4E8FA

Structural basis for the activity of a cytoplasmic rna terminal u-transferase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
343
structure length
327
Chain Sequence
b'PNSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Structural basis for the activity of a cytoplasmic RNA terminal uridylyl transferase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
molecule tags Transferase
total genus 106
structure length 327
sequence length 343
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4e8fA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4e8fA02
4IQTA 1YLQA 3JPRA 1ZQLA 3AQKA 4K4GA 3H37A 4X4VA 4I2DA 4RQ1A 3C2MA 3H3AA 1KNYA 2GWSA 7ICFA 3AQLA 4AT8A 5J2DA 2ISPA 3MGHA 2DR5A 4NLNA 3RJEA 2HHPA 5HC9A 9ICLA 4YCXA 4NKTA 5CWRA 5J2AA 3MDCA 1ZQBA 3OVBA 4YMNA 4X4PA 5HRLA 4RQ5A 3UXOA 5D46A 3UPQA 2B4VA 4F5RA 1ZQOA 3PMNA 3PNCA 5DDMA 8ICYA 4DOBA 9ICMA 4I2IA 4XQ8A 4QZIA 3V7KA 4RQ3A 2DR7A 4X4TA 5HREA 1NO5A 1RZTA 2RFFA 4KLIA 5DBAA 1FA0A 4RQ0A 4WC6A 2FMQA 3RJIA 4KLOA 7ICGA 8ICLA 4FHXA 8ICNA 4Z6CA 3V72A 1XSLA 4P2HA 3RH5A 5IIKA 3OV7A 4KLGA 1KEJA 4I2GA 1HUZA 1R8AA 4XRHA 4UBCA 5DB7A 5J0YA 3WFOA 4IQUA 3JPNA 1BPDA 5HRHA 5HRFA 5IILA 7ICUA 5J0WA 4RQ2A 5CJ7A 1BPBA 5J2FA 1MIYA 5DBCA 4X4OA 4RPZA 4MF8A 4WBYA 3C2KA 3AQMA 5D4BA 4X4RA 8ICVA 4M9HA 9ICFA 3AU2A 4UB3A 3UQ0A 5J2BA 4R66A 5DB6A 4WC1A 4UAWA 1MQ3A 5EOZA 4JWNA 3B0YA 5DECA 4MFAA 4UAZA 4FHPA 4IQWA 2O1PA 4KLSA 2PFQA 3WFRE 2PFPA 8ICIA 4K4HA 2M2UA 4O5EA 4YMMA 4XA5A 5J0SA 9ICPA 5BOLA 5HRBA 1ZQEA 4X4UA 4PHDA 4WC4A 5J0OA 9ICBA 3OUYB 4M9GA 4RQ6A 5CA7A 3UQ2A 5HHHA 5IINA 3LQCB 1MIWA 2DR8A 4M9NA 4LZGA 5J0QA 4PGQA 2W9MA 4PHPA 5J2IA 1KDHA 4UBBA 1XSPA 4UB1A 5CB1A 3H39A 5BOMA 3RH6A 4RWQA 8ICXA 4E7XA 2DR9A 4X4QA 4I2JA 8ICTA 4UD5A 4I2FA 4TURA 4P4MA 8ICCA 9ICEA 4DO9A 7ICIA 4RWOA 1ZJNA 3HX0A 1R89A 4I2CA 2BPCA 4NKUA 4TUQA 4I2AA 3OGUA 3AQNA 5J2KA 2ZH7A 7ICHA 4RQ8A 2ID1A 5HHIA 4QZAA 3C5FA 4WCWA 4UB2A 7ICOA 4QZEA 4RWPA 5IIMA 2M2WA 8ICZA 3JPQA 8ICHA 2Q66A 1R8CA 3HW8A 1ZQNA 4IG8A 8ICJA 2ZH2A 2DRBA 4WBZA 7ICTA 9ICXA 9ICVA 8ICWA 4FO6A 9ICOA 2ZH3A 2M2TA 5J2HA 1ZQGA 3OUYA 4Z6EA 1MQ2A 4YD1A 4I27A 3RJHA 3TFSA 4NM2A 7ICEA 4PH5A 3MGIA 8ICEA 4RPXA 1ZQJA 4P4OA 4RQ7A 4RT2A 7ICSA 3L9DA 8ICFA 1ZQDA 4M5DA 2I9GA 4R64A 8ICAA 5J0PA 4NXZA 5F2VO 2BPGA 1ZQUA 5J2JA 5CR0A 7ICVA 4KLDA 3WFPA 4AT7B 9ICSA 4PGYA 5CP2A 4RT3A 1ZQWA 1BPXA 4QZGA 1BPYA 4NLZA 2FMPA 7ICRA 4M9JA 3K75D 5DEDA 2DRAA 2BCVA 9ICRA 8ICBA 9ICTA 4XUSA 9ICGA 1UEUA 4KLFA 4RWNA 1Q78A 1ZQKA 3JPOA 4X5VA 4KLMA 1BPEA 9ICAA 2M2VA 8ICRA 4EP7A 5J29A 7ICMA 1TFWA 8ICGA 5DDYA 1ZQTA 1ZQAA 4I2BA 3JPSA 5J0TA 4F5OA 4PHAA 8ICSA 9ICQA 9ICJA 3PMLA 9ICWA 5IIIA 1F5AA 1TV9A 3HJ4A 5TZVA 9ICHA 3ISDA 4E8FA 1V4AA 1VJ7A 4DOAA 3JYYA 2BCSA 3TFRA 5IIJA 3V7JA 4TUPA 2ZH5A 1JMSA 4FHWA 4FH3A 4GXJA 1UEVA 4R63A 1ZQMA 3WFQE 1XSNA 1JAJA 3UXNA 1TFYA 2PBEA 1UETA 4KLHA 4QZBA 1R8BA 2NRKA 4AT7A 1ZQXA 3B0XA 3UXPA 4F5NA 1ZQYA 3JZ0A 1ZQQA 8ICQA 5IIOA 5HR9A 1BPZA 9ICCA 4GXIA 4MFFA 9ICKA 2ZHAA 8ICKA 4S3NA 4M47A 3C18A 1NOMA 1TVAA 4X4NA 1JN3A 4NY8A 5DB9A 1OU5A 2ZHBA 2ZH9A 7ICPA 4E80A 5HRKA 4Z6FA 8ICUA 4AT9A 4WC0A 2FMSA 4KLEA 2BE3A 3C5GA 4RPYA 4M0AA 3LK9A 4ATBB 3RJGA 2BPFA 4Z6DA 5J2CA 2BCQA 2VANA 4RQ4A 3UPSA 1Q79A 2DVIA 4NLKA 5J0RA 4UAYA 3HJ1A 4FH5A 3MDAA 3GDXA 4FHVA 7ICKA 3H38A 1WOTA 4LT6A 4QZ9A 4YN4A 5J0UA 1HUOA 5J0XA 5HRDA 4O9MA 5D49A 4UD4A 4I29A 9ICNA 4LZDA 3C2LA 5DBBA 4PPXA 3RH4A 7ICLA 4WC5A 4R65A 3JPPA 2PFNA 4JWMA 4K4IA 4UB4A 3WFSC 4PGXA 3OVAA 4F5QA 3C66A 1ZQIA 9ICUA 4KLTA 4M04A 1ZQSA 1VFGA 5J2GA 2ISOA 2BCUA 2ZH6A 4O5CA 1ZQHA 4KLLA 5CHGA 3OVSA 4I2EA 4QZ8A 4ATBA 1MIVA 4WC3A 4KLQA 4QZCA 3ISCA 4AT9B 7ICQA 1ZJMA 3HWTA 4QZFA 2ZH4A 2PFOA 4AT8B 4DOCA 4EBKA 4F5PA 4XQ7A 5HRIA 9ICIA 1ZQZA 4UB5A 8ICPA 1ZQFA 2B56A 8ICMA 7ICNA 3HIYA 4X0AA 4P4PA 4MF2A 3V7LA 4WC7A 4KLUA 4M2YA 3MBYA 3JPTA 4YMOA 1ZQCA 1PX5A 4WC2A 4GXKA 4I2HA 1JQRA 4IQVA 4FHYA 3AU6A 3RJFA 7ICJA 5DKWA 4EBJA 4M9LA 5DB8A 3RJJA 2B51A 4QZHA 4MFCA 1ZQRA 4KLJA 1RPLA 3RJKA 4PHEA 4QZDA 8ICOA 3ISBA 3AUOA 5BPCA 4X4SA 1ZQVA 2PXIA 2IHMA 4LVSA 3NYBA 2O5AA 2ZH1A 2BCRA 4I28A 4NM1A 4TUSA 2ZH8A 2P66A 4YD2A 4O5KA 5J2EA 5HRGA 1ZQPA 4X0BA
