DR8A 5IIJA 3H38A 1JMSA 7ICQA 1BPYA 2FMSA 4X4OA 2DVIA 2ZH1A 4YCXA 4K4IA 4EBJA 2PXIA 3JPOA 3C2KA 9ICKA 9ICBA 3AQKA 4KLSA 4NY8A 4QZBA 4I27A 3LQCB 4M9HA 4AT9B 3HWTA 4I2BA 4IG8A 5HRHA 2BCVA 4RWPA 5IIMA 4WC2A 7ICLA 7ICJA 1V4AA 9ICHA 4FHPA 1UEVA 4NXZA 3B0YA 4YN4A 4YMOA 3K75D 1BPXA 4PH5A 1Q79A 4RPZA 4RQ4A 4R63A 4M47A 8ICNA 3AQNA 1JQRA 4RPXA 4Z6EA 3C5FA 4JWNA 4WC5A 5DDMA 4NLKA 4RQ8A 1ZQPA 2PFOA 2RFFA 2ZHBA 2NRKA 4WC1A 4ATBB 4QZAA 4AT8A 5J29A 5J2BA 4TUPA 3RJJA 7ICKA 1R8BA 4RQ1A 4RWQA 4KLJA 1MIWA 5CHGA 4RWOA 4I2DA 4P4PA 2BE3A 1HUOA 8ICGA 1OU5A 8ICXA 9ICTA 5CJ7A 8ICJA 8ICOA 4YMMA 3UQ0A 1ZQSA 2I9GA 3AUOA 4RT2A 3HJ1A 3PMLA 2M2UA 1ZQTA 4PPXA 9ICCA 8ICEA 4UB4A 1RZTA 4QZIA 4P4MA 5HRFA 2VANA 1ZQLA 1XSLA 1ZQBA 5F2VO 4UB2A 4PHAA 4QZ8A 3WFSC 9ICEA 4O5KA 9ICPA 7ICFA 1Q78A 4WC0A 7ICNA 3HX0A 3RJFA 2BPFA 5BOMA 4JWMA 5J0SA 4X0AA 1KEJA 4YMNA 1FA0A 4RQ6A 2P66A 4NKTA 7ICUA 3RH5A 3C5GA 4F5RA 1ZQOA 4RQ5A 4X4RA 4R64A 4NLNA 3JYYA 3RH6A 4P2HA 4UD4A 7ICIA 2ZH6A 3GDXA 3HW8A 5J0XA 3NYBA 1XSPA 2ZH2A 4KLDA 4M9LA 1TFWA 5J2JA 4WBYA 3V72A 4PHEA 4E7XA 8ICPA 9ICWA 7ICTA 4GXIA 1WOTA 3UQ2A 4X4QA 5CR0A 3RJIA 4UB1A 1MIYA 4I2AA 1TV9A 3C18A 2B56A 5IILA 1ZJMA 4DO9A 4YD2A 3UXPA 9ICAA 2ISOA 8ICLA 4TUQA 4DOAA 2DR5A 3JPNA 5DECA 4I2FA 4E8FA 4I2HA 2W9MA 2PFNA 5TZVA 4KLFA 5CWRA 4AT7B 1TVAA 4X4VA 4WCWA 5J0UA 4AT9A 9ICSA 2B4VA 9ICVA 8ICBA 5D4BA 2GWSA 1PX5A 4O9MA 4Z6DA 5J2DA 3OGUA 1ZQYA 4QZFA 4NM2A 4LVSA 4X0BA 4GXJA 2ISPA 3TFSA 3MGIA 1NOMA 2ID1A 3UPQA 4X5VA 9ICNA 2ZH9A 2ZH5A 4I2EA 3HIYA 3RJHA 4UBCA 8ICKA 1RPLA 4ATBA 2O1PA 7ICGA 4KLHA 4I2JA 3LK9A 3PMNA 2FMQA 1ZQRA 3MGHA 4KLQA 1ZQJA 2M2WA 4X4UA 4FO6A 4M9NA 7ICPA 2DRBA 1ZQNA 5DBBA 4I28A 9ICLA 2ZHAA 5J0RA 2IHMA 3L9DA 1UEUA 5HR9A 4KLGA 5BPCA 4X4PA 9ICMA 1JAJA 3MDCA 5J0OA 4KLEA 4M9GA 4E80A 1ZQEA 4KLOA 4RQ2A 1VFGA 4YD1A 2ZH7A 4WC4A 5DB6A 8ICVA 5CA7A 4FHVA 4QZGA 3OUYB 4WC7A 1R89A 1KDHA 3C2LA 4MF2A 8ICQA 3PNCA 4EBKA 3AU6A 2B51A 4UAWA 3AU2A 1ZQHA 4AT7A 4R65A 9ICQA 3JPRA 3WFRE 1MIVA 4IQTA 4XQ7A 3UXNA 2BPCA 5J0QA 3OVSA 5HRDA 5HRBA 4XUSA 8ICHA 1BPZA 3OV7A 1ZJNA 7ICEA 8ICWA 1NO5A 4M04A 1UETA 4DOBA 8ICFA 5CB1A 2PFQA 4LZDA 1ZQZA 3V7JA 1F5AA 4UAZA 7ICRA 5J2CA 5HRIA 4UD5A 4RWNA 1TFYA 4IQWA 5DEDA 4PGYA 4IQVA 3OUYA 5J2HA 4M9JA 7ICVA 4QZCA 3TFRA 5J2EA 4K4HA 3JPTA 4NM1A 4GXKA 4TURA 2ZH8A 4I2CA 3MBYA 1YLQA 4RQ0A 2FMPA 4NKUA 3H37A 4LT6A 4X4SA 9ICOA 1BPBA 9ICXA 4FH3A 3RJGA 4UBBA 5HRGA 1MQ3A 2PFPA 2M2TA 4WBZA 5HRKA 5IIKA 8ICTA 4F5NA 3B0XA 4MF8A 1ZQIA 1XSNA 9ICFA 4KLMA 4DOCA 3AQLA 3V7LA 1ZQAA 5CP2A 5J2KA 4MFAA 5DDYA 4FH5A 8ICYA 1ZQQA 4S3NA 4UB5A 5HHHA 8ICMA
chains in the Genus database with same CATH superfamily
4KLLA 4PHPA 5D61A 4JLZA 2PBEA 1ZQKA 9ICIA 4K99A 1VJ7A 5J2AA 5J0WA 4RPYA 2HHPA 1R8CA 2DR9A 2IHOA 4FO1A 5DB9A 4X4NA 9ICUA 3WFPA 5J2FA 5J0YA 4QZHA 1BPEA 5DBCA 3C2MA 4LEVA 2M2VA 3UPSA 7ICOA 3H3AA 5J2IA 4WC3A 3ISCA 2Q66A 4RQ3A 5DB7A 8ICAA 7ICHA 5DB8A 3WFOA 4FHWA 4AT8B 8ICRA 4I2IA 3JPPA 4O5EA 1ZQXA 4X4TA 5EOZA 4QZ9A 5HC9A 4M0AA 5IIOA 4QZDA 4TUSA 4F5QA 5D62A 5J0PA 3ISDA 5IINA 4R66A 4O69A 4Z6FA 3JZ0A 4IQUA 4XA5A 1MQ2A 2BPGA 4FHXA 1ZQFA 4OAGA 3RJKA 2BCSA 4O5CA 1R8AA 2ZH4A 5DKWA 8ICZA 3NKUA 4UB3A 9ICGA 1JN3A 3H39A 5HREA 4F5OA 3HJ4A 4FHYA 8ICIA 4I2GA 3RH4A 4M2YA 8ICSA 3RJEA 4WC6A 1HUZA 4MFCA 2ZH3A 4F5PA 3V7KA 1ZQMA 5J0TA 1ZQGA 4PGXA 4KLTA 2BCQA 1ZQCA 4OAFA 4EP7A 4KLUA 3AQMA 3JPSA 2EWRA 5IIIA 5CFSA 4LZGA 4QZEA 5D46A 3OVAA 4PGQA 3C66A 7ICSA 4NLZA 1GPJA 4P4OA 8ICCA 2BCUA 