4E91A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bd3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
131
Chain Sequence
PIVQVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Distinct Effects of Two HIV-1 Capsid Assembly Inhibitor Families That Bind the Same Site within the N-Terminal Domain of the Viral CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Structural protein/inhibitor
total genus 48
structure length 131
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4e91A00
1EM9A 2X82A 2PWMA 1E6JP 4LQWC 5HGMA 4NX4C 1AK4C 2PXRC 4U0CA 1M9DC 4XROA 1QRJA 1AFVA 4XFYA 2KGFA 4HTWA 2JPRA 4PH3A 4B4NA 4PH0A 4XRQA 2WLVA 4QNBA 4PH2A 2XDEA 2XGUA 4XFXA 1U7KA 2X2DD 4U0BA 2XGYA 5HGNA 4U0DA 3BP9A 4U0AA 1GWPA 2GONA 1EIAA 1M9XC 2Y4ZA 2V4XA 2EIAA 5HGLA 2X83A 1G03A 3NTEA 5HGKA 3MGEA 4DGAC 2GOLB 4E91A 5HGOA 4XFZA 4DGEC 3H4EA 2PWOA 1M9EC 2M8LA 4U0FA 4U0EA 1M9YC 2M8NA 2M8PA 1M9CC 2WLVB 3H47A 4INBA 4J93A 2XGVA 1L6NA 1M9FC 4E92A 3P05A 1P7NA 5JPAA 4WYMA 1D1DA 2LF4A
chains in the Genus database with same CATH superfamily
1EM9A 2X82A 2PWMA 1E6JP 4LQWC 5HGMA 4NX4C 1AK4C 2PXRC 4U0CA 1M9DC 4XROA 1QRJA 1AFVA 4XFYA 2KGFA 4HTWA 2JPRA 4PH3A 4B4NA 4PH0A 4XRQA 2WLVA 4QNBA 4PH2A 2XDEA 2XGUA 4XFXA 1U7KA 2X2DD 4U0BA 2XGYA 5HGNA 4U0DA 3BP9A 4U0AA 1GWPA 2GONA 1EIAA 1M9XC 2Y4ZA 2V4XA 2EIAA 5HGLA 2X83A 1G03A 3NTEA 5HGKA 3MGEA 4DGAC 2GOLB 4E91A 5HGOA 4XFZA 4DGEC 3H4EA 2PWOA 1M9EC 2M8LA 4U0FA 4U0EA 1M9YC 2M8NA 2M8PA 1M9CC 2WLVB 3H47A 4INBA 4J93A 2XGVA 1L6NA 1M9FC 4E92A 3P05A 1P7NA 5JPAA 4WYMA 1D1DA 2LF4A
chains in the Genus database with same CATH topology
1EM9A 2X82A 2PWMA 1E6JP 4LQWC 5HGMA 4NX4C 1AK4C 2PXRC 4U0CA 1M9DC 4XROA 1QRJA 1AFVA 4XFYA 2KGFA 4HTWA 2JPRA 4PH3A 4B4NA 4PH0A 4XRQA 2WLVA 4QNBA 4PH2A 2XDEA 2XGUA 4XFXA 1U7KA 2X2DD 4U0BA 2XGYA 5HGNA 4U0DA 3BP9A 4U0AA 1GWPA 2GONA 1EIAA 1M9XC 2Y4ZA 2V4XA 2EIAA 5HGLA 2X83A 1G03A 3NTEA 5HGKA 3MGEA 4DGAC 2GOLB 4E91A 5HGOA 4XFZA 4DGEC 3H4EA 2PWOA 1M9EC 2M8LA 4U0FA 4U0EA 1M9YC 2M8NA 2M8PA 1M9CC 2WLVB 3H47A 4INBA 4J93A 2XGVA 1L6NA 1M9FC 4E92A 3P05A 1P7NA 5JPAA 4WYMA 1D1DA 2LF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EM9 A;  2X82 A;  2PWM A;  1E6J P;  4LQW C;  5HGM A;  4NX4 C;  1AK4 C;  2PXR C;  4U0C A;  1M9D C;  4XRO