4E9MA

Nod1 card domain with three disulfide-clinched, domain-swapped dimers in the asymmetric unit
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
97
structure length
97
Chain Sequence
SESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCACPTQPDKVRKILDLVQSKGEEVSEFFLYLLQQLADAYVDLRPWLLEIGFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nod1 card domain with three disulfide-clinched, domain-swapped dimers in the asymmetric unit
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Nucleotide-binding oligomerization domain-containing protein
total genus 37
structure length 97
sequence length 97
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00619 CARD Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4e9mA00
2VGQA 4NQKA 4N1JA 4M9ZA 4IZ5E 4LWDA 4EWIA 1DDFA 3J63A 4P4HA 4O9LA 1YGOA 2DO9A 2A9IA 2MN4A 1A1ZA 2N7ZA 3MOPA 2BBRA 2BBZA 1E41A 4I16A 3LQQA 3MOPK 2IB1A 4E9MA 1Z6TA 3CL3A 4N1LA 4O6XA 4FH0A 1WMGA 2YU0A 1PN5A 2DBGA 3J6JA 2OF5A 4RHWA 2D96A 2DBHA 2NZ7A 1CY5A 3MOPG 3YGSP 4O7QA 4IZ7B 4QOBA 2N80A 1ICHA 3CRDA 4N1KA 4D8OA 1D2ZA 2KM6A 2YQFA 2G7RA 1C15A 2MS8A 2HM2Q 2O71A 3YGSC 3KATA 2YGSA 2P1HA 4RHWE 1WXPA 2F1SA 2NSNA 4UZ0A 3EZQA 4ZBWA 4F42A 3LQRA 2N83A 2DBFA 3EZQB 2A5YB 4P4HI 2YVIA 4A2QA 2MB9A 2GF5A 2N97A 1A1WA 1D2ZB 2L9MA 4O9FA 1UCPA 4JUPA 2B1WA 2N00A 1N3KA 1WH4A 1E3YA 1FADA 2NAQA 2MS7A 3T6PA 2M5VA 1CWWA 4A2WA 4M9SA 4JQWA 2OF5H 2LS7A 2LWEA 1DGNA 2LWDA 2N1FA 4IZAB 3QF2A 4F44A 2MPCA 2KN6A 2L6AA 4M9XA 1NGRA 2DBDA 4DWNA
chains in the Genus database with same CATH superfamily
2VGQA 4NQKA 4N1JA 4M9ZA 4IZ5E 4LWDA 4EWIA 1DDFA 3J63A 4P4HA 4O9LA 1YGOA 2MJMA 2DO9A 2A9IA 2MN4A 1A1ZA 2N7ZA 3MOPA 2BBRA 2BBZA 1E41A 4I16A 3LQQA 3MOPK 2IB1A 4E9MA 1Z6TA 3CL3A 4N1LA 4O6XA 4FH0A 1WMGA 2YU0A 1PN5A 2DBGA 3J6JA 2OF5A 4RHWA 2D96A 2DBHA 2NZ7A 1CY5A 3MOPG 3YGSP 4O7QA 4IZ7B 4QOBA 2N80A 1ICHA 3CRDA 4N1KA 4D8OA 1D2ZA 2KM6A 2YQFA 2G7RA 1C15A 2MS8A 2HM2Q 2O71A 3YGSC 3KATA 2YGSA 2P1HA 4RHWE 2XV9A 1WXPA 2F1SA 2NSNA 4UZ0A 3EZQA 4ZBWA 4F42A 3LQRA 2N83A 2DBFA 3EZQB 2A5YB 4P4HI 2YVIA 4A2QA 2MB9A 2GF5A 2N97A 1A1WA 1D2ZB 2L9MA 4O9FA 1UCPA 2B1WA 2N00A 4JUPA 1N3KA 1WH4A 1E3YA 1FADA 2NAQA 2MS7A 3T6PA 2M5VA 1CWWA 4A2WA 4M9SA 4JQWA 2OF5H 2LS7A 2LWEA 1DGNA 2LWDA 2N1FA 4IZAB 3QF2A 4F44A 2MPCA 2KN6A 2L6AA 4M9XA 1NGRA 2DBDA 4DWNA