9ICJA 4M5DA 5CFUA 4RT3A 3JPQA 1ZQDA 4N7RA 2O5AA 4KLIA 5HRLA 5DBAA 5J2GA 2GA9D 4I29A 2DR7A 1ZQUA 2BBHA 5BOLA 4PHDA 9ICRA 1BPDA 5D49A 4UAYA 4XQ8A 4MFFA 3OVBA 3UXOA 2BCRA 3ISBA 7ICMA 8ICUA 1KNYA 4Z6CA 3WFQE 4RQ7A 5HHIA 1ZQVA 4XRHA 3MDAA 4K4GA 2DRAA 1ZQWA 2DR8A 5IIJA 3H38A 1JMSA 7ICQA 1BPYA 2FMSA 4NXVA 4X4OA 2ZH1A 2DVIA 4EEDA 4YCXA 4EBJA 4OAHA 5B3PA 3JPOA 2PXIA 4K4IA 3C2KA 9ICKA 9ICBA 3AQKA 4KLSA 4NY8A 4QZBA 4I27A 3LQCB 4M9HA 4AT9B 3HWTA 4I2BA 4IG8A 5HRHA 4EV6A 2BCVA 4RWPA 5IIMA 4WC2A 7ICLA 7ICJA 1V4AA 9ICHA 4K97A 1UEVA 4FHPA 4NXZA 3B0YA 4YN4A 4YMOA 3K75D 1BPXA 4PH5A 1Q79A 4RPZA 4RQ4A 4R63A 4M47A 8ICNA 3AQNA 1JQRA 4RPXA 3ER8C 3EF2A 4Z6EA 3C5FA 4JWNA 4WC5A 5DDMA 4NLKA 4RQ8A 1ZQPA 2PFOA 2RFFA 4KB6A 2ZHBA 2HN1A 4ATBB 4QZAA 2NRKA 4WC1A 5J29A 5J2BA 4AT8A 4WQKA 4TUPA 3NVOA 3RJJA 1R8BA 7ICKA 4RQ1A 4RWQA 4KLJA 1MIWA 5CHGA 4RWOA 4WQLA 4I2DA 4P4PA 2BE3A 1HUOA 8ICGA 1OU5A 8ICXA 9ICTA 5CJ7A 8ICJA 8ICOA 4WOYA 4YMMA 3UQ0A 1ZQSA 2I9GA 3AUOA 4O6AA 4RT2A 3HJ1A 3PMLA 2M2UA 2FCLA 1ZQTA 4PPXA 9ICCA 8ICEA 4UB4A 1RZTA 4QZIA 4P4MA 5HRFA 2VANA 1ZQLA 1XSLA 1ZQBA 5F2VO 4UB2A 4PHAA 5D63A 4QZ8A 3WFSC 9ICEA 4O5KA 9ICPA 7ICFA 1Q78A 4WC0A 7ICNA 3HX0A 3NWIA 3RJFA 2BPFA 5BOMA 4JWMA 5J0SA 4X0AA 1KEJA 4YMNA 1FA0A 4RQ6A 2P66A 4NKTA 3ER9B 4NXWA 7ICUA 3RH5A 4OAIZ 3C5GA 3OWGA 4F5RA 4XJEA 4X4RA 4RQ5A 4R64A 1ZQOA 4NLNA 3JYYA 3RH6A 4P2HA 4UD4A 7ICIA 3MCRA 2ZH6A 3GDXA 3HW8A 2BBJA 5J0XA 3NYBA 4HX0A 1XSPA 2ZH2A 4KLDA 4M9LA 1TFWA 5J2JA 4WBYA 3V72A 4PHEA 4E7XA 8ICPA 9ICWA 2HN2A 7ICTA 4GXIA 1WOTA 3UQ2A 4X4QA 5CR0A 3RJIA 4UB1A 1MIYA 4I2AA 1TV9A 3C18A 2B56A 4EEBA 5IILA 4NXUA 1ZJMA 4DO9A 4YD2A 3UXPA 9ICAA 2ISOA 8ICLA 4TUQA 4DOAA 2DR5A 3JPNA 5DECA 4I2FA 4E8FA 4I2HA 2W9MA 2PFNA 5TZVA 4KLFA 5CWRA 4AT7B 1TVAA 4X4VA 4WCWA 5J0UA 3ERCC 4AT9A 9ICSA 2B4VA 9ICVA 8ICBA 5D4BA 2GWSA 1PX5A 4O9MA 5J2DA 4Z6DA 3OGUA 1ZQYA 4QZFA 4NM2A 4LVSA 4X0BA 4GXJA 2ISPA 3TFSA 2IUBA 3MGIA 1NOMA 2ID1A 3UPQA 4X5VA 9ICNA 2ZH9A 2ZH5A 4I2EA 3HIYA 3RJHA 4UBCA 8ICKA 1RPLA 4ATBA 2O1PA 7ICGA 4KLHA 4I2JA 3LK9A 3PMNA 4K9BA 1ZQRA 3MGHA 2FMQA 3K7DA 4KLQA 1ZQJA 4X4UA 2M2WA 4FO6A 4M9NA 7ICPA 2DRBA 1ZQNA 5DBBA 4I28A 9ICLA 2ZHAA 5J0RA 2IHMA 3L9DA 1UEUA 3PHZA 5HR9A 4KLGA 5BPCA 4WH5A 4X4PA 9ICMA 1JAJA 3MDCA 5J0OA 4KLEA 4M9GA 4E80A 1ZQEA 4KLOA 3CK6A 4RQ2A 1VFGA 4YD1A 2ZH7A 4WC4A 5DB6A 8ICVA 4LEWA 4O68A 4NXTA 5CA7A 4I0UA 4FHVA 4QZGA 4K96A 4LEYA 3OUYB 4WC7A 1R89A 1KDHA 3C2LA 4O67A 4MF2A 8ICQA 3PNCA 4EGWA 4EBKA 5CFTA 3AU6A 2B51A 4UAWA 3AU2A 1ZQHA 4AT7A 4R65A 9ICQA 3JPRA 3JCFA 5JTGA 3WFRE 1MIVA 4IQTA 4XQ7A 3UXNA 2BPCA 5J0QA 3OVSA 5HRDA 5HRBA 4XUSA 8ICHA 1BPZA 3OV7A 1ZJNA 7ICEA 8ICWA 4MKPA 1NO5A 4M04A 1UETA 4DOBA 8ICFA 5CB1A 2PFQA 4LZDA 1ZQZA 3V7JA 1F5AA 4UAZA 5CHEA 7ICRA 5J2CA 5HRIA 4UD5A 4RWNA 4KM5A 1TFYA 4IQWA 5DEDA 3OUYA 4IQVA 4PGYA 5J2HA 4M9JA 7ICVA 4QZCA 3TFRA 5J2EA 4K4HA 3JPTA 4NM1A 4GXKA 4TURA 2ZH8A 4I2CA 3MBYA 1YLQA 4RQ0A 2FMPA 4NKUA 3H37A 4LT6A 4X4SA 9ICOA 1BPBA 5B3QA 9ICXA 4K8VA 4FH3A 4LEZA 3RJGA 4UBBA 5HRGA 1MQ3A 2PFPA 2M2TA 4WBZA 2GAFD 4NXXA 5HRKA 5IIKA 8ICTA 4F5NA 3B0XA 4MF8A 1ZQIA 1XSNA 9ICFA 4KLMA 4DOCA 3AQLA 3V7LA 1ZQAA 5CP2A 5J2KA 4MFAA 5DDYA 4FH5A 8ICYA 4JLXA 1ZQQA 4K98A 4K9AA 4S3NA 4UB5A 5HHHA 8ICMA
chains in the Genus database with same CATH topology