chains in the Genus database with same CATH superfamily
4IQTA 1YLQA 4OAIZ 3JPRA 1ZQLA 3AQKA 4K4GA 3H37A 4X4VA 4I2DA 4RQ1A 3C2MA 3H3AA 2HN1A 1KNYA 2GWSA 7ICFA 3AQLA 4AT8A 5J2DA 2ISPA 3JCFA 3MGHA 2DR5A 4NLNA 3RJEA 2HHPA 5HC9A 9ICLA 4YCXA 4NKTA 5CWRA 3OVBA 5J2AA 3MDCA 1ZQBA 4YMNA 4X4PA 5HRLA 4RQ5A 3UXOA 5D62A 5D46A 3UPQA 2B4VA 4F5RA 1ZQOA 3PMNA 3PNCA 5DDMA 8ICYA 4DOBA 9ICMA 4I2IA 4XQ8A 4QZIA 3V7KA 4RQ3A 2DR7A 4X4TA 5HREA 1NO5A 1RZTA 2RFFA 4KLIA 5DBAA 1FA0A 4RQ0A 4O67A 4WC6A 2FMQA 3RJIA 4KLOA 7ICGA 8ICLA 4FHXA 8ICNA 4Z6CA 3V72A 1XSLA 4P2HA 3RH5A 5IIKA 3OV7A 4KLGA 1KEJA 4I2GA 1HUZA 1R8AA 4XRHA 4UBCA 5DB7A 5J0YA 3WFOA 2FCLA 4IQUA 3JPNA 1BPDA 5HRHA 5HRFA 5IILA 7ICUA 5J0WA 4RQ2A 5CJ7A 1BPBA 5J2FA 4EV6A 1MIYA 5DBCA 4X4OA 4RPZA 4MF8A 4WBYA 3C2KA 3AQMA 5D4BA 4X4RA 8ICVA 4M9HA 9ICFA 3AU2A 4UB3A 3UQ0A 5J2BA 4R66A 5DB6A 4WC1A 3NVOA 4UAWA 1MQ3A 5EOZA 4JWNA 3B0YA 5DECA 4MFAA 4LEVA 4FHPA 4UAZA 2O1PA 4IQWA 4KLSA 2PFQA 3WFRE 1JAJA 2PFPA 8ICIA 4K4HA 2M2UA 4O5EA 4YMMA 4XA5A 5J0SA 9ICPA 5BOLA 5HRBA 1ZQEA 4X4UA 4PHDA 4WC4A 5J0OA 9ICBA 4O6AA 3OUYB 4M9GA 4RQ6A 5CA7A 3UQ2A 5HHHA 5IINA 3LQCB 1MIWA 2DR8A 4M9NA 4LZGA 5J0QA 4PGQA 2W9MA 4PHPA 5J2IA 1KDHA 4UBBA 1XSPA 4UB1A 5CB1A 3H39A 5BOMA 3RH6A 4RWQA 8ICXA 4E7XA 2DR9A 4X4QA 4I2JA 8ICTA 4UD5A 4I2FA 4TURA 4P4MA 8ICCA 9ICEA 4DO9A 7ICIA 4RWOA 1ZJNA 3HX0A 4LEYA 1R89A 4I2CA 2BPCA 4NKUA 4TUQA 4NXXA 3OGUA 4I2AA 3AQNA 5J2KA 2ZH7A 7ICHA 4RQ8A 2ID1A 5HHIA 4QZAA 3C5FA 4WCWA 4UB2A 7ICOA 4QZEA 4RWPA 5IIMA 2M2WA 4OAHA 8ICZA 3JPQA 8ICHA 1R8CA 2Q66A 3HW8A 1ZQNA 4IG8A 8ICJA 2ZH2A 2DRBA 4WBZA 7ICTA 9ICXA 9ICVA 8ICWA 4FO6A 9ICOA 2ZH3A 2M2TA 5J2HA 2GAFD 1ZQGA 3OUYA 4Z6EA 1MQ2A 4LEWA 4YD1A 4I27A 3RJHA 3TFSA 4NM2A 7ICEA 2HN2A 4PH5A 3MGIA 8ICEA 4RPXA 1ZQJA 4EEDA 4P4OA 4RQ7A 3CK6A 4RT2A 7ICSA 3L9DA 4I0UA 8ICFA 4O69A 1ZQDA 4M5DA 2I9GA 4R64A 8ICAA 5J0PA 4NXZA 5F2VO 2BPGA 1ZQUA 5J2JA 5CR0A 7ICVA 3ER9B 4KLDA 3WFPA 4AT7B 9ICSA 4PGYA 5CP2A 4RT3A 1ZQWA 5D61A 1BPXA 5B3PA 4QZGA 1BPYA 4NLZA 2FMPA 7ICRA 4M9JA 3K75D 5DEDA 2DRAA 5B3QA 2BCVA 4K8VA 9ICRA 8ICBA 9ICTA 4XUSA 9ICGA 1UEUA 4KLFA 4RWNA 1Q78A 1ZQKA 4NXUA 3JPOA 4X5VA 4KLMA 4WQKA 1BPEA 9ICAA 2M2VA 8ICRA 4EP7A 5J29A 7ICMA 1TFWA 8ICGA 5DDYA 1ZQTA 1ZQAA 4I2BA 3JPSA 5J0TA 4F5OA 4PHAA 8ICSA 9ICQA 9ICJA 4KM5A 3PMLA 9ICWA 4EEBA 5IIIA 1F5AA 1TV9A 3HJ4A 5TZVA 9ICHA 3ERCC 3EF2A 3ISDA 4E8FA 1V4AA 1VJ7A 4K97A 4DOAA 1GPJA 3JYYA 2BCSA 3TFRA 5IIJA 3V7JA 4TUPA 2ZH5A 1JMSA 4FHWA 4FH3A 4GXJA 1UEVA 2IHOA 4R63A 2GA9D 3K7DA 1XSNA 1ZQMA 1TFYA 3UXNA 3WFQE 2PBEA 1UETA 4KLHA 4QZBA 1R8BA 4AT7A 2NRKA 1ZQXA 5CFUA 4O68A 4LEZA 3B0XA 3UXPA 4F5NA 1ZQYA 3JZ0A 1ZQQA 8ICQA 5IIOA 5HR9A 1BPZA 9ICCA 4GXIA 4MFFA 9ICKA 5JTGA 2ZHAA 8ICKA 4S3NA 4M47A 3C18A 1NOMA 1TVAA 4NXWA 4X4NA 1JN3A 4NY8A 5DB9A 1OU5A 4HX0A 2ZHBA 4OAFA 4XJEA 2ZH9A 2BBHA 7ICPA 4E80A 5HRKA 5D63A 4NXTA 4Z6FA 8ICUA 4AT9A 4WQLA 4JLXA 2BBJA 4WC0A 2FMSA 4KLEA 2BE3A 3C5GA 4RPYA 4M0AA 3LK9A 4ATBB 3RJGA 2BPFA 4Z6DA 5J2CA 2BCQA 2VANA 4EGWA 4FO1A 4RQ4A 3UPSA 1Q79A 2DVIA 4K9BA 3NKUA 4NLKA 5J0RA 4UAYA 4KB6A 5CFTA 3HJ1A 4FH5A 3MDAA 2EWRA 3GDXA 4FHVA 7ICKA 3H38A 1WOTA 4LT6A 4QZ9A 4YN4A 5J0UA 1HUOA 