A;  1QRJ A;  1AFV A;  4XFY A;  2KGF A;  4HTW A;  2JPR A;  4PH3 A;  4B4N A;  4PH0 A;  4XRQ A;  2WLV A;  4QNB A;  4PH2 A;  2XDE A;  2XGU A;  4XFX A;  1U7K A;  2X2D D;  4U0B A;  2XGY A;  5HGN A;  4U0D A;  3BP9 A;  4U0A A;  1GWP A;  2GON A;  1EIA A;  1M9X C;  2Y4Z A;  2V4X A;  2EIA A;  5HGL A;  2X83 A;  1G03 A;  3NTE A;  5HGK A;  3MGE A;  4DGA C;  2GOL B;  4E91 A;  5HGO A;  4XFZ A;  4DGE C;  3H4E A;  2PWO A;  1M9E C;  2M8L A;  4U0F A;  4U0E A;  1M9Y C;  2M8N A;  2M8P A;  1M9C C;  2WLV B;  3H47 A;  4INB A;  4J93 A;  2XGV A;  1L6N A;  1M9F C;  4E92 A;  3P05 A;  1P7N A;  5JPA A;  4WYM A;  1D1D A;  2LF4 A; 
#chains in the Genus database with same CATH topology
 1EM9 A;  2X82 A;  2PWM A;  1E6J P;  4LQW C;  5HGM A;  4NX4 C;  1AK4 C;  2PXR C;  4U0C A;  1M9D C;  4XRO A;  1QRJ A;  1AFV A;  4XFY A;  2KGF A;  4HTW A;  2JPR A;  4PH3 A;  4B4N A;  4PH0 A;  4XRQ A;  2WLV A;  4QNB A;  4PH2 A;  2XDE A;  2XGU A;  4XFX A;  1U7K A;  2X2D D;  4U0B A;  2XGY A;  5HGN A;  4U0D A;  3BP9 A;  4U0A A;  1GWP A;  2GON A;  1EIA A;  1M9X C;  2Y4Z A;  2V4X A;  2EIA A;  5HGL A;  2X83 A;  1G03 A;  3NTE A;  5HGK A;  3MGE A;  4DGA C;  2GOL B;  4E91 A;  5HGO A;  4XFZ A;  4DGE C;  3H4E A;  2PWO A;  1M9E C;  2M8L A;  4U0F A;  4U0E A;  1M9Y C;  2M8N A;  2M8P A;  1M9C C;  2WLV B;  3H47 A;  4INB A;  4J93 A;  2XGV A;  1L6N A;  1M9F C;  4E92 A;  3P05 A;  1P7N A;  5JPA A;  4WYM A;  1D1D A;  2LF4 A; 
#chains in the Genus database with same CATH homology
 1EM9 A;  2X82 A;  2PWM A;  1E6J P;  4LQW C;  5HGM A;  4NX4 C;  1AK4 C;  2PXR C;  4U0C A;  1M9D C;  4XRO A;  1QRJ A;  1AFV A;  4XFY A;  2KGF A;  4HTW A;  2JPR A;  4PH3 A;  4B4N A;  4PH0 A;  4XRQ A;  2WLV A;  4QNB A;  4PH2 A;  2XDE A;  2XGU A;  4XFX A;  1U7K A;  2X2D D;  4U0B A;  2XGY A;  5HGN A;  4U0D A;  3BP9 A;  4U0A A;  1GWP A;  2GON A;  1EIA A;  1M9X C;  2Y4Z A;  2V4X A;  2EIA A;  5HGL A;  2X83 A;  1G03 A;  3NTE A;  5HGK A;  3MGE A;  4DGA C;  2GOL B;  4E91 A;  5HGO A;  4XFZ A;  4DGE C;  3H4E A;  2PWO A;  1M9E C;  2M8L A;  4U0F A;  4U0E A;  1M9Y C;  2M8N A;  2M8P A;  1M9C C;  2WLV B;  3H47 A;  4INB A;  4J93 A;  2XGV A;  1L6N A;  1M9F C;  4E92 A;  3P05 A;  1P7N A;  5JPA A;  4WYM A;  1D1D A;  2LF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...