4KLLA 4PHPA 4JLZA 2PBEA 1ZQKA 9ICIA 4K99A 1VJ7A 5J2AA 5J0WA 4RPYA 2HHPA 1R8CA 2DR9A 5DB9A 4X4NA 9ICUA 3WFPA 5J2FA 5J0YA 4QZHA 1BPEA 5DBCA 3C2MA 4LEVA 2M2VA 3UPSA 7ICOA 3H3AA 5J2IA 4WC3A 3ISCA 2Q66A 4RQ3A 5DB7A 8ICAA 7ICHA 5DB8A 3WFOA 4FHWA 4AT8B 8ICRA 4I2IA 3JPPA 4O5EA 1ZQXA 4X4TA 5EOZA 4QZ9A 5HC9A 4M0AA 5IIOA 4QZDA 4TUSA 4F5QA 5J0PA 3ISDA 5IINA 4R66A 4O69A 4Z6FA 3JZ0A 4IQUA 4XA5A 1MQ2A 2BPGA 4FHXA 1ZQFA 4OAGA 3RJKA 2BCSA 4O5CA 1R8AA 2ZH4A 5DKWA 8ICZA 4UB3A 9ICGA 1JN3A 3H39A 5HREA 4F5OA 3HJ4A 4FHYA 8ICIA 4I2GA 3RH4A 4M2YA 8ICSA 3RJEA 4WC6A 1HUZA 4MFCA 2ZH3A 4F5PA 3V7KA 1ZQMA 5J0TA 1ZQGA 4PGXA 4KLTA 2BCQA 1ZQCA 4OAFA 4EP7A 4KLUA 3AQMA 3JPSA 5IIIA 4LZGA 4QZEA 5D46A 3OVAA 4PGQA 3C66A 7ICSA 4NLZA 4P4OA 8ICCA 2BCUA 9ICJA 4M5DA 4RT3A 3JPQA 1ZQDA 2O5AA 4KLIA 5HRLA 5DBAA 5J2GA 4I29A 2DR7A 1ZQUA 4PHDA 5BOLA 9ICRA 1BPDA 5D49A 4UAYA 4XQ8A 4MFFA 3OVBA 3UXOA 2BCRA 3ISBA 7ICMA 8ICUA 1KNYA 4Z6CA 3WFQE 4RQ7A 5HHIA 1ZQVA 4XRHA 3MDAA 4K4GA 2DRAA 1ZQWA 2DR8A 5IIJA 3H38A 1JMSA 7ICQA 1BPYA 2FMSA 4NXVA 4X4OA 2ZH1A 2DVIA 4YCXA 4K4IA 4EBJA 4OAHA 2PXIA 3JPOA 3C2KA 9ICKA 9ICBA 3AQKA 4KLSA 4NY8A 4QZBA 4I27A 3LQCB 4M9HA 4AT9B 3HWTA 4I2BA 4IG8A 5HRHA 2BCVA 4RWPA 5IIMA 4WC2A 7ICLA 7ICJA 1V4AA 9ICHA 4K97A 1UEVA 4FHPA 4NXZA 3B0YA 4YN4A 4YMOA 3K75D 1BPXA 4PH5A 1Q79A 4RPZA 4RQ4A 4R63A 4M47A 8ICNA 3AQNA 1JQRA 4RPXA 4Z6EA 3C5FA 4JWNA 4WC5A 5DDMA 4NLKA 4RQ8A 1ZQPA 2PFOA 2RFFA 4KB6A 2ZHBA 4ATBB 2NRKA 4WC1A 4QZAA 4AT8A 5J2BA 5J29A 4TUPA 3RJJA 7ICKA 1R8BA 4RQ1A 4RWQA 4KLJA 1MIWA 5CHGA 4RWOA 4I2DA 4P4PA 2BE3A 1HUOA 8ICGA 1OU5A 8ICXA 9ICTA 5CJ7A 8ICJA 8ICOA 4WOYA 4YMMA 3UQ0A 1ZQSA 2I9GA 3AUOA 4O6AA 4RT2A 3HJ1A 3PMLA 2M2UA 1ZQTA 4PPXA 9ICCA 8ICEA 4UB4A 1RZTA 4QZIA 4P4MA 5HRFA 2VANA 1ZQLA 1XSLA 1ZQBA 5F2VO 4UB2A 4PHAA 4QZ8A 3WFSC 9ICEA 4O5KA 9ICPA 7ICFA 1Q78A 4WC0A 7ICNA 3HX0A 3RJFA 2BPFA 5BOMA 4JWMA 5J0SA 4X0AA 1KEJA 4YMNA 1FA0A 4RQ6A 2P66A 4NKTA 4NXWA 7ICUA 3RH5A 4OAIZ 3C5GA 4F5RA 1ZQOA 4X4RA 4RQ5A 4R64A 4NLNA 3JYYA 3RH6A 4P2HA 4UD4A 7ICIA 2ZH6A 3GDXA 3HW8A 5J0XA 3NYBA 1XSPA 2ZH2A 4KLDA 4M9LA 1TFWA 5J2JA 4WBYA 3V72A 4PHEA 4E7XA 8ICPA 9ICWA 7ICTA 4GXIA 1WOTA 3UQ2A 4X4QA 5CR0A 3RJIA 4UB1A 1MIYA 4I2AA 1TV9A 3C18A 2B56A 5IILA 4NXUA 1ZJMA 4DO9A 4YD2A 3UXPA 9ICAA 2ISOA 8ICLA 4TUQA 4DOAA 2DR5A 3JPNA 5DECA 4I2FA 4E8FA 4I2HA 2W9MA 2PFNA 5TZVA 4KLFA 5CWRA 4AT7B 1TVAA 4X4VA 4WCWA 5J0UA 4AT9A 9ICSA 2B4VA 9ICVA 8ICBA 5D4BA 2GWSA 1PX5A 4O9MA 4Z6DA 5J2DA 3OGUA 1ZQYA 4QZFA 4NM2A 4LVSA 4X0BA 4GXJA 2ISPA 3TFSA 3MGIA 1NOMA 2ID1A 3UPQA 4X5VA 9ICNA 2ZH9A 2ZH5A 4I2EA 3HIYA 3RJHA 4UBCA 8ICKA 1RPLA 4ATBA 2O1PA 7ICGA 4KLHA 4I2JA 3LK9A 3PMNA 4K9BA 1ZQRA 3MGHA 2FMQA 4KLQA 1ZQJA 4X4UA 2M2WA 4FO6A 4M9NA 7ICPA 2DRBA 1ZQNA 5DBBA 4I28A 9ICLA 2ZHAA 5J0RA 2IHMA 3L9DA 1UEUA 5HR9A 4KLGA 5BPCA 4X4PA 9ICMA 1JAJA 3MDCA 5J0OA 4KLEA 4M9GA 4E80A 1ZQEA 4KLOA 4RQ2A 1VFGA 4YD1A 2ZH7A 4WC4A 5DB6A 8ICVA 4LEWA 4O68A 4NXTA 5CA7A 4FHVA 4QZGA 4K96A 4LEYA 3OUYB 4WC7A 1R89A 1KDHA 3C2LA 4O67A 4MF2A 8ICQA 3PNCA 4EBKA 3AU6A 2B51A 4UAWA 3AU2A 1ZQHA 4AT7A 4R65A 9ICQA 3JPRA 3WFRE 1MIVA 4IQTA 4XQ7A 3UXNA 2BPCA 5J0QA 3OVSA 5HRDA 5HRBA 4XUSA 8ICHA 1BPZA 3OV7A 1ZJNA 7ICEA 8ICWA 4MKPA 1NO5A 4M04A 1UETA 4DOBA 8ICFA 5CB1A 2PFQA 4LZDA 1ZQZA 3V7JA 1F5AA 4UAZA 7ICRA 5J2CA 5HRIA 4UD5A 4RWNA 4KM5A 1TFYA 4IQWA 5DEDA 3OUYA 4IQVA 4PGYA 5J2HA 4M9JA 7ICVA 4QZCA 3TFRA 5J2EA 4K4HA 3JPTA 4NM1A 4GXKA 4TURA 2ZH8A 4I2CA 3MBYA 1YLQA 4RQ0A 2FMPA 4NKUA 3H37A 4LT6A 4X4SA 9ICOA 1BPBA 9ICXA 4K8VA 4FH3A 4LEZA 3RJGA 4UBBA 5HRGA 1MQ3A 2PFPA 2M2TA 4WBZA 4NXXA 5HRKA 5IIKA 8ICTA 4F5NA 3B0XA 4MF8A 1ZQIA 1XSNA 9ICFA 4KLMA 4DOCA 3AQLA 3V7LA 