5J0XA 5HRDA 4O9MA 5D49A 2IUBA 4WOYA 4JLZA 5CFSA 4UD4A 4I29A 9ICNA 4LZDA 3C2LA 5DBBA 4PPXA 3RH4A 7ICLA 4WC5A 4R65A 3JPPA 2PFNA 4JWMA 4K4IA 4UB4A 3WFSC 4PGXA 3OWGA 3OVAA 4F5QA 3C66A 1ZQIA 3ER8C 9ICUA 4KLTA 4K9AA 4M04A 1ZQSA 1VFGA 5J2GA 2ISOA 3MCRA 2BCUA 2ZH6A 4O5CA 1ZQHA 4KLLA 3OVSA 5CHGA 4I2EA 4QZ8A 3PHZA 4ATBA 4WH5A 4NXVA 1MIVA 4WC3A 4KLQA 4QZCA 3ISCA 4AT9B 7ICQA 1ZJMA 3HWTA 4MKPA 4QZFA 2ZH4A 2PFOA 4AT8B 4DOCA 4EBKA 4F5PA 4XQ7A 5HRIA 9ICIA 1ZQZA 4UB5A 8ICPA 1ZQFA 2B56A 8ICMA 7ICNA 3HIYA 4K99A 4X0AA 4P4PA 4MF2A 3V7LA 4WC7A 4KLUA 4M2YA 3MBYA 3JPTA 4YMOA 1ZQCA 4OAGA 1PX5A 4WC2A 4GXKA 4I2HA 4K96A 1JQRA 4IQVA 4FHYA 3AU6A 3RJFA 7ICJA 5DKWA 5CHEA 4EBJA 4M9LA 5DB8A 3RJJA 2B51A 4QZHA 4MFCA 1ZQRA 4KLJA 1RPLA 3RJKA 4PHEA 4N7RA 4QZDA 8ICOA 3ISBA 3AUOA 4X4SA 5BPCA 1ZQVA 2PXIA 2IHMA 4LVSA 3NYBA 2O5AA 3NWIA 2ZH1A 2BCRA 4I28A 4NM1A 2ZH8A 4TUSA 2P66A 4K98A 4YD2A 4O5KA 5J2EA 5HRGA 1ZQPA 4X0BA
chains in the Genus database with same CATH topology
4IQTA 1YLQA 4OAIZ 3JPRA 1ZQLA 3AQKA 4K4GA 3H37A 4X4VA 4I2DA 4RQ1A 3C2MA 3H3AA 1KNYA 2GWSA 7ICFA 3AQLA 4AT8A 5J2DA 2ISPA 3MGHA 2DR5A 4NLNA 3RJEA 2HHPA 5HC9A 9ICLA 4YCXA 4NKTA 5CWRA 3OVBA 5J2AA 3MDCA 1ZQBA 4YMNA 4X4PA 5HRLA 4RQ5A 3UXOA 5D46A 3UPQA 2B4VA 4F5RA 1ZQOA 3PMNA 3PNCA 5DDMA 8ICYA 4DOBA 9ICMA 4I2IA 4XQ8A 4QZIA 3V7KA 4RQ3A 2DR7A 4X4TA 5HREA 1NO5A 1RZTA 2RFFA 4KLIA 5DBAA 1FA0A 4RQ0A 4O67A 4WC6A 2FMQA 3RJIA 4KLOA 7ICGA 8ICLA 4FHXA 8ICNA 4Z6CA 3V72A 1XSLA 4P2HA 3RH5A 5IIKA 3OV7A 4KLGA 1KEJA 4I2GA 1HUZA 1R8AA 4XRHA 4UBCA 5DB7A 5J0YA 3WFOA 4IQUA 3JPNA 1BPDA 5HRHA 5HRFA 5IILA 7ICUA 5J0WA 4RQ2A 5CJ7A 1BPBA 5J2FA 1MIYA 5DBCA 4X4OA 4RPZA 4MF8A 4WBYA 3C2KA 3AQMA 5D4BA 4X4RA 8ICVA 4M9HA 9ICFA 3AU2A 4UB3A 3UQ0A 5J2BA 4R66A 5DB6A 4WC1A 4UAWA 1MQ3A 5EOZA 4JWNA 3B0YA 5DECA 4MFAA 4LEVA 4FHPA 4UAZA 2O1PA 4IQWA 4KLSA 2PFQA 3WFRE 2PFPA 8ICIA 4K4HA 2M2UA 4O5EA 4YMMA 4XA5A 5J0SA 9ICPA 5BOLA 5HRBA 1ZQEA 4X4UA 4PHDA 4WC4A 5J0OA 9ICBA 4O6AA 3OUYB 4M9GA 4RQ6A 5CA7A 3UQ2A 5HHHA 5IINA 3LQCB 1MIWA 2DR8A 4M9NA 4LZGA 5J0QA 4PGQA 2W9MA 4PHPA 5J2IA 1KDHA 4UBBA 1XSPA 4UB1A 5CB1A 3H39A 5BOMA 3RH6A 4RWQA 8ICXA 4E7XA 2DR9A 4X4QA 4I2JA 8ICTA 4UD5A 4I2FA 4TURA 4P4MA 8ICCA 9ICEA 4DO9A 7ICIA 4RWOA 1ZJNA 3HX0A 4LEYA 1R89A 4I2CA 2BPCA 4NKUA 4TUQA 4NXXA 3OGUA 4I2AA 3AQNA 5J2KA 2ZH7A 7ICHA 4RQ8A 2ID1A 5HHIA 4QZAA 3C5FA 4WCWA 4UB2A 7ICOA 4QZEA 4RWPA 5IIMA 2M2WA 4OAHA 8ICZA 3JPQA 8ICHA 1R8CA 2Q66A 3HW8A 1ZQNA 4IG8A 8ICJA 2ZH2A 2DRBA 4WBZA 7ICTA 9ICXA 9ICVA 8ICWA 4FO6A 9ICOA 2ZH3A 2M2TA 5J2HA 1ZQGA 3OUYA 4Z6EA 1MQ2A 4LEWA 4YD1A 4I27A 3RJHA 3TFSA 4NM2A 7ICEA 4PH5A 3MGIA 8ICEA 4RPXA 1ZQJA 4P4OA 4RQ7A 4RT2A 7ICSA 3L9DA 8ICFA 4O69A 1ZQDA 4M5DA 2I9GA 4R64A 8ICAA 5J0PA 4NXZA 5F2VO 2BPGA 1ZQUA 5J2JA 5CR0A 7ICVA 4KLDA 3WFPA 4AT7B 9ICSA 4PGYA 5CP2A 4RT3A 1ZQWA 1BPXA 4QZGA 1BPYA 4NLZA 2FMPA 7ICRA 4M9JA 3K75D 5DEDA 2DRAA 2BCVA 4K8VA 9ICRA 8ICBA 9ICTA 4XUSA 9ICGA 1UEUA 4KLFA 4RWNA 1Q78A 1ZQKA 4NXUA 3JPOA 4X5VA 4KLMA 1BPEA 9ICAA 2M2VA 8ICRA 4EP7A 5J29A 7ICMA 1TFWA 8ICGA 5DDYA 1ZQTA 1ZQAA 4I2BA 3JPSA 5J0TA 4F5OA 4PHAA 8ICSA 9ICQA 9ICJA 4KM5A 3PMLA 9ICWA 5IIIA 1F5AA 1TV9A 3HJ4A 5TZVA 9ICHA 3ISDA 4E8FA 1V4AA 1VJ7A 4K97A 4DOAA 3JYYA 2BCSA 3TFRA 5IIJA 3V7JA 4TUPA 2ZH5A 1JMSA 4FHWA 4FH3A 4GXJA 1UEVA 4R63A 1ZQMA 3WFQE 1XSNA 1JAJA 1TFYA 3UXNA 2PBEA 1UETA 4KLHA 4QZBA 1R8BA 4AT7A 2NRKA 1ZQXA 4O68A 4LEZA 3B0XA 3UXPA 4F5NA 1ZQYA 3JZ0A 1ZQQA 8ICQA 5IIOA 5HR9A 1BPZA 9ICCA 4GXIA 4MFFA 9ICKA 2ZHAA 8ICKA 4S3NA 4M47A 3C18A 1NOMA 1TVAA 4NXWA 4X4NA 1JN3A 4NY8A 5DB9A 1OU5A 2ZHBA 4OAFA 2ZH9A 7ICPA 4E80A 5HRKA 4NXTA 4Z6FA 8ICUA 4AT9A 4JLXA 4WC0A 2FMSA 4KLEA 2BE3A 