4E9TA

Multicopper oxidase cueo (data6)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
489
structure length
476
Chain Sequence
b'AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
molecule tags Metal binding protein
source organism Escherichia coli
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site.
pubmed doi rcsb
total genus 139
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA03
2UX6A 4DPCX 5B1JA 1L9SA 2YAQA 3SBQA 4F2FA 2BW4A 1TEFA 1ASPA 1NIEA 3TBCA 3N55A 3CZUB 2IWKA 4HCGA 3AY2A 1GR7A 1AANA 2TSAA 1RCYA 2W8CA 1AOZA 2DWSA 1AZRA 3PAVA 2XV2A 2GB2A 2Q5BA 3JTBA 4KO5A 4YSSA 1PZAA 3NJNA 3TA4D 2PPDA 3X1NA 2QT6A 4KNUA 2J57A 2VSKB 2IWFA 1YLBB 2JFCA 3S8FB 4DP7X 4QLWA 3T6ZA 1AQ8A 3TU6A 3G5WA 2FTAA 1KBWA 3FT0A 3GYRA 1ADWA 1AS7A 3NJKA 1FA4A 2BP0B 3X1EA 5I6PA 1UATA 1JZJA 2QDWA 2FQEA 1HFUA 3QPKA 1GSKA 3HEIB 5I6NA 3FQ1A 2FQGA 1N70A 1SDDB 2HX7A 1X9RA 2UX7A 5AKRA 5B7EA 4ZK8A 1ET8A 3ERXA 3NJMA 5I6LA 2R7EB 1KDJA 5TK2A 1NTDA 2AZUA 4GXFA 1JOIA 2EIMB 2PP8A 4KOCA 3IN0A 2AVFA 3S8GB 1ID2A 5B7MA 8PAZA 4YSRA 1GS8A 5B1BB 2X87A 3FU8A 2YARA 4M4RB 2E86A 1PZBA 1JERA 2IH9A 2Y1AA 2UXTA 3ASNB 3CVBA 2BP8B 4YSOA 1B3IA 4G7RB 3V9CA 1JVLA 4NAJA 3WNJA 5AFAA 5PCYA 3QJRB 4HAKA 1PF3A 1IKOP 2YAOA 2YAHA 4JKNA 3NSDA 3EH5B 4DP6X 1TU2A 2PPCA 3NJHA 1BXVA 2IAAC 2XU9A 3X1FA 4WKXA 2HRGA 4G72B 4E9RA 1WA2X 4E9VA 4DPAX 4FAAB 4HHWA 2XXFA 1SF5A 1SFDA 1BQRA 1DZ0A 4YVUA 3EHBB 4JHUA 4N8UA 3ZBMA 7PCYA 1NWPA 1AZBA 2GIMA 2IDTA 1AIZA 1VLXA 5B1AB 4G70B 4G7SB 3PAZA 5I6KA 3X2QB 1KBVA 1E65A 3X1GA 2PPEA 1L9OA 2XUWA 2ZONA 3NJFA 1TEGA 1JZHA 2UXVA 2YAEA 1M56B 1CYWA 1URIA 4DP9X 2WSDA 1J5CA 1BAWA 1ZV2A 1F56A 1JVOA 4G71B 3MBWB 4Q89A 3ASOB 1OV8A 2GHZA 2IDUA 4UF7C 2PPAA 2BP0A 4BXVA 4E9XA 4BDVA 2DWTA 4AKPA 5B1KA 4F7KA 5I5MA 4GP4B 