1ZQAA 5CP2A 5J2KA 4MFAA 5DDYA 4FH5A 8ICYA 4JLXA 1ZQQA 4K98A 4K9AA 4S3NA 4UB5A 5HHHA 8ICMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLL A;  4PHP A;  2PBE A;  1ZQK A;  9ICI A;  1VJ7 A;  5J2A A;  5J0W A;  4RPY A;  2HHP A;  1R8C A;  2DR9 A;  5DB9 A;  4X4N A;  9ICU A;  3WFP A;  5J2F A;  5J0Y A;  4QZH A;  1BPE A;  5DBC A;  3C2M A;  2M2V A;  3UPS A;  7ICO A;  3H3A A;  5J2I A;  4WC3 A;  3ISC A;  2Q66 A;  4RQ3 A;  5DB7 A;  8ICA A;  7ICH A;  5DB8 A;  3WFO A;  4FHW A;  4AT8 B;  8ICR A;  4I2I A;  3JPP A;  4O5E A;  1ZQX A;  5EOZ A;  4X4T A;  4QZ9 A;  5HC9 A;  4M0A A;  5IIO A;  4QZD A;  4TUS A;  4F5Q A;  5J0P A;  3ISD A;  5IIN A;  4R66 A;  4Z6F A;  3JZ0 A;  4IQU A;  4XA5 A;  1MQ2 A;  2BPG A;  4FHX A;  1ZQF A;  3RJK A;  2BCS A;  4O5C A;  1R8A A;  2ZH4 A;  5DKW A;  8ICZ A;  4UB3 A;  9ICG A;  4F5O A;  1JN3 A;  3H39 A;  5HRE A;  3HJ4 A;  4FHY A;  8ICI A;  4I2G A;  3RH4 A;  4M2Y A;  8ICS A;  3RJE A;  4WC6 A;  1HUZ A;  4MFC A;  2ZH3 A;  4F5P A;  3V7K A;  1ZQM A;  5J0T A;  1ZQG A;  4PGX A;  4KLT A;  2BCQ A;  1ZQC A;  4EP7 A;  4KLU A;  3AQM A;  3JPS A;  5III A;  4LZG A;  4QZE A;  5D46 A;  4PGQ A;  3OVA A;  3C66 A;  7ICS A;  4NLZ A;  4P4O A;  8ICC A;  2BCU A;  9ICJ A;  4M5D A;  4RT3 A;  3JPQ A;  1ZQD A;  2O5A A;  4KLI A;  5HRL A;  5DBA A;  5J2G A;  4I29 A;  1ZQU A;  2DR7 A;  4PHD A;  5BOL A;  9ICR A;  1BPD A;  5D49 A;  4UAY A;  4XQ8 A;  4MFF A;  3OVB A;  3UXO A;  2BCR A;  3ISB A;  7ICM A;  8ICU A;  1KNY A;  4Z6C A;  3WFQ E;  4RQ7 A;  5HHI A;  1ZQV A;  4XRH A;  3MDA A;  4K4G A;  2DRA A;  1ZQW A;  2DR8 A;  5IIJ A;  3H38 A;  1JMS A;  7ICQ A;  1BPY A;  2FMS A;  4X4O A;  2DVI A;  2ZH1 A;  4YCX A;  4K4I A;  4EBJ A;  2PXI A;  3JPO A;  3C2K A;  9ICK A;  9ICB A;  3AQK A;  4KLS A;  4NY8 A;  4QZB A;  4I27 A;  3LQC B;  4M9H A;  4AT9 B;  3HWT A;  4I2B A;  4IG8 A;  5HRH A;  2BCV A;  4RWP A;  5IIM A;  4WC2 A;  7ICL A;  7ICJ A;  1V4A A;  9ICH A;  4FHP A;  1UEV A;  4NXZ A;  3B0Y A;  4YN4 A;  4YMO A;  3K75 D;  1BPX A;  4PH5 A;  1Q79 A;  4RPZ A;  4RQ4 A;  4R63 A;  4M47 A;  8ICN A;  3AQN A;  1JQR A;  4RPX A;  4Z6E A;  3C5F A;  4JWN A;  4WC5 A;  5DDM A;  4NLK A;  4RQ8 A;  1ZQP A;  2PFO A;  2RFF A;  2ZHB A;  2NRK A;  4WC1 A;  4ATB B;  4QZA A;  4AT8 A;  5J29 A;  5J2B A;  4TUP A;  3RJJ A;  7ICK A;  1R8B A;  4RQ1 A;  4RWQ A;  4KLJ A;  1MIW A;  5CHG A;  4RWO A;  4I2D A;  4P4P A;  2BE3 A;  1HUO A;  8ICG A;  1OU5 A;  8ICX A;  9ICT A;  5CJ7 A;  8ICJ A;  8ICO A;  4YMM A;  3UQ0 A;  1ZQS A;  2I9G A;  3AUO A;  4RT2 A;  3HJ1 A;  3PML A;  2M2U A;  1ZQT A;  4PPX A;  9ICC A;  8ICE A;  4UB4 A;  1RZT A;  4QZI A;  4P4M A;  5HRF A;  2VAN A;  1ZQL A;  1XSL A;  1ZQB A;  5F2V O;  4UB2 A;  4PHA A;  4QZ8 A;  3WFS C;  9ICE A;  4O5K A;  9ICP A;  7ICF A;  1Q78 A;  4WC0 A;  7ICN A;  3HX0 A;  3RJF A;  2BPF A;  5BOM A;  4JWM A;  5J0S A;  4X0A A;  1KEJ A;  4YMN A;  1FA0 A;  4RQ6 A;  2P66 A;  4NKT A;  7ICU A;  3RH5 A;  3C5G A;  4F5R A;  1ZQO A;  4RQ5 A;  4X4R A;  4R64 A;  4NLN A;  3JYY A;  3RH6 A;  4P2H A;  4UD4 A;  7ICI A;  2ZH6 A;  3GDX A;  3HW8 A;  5J0X A;  3NYB A;  1XSP A;  2ZH2 A;  4KLD A;  4M9L A;  1TFW A;  5J2J A;  4WBY A;  3V72 A;  4PHE A;  4E7X A;  8ICP A;  9ICW A;  7ICT A;  4GXI A;  1WOT A;  3UQ2 A;  4X4Q A;  5CR0 A;  3RJI A;  4UB1 A;  1MIY A;  4I2A A;  1TV9 A;  3C18 A;  2B56 A;  5IIL A;  1ZJM A;  4DO9 A;  4YD2 A;  3UXP A;  9ICA A;  2ISO A;  8ICL A;  4TUQ A;  4DOA A;  2DR5 A;  3JPN A;  