3C5GA 4RPYA 4M0AA 3LK9A 4ATBB 3RJGA 2BPFA 4Z6DA 5J2CA 2BCQA 2VANA 4RQ4A 3UPSA 1Q79A 2DVIA 4K9BA 4NLKA 5J0RA 4UAYA 4KB6A 3HJ1A 4FH5A 3MDAA 3GDXA 4FHVA 7ICKA 3H38A 1WOTA 4LT6A 4QZ9A 4YN4A 5J0UA 1HUOA 5J0XA 5HRDA 4O9MA 5D49A 4WOYA 4JLZA 4UD4A 4I29A 9ICNA 4LZDA 3C2LA 5DBBA 4PPXA 3RH4A 7ICLA 4WC5A 4R65A 3JPPA 2PFNA 4JWMA 4K4IA 4UB4A 3WFSC 4PGXA 3OVAA 4F5QA 3C66A 1ZQIA 9ICUA 4KLTA 4K9AA 4M04A 1ZQSA 1VFGA 5J2GA 2ISOA 2BCUA 2ZH6A 4O5CA 1ZQHA 4KLLA 3OVSA 5CHGA 4I2EA 4QZ8A 4ATBA 4NXVA 1MIVA 4WC3A 4KLQA 4QZCA 3ISCA 4AT9B 7ICQA 1ZJMA 3HWTA 4MKPA 4QZFA 2ZH4A 2PFOA 4AT8B 4DOCA 4EBKA 4F5PA 4XQ7A 5HRIA 9ICIA 1ZQZA 4UB5A 8ICPA 1ZQFA 2B56A 8ICMA 7ICNA 3HIYA 4K99A 4X0AA 4P4PA 4MF2A 3V7LA 4WC7A 4KLUA 4M2YA 3MBYA 3JPTA 4YMOA 1ZQCA 4OAGA 1PX5A 4WC2A 4GXKA 4I2HA 4K96A 1JQRA 4IQVA 4FHYA 3AU6A 3RJFA 7ICJA 5DKWA 4EBJA 4M9LA 5DB8A 3RJJA 2B51A 4QZHA 4MFCA 1ZQRA 4KLJA 1RPLA 3RJKA 4PHEA 4QZDA 8ICOA 3ISBA 3AUOA 4X4SA 5BPCA 1ZQVA 2PXIA 2IHMA 4LVSA 3NYBA 2O5AA 2ZH1A 2BCRA 4I28A 4NM1A 2ZH8A 4TUSA 2P66A 4K98A 4YD2A 4O5KA 5J2EA 5HRGA 1ZQPA 4X0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQT A;  1YLQ A;  3JPR A;  1ZQL A;  3AQK A;  4K4G A;  3H37 A;  4X4V A;  4I2D A;  4RQ1 A;  3C2M A;  3H3A A;  1KNY A;  2GWS A;  7ICF A;  3AQL A;  4AT8 A;  5J2D A;  2ISP A;  3MGH A;  2DR5 A;  4NLN A;  3RJE A;  2HHP A;  5HC9 A;  9ICL A;  4YCX A;  4NKT A;  5CWR A;  5J2A A;  3MDC A;  1ZQB A;  3OVB A;  4YMN A;  4X4P A;  5HRL A;  4RQ5 A;  3UXO A;  5D46 A;  3UPQ A;  2B4V A;  4F5R A;  1ZQO A;  3PMN A;  3PNC A;  5DDM A;  8ICY A;  4DOB A;  9ICM A;  4I2I A;  4XQ8 A;  4QZI A;  3V7K A;  4RQ3 A;  2DR7 A;  4X4T A;  5HRE A;  1NO5 A;  1RZT A;  2RFF A;  4KLI A;  5DBA A;  1FA0 A;  4RQ0 A;  4WC6 A;  2FMQ A;  3RJI A;  4KLO A;  7ICG A;  8ICL A;  4FHX A;  8ICN A;  4Z6C A;  3V72 A;  1XSL A;  4P2H A;  3RH5 A;  5IIK A;  3OV7 A;  4KLG A;  1KEJ A;  4I2G A;  1HUZ A;  1R8A A;  4XRH A;  4UBC A;  5DB7 A;  5J0Y A;  3WFO A;  4IQU A;  3JPN A;  1BPD A;  5HRH A;  5HRF A;  5IIL A;  7ICU A;  5J0W A;  4RQ2 A;  5CJ7 A;  1BPB A;  5J2F A;  1MIY A;  5DBC A;  4X4O A;  4RPZ A;  4MF8 A;  4WBY A;  3C2K A;  3AQM A;  5D4B A;  4X4R A;  8ICV A;  4M9H A;  9ICF A;  3AU2 A;  4UB3 A;  3UQ0 A;  5J2B A;  4R66 A;  5DB6 A;  4WC1 A;  4UAW A;  1MQ3 A;  5EOZ A;  4JWN A;  3B0Y A;  5DEC A;  4MFA A;  4UAZ A;  4FHP A;  4IQW A;  2O1P A;  4KLS A;  2PFQ A;  3WFR E;  2PFP A;  8ICI A;  4K4H A;  2M2U A;  4O5E A;  4YMM A;  4XA5 A;  5J0S A;  9ICP A;  5BOL A;  5HRB A;  1ZQE A;  4X4U A;  4PHD A;  4WC4 A;  5J0O A;  9ICB A;  3OUY B;  4M9G A;  4RQ6 A;  5CA7 A;  3UQ2 A;  5HHH A;  5IIN A;  3LQC B;  1MIW A;  2DR8 A;  4M9N A;  4LZG A;  5J0Q A;  4PGQ A;  2W9M A;  4PHP A;  5J2I A;  1KDH A;  4UBB A;  1XSP A;  4UB1 A;  5CB1 A;  3H39 A;  5BOM A;  3RH6 A;  4RWQ A;  8ICX A;  4E7X A;  2DR9 A;  4X4Q A;  4I2J A;  8ICT A;  4UD5 A;  4I2F A;  4TUR A;  4P4M A;  8ICC A;  9ICE A;  4DO9 A;  7ICI A;  4RWO A;  1ZJN A;  3HX0 A;  1R89 A;  4I2C A;  2BPC A;  4NKU A;  4TUQ A;  4I2A A;  3OGU A;  3AQN A;  5J2K A;  2ZH7 A;  7ICH A;  4RQ8 A;  2ID1 A;  5HHI A;  4QZA A;  3C5F A;  4WCW A;  4UB2 A;  7ICO A;  4QZE A;  4RWP A;  5IIM A;  2M2W A;  8ICZ A;  3JPQ A;  8ICH A;  2Q66 A;  1R8C A;  3HW8 A;  1ZQN A;  4IG8 A;  8ICJ A;  2ZH2 A;  2DRB A;  4WBZ A;  7ICT A;  9ICX A;  9ICV A;  8ICW A;  4FO6 A;  9ICO A;  2ZH3 A;  2M2T A;  5J2H A;  1ZQG A;  3OUY A;  4Z6E A;  1MQ2 A;  4YD1 A;  4I27 A;  3RJH A;  3TFS A;  4NM2 A;  7ICE A;  4PH5 A;  3MGI A;  8ICE A;  4RPX A;  1ZQJ A;  4P4O A;  4RQ7 A;  4RT2 A;  7ICS A;  3L9D A;  8ICF A;  1ZQD A;  4M5D A;  2I9G A;  4R64 A;  8ICA A;  5J0P A;  4NXZ A;  5F2V