4E91A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bd3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
131
Chain Sequence
PIVQVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Effects of Two HIV-1 Capsid Assembly Inhibitor Families That Bind the Same Site within the N-Terminal Domain of the Viral CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Structural protein/inhibitor
molecule keywords Gag protein
total genus 48
structure length 131
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4e91A00
2X82A 2Y4ZA 3NTEA 1EM9A 4XFYA 4HTWA 2LF4A 1EIAA 2XGYA 2GOLB 2X2DD 4NX4C 4U0DA 4U0BA 2M8LA 2XGUA 4PH3A 1G03A 4B4NA 4WYMA 4U0CA 2M8NA 5HGLA 4U0FA 4E92A 4PH2A 5HGNA 1M9XC 1QRJA 4INBA 4XFXA 4XFZA 5HGMA 4DGAC 1M9CC 1M9YC 1GWPA 5HGOA 4QNBA 4DGEC 3P05A 2PWOA 2JPRA 2PWMA 3BP9A 3MGEA 1M9EC 1U7KA 4U0EA 1AK4C 3H47A 1D1DA 1L6NA 4U0AA 2XGVA 4PH0A 1P7NA 4E91A 2PXRC 2WLVB 4J93A 5HGKA 2V4XA 1E6JP 5JPAA 1M9FC 2GONA 1M9DC 2X83A 3H4EA 2KGFA 1AFVA 2EIAA 2XDEA 4XRQA 4XROA 4LQWC 2WLVA 2M8PA
chains in the Genus database with same CATH superfamily
2X82A 2Y4ZA 3NTEA 1EM9A 4XFYA 4HTWA 2LF4A 1EIAA 2XGYA 2GOLB 2X2DD 4NX4C 4U0DA 4U0BA 2M8LA 2XGUA 4PH3A 1G03A 4B4NA 4WYMA 4U0CA 2M8NA 5HGLA 4U0FA 4E92A 4PH2A 5HGNA 1M9XC 1QRJA 4INBA 4XFXA 4XFZA 5HGMA 4DGAC 1M9CC 1M9YC 1GWPA 5HGOA 4QNBA 4DGEC 3P05A 2PWOA 2JPRA 2PWMA 3BP9A 3MGEA 1M9EC 1U7KA 4U0EA 1AK4C 3H47A 1D1DA 1L6NA 4U0AA 2XGVA 4PH0A 1P7NA 4E91A 2PXRC 2WLVB 4J93A 5HGKA 2V4XA 1E6JP 5JPAA 1M9FC 2GONA 1M9DC 2X83A 3H4EA 2KGFA 1AFVA 2EIAA 2XDEA 4XRQA 4XROA 4LQWC 2WLVA 2M8PA
chains in the Genus database with same CATH topology
2X82A 2Y4ZA 3NTEA 1EM9A 4XFYA 4HTWA 2LF4A 1EIAA 2XGYA 2GOLB 2X2DD 4NX4C 4U0DA 4U0BA 2M8LA 2XGUA 4PH3A 1G03A 4B4NA 4WYMA 4U0CA 2M8NA 5HGLA 4U0FA 4E92A 4PH2A 5HGNA 1M9XC 1QRJA 4INBA 4XFXA 4XFZA 5HGMA 4DGAC 1M9CC 1M9YC 1GWPA 5HGOA 4QNBA 4DGEC 3P05A 2PWOA 2JPRA 2PWMA 3BP9A 3MGEA 1M9EC 1U7KA 4U0EA 1AK4C 3H47A 1D1DA 1L6NA 4U0AA 2XGVA 4PH0A 1P7NA 4E91A 2PXRC 2WLVB 4J93A 5HGKA 2V4XA 1E6JP 5JPAA 1M9FC 2GONA 1M9DC 2X83A 3H4EA 2KGFA 1AFVA 2EIAA 2XDEA 4XRQA 4XROA 4LQWC 2WLVA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X82 A;  2Y4Z A;  3NTE A;  1EM9 A;  4XFY A;  4HTW A;  2LF4 A;  1EIA A;  2XGY A;  2GOL B;  2X2D