5DEC A;  4I2F A;  4E8F A;  4I2H A;  2W9M A;  2PFN A;  5TZV A;  4KLF A;  5CWR A;  4AT7 B;  1TVA A;  4X4V A;  4WCW A;  5J0U A;  4AT9 A;  9ICS A;  2B4V A;  9ICV A;  8ICB A;  5D4B A;  2GWS A;  1PX5 A;  4O9M A;  4Z6D A;  5J2D A;  3OGU A;  1ZQY A;  4QZF A;  4NM2 A;  4LVS A;  4X0B A;  4GXJ A;  2ISP A;  3TFS A;  3MGI A;  1NOM A;  2ID1 A;  3UPQ A;  4X5V A;  9ICN A;  2ZH9 A;  2ZH5 A;  4I2E A;  3HIY A;  3RJH A;  4UBC A;  8ICK A;  1RPL A;  4ATB A;  2O1P A;  7ICG A;  4KLH A;  4I2J A;  3LK9 A;  3PMN A;  2FMQ A;  1ZQR A;  3MGH A;  4KLQ A;  1ZQJ A;  2M2W A;  4X4U A;  4FO6 A;  4M9N A;  7ICP A;  2DRB A;  1ZQN A;  5DBB A;  4I28 A;  9ICL A;  2ZHA A;  5J0R A;  2IHM A;  3L9D A;  1UEU A;  5HR9 A;  4KLG A;  5BPC A;  4X4P A;  9ICM A;  1JAJ A;  3MDC A;  5J0O A;  4KLE A;  4M9G A;  4E80 A;  1ZQE A;  4KLO A;  4RQ2 A;  1VFG A;  4YD1 A;  2ZH7 A;  4WC4 A;  5DB6 A;  8ICV A;  5CA7 A;  4FHV A;  4QZG A;  3OUY B;  4WC7 A;  1R89 A;  1KDH A;  3C2L A;  4MF2 A;  8ICQ A;  3PNC A;  4EBK A;  3AU6 A;  2B51 A;  4UAW A;  3AU2 A;  1ZQH A;  4AT7 A;  4R65 A;  9ICQ A;  3JPR A;  3WFR E;  1MIV A;  4IQT A;  4XQ7 A;  3UXN A;  2BPC A;  5J0Q A;  3OVS A;  5HRD A;  5HRB A;  4XUS A;  8ICH A;  1BPZ A;  3OV7 A;  1ZJN A;  7ICE A;  8ICW A;  1NO5 A;  4M04 A;  1UET A;  4DOB A;  8ICF A;  5CB1 A;  2PFQ A;  4LZD A;  1ZQZ A;  3V7J A;  1F5A A;  4UAZ A;  7ICR A;  5J2C A;  5HRI A;  4UD5 A;  4RWN A;  1TFY A;  4IQW A;  5DED A;  4PGY A;  4IQV A;  3OUY A;  5J2H A;  4M9J A;  7ICV A;  4QZC A;  3TFR A;  5J2E A;  4K4H A;  3JPT A;  4NM1 A;  4GXK A;  4TUR A;  2ZH8 A;  4I2C A;  3MBY A;  1YLQ A;  4RQ0 A;  2FMP A;  4NKU A;  3H37 A;  4LT6 A;  4X4S A;  9ICO A;  1BPB A;  9ICX A;  4FH3 A;  3RJG A;  4UBB A;  5HRG A;  1MQ3 A;  2PFP A;  2M2T A;  4WBZ A;  5HRK A;  5IIK A;  8ICT A;  4F5N A;  3B0X A;  4MF8 A;  1ZQI A;  1XSN A;  9ICF A;  4KLM A;  4DOC A;  3AQL A;  3V7L A;  1ZQA A;  5CP2 A;  5J2K A;  4MFA A;  5DDY A;  4FH5 A;  8ICY A;  1ZQQ A;  4S3N A;  4UB5 A;  5HHH A;  8ICM A; 
#chains in the Genus database with same CATH topology
 4KLL A;  4PHP A;  5D61 A;  4JLZ A;  2PBE A;  1ZQK A;  9ICI A;  4K99 A;  1VJ7 A;  5J2A A;  5J0W A;  4RPY A;  2HHP A;  1R8C A;  2DR9 A;  2IHO A;  4FO1 A;  5DB9 A;  4X4N A;  9ICU A;  3WFP A;  5J2F A;  5J0Y A;  4QZH A;  1BPE A;  5DBC A;  3C2M A;  4LEV A;  2M2V A;  3UPS A;  7ICO A;  3H3A A;  5J2I A;  4WC3 A;  3ISC A;  2Q66 A;  4RQ3 A;  5DB7 A;  8ICA A;  7ICH A;  5DB8 A;  3WFO A;  4FHW A;  4AT8 B;  8ICR A;  4I2I A;  3JPP A;  4O5E A;  1ZQX A;  4X4T A;  5EOZ A;  4QZ9 A;  5HC9 A;  4M0A A;  5IIO A;  4QZD A;  4TUS A;  4F5Q A;  5D62 A;  5J0P A;  3ISD A;  5IIN A;  4R66 A;  4O69 A;  4Z6F A;  3JZ0 A;  4IQU A;  4XA5 A;  1MQ2 A;  2BPG A;  4FHX A;  1ZQF A;  4OAG A;  3RJK A;  2BCS A;  4O5C A;  1R8A A;  2ZH4 A;  5DKW A;  8ICZ A;  3NKU A;  4UB3 A;  9ICG A;  1JN3 A;  3H39 A;  5HRE A;  4F5O A;  3HJ4 A;  4FHY A;  8ICI A;  4I2G A;  3RH4 A;  4M2Y A;  8ICS A;  3RJE A;  4WC6 A;  1HUZ A;  4MFC A;  2ZH3 A;  4F5P A;  3V7K A;  1ZQM A;  5J0T A;  1ZQG A;  4PGX A;  4KLT A;  2BCQ A;  1ZQC A;  4OAF A;  4EP7 A;  4KLU A;  3AQM A;  3JPS A;  2EWR A;  5III A;  5CFS A;  4LZG A;  4QZE A;  5D46 A;  3OVA A;  4PGQ A;  3C66 A;  7ICS A;  4NLZ A;  1GPJ A;  4P4O A;  8ICC A;  2BCU A;  9ICJ A;  4M5D A;  5CFU A;  4RT3 A;  3JPQ A;  1ZQD A;  4N7R A;  2O5A A;  4KLI A;  5HRL A;  5DBA A;  5J2G A;  2GA9 D;  4I29 A;  2DR7 A;  1ZQU A;  2BBH A;  5BOL A;  4PHD