1IBYA 1I53A 2PLTA 4HHGA 2UXFA 5B3SB 4BWUA 2FQDA 2EIJB 1A8ZA 3IBOA 4AI7A 1ILUA 4DP0X 1GS7A 3ABGA 2YAPA 1AZNA 2YXVA 1A4AA 2GSMB 2IDFA 1OCRB 1SNRA 4E9TA 1ETJA 3OD3A 2XLLA 1BEXA 3N2JA 3OMNB 2I7SA 1SDDA 3WKQA 2HLEB 2PPFA 4YSUA 3QJSB 2CCWA 4WTQA 3UGEA 2X88A 4YSCA 1R1CA 2H47C 4A2HA 1M57B 2UXGA 1OCZB 1OE1A 4K9JA 5I26A 6PAZA 2VSMB 2IDSA 2WO2B 3RYMA 2B3IA 1JZFA 5B7FA 2Y69B 1NPNA 2GBAA 1AG0A 3X1BA 2ZXWB 1IUZA 4YSDA 3C75A 1RKRA 2DYRB 1KDIA 3NP4A 2XXGA 4F2EA 1FFTB 2AFNA 1A65A 1L9TA 4YL4A 1SFHA 2YQBA 2XX1A 3H4HA 4UAHA 1HAUA 3NT0A 2NRDA 2WO3B 3H4FA 3NSCA 5B1JC 1MZYA 1FWXA 2Q9OA 2BZCA 3HB3B 3OMIB 5D4HA 1T5KA 1GY1A 5D4IA 4RH4A 3FYIB 1MZZA 2W88A 2QPEB 1V10A 3AW5A 4DP2X 2MTAA 3FPXA 1CURA 2PP9A 1XB8A 3PCYA 1AG6A 1W6WA 2J56A 1BXUA 2J55A 2FNWA 2BW5A 4JHVA 3V9EA 1J9QA 3WNIA 4AX3A 4BDVB 1GYCA 2XV3A 3GXUB 4HCFA 5I5IA 3NSFA 2IDQA 2VW7A 3QJVB 2FJSA 3UAEA 1E5YA 1BYOA 4KNTA 3UABA 3WI9A 1GS6X 4DP1X 2GI0A 2EILB 4A67A 1JZEA 4KO7A 1M9WA 1PZCA 2BZ7A 2YXWA 4CSZA 1KYAA 5D4JA 5I6MA 5LDUA 1JXFA 1NIAA 3T9WA 2N0MA 9PCYA 2OCCB 1NPJA 4M3HA 1E30A 2FT6A 3ZDWA 2BO0A 3BQVA 6PCYA 1WA1X 5PAZA 1WS7A 2DY2A 2FT7A 2LLNA 1A4CA 3KW7A 2VM4A 1SHXA 1ZPUA 1SHWA 2RACA 4FA7B 1PNCA 3ABKB 1PY0A 2VM3A 4KO9A 4X4KA 3WKPA 1A3ZA 3SBPA 4DP4X 4YSTA 2XV0A 4KNSA 3DKHA 2VN3A 1JXDA 3H56A 2FT8A 2AANA 5I28A 4YVNA 2HX8A 1EHKB 1EZLA 4GP5B 2OV0A 3NP3A 2BHFA 3NYKA 3NJJA 2I7OA 1IC0A 3AG1B 5EHFA 4HALA 1GW0A 4NB7A 7PAZA 2XX0A 2AZAA 3ABLB 4AKOA 3U25A 2YAMA 1OE3A 1ZDSA 3PPSA 4AKQA 2FQFA 3IE9A 1L9PA 3S3BB 2PCFA 2J5WA 1E5ZA 2VW4A 2GC7C 2DYSB 3FSVA 4BK5C 1ZDQA 3OQRA 1MG3C 4A2FA 1OOWA 2PP7A 2R7EA 5IY5B 1OE2A 3FPYA 2VMJA 3FU7A 3PLYA 3L45A 3CVDA 4ENZA 4W1TA 5ANHA 1DYZA 4DPBX 3FYEB 1L9QA 1PLBA 1J9RA 2ZWNA 3AZUA 3PAUA 5AZUA 4HCIA 3UADA 2XWZA 3FS9A 2A3TA 4A66A 1NIFA 