O;  2BPG A;  1ZQU A;  5J2J A;  5CR0 A;  7ICV A;  4KLD A;  3WFP A;  4AT7 B;  9ICS A;  4PGY A;  5CP2 A;  4RT3 A;  1ZQW A;  1BPX A;  4QZG A;  1BPY A;  4NLZ A;  2FMP A;  7ICR A;  4M9J A;  3K75 D;  5DED A;  2DRA A;  2BCV A;  9ICR A;  8ICB A;  9ICT A;  4XUS A;  9ICG A;  1UEU A;  4KLF A;  4RWN A;  1Q78 A;  1ZQK A;  3JPO A;  4X5V A;  4KLM A;  1BPE A;  9ICA A;  2M2V A;  8ICR A;  4EP7 A;  5J29 A;  7ICM A;  1TFW A;  8ICG A;  5DDY A;  1ZQT A;  1ZQA A;  4I2B A;  3JPS A;  5J0T A;  4F5O A;  4PHA A;  8ICS A;  9ICQ A;  9ICJ A;  3PML A;  9ICW A;  5III A;  1F5A A;  1TV9 A;  3HJ4 A;  5TZV A;  9ICH A;  3ISD A;  4E8F A;  1V4A A;  1VJ7 A;  4DOA A;  3JYY A;  2BCS A;  3TFR A;  5IIJ A;  3V7J A;  4TUP A;  2ZH5 A;  1JMS A;  4FHW A;  4FH3 A;  4GXJ A;  1UEV A;  4R63 A;  1ZQM A;  3WFQ E;  1XSN A;  1JAJ A;  3UXN A;  1TFY A;  2PBE A;  1UET A;  4KLH A;  4QZB A;  1R8B A;  2NRK A;  4AT7 A;  1ZQX A;  3B0X A;  3UXP A;  4F5N A;  1ZQY A;  3JZ0 A;  1ZQQ A;  8ICQ A;  5IIO A;  5HR9 A;  1BPZ A;  9ICC A;  4GXI A;  4MFF A;  9ICK A;  2ZHA A;  8ICK A;  4S3N A;  4M47 A;  3C18 A;  1NOM A;  1TVA A;  4X4N A;  1JN3 A;  4NY8 A;  5DB9 A;  1OU5 A;  2ZHB A;  2ZH9 A;  7ICP A;  4E80 A;  5HRK A;  4Z6F A;  8ICU A;  4AT9 A;  4WC0 A;  2FMS A;  4KLE A;  2BE3 A;  3C5G A;  4RPY A;  4M0A A;  3LK9 A;  4ATB B;  3RJG A;  2BPF A;  4Z6D A;  5J2C A;  2BCQ A;  2VAN A;  4RQ4 A;  3UPS A;  1Q79 A;  2DVI A;  4NLK A;  5J0R A;  4UAY A;  3HJ1 A;  4FH5 A;  3MDA A;  3GDX A;  4FHV A;  7ICK A;  3H38 A;  1WOT A;  4LT6 A;  4QZ9 A;  4YN4 A;  5J0U A;  1HUO A;  5J0X A;  5HRD A;  4O9M A;  5D49 A;  4UD4 A;  4I29 A;  9ICN A;  4LZD A;  3C2L A;  5DBB A;  4PPX A;  3RH4 A;  7ICL A;  4WC5 A;  4R65 A;  3JPP A;  2PFN A;  4JWM A;  4K4I A;  4UB4 A;  3WFS C;  4PGX A;  3OVA A;  4F5Q A;  3C66 A;  1ZQI A;  9ICU A;  4KLT A;  4M04 A;  1ZQS A;  1VFG A;  5J2G A;  2ISO A;  2BCU A;  2ZH6 A;  4O5C A;  1ZQH A;  4KLL A;  5CHG A;  3OVS A;  4I2E A;  4QZ8 A;  4ATB A;  1MIV A;  4WC3 A;  4KLQ A;  4QZC A;  3ISC A;  4AT9 B;  7ICQ A;  1ZJM A;  3HWT A;  4QZF A;  2ZH4 A;  2PFO A;  4AT8 B;  4DOC A;  4EBK A;  4F5P A;  4XQ7 A;  5HRI A;  9ICI A;  1ZQZ A;  4UB5 A;  8ICP A;  1ZQF A;  2B56 A;  8ICM A;  7ICN A;  3HIY A;  4X0A A;  4P4P A;  4MF2 A;  3V7L A;  4WC7 A;  4KLU A;  4M2Y A;  3MBY A;  3JPT A;  4YMO A;  1ZQC A;  1PX5 A;  4WC2 A;  4GXK A;  4I2H A;  1JQR A;  4IQV A;  4FHY A;  3AU6 A;  3RJF A;  7ICJ A;  5DKW A;  4EBJ A;  4M9L A;  5DB8 A;  3RJJ A;  2B51 A;  4QZH A;  4MFC A;  1ZQR A;  4KLJ A;  1RPL A;  3RJK A;  4PHE A;  4QZD A;  8ICO A;  3ISB A;  3AUO A;  5BPC A;  4X4S A;  1ZQV A;  2PXI A;  2IHM A;  4LVS A;  3NYB A;  2O5A A;  2ZH1 A;  2BCR A;  4I28 A;  4NM1 A;  4TUS A;  2ZH8 A;  2P66 A;  4YD2 A;  4O5K A;  5J2E A;  5HRG A;  1ZQP A;  4X0B A; 
#chains in the Genus database with same CATH topology
 4IQT A;  1YLQ A;  4OAI Z;  3JPR A;  1ZQL A;  3AQK A;  4K4G A;  3H37 A;  4X4V A;  4I2D A;  4RQ1 A;  3C2M A;  3H3A A;  2HN1 A;  1KNY A;  2GWS A;  7ICF A;  3AQL A;  4AT8 A;  5J2D A;  2ISP A;  3JCF A;  3MGH A;  2DR5 A;  4NLN A;  3RJE A;  2HHP A;  5HC9 A;  9ICL A;  4YCX A;  4NKT A;  5CWR A;  3OVB A;  5J2A A;  3MDC A;  1ZQB A;  4YMN A;  4X4P A;  5HRL A;  4RQ5 A;  3UXO A;  5D62 A;  5D46 A;  3UPQ A;  2B4V A;  4F5R A;  1ZQO A;  3PMN A;  3PNC A;  5DDM A;  8ICY A;  4DOB A;  9ICM A;  4I2I A;  4XQ8 A;  4QZI A;  3V7K A;  4RQ3 A;  2DR7 A;  4X4T A;  5HRE A;  1NO5 A;  1RZT A;  2RFF A;  4KLI A;  5DBA A;  1FA0 A;  4RQ0 A;  4O67 A;  4WC6 A;  2FMQ A;  3RJI A;  4KLO A;  7ICG A;  8ICL A;  4FHX A;  8ICN A;  4Z6C A;  3V72 A;  1XSL A;  4P2H A;  3RH5 A;  5IIK A;  3OV7 A;  4KLG