A;  9ICR A;  1BPD A;  5D49 A;  4UAY A;  4XQ8 A;  4MFF A;  3OVB A;  3UXO A;  2BCR A;  3ISB A;  7ICM A;  8ICU A;  1KNY A;  4Z6C A;  3WFQ E;  4RQ7 A;  5HHI A;  1ZQV A;  4XRH A;  3MDA A;  4K4G A;  2DRA A;  1ZQW A;  2DR8 A;  5IIJ A;  3H38 A;  1JMS A;  7ICQ A;  1BPY A;  2FMS A;  4NXV A;  4X4O A;  2ZH1 A;  2DVI A;  4EED A;  4YCX A;  4EBJ A;  4OAH A;  5B3P A;  3JPO A;  2PXI A;  4K4I A;  3C2K A;  9ICK A;  9ICB A;  3AQK A;  4KLS A;  4NY8 A;  4QZB A;  4I27 A;  3LQC B;  4M9H A;  4AT9 B;  3HWT A;  4I2B A;  4IG8 A;  5HRH A;  4EV6 A;  2BCV A;  4RWP A;  5IIM A;  4WC2 A;  7ICL A;  7ICJ A;  1V4A A;  9ICH A;  4K97 A;  1UEV A;  4FHP A;  4NXZ A;  3B0Y A;  4YN4 A;  4YMO A;  3K75 D;  1BPX A;  4PH5 A;  1Q79 A;  4RPZ A;  4RQ4 A;  4R63 A;  4M47 A;  8ICN A;  3AQN A;  1JQR A;  4RPX A;  3ER8 C;  3EF2 A;  4Z6E A;  3C5F A;  4JWN A;  4WC5 A;  5DDM A;  4NLK A;  4RQ8 A;  1ZQP A;  2PFO A;  2RFF A;  4KB6 A;  2ZHB A;  2HN1 A;  4ATB B;  4QZA A;  2NRK A;  4WC1 A;  5J29 A;  5J2B A;  4AT8 A;  4WQK A;  4TUP A;  3NVO A;  3RJJ A;  1R8B A;  7ICK A;  4RQ1 A;  4RWQ A;  4KLJ A;  1MIW A;  5CHG A;  4RWO A;  4WQL A;  4I2D A;  4P4P A;  2BE3 A;  1HUO A;  8ICG A;  1OU5 A;  8ICX A;  9ICT A;  5CJ7 A;  8ICJ A;  8ICO A;  4WOY A;  4YMM A;  3UQ0 A;  1ZQS A;  2I9G A;  3AUO A;  4O6A A;  4RT2 A;  3HJ1 A;  3PML A;  2M2U A;  2FCL A;  1ZQT A;  4PPX A;  9ICC A;  8ICE A;  4UB4 A;  1RZT A;  4QZI A;  4P4M A;  5HRF A;  2VAN A;  1ZQL A;  1XSL A;  1ZQB A;  5F2V O;  4UB2 A;  4PHA A;  5D63 A;  4QZ8 A;  3WFS C;  9ICE A;  4O5K A;  9ICP A;  7ICF A;  1Q78 A;  4WC0 A;  7ICN A;  3HX0 A;  3NWI A;  3RJF A;  2BPF A;  5BOM A;  4JWM A;  5J0S A;  4X0A A;  1KEJ A;  4YMN A;  1FA0 A;  4RQ6 A;  2P66 A;  4NKT A;  3ER9 B;  4NXW A;  7ICU A;  3RH5 A;  4OAI Z;  3C5G A;  3OWG A;  4F5R A;  4XJE A;  4X4R A;  4RQ5 A;  4R64 A;  1ZQO A;  4NLN A;  3JYY A;  3RH6 A;  4P2H A;  4UD4 A;  7ICI A;  3MCR A;  2ZH6 A;  3GDX A;  3HW8 A;  2BBJ A;  5J0X A;  3NYB A;  4HX0 A;  1XSP A;  2ZH2 A;  4KLD A;  4M9L A;  1TFW A;  5J2J A;  4WBY A;  3V72 A;  4PHE A;  4E7X A;  8ICP A;  9ICW A;  2HN2 A;  7ICT A;  4GXI A;  1WOT A;  3UQ2 A;  4X4Q A;  5CR0 A;  3RJI A;  4UB1 A;  1MIY A;  4I2A A;  1TV9 A;  3C18 A;  2B56 A;  4EEB A;  5IIL A;  4NXU A;  1ZJM A;  4DO9 A;  4YD2 A;  3UXP A;  9ICA A;  2ISO A;  8ICL A;  4TUQ A;  4DOA A;  2DR5 A;  3JPN A;  5DEC A;  4I2F A;  4E8F A;  4I2H A;  2W9M A;  2PFN A;  5TZV A;  4KLF A;  5CWR A;  4AT7 B;  1TVA A;  4X4V A;  4WCW A;  5J0U A;  3ERC C;  4AT9 A;  9ICS A;  2B4V A;  9ICV A;  8ICB A;  5D4B A;  2GWS A;  1PX5 A;  4O9M A;  5J2D A;  4Z6D A;  3OGU A;  1ZQY A;  4QZF A;  4NM2 A;  4LVS A;  4X0B A;  4GXJ A;  2ISP A;  3TFS A;  2IUB A;  3MGI A;  1NOM A;  2ID1 A;  3UPQ A;  4X5V A;  9ICN A;  2ZH9 A;  2ZH5 A;  4I2E A;  3HIY A;  3RJH A;  4UBC A;  8ICK A;  1RPL A;  4ATB A;  2O1P A;  7ICG A;  4KLH A;  4I2J A;  3LK9 A;  3PMN A;  4K9B A;  1ZQR A;  3MGH A;  2FMQ A;  3K7D A;  4KLQ A;  1ZQJ A;  4X4U A;  2M2W A;  4FO6 A;  4M9N A;  7ICP A;  2DRB A;  1ZQN A;  5DBB A;  4I28 A;  9ICL A;  2ZHA A;  5J0R A;  2IHM A;  3L9D A;  1UEU A;  3PHZ A;  5HR9 A;  4KLG A;  5BPC A;  4WH5 A;  4X4P A;  9ICM A;  1JAJ A;  3MDC A;  5J0O A;  4KLE A;  4M9G A;  4E80 A;  1ZQE A;  4KLO A;  3CK6 A;  4RQ2 A;  1VFG A;  4YD1 A;  2ZH7 A;  4WC4 A;  5DB6 A;  8ICV A;  4LEW A;  4O68 A;  4NXT A;  5CA7 A;  4I0U A;  4FHV A;  4QZG A;  4K96 A;  4LEY A;  3OUY B;  4WC7 A;  1R89 A;  1KDH A;  3C2L