1QHQA 3CDZA 3IN2A 2DV6A 3FSZA 2HZHA 3OMAB 1SF3A 2EIKB 3FQYA 2H5UA 2MRYA 1E67A 1KCWA 3SQRA 3ZIYA 3WG7B 4BWTA 2FWLB 4BWWA 1ET5A 2B08A 1IBZA 1MDAA 3AG3B 4G7QB 3TBBA 3CVCA 4GY4A 4A2GA 4BXSV 1ZIBA 4GYBA 4HIPA 3S3CB 2EINB 3FU7B 1L9RA 1QNIA 2CAKA 1CYXA 1NIDA 4KOBA 3EH3B 3S3DB 4A2DA 3ABMB 3PXLA 2BP8A 1J9SA 1TKWA 1GY2A 1ZIAA 1PCSA 3FSWA 1OF0A 1BQKA 1PAZA 4P5RA 4A68A 4AZUA 2JXMA 2P80A 2IWEA 2IH8A 1AR1B 5I5JA 2BWIA 1WA0X 1WS8A 1KGYE 1PNDA 4E9SA 4PAZA 2ZOOA 5E9NA 5F7AA 3UACA 4DP5X 3IEAA 1PLCA 2CJ3A 4N4YB 1XMEB 2PCYA 1BYPA 3DTUB 1V54B 4EF3A 3FQ2A 5A7EA 1NICA 2OJ1A 1ASQA 1SJMA 2QPDB 5I6OA 1KV7A 2I85A 1QLEB 4YSEA 4PCYA 2GC4C 3EF4A 2HXAA 2YAFA 1AS8A 1X9UA 3UAAA 2P80D 3KW8A 1JZIA 4HZ1A 4CSPA 1PLAA 3QQXA 3CDZB 1XB3A 2VW6A 4E9YA 1J9TA 1RZQA 1A4BA 3FSAA 3GDCA 3CG8A 3QJQB 1ILSA 5FC9A 3AG4B 1MG2C 1J5DA 2QDVA 3D12B 3QJTB 1WAEA 4YSAA 1AAJA 1OCCB 3JT2A 3FU9A 3T6VA 1ASOA 1BQ5A 4Q8BA 1AS6A 3T71A 2BWDA 3AG2B 3T6XA 4GP8B 1JXGA 1V55B 4E9WA 1PMYA 2CBPA 3WIAA 2XYBA 1NIBA 4KO6A 5TK4A 1AZCA 5F7BA 4TXVB 1ET7A 1NZRA 3SBRA 2HX9A 3TASA 4QKTA 1W6LA 1NDTA 1XB6A 3EH4B 1W8EA 3NJIA 2TSBA 1BXAA 1N68A 3MX0B 4UANA 4E9QA 3NSYA 3QJUB 4L0PB 4MFHA 3NJLA 1JZGA 2JKWA 2CUAA 1CC3A 4YSPA 3DIVA 1KCBA 4W9ZA 3NJGA 4P5SA 1CUOA 4YSQA 1AACA 1RZPA 1HAWA 2CALA 1NWOA 3T6WA 3BVDB 2H3XC 2HRHA 1OCOB 3OM3B 4A2EA 2XVBA 1NINA 4DP8X 3ZX1A 4NERA 1AZUA
chains in the Genus database with same CATH superfamily
2UX6A 2AGJH 2P5EB 1VACB 4MQ7B 4GBXA 4NP4H 5AVQB 1QO3B 2HJFA 3US9A 4MNQB 1JF5A 1OCWH 3DX0A 4CNIA 5ID0A 4MXQD 5HVFB 4OZIB 1AXTL 1E2VA 3S34L 1K9TA 1DFXA 3NTCH 1DHKA 4H0LC 4Z8FH 2JK5A 3PAVA 2DTMH 4FXGA 3RL1B 2R4RL 3CSPA 3ZTEA 1U8KB 2IAMC 4HJSA 5GIRB 2ODHA 4WRLA 3LD8C 4RSVA 1L0PA 2QPFA 1R5IA 1KXTA 3AREC 5D1XC 4RAVA 4KJQC 4LCVA 4P5TB 2H0JA 2D4FA 2YRPA 