A;  1KEJ A;  4I2G A;  1HUZ A;  1R8A A;  4XRH A;  4UBC A;  5DB7 A;  5J0Y A;  3WFO A;  2FCL A;  4IQU A;  3JPN A;  1BPD A;  5HRH A;  5HRF A;  5IIL A;  7ICU A;  5J0W A;  4RQ2 A;  5CJ7 A;  1BPB A;  5J2F A;  4EV6 A;  1MIY A;  5DBC A;  4X4O A;  4RPZ A;  4MF8 A;  4WBY A;  3C2K A;  3AQM A;  5D4B A;  4X4R A;  8ICV A;  4M9H A;  9ICF A;  3AU2 A;  4UB3 A;  3UQ0 A;  5J2B A;  4R66 A;  5DB6 A;  4WC1 A;  3NVO A;  4UAW A;  1MQ3 A;  5EOZ A;  4JWN A;  3B0Y A;  5DEC A;  4MFA A;  4LEV A;  4FHP A;  4UAZ A;  2O1P A;  4IQW A;  4KLS A;  2PFQ A;  3WFR E;  1JAJ A;  2PFP A;  8ICI A;  4K4H A;  2M2U A;  4O5E A;  4YMM A;  4XA5 A;  5J0S A;  9ICP A;  5BOL A;  5HRB A;  1ZQE A;  4X4U A;  4PHD A;  4WC4 A;  5J0O A;  9ICB A;  4O6A A;  3OUY B;  4M9G A;  4RQ6 A;  5CA7 A;  3UQ2 A;  5HHH A;  5IIN A;  3LQC B;  1MIW A;  2DR8 A;  4M9N A;  4LZG A;  5J0Q A;  4PGQ A;  2W9M A;  4PHP A;  5J2I A;  1KDH A;  4UBB A;  1XSP A;  4UB1 A;  5CB1 A;  3H39 A;  5BOM A;  3RH6 A;  4RWQ A;  8ICX A;  4E7X A;  2DR9 A;  4X4Q A;  4I2J A;  8ICT A;  4UD5 A;  4I2F A;  4TUR A;  4P4M A;  8ICC A;  9ICE A;  4DO9 A;  7ICI A;  4RWO A;  1ZJN A;  3HX0 A;  4LEY A;  1R89 A;  4I2C A;  2BPC A;  4NKU A;  4TUQ A;  4NXX A;  3OGU A;  4I2A A;  3AQN A;  5J2K A;  2ZH7 A;  7ICH A;  4RQ8 A;  2ID1 A;  5HHI A;  4QZA A;  3C5F A;  4WCW A;  4UB2 A;  7ICO A;  4QZE A;  4RWP A;  5IIM A;  2M2W A;  4OAH A;  8ICZ A;  3JPQ A;  8ICH A;  1R8C A;  2Q66 A;  3HW8 A;  1ZQN A;  4IG8 A;  8ICJ A;  2ZH2 A;  2DRB A;  4WBZ A;  7ICT A;  9ICX A;  9ICV A;  8ICW A;  4FO6 A;  9ICO A;  2ZH3 A;  2M2T A;  5J2H A;  2GAF D;  1ZQG A;  3OUY A;  4Z6E A;  1MQ2 A;  4LEW A;  4YD1 A;  4I27 A;  3RJH A;  3TFS A;  4NM2 A;  7ICE A;  2HN2 A;  4PH5 A;  3MGI A;  8ICE A;  4RPX A;  1ZQJ A;  4EED A;  4P4O A;  4RQ7 A;  3CK6 A;  4RT2 A;  7ICS A;  3L9D A;  4I0U A;  8ICF A;  4O69 A;  1ZQD A;  4M5D A;  2I9G A;  4R64 A;  8ICA A;  5J0P A;  4NXZ A;  5F2V O;  2BPG A;  1ZQU A;  5J2J A;  5CR0 A;  7ICV A;  3ER9 B;  4KLD A;  3WFP A;  4AT7 B;  9ICS A;  4PGY A;  5CP2 A;  4RT3 A;  1ZQW A;  5D61 A;  1BPX A;  5B3P A;  4QZG A;  1BPY A;  4NLZ A;  2FMP A;  7ICR A;  4M9J A;  3K75 D;  5DED A;  2DRA A;  5B3Q A;  2BCV A;  4K8V A;  9ICR A;  8ICB A;  9ICT A;  4XUS A;  9ICG A;  1UEU A;  4KLF A;  4RWN A;  1Q78 A;  1ZQK A;  4NXU A;  3JPO A;  4X5V A;  4KLM A;  4WQK A;  1BPE A;  9ICA A;  2M2V A;  8ICR A;  4EP7 A;  5J29 A;  7ICM A;  1TFW A;  8ICG A;  5DDY A;  1ZQT A;  1ZQA A;  4I2B A;  3JPS A;  5J0T A;  4F5O A;  4PHA A;  8ICS A;  9ICQ A;  9ICJ A;  4KM5 A;  3PML A;  9ICW A;  4EEB A;  5III A;  1F5A A;  1TV9 A;  3HJ4 A;  5TZV A;  9ICH A;  3ERC C;  3EF2 A;  3ISD A;  4E8F A;  1V4A A;  1VJ7 A;  4K97 A;  4DOA A;  1GPJ A;  3JYY A;  2BCS A;  3TFR A;  5IIJ A;  3V7J A;  4TUP A;  2ZH5 A;  1JMS A;  4FHW A;  4FH3 A;  4GXJ A;  1UEV A;  2IHO A;  4R63 A;  2GA9 D;  3K7D A;  1XSN A;  1ZQM A;  1TFY A;  3UXN A;  3WFQ E;  2PBE A;  1UET A;  4KLH A;  4QZB A;  1R8B A;  4AT7 A;  2NRK A;  1ZQX A;  5CFU A;  4O68 A;  4LEZ A;  3B0X A;  3UXP A;  4F5N A;  1ZQY A;  3JZ0 A;  1ZQQ A;  8ICQ A;  5IIO A;  5HR9 A;  1BPZ A;  9ICC A;  4GXI A;  4MFF A;  9ICK A;  5JTG A;  2ZHA A;  8ICK A;  4S3N A;  4M47 A;  3C18 A;  1NOM A;  1TVA A;  4NXW A;  4X4N A;  1JN3 A;  4NY8 A;  5DB9 A;  1OU5 A;  4HX0 A;  2ZHB A;  4OAF A;  4XJE A;  2ZH9 A;  2BBH A;  7ICP A;  4E80 A;  5HRK A;  5D63 A;  4NXT A;  4Z6F A;  8ICU A;  4AT9 A;  4WQL A;  4JLX A;  2BBJ A;  4WC0 A;  2FMS A;  4KLE A;  2BE3 A;  3C5G A;  4RPY A;  4M0A A;  3LK9 A;  4ATB B;  3RJG A;  2BPF A;  4Z6D A;  5J2C A;  2BCQ A;  2VAN A;  4EGW A;  4FO1 A;  4RQ4 A;  3UPS A;  1Q79 A;  2DVI A;  4K9B A;  