A;  4O67 A;  4MF2 A;  8ICQ A;  3PNC A;  4EGW A;  4EBK A;  5CFT A;  3AU6 A;  2B51 A;  4UAW A;  3AU2 A;  1ZQH A;  4AT7 A;  4R65 A;  9ICQ A;  3JPR A;  3JCF A;  5JTG A;  3WFR E;  1MIV A;  4IQT A;  4XQ7 A;  3UXN A;  2BPC A;  5J0Q A;  3OVS A;  5HRD A;  5HRB A;  4XUS A;  8ICH A;  1BPZ A;  3OV7 A;  1ZJN A;  7ICE A;  8ICW A;  4MKP A;  1NO5 A;  4M04 A;  1UET A;  4DOB A;  8ICF A;  5CB1 A;  2PFQ A;  4LZD A;  1ZQZ A;  3V7J A;  1F5A A;  4UAZ A;  5CHE A;  7ICR A;  5J2C A;  5HRI A;  4UD5 A;  4RWN A;  4KM5 A;  1TFY A;  4IQW A;  5DED A;  3OUY A;  4IQV A;  4PGY A;  5J2H A;  4M9J A;  7ICV A;  4QZC A;  3TFR A;  5J2E A;  4K4H A;  3JPT A;  4NM1 A;  4GXK A;  4TUR A;  2ZH8 A;  4I2C A;  3MBY A;  1YLQ A;  4RQ0 A;  2FMP A;  4NKU A;  3H37 A;  4LT6 A;  4X4S A;  9ICO A;  1BPB A;  5B3Q A;  9ICX A;  4K8V A;  4FH3 A;  4LEZ A;  3RJG A;  4UBB A;  5HRG A;  1MQ3 A;  2PFP A;  2M2T A;  4WBZ A;  2GAF D;  4NXX A;  5HRK A;  5IIK A;  8ICT A;  4F5N A;  3B0X A;  4MF8 A;  1ZQI A;  1XSN A;  9ICF A;  4KLM A;  4DOC A;  3AQL A;  3V7L A;  1ZQA A;  5CP2 A;  5J2K A;  4MFA A;  5DDY A;  4FH5 A;  8ICY A;  4JLX A;  1ZQQ A;  4K98 A;  4K9A A;  4S3N A;  4UB5 A;  5HHH A;  8ICM A; 
#chains in the Genus database with same CATH homology
 4KLL A;  4PHP A;  4JLZ A;  2PBE A;  1ZQK A;  9ICI A;  4K99 A;  1VJ7 A;  5J2A A;  5J0W A;  4RPY A;  2HHP A;  1R8C A;  2DR9 A;  5DB9 A;  4X4N A;  9ICU A;  3WFP A;  5J2F A;  5J0Y A;  4QZH A;  1BPE A;  5DBC A;  3C2M A;  4LEV A;  2M2V A;  3UPS A;  7ICO A;  3H3A A;  5J2I A;  4WC3 A;  3ISC A;  2Q66 A;  4RQ3 A;  5DB7 A;  8ICA A;  7ICH A;  5DB8 A;  3WFO A;  4FHW A;  4AT8 B;  8ICR A;  4I2I A;  3JPP A;  4O5E A;  1ZQX A;  4X4T A;  5EOZ A;  4QZ9 A;  5HC9 A;  4M0A A;  5IIO A;  4QZD A;  4TUS A;  4F5Q A;  5J0P A;  3ISD A;  5IIN A;  4R66 A;  4O69 A;  4Z6F A;  3JZ0 A;  4IQU A;  4XA5 A;  1MQ2 A;  2BPG A;  4FHX A;  1ZQF A;  4OAG A;  3RJK A;  2BCS A;  4O5C A;  1R8A A;  2ZH4 A;  5DKW A;  8ICZ A;  4UB3 A;  9ICG A;  1JN3 A;  3H39 A;  5HRE A;  4F5O A;  3HJ4 A;  4FHY A;  8ICI A;  4I2G A;  3RH4 A;  4M2Y A;  8ICS A;  3RJE A;  4WC6 A;  1HUZ A;  4MFC A;  2ZH3 A;  4F5P A;  3V7K A;  1ZQM A;  5J0T A;  1ZQG A;  4PGX A;  4KLT A;  2BCQ A;  1ZQC A;  4OAF A;  4EP7 A;  4KLU A;  3AQM A;  3JPS A;  5III A;  4LZG A;  4QZE A;  5D46 A;  3OVA A;  4PGQ A;  3C66 A;  7ICS A;  4NLZ A;  4P4O A;  8ICC A;  2BCU A;  9ICJ A;  4M5D A;  4RT3 A;  3JPQ A;  1ZQD A;  2O5A A;  4KLI A;  5HRL A;  5DBA A;  5J2G A;  4I29 A;  2DR7 A;  1ZQU A;  4PHD A;  5BOL A;  9ICR A;  1BPD A;  5D49 A;  4UAY A;  4XQ8 A;  4MFF A;  3OVB A;  3UXO A;  2BCR A;  3ISB A;  7ICM A;  8ICU A;  1KNY A;  4Z6C A;  3WFQ E;  4RQ7 A;  5HHI A;  1ZQV A;  4XRH A;  3MDA A;  4K4G A;  2DRA A;  1ZQW A;  2DR8 A;  5IIJ A;  3H38 A;  1JMS A;  7ICQ A;  1BPY A;  2FMS A;  4NXV A;  4X4O A;  2ZH1 A;  2DVI A;  4YCX A;  4K4I A;  4EBJ A;  4OAH A;  2PXI A;  3JPO A;  3C2K A;  9ICK A;  9ICB A;  3AQK A;  4KLS A;  4NY8 A;  4QZB A;  4I27 A;  3LQC B;  4M9H A;  4AT9 B;  3HWT A;  4I2B A;  4IG8 A;  5HRH A;  2BCV A;  4RWP A;  5IIM A;  4WC2 A;  7ICL A;  7ICJ A;  1V4A A;  9ICH A;  4K97 A;  1UEV A;  4FHP A;  4NXZ A;  3B0Y A;  4YN4 A;  4YMO A;  3K75 D;  1BPX A;  4PH5 A;  1Q79 A;  4RPZ A;  4RQ4 A;  4R63 A;  4M47 A;  8ICN A;  3AQN A;  1JQR A;  4RPX A;  4Z6E A;  3C5F A;  4JWN A;  4WC5 A;  5DDM A;  4NLK A;  4RQ8 A;  1ZQP A;  2PFO A;  2RFF A;  4KB6 A;  2ZHB A;  4ATB B;  2NRK A;  4WC1 A;  4QZA A;  