D;  4NX4 C;  4U0D A;  4U0B A;  2M8L A;  2XGU A;  4PH3 A;  1G03 A;  4B4N A;  4WYM A;  4U0C A;  2M8N A;  5HGL A;  4U0F A;  4E92 A;  4PH2 A;  5HGN A;  1M9X C;  1QRJ A;  4INB A;  4XFX A;  4XFZ A;  5HGM A;  4DGA C;  1M9C C;  1M9Y C;  1GWP A;  5HGO A;  4QNB A;  4DGE C;  3P05 A;  2PWO A;  2JPR A;  2PWM A;  3BP9 A;  3MGE A;  1M9E C;  1U7K A;  4U0E A;  1AK4 C;  3H47 A;  1D1D A;  1L6N A;  4U0A A;  2XGV A;  4PH0 A;  1P7N A;  4E91 A;  2PXR C;  2WLV B;  4J93 A;  5HGK A;  2V4X A;  1E6J P;  5JPA A;  1M9F C;  2GON A;  1M9D C;  2X83 A;  3H4E A;  2KGF A;  1AFV A;  2EIA A;  2XDE A;  4XRQ A;  4XRO A;  4LQW C;  2WLV A;  2M8P A; 
#chains in the Genus database with same CATH topology
 2X82 A;  2Y4Z A;  3NTE A;  1EM9 A;  4XFY A;  4HTW A;  2LF4 A;  1EIA A;  2XGY A;  2GOL B;  2X2D D;  4NX4 C;  4U0D A;  4U0B A;  2M8L A;  2XGU A;  4PH3 A;  1G03 A;  4B4N A;  4WYM A;  4U0C A;  2M8N A;  5HGL A;  4U0F A;  4E92 A;  4PH2 A;  5HGN A;  1M9X C;  1QRJ A;  4INB A;  4XFX A;  4XFZ A;  5HGM A;  4DGA C;  1M9C C;  1M9Y C;  1GWP A;  5HGO A;  4QNB A;  4DGE C;  3P05 A;  2PWO A;  2JPR A;  2PWM A;  3BP9 A;  3MGE A;  1M9E C;  1U7K A;  4U0E A;  1AK4 C;  3H47 A;  1D1D A;  1L6N A;  4U0A A;  2XGV A;  4PH0 A;  1P7N A;  4E91 A;  2PXR C;  2WLV B;  4J93 A;  5HGK A;  2V4X A;  1E6J P;  5JPA A;  1M9F C;  2GON A;  1M9D C;  2X83 A;  3H4E A;  2KGF A;  1AFV A;  2EIA A;  2XDE A;  4XRQ A;  4XRO A;  4LQW C;  2WLV A;  2M8P A; 
#chains in the Genus database with same CATH homology
 2X82 A;  2Y4Z A;  3NTE A;  1EM9 A;  4XFY A;  4HTW A;  2LF4 A;  1EIA A;  2XGY A;  2GOL B;  2X2D D;  4NX4 C;  4U0D A;  4U0B A;  2M8L A;  2XGU A;  4PH3 A;  1G03 A;  4B4N A;  4WYM A;  4U0C A;  2M8N A;  5HGL A;  4U0F A;  4E92 A;  4PH2 A;  5HGN A;  1M9X C;  1QRJ A;  4INB A;  4XFX A;  4XFZ A;  5HGM A;  4DGA C;  1M9C C;  1M9Y C;  1GWP A;  5HGO A;  4QNB A;  4DGE C;  3P05 A;  2PWO A;  2JPR A;  2PWM A;  3BP9 A;  3MGE A;  1M9E C;  1U7K A;  4U0E A;  1AK4 C;  3H47 A;  1D1D A;  1L6N A;  4U0A A;  2XGV A;  4PH0 A;  1P7N A;  4E91 A;  2PXR C;  2WLV B;  4J93 A;  5HGK A;  2V4X A;  1E6J P;  5JPA A;  1M9F C;  2GON A;  1M9D C;  2X83 A;  3H4E A;  2KGF A;  1AFV A;  2EIA A;  2XDE A;  4XRQ A;  4XRO A;  4LQW C;  2WLV A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...