3NKU A;  4NLK A;  5J0R A;  4UAY A;  4KB6 A;  5CFT A;  3HJ1 A;  4FH5 A;  3MDA A;  2EWR A;  3GDX A;  4FHV A;  7ICK A;  3H38 A;  1WOT A;  4LT6 A;  4QZ9 A;  4YN4 A;  5J0U A;  1HUO A;  5J0X A;  5HRD A;  4O9M A;  5D49 A;  2IUB A;  4WOY A;  4JLZ A;  5CFS A;  4UD4 A;  4I29 A;  9ICN A;  4LZD A;  3C2L A;  5DBB A;  4PPX A;  3RH4 A;  7ICL A;  4WC5 A;  4R65 A;  3JPP A;  2PFN A;  4JWM A;  4K4I A;  4UB4 A;  3WFS C;  4PGX A;  3OWG A;  3OVA A;  4F5Q A;  3C66 A;  1ZQI A;  3ER8 C;  9ICU A;  4KLT A;  4K9A A;  4M04 A;  1ZQS A;  1VFG A;  5J2G A;  2ISO A;  3MCR A;  2BCU A;  2ZH6 A;  4O5C A;  1ZQH A;  4KLL A;  3OVS A;  5CHG A;  4I2E A;  4QZ8 A;  3PHZ A;  4ATB A;  4WH5 A;  4NXV A;  1MIV A;  4WC3 A;  4KLQ A;  4QZC A;  3ISC A;  4AT9 B;  7ICQ A;  1ZJM A;  3HWT A;  4MKP A;  4QZF A;  2ZH4 A;  2PFO A;  4AT8 B;  4DOC A;  4EBK A;  4F5P A;  4XQ7 A;  5HRI A;  9ICI A;  1ZQZ A;  4UB5 A;  8ICP A;  1ZQF A;  2B56 A;  8ICM A;  7ICN A;  3HIY A;  4K99 A;  4X0A A;  4P4P A;  4MF2 A;  3V7L A;  4WC7 A;  4KLU A;  4M2Y A;  3MBY A;  3JPT A;  4YMO A;  1ZQC A;  4OAG A;  1PX5 A;  4WC2 A;  4GXK A;  4I2H A;  4K96 A;  1JQR A;  4IQV A;  4FHY A;  3AU6 A;  3RJF A;  7ICJ A;  5DKW A;  5CHE A;  4EBJ A;  4M9L A;  5DB8 A;  3RJJ A;  2B51 A;  4QZH A;  4MFC A;  1ZQR A;  4KLJ A;  1RPL A;  3RJK A;  4PHE A;  4N7R A;  4QZD A;  8ICO A;  3ISB A;  3AUO A;  4X4S A;  5BPC A;  1ZQV A;  2PXI A;  2IHM A;  4LVS A;  3NYB A;  2O5A A;  3NWI A;  2ZH1 A;  2BCR A;  4I28 A;  4NM1 A;  2ZH8 A;  4TUS A;  2P66 A;  4K98 A;  4YD2 A;  4O5K A;  5J2E A;  5HRG A;  1ZQP A;  4X0B A; 
#chains in the Genus database with same CATH homology
 4IQT A;  1YLQ A;  4OAI Z;  3JPR A;  1ZQL A;  3AQK A;  4K4G A;  3H37 A;  4X4V A;  4I2D A;  4RQ1 A;  3C2M A;  3H3A A;  1KNY A;  2GWS A;  7ICF A;  3AQL A;  4AT8 A;  5J2D A;  2ISP A;  3MGH A;  2DR5 A;  4NLN A;  3RJE A;  2HHP A;  5HC9 A;  9ICL A;  4YCX A;  4NKT A;  5CWR A;  3OVB A;  5J2A A;  3MDC A;  1ZQB A;  4YMN A;  4X4P A;  5HRL A;  4RQ5 A;  3UXO A;  5D46 A;  3UPQ A;  2B4V A;  4F5R A;  1ZQO A;  3PMN A;  3PNC A;  5DDM A;  8ICY A;  4DOB A;  9ICM A;  4I2I A;  4XQ8 A;  4QZI A;  3V7K A;  4RQ3 A;  2DR7 A;  4X4T A;  5HRE A;  1NO5 A;  1RZT A;  2RFF A;  4KLI A;  5DBA A;  1FA0 A;  4RQ0 A;  4O67 A;  4WC6 A;  2FMQ A;  3RJI A;  4KLO A;  7ICG A;  8ICL A;  4FHX A;  8ICN A;  4Z6C A;  3V72 A;  1XSL A;  4P2H A;  3RH5 A;  5IIK A;  3OV7 A;  4KLG A;  1KEJ A;  4I2G A;  1HUZ A;  1R8A A;  4XRH A;  4UBC A;  5DB7 A;  5J0Y A;  3WFO A;  4IQU A;  3JPN A;  1BPD A;  5HRH A;  5HRF A;  5IIL A;  7ICU A;  5J0W A;  4RQ2 A;  5CJ7 A;  1BPB A;  5J2F A;  1MIY A;  5DBC A;  4X4O A;  4RPZ A;  4MF8 A;  4WBY A;  3C2K A;  3AQM A;  5D4B A;  4X4R A;  8ICV A;  4M9H A;  9ICF A;  3AU2 A;  4UB3 A;  3UQ0 A;  5J2B A;  4R66 A;  5DB6 A;  4WC1 A;  4UAW A;  1MQ3 A;  5EOZ A;  4JWN A;  3B0Y A;  5DEC A;  4MFA A;  4LEV A;  4FHP A;  4UAZ A;  2O1P A;  4IQW A;  4KLS A;  2PFQ A;  3WFR E;  2PFP A;  8ICI A;  4K4H A;  2M2U A;  4O5E A;  4YMM A;  4XA5 A;  5J0S A;  9ICP A;  5BOL A;  5HRB A;  1ZQE A;  4X4U A;  4PHD A;  4WC4 A;  5J0O A;  9ICB A;  4O6A A;  3OUY B;  4M9G A;  4RQ6 A;  5CA7 A;  3UQ2 A;  5HHH A;  5IIN A;  3LQC B;  1MIW A;  2DR8 A;  4M9N A;  4LZG A;  5J0Q A;  4PGQ A;  2W9M A;  4PHP A;  5J2I A;  1KDH A;  4UBB A;  1XSP A;  4UB1 A;  5CB1 A;  3H39 A;  5BOM A;  3RH6 A;  4RWQ A;  8ICX A;  4E7X A;  2DR9 A;  4X4Q A;  4I2J A;  8ICT A;  4UD5 A;  4I2F A;  4TUR A;  4P4M A;  8ICC A;  9ICE A;  4DO9 A;  7ICI A;  4RWO A;  1ZJN A;  3HX0 A;  4LEY A;  1R89 A;  4I2C A;  2BPC A;  4NKU A;  4TUQ A;  4NXX A;  3OGU A;  4I2A A;  3AQN A;  5J2K A;  2ZH7 A;  7ICH A;  