4AT8 A;  5J2B A;  5J29 A;  4TUP A;  3RJJ A;  7ICK A;  1R8B A;  4RQ1 A;  4RWQ A;  4KLJ A;  1MIW A;  5CHG A;  4RWO A;  4I2D A;  4P4P A;  2BE3 A;  1HUO A;  8ICG A;  1OU5 A;  8ICX A;  9ICT A;  5CJ7 A;  8ICJ A;  8ICO A;  4WOY A;  4YMM A;  3UQ0 A;  1ZQS A;  2I9G A;  3AUO A;  4O6A A;  4RT2 A;  3HJ1 A;  3PML A;  2M2U A;  1ZQT A;  4PPX A;  9ICC A;  8ICE A;  4UB4 A;  1RZT A;  4QZI A;  4P4M A;  5HRF A;  2VAN A;  1ZQL A;  1XSL A;  1ZQB A;  5F2V O;  4UB2 A;  4PHA A;  4QZ8 A;  3WFS C;  9ICE A;  4O5K A;  9ICP A;  7ICF A;  1Q78 A;  4WC0 A;  7ICN A;  3HX0 A;  3RJF A;  2BPF A;  5BOM A;  4JWM A;  5J0S A;  4X0A A;  1KEJ A;  4YMN A;  1FA0 A;  4RQ6 A;  2P66 A;  4NKT A;  4NXW A;  7ICU A;  3RH5 A;  4OAI Z;  3C5G A;  4F5R A;  1ZQO A;  4X4R A;  4RQ5 A;  4R64 A;  4NLN A;  3JYY A;  3RH6 A;  4P2H A;  4UD4 A;  7ICI A;  2ZH6 A;  3GDX A;  3HW8 A;  5J0X A;  3NYB A;  1XSP A;  2ZH2 A;  4KLD A;  4M9L A;  1TFW A;  5J2J A;  4WBY A;  3V72 A;  4PHE A;  4E7X A;  8ICP A;  9ICW A;  7ICT A;  4GXI A;  1WOT A;  3UQ2 A;  4X4Q A;  5CR0 A;  3RJI A;  4UB1 A;  1MIY A;  4I2A A;  1TV9 A;  3C18 A;  2B56 A;  5IIL A;  4NXU A;  1ZJM A;  4DO9 A;  4YD2 A;  3UXP A;  9ICA A;  2ISO A;  8ICL A;  4TUQ A;  4DOA A;  2DR5 A;  3JPN A;  5DEC A;  4I2F A;  4E8F A;  4I2H A;  2W9M A;  2PFN A;  5TZV A;  4KLF A;  5CWR A;  4AT7 B;  1TVA A;  4X4V A;  4WCW A;  5J0U A;  4AT9 A;  9ICS A;  2B4V A;  9ICV A;  8ICB A;  5D4B A;  2GWS A;  1PX5 A;  4O9M A;  4Z6D A;  5J2D A;  3OGU A;  1ZQY A;  4QZF A;  4NM2 A;  4LVS A;  4X0B A;  4GXJ A;  2ISP A;  3TFS A;  3MGI A;  1NOM A;  2ID1 A;  3UPQ A;  4X5V A;  9ICN A;  2ZH9 A;  2ZH5 A;  4I2E A;  3HIY A;  3RJH A;  4UBC A;  8ICK A;  1RPL A;  4ATB A;  2O1P A;  7ICG A;  4KLH A;  4I2J A;  3LK9 A;  3PMN A;  4K9B A;  1ZQR A;  3MGH A;  2FMQ A;  4KLQ A;  1ZQJ A;  4X4U A;  2M2W A;  4FO6 A;  4M9N A;  7ICP A;  2DRB A;  1ZQN A;  5DBB A;  4I28 A;  9ICL A;  2ZHA A;  5J0R A;  2IHM A;  3L9D A;  1UEU A;  5HR9 A;  4KLG A;  5BPC A;  4X4P A;  9ICM A;  1JAJ A;  3MDC A;  5J0O A;  4KLE A;  4M9G A;  4E80 A;  1ZQE A;  4KLO A;  4RQ2 A;  1VFG A;  4YD1 A;  2ZH7 A;  4WC4 A;  5DB6 A;  8ICV A;  4LEW A;  4O68 A;  4NXT A;  5CA7 A;  4FHV A;  4QZG A;  4K96 A;  4LEY A;  3OUY B;  4WC7 A;  1R89 A;  1KDH A;  3C2L A;  4O67 A;  4MF2 A;  8ICQ A;  3PNC A;  4EBK A;  3AU6 A;  2B51 A;  4UAW A;  3AU2 A;  1ZQH A;  4AT7 A;  4R65 A;  9ICQ A;  3JPR A;  3WFR E;  1MIV A;  4IQT A;  4XQ7 A;  3UXN A;  2BPC A;  5J0Q A;  3OVS A;  5HRD A;  5HRB A;  4XUS A;  8ICH A;  1BPZ A;  3OV7 A;  1ZJN A;  7ICE A;  8ICW A;  4MKP A;  1NO5 A;  4M04 A;  1UET A;  4DOB A;  8ICF A;  5CB1 A;  2PFQ A;  4LZD A;  1ZQZ A;  3V7J A;  1F5A A;  4UAZ A;  7ICR A;  5J2C A;  5HRI A;  4UD5 A;  4RWN A;  4KM5 A;  1TFY A;  4IQW A;  5DED A;  3OUY A;  4IQV A;  4PGY A;  5J2H A;  4M9J A;  7ICV A;  4QZC A;  3TFR A;  5J2E A;  4K4H A;  3JPT A;  4NM1 A;  4GXK A;  4TUR A;  2ZH8 A;  4I2C A;  3MBY A;  1YLQ A;  4RQ0 A;  2FMP A;  4NKU A;  3H37 A;  4LT6 A;  4X4S A;  9ICO A;  1BPB A;  9ICX A;  4K8V A;  4FH3 A;  4LEZ A;  3RJG A;  4UBB A;  5HRG A;  1MQ3 A;  2PFP A;  2M2T A;  4WBZ A;  4NXX A;  5HRK A;  5IIK A;  8ICT A;  4F5N A;  3B0X A;  4MF8 A;  1ZQI A;  1XSN A;  9ICF A;  4KLM A;  4DOC A;  3AQL A;  3V7L A;  1ZQA A;  5CP2 A;  5J2K A;  4MFA A;  5DDY A;  4FH5 A;  8ICY A;  4JLX A;  1ZQQ A;  4K98 A;  4K9A A;  4S3N A;  4UB5 A;  5HHH A;  8ICM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...