chains in the Genus database with same CATH topology
2VGQA 4NQKA 4N1JA 4M9ZA 4IZ5E 4LWDA 4EWIA 1DDFA 3J63A 4P4HA 4O9LA 1YGOA 2MJMA 2DO9A 2A9IA 2MN4A 1A1ZA 2N7ZA 3MOPA 2BBRA 2BBZA 1E41A 4I16A 3LQQA 3MOPK 2IB1A 4E9MA 1Z6TA 3CL3A 4N1LA 4O6XA 4FH0A 1WMGA 2YU0A 1PN5A 2DBGA 3J6JA 2OF5A 4RHWA 2D96A 2DBHA 2NZ7A 1CY5A 3MOPG 3YGSP 4O7QA 4IZ7B 4QOBA 2N80A 1ICHA 3CRDA 4N1KA 4D8OA 1D2ZA 2KM6A 2YQFA 2G7RA 1C15A 2MS8A 2HM2Q 2O71A 3YGSC 3KATA 2YGSA 2P1HA 4RHWE 2XV9A 1WXPA 2F1SA 2NSNA 4UZ0A 3EZQA 4ZBWA 4F42A 3LQRA 2N83A 2DBFA 3EZQB 2A5YB 4P4HI 2YVIA 4A2QA 2MB9A 2GF5A 2N97A 1A1WA 1D2ZB 2L9MA 4O9FA 1UCPA 2B1WA 2N00A 4JUPA 1N3KA 1WH4A 1E3YA 1FADA 2NAQA 2MS7A 3T6PA 2M5VA 1CWWA 4A2WA 4M9SA 4JQWA 2OF5H 2LS7A 2LWEA 1DGNA 2LWDA 2N1FA 4IZAB 3QF2A 4F44A 2MPCA 2KN6A 2L6AA 4M9XA 1NGRA 2DBDA 4DWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGQ A;  4NQK A;  4N1J A;  4M9Z A;  4IZ5 E;  4LWD A;  4EWI A;  1DDF A;  3J63 A;  4P4H A;  4O9L A;  1YGO A;  2DO9 A;  2A9I A;  2MN4 A;  1A1Z A;  2N7Z A;  3MOP A;  2BBR A;  2BBZ A;  1E41 A;  4I16 A;  3LQQ A;  3MOP K;  2IB1 A;  4E9M A;  1Z6T A;  3CL3 A;  4N1L A;  4O6X A;  4FH0 A;  1WMG A;  2YU0 A;  1PN5 A;  2DBG A;  3J6J A;  2OF5 A;  4RHW A;  2D96 A;  2DBH A;  2NZ7 A;  1CY5 A;  3MOP G;  3YGS P;  4O7Q A;  4IZ7 B;  4QOB A;  2N80 A;  1ICH A;  3CRD A;  4N1K A;  4D8O A;  1D2Z A;  2KM6 A;  2YQF A;  2G7R A;  1C15 A;  2MS8 A;  2HM2 Q;  2O71 A;  3YGS C;  3KAT A;  2YGS A;  2P1H A;  4RHW E;  1WXP A;  2F1S A;  2NSN A;  4UZ0 A;  3EZQ A;  4ZBW A;  4F42 A;  3LQR A;  2N83 A;  2DBF A;  3EZQ B;  2A5Y B;  4P4H I;  2YVI A;  4A2Q A;  2MB9 A;  2GF5 A;  2N97 A;  1A1W A;  1D2Z B;  2L9M A;  4O9F A;  1UCP A;  4JUP A;  2B1W A;  2N00 A;  1N3K A;  1WH4 A;  1E3Y A;  1FAD A;  2NAQ A;  2MS7 A;  3T6P A;  2M5V A;  1CWW A;  4A2W A;  4M9S A;  4JQW A;  2OF5 H;  2LS7 A;  2LWE A;  1DGN A;  2LWD A;  2N1F A;  4IZA B;  3QF2 A;  4F44 A;  2MPC A;  2KN6 A;  2L6A A;  4M9X A;  1NGR A;  2DBD A;  4DWN A; 
#chains in the Genus database with same CATH topology