4RQ8 A;  2ID1 A;  5HHI A;  4QZA A;  3C5F A;  4WCW A;  4UB2 A;  7ICO A;  4QZE A;  4RWP A;  5IIM A;  2M2W A;  4OAH A;  8ICZ A;  3JPQ A;  8ICH A;  1R8C A;  2Q66 A;  3HW8 A;  1ZQN A;  4IG8 A;  8ICJ A;  2ZH2 A;  2DRB A;  4WBZ A;  7ICT A;  9ICX A;  9ICV A;  8ICW A;  4FO6 A;  9ICO A;  2ZH3 A;  2M2T A;  5J2H A;  1ZQG A;  3OUY A;  4Z6E A;  1MQ2 A;  4LEW A;  4YD1 A;  4I27 A;  3RJH A;  3TFS A;  4NM2 A;  7ICE A;  4PH5 A;  3MGI A;  8ICE A;  4RPX A;  1ZQJ A;  4P4O A;  4RQ7 A;  4RT2 A;  7ICS A;  3L9D A;  8ICF A;  4O69 A;  1ZQD A;  4M5D A;  2I9G A;  4R64 A;  8ICA A;  5J0P A;  4NXZ A;  5F2V O;  2BPG A;  1ZQU A;  5J2J A;  5CR0 A;  7ICV A;  4KLD A;  3WFP A;  4AT7 B;  9ICS A;  4PGY A;  5CP2 A;  4RT3 A;  1ZQW A;  1BPX A;  4QZG A;  1BPY A;  4NLZ A;  2FMP A;  7ICR A;  4M9J A;  3K75 D;  5DED A;  2DRA A;  2BCV A;  4K8V A;  9ICR A;  8ICB A;  9ICT A;  4XUS A;  9ICG A;  1UEU A;  4KLF A;  4RWN A;  1Q78 A;  1ZQK A;  4NXU A;  3JPO A;  4X5V A;  4KLM A;  1BPE A;  9ICA A;  2M2V A;  8ICR A;  4EP7 A;  5J29 A;  7ICM A;  1TFW A;  8ICG A;  5DDY A;  1ZQT A;  1ZQA A;  4I2B A;  3JPS A;  5J0T A;  4F5O A;  4PHA A;  8ICS A;  9ICQ A;  9ICJ A;  4KM5 A;  3PML A;  9ICW A;  5III A;  1F5A A;  1TV9 A;  3HJ4 A;  5TZV A;  9ICH A;  3ISD A;  4E8F A;  1V4A A;  1VJ7 A;  4K97 A;  4DOA A;  3JYY A;  2BCS A;  3TFR A;  5IIJ A;  3V7J A;  4TUP A;  2ZH5 A;  1JMS A;  4FHW A;  4FH3 A;  4GXJ A;  1UEV A;  4R63 A;  1ZQM A;  3WFQ E;  1XSN A;  1JAJ A;  1TFY A;  3UXN A;  2PBE A;  1UET A;  4KLH A;  4QZB A;  1R8B A;  4AT7 A;  2NRK A;  1ZQX A;  4O68 A;  4LEZ A;  3B0X A;  3UXP A;  4F5N A;  1ZQY A;  3JZ0 A;  1ZQQ A;  8ICQ A;  5IIO A;  5HR9 A;  1BPZ A;  9ICC A;  4GXI A;  4MFF A;  9ICK A;  2ZHA A;  8ICK A;  4S3N A;  4M47 A;  3C18 A;  1NOM A;  1TVA A;  4NXW A;  4X4N A;  1JN3 A;  4NY8 A;  5DB9 A;  1OU5 A;  2ZHB A;  4OAF A;  2ZH9 A;  7ICP A;  4E80 A;  5HRK A;  4NXT A;  4Z6F A;  8ICU A;  4AT9 A;  4JLX A;  4WC0 A;  2FMS A;  4KLE A;  2BE3 A;  3C5G A;  4RPY A;  4M0A A;  3LK9 A;  4ATB B;  3RJG A;  2BPF A;  4Z6D A;  5J2C A;  2BCQ A;  2VAN A;  4RQ4 A;  3UPS A;  1Q79 A;  2DVI A;  4K9B A;  4NLK A;  5J0R A;  4UAY A;  4KB6 A;  3HJ1 A;  4FH5 A;  3MDA A;  3GDX A;  4FHV A;  7ICK A;  3H38 A;  1WOT A;  4LT6 A;  4QZ9 A;  4YN4 A;  5J0U A;  1HUO A;  5J0X A;  5HRD A;  4O9M A;  5D49 A;  4WOY A;  4JLZ A;  4UD4 A;  4I29 A;  9ICN A;  4LZD A;  3C2L A;  5DBB A;  4PPX A;  3RH4 A;  7ICL A;  4WC5 A;  4R65 A;  3JPP A;  2PFN A;  4JWM A;  4K4I A;  4UB4 A;  3WFS C;  4PGX A;  3OVA A;  4F5Q A;  3C66 A;  1ZQI A;  9ICU A;  4KLT A;  4K9A A;  4M04 A;  1ZQS A;  1VFG A;  5J2G A;  2ISO A;  2BCU A;  2ZH6 A;  4O5C A;  1ZQH A;  4KLL A;  3OVS A;  5CHG A;  4I2E A;  4QZ8 A;  4ATB A;  4NXV A;  1MIV A;  4WC3 A;  4KLQ A;  4QZC A;  3ISC A;  4AT9 B;  7ICQ A;  1ZJM A;  3HWT A;  4MKP A;  4QZF A;  2ZH4 A;  2PFO A;  4AT8 B;  4DOC A;  4EBK A;  4F5P A;  4XQ7 A;  5HRI A;  9ICI A;  1ZQZ A;  4UB5 A;  8ICP A;  1ZQF A;  2B56 A;  8ICM A;  7ICN A;  3HIY A;  4K99 A;  4X0A A;  4P4P A;  4MF2 A;  3V7L A;  4WC7 A;  4KLU A;  4M2Y A;  3MBY A;  3JPT A;  4YMO A;  1ZQC A;  4OAG A;  1PX5 A;  4WC2 A;  4GXK A;  4I2H A;  4K96 A;  1JQR A;  4IQV A;  4FHY A;  3AU6 A;  3RJF A;  7ICJ A;  5DKW A;  4EBJ A;  4M9L A;  5DB8 A;  3RJJ A;  2B51 A;  4QZH A;  4MFC A;  1ZQR A;  4KLJ A;  1RPL A;  3RJK A;  4PHE A;  4QZD A;  8ICO A;  3ISB A;  3AUO A;  4X4S A;  5BPC A;  1ZQV A;  2PXI A;  2IHM A;  4LVS A;  3NYB A;  2O5A A;  2ZH1 A;  2BCR A;  4I28 A;  4NM1 A;  2ZH8 A;  4TUS A;  2P66 A;  4K98 A;  4YD2 A;  4O5K A;  5J2E A;  5HRG A;  1ZQP A;  4X0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...