 2VGQ A;  4NQK A;  4N1J A;  4M9Z A;  4IZ5 E;  4LWD A;  4EWI A;  1DDF A;  3J63 A;  4P4H A;  4O9L A;  1YGO A;  2MJM A;  2DO9 A;  2A9I A;  2MN4 A;  1A1Z A;  2N7Z A;  3MOP A;  2BBR A;  2BBZ A;  1E41 A;  4I16 A;  3LQQ A;  3MOP K;  2IB1 A;  4E9M A;  1Z6T A;  3CL3 A;  4N1L A;  4O6X A;  4FH0 A;  1WMG A;  2YU0 A;  1PN5 A;  2DBG A;  3J6J A;  2OF5 A;  4RHW A;  2D96 A;  2DBH A;  2NZ7 A;  1CY5 A;  3MOP G;  3YGS P;  4O7Q A;  4IZ7 B;  4QOB A;  2N80 A;  1ICH A;  3CRD A;  4N1K A;  4D8O A;  1D2Z A;  2KM6 A;  2YQF A;  2G7R A;  1C15 A;  2MS8 A;  2HM2 Q;  2O71 A;  3YGS C;  3KAT A;  2YGS A;  2P1H A;  4RHW E;  2XV9 A;  1WXP A;  2F1S A;  2NSN A;  4UZ0 A;  3EZQ A;  4ZBW A;  4F42 A;  3LQR A;  2N83 A;  2DBF A;  3EZQ B;  2A5Y B;  4P4H I;  2YVI A;  4A2Q A;  2MB9 A;  2GF5 A;  2N97 A;  1A1W A;  1D2Z B;  2L9M A;  4O9F A;  1UCP A;  2B1W A;  2N00 A;  4JUP A;  1N3K A;  1WH4 A;  1E3Y A;  1FAD A;  2NAQ A;  2MS7 A;  3T6P A;  2M5V A;  1CWW A;  4A2W A;  4M9S A;  4JQW A;  2OF5 H;  2LS7 A;  2LWE A;  1DGN A;  2LWD A;  2N1F A;  4IZA B;  3QF2 A;  4F44 A;  2MPC A;  2KN6 A;  2L6A A;  4M9X A;  1NGR A;  2DBD A;  4DWN A; 
#chains in the Genus database with same CATH homology
 2VGQ A;  4NQK A;  4N1J A;  4M9Z A;  4IZ5 E;  4LWD A;  4EWI A;  1DDF A;  3J63 A;  4P4H A;  4O9L A;  1YGO A;  2MJM A;  2DO9 A;  2A9I A;  2MN4 A;  1A1Z A;  2N7Z A;  3MOP A;  2BBR A;  2BBZ A;  1E41 A;  4I16 A;  3LQQ A;  3MOP K;  2IB1 A;  4E9M A;  1Z6T A;  3CL3 A;  4N1L A;  4O6X A;  4FH0 A;  1WMG A;  2YU0 A;  1PN5 A;  2DBG A;  3J6J A;  2OF5 A;  4RHW A;  2D96 A;  2DBH A;  2NZ7 A;  1CY5 A;  3MOP G;  3YGS P;  4O7Q A;  4IZ7 B;  4QOB A;  2N80 A;  1ICH A;  3CRD A;  4N1K A;  4D8O A;  1D2Z A;  2KM6 A;  2YQF A;  2G7R A;  1C15 A;  2MS8 A;  2HM2 Q;  2O71 A;  3YGS C;  3KAT A;  2YGS A;  2P1H A;  4RHW E;  2XV9 A;  1WXP A;  2F1S A;  2NSN A;  4UZ0 A;  3EZQ A;  4ZBW A;  4F42 A;  3LQR A;  2N83 A;  2DBF A;  3EZQ B;  2A5Y B;  4P4H I;  2YVI A;  4A2Q A;  2MB9 A;  2GF5 A;  2N97 A;  1A1W A;  1D2Z B;  2L9M A;  4O9F A;  1UCP A;  2B1W A;  2N00 A;  4JUP A;  1N3K A;  1WH4 A;  1E3Y A;  1FAD A;  2NAQ A;  2MS7 A;  3T6P A;  2M5V A;  1CWW A;  4A2W A;  4M9S A;  4JQW A;  2OF5 H;  2LS7 A;  2LWE A;  1DGN A;  2LWD A;  2N1F A;  4IZA B;  3QF2 A;  4F44 A;  2MPC A;  2KN6 A;  2L6A A;  4M9X A;  1NGR A;  2DBD A;  4DWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...