1B3JA 3FU5A 4QRRE 3O11A 1BJ8A 4NBXB 3RDTC 1HKLH 5IVZA 1FAKT 2WZ0A 3GMNB 3RVXC 3HNVH 1QATA 1WZMA 3F5WB 3S5LB 1UXLA 2YBRB 1KLGA 2RH0A 1MCLA 5K9OA 1JDCA 3FB8B 3NJKA 2MNJB 1KGJA 3MRBB 4ZUTA 3DURB 1N5AB 5E8NA 1D7BA 3WIIH 3S8WA 2H7WA 2NY2C 5DVLA 3QYNA 4Y8DC 5I2IA 3BVUA 1PD1A 4IU2B 4QXTA 4U1HA 5L8KB 3DX4A 1DQIA 1MW0A 3DUHA 5AW7B 1X9RA 2YGPA 2X44D 4OFYA 4ELME 5F1KC 4PWJA 1YQ2A 4PJ9B 5E9DE 5EFIA 3K0YA 2APFA 3IMUA 1WJ3A 4M1CC 3VXUD 2FWSA 1F90L 4ZX5A 5BS0D 4IRSB 5EBGA 4Z7NE 5HHQB 4U1KA 3WFCH 4P48A 3WEOA 1M71A 3AM8C 3F62A 1A0QH 1FYTD 1KTJA 3CDGA 2DTML 2WUBH 1N64L 4G42B 3NFNA 3CC5B 1A6PA 2R4RH 5ALCH 3H9YA 1BQLL 5I23A 1NCNA 4YSOA 4KK6C 3ZW3A 4DWHA 4A7SA 5DGQA 1RIUH 4PV8A 4I18C 5HTSA 3PHOA 1JMZA 2NY3C 5JA8B 4R26H 4JFQB 1DVSA 3MLUL 2ICCA 1BX2B 1NC2B 2C9AA 5C3IA 1HWHB 1I9IL 1KTCA 1OIOA 4J3OD 3GQFA 1DEEA 4Q4IA 4EN3C 3KPLA 4PW4A 3X1FA 4EOWL 1UGKA 1AY1L 1WITA 2B16A 2P8PB 4UM8A 4XGZB 5IFJA 1PZ5B 4DIXA 5JHLH 4FXKC 1XT5A 2NNAB 5DHYB 3DO4A 1NM9A 3OR6B 3MBED 2Q7YA 2AV1A 3FO0L 4A7GA 4AG4L 4TTDD 1JV2B 4M8VA 4Y16C 4ZTPH 2AJ3B 3BVTA 4N1HB 4PJHF 3B7RL 4U4BA 4GKSA 3D85A 4QOKA 5E0QA 1UWGH 3B7TA 3OPUA 3P11H 3QUXA 2PWHA 4J3SA 4JO3H 5I1JL 2PPEA 1UXSB 4TUOA 2MOQA 5FKAA 3P0YL 3D18A 1KIUB 1LO5B 3QUZB 4Y4KC 3ORJA 1GC1L 5I8OH 2GHZA 1XGUA 2LTQC 3LN5A 3BD3A 5IHBA 4I3GA 5M7QA 1OD9A 1U41A 3HG1E 5JPMB 3IGLA 3MRRB 1QW9A 2WTPA 4GNKB 2PO6A 4LIQL 1HYSD 35C8H 1D2OA 4NZ8A 5HHQA 1A8ZA 1KGWA 3IJ9A 3GBNH 2P7TA 4DVRH 2EE0A 1DQLL 3MRDA 4WQOA 3WLBB 5FYLH 4PRHE 3KPRB 3HG3A 4B95C 4JNXA 3NEXA 5KJ4A 5CJQH 1E9OB 3FCTA 2GSGA 1S46A 3PFUA 3QWQB 3TESA 4ADGA 5JUEH 2VDRL 2XN0A 2XKNB 3SB3A 5C6PB 4XNMA 2HLEB 1D6VH 3KMDA 4RESB 3K1DA 3CFKB 3UDWC 2Y25A 3N1FC 2KMWA 1GOGA 2X88A 1E7VA 1II4E 2DMCA 4Y2NA 3U0PB 1DQQB 1CD1A 1QBBA 4XP1H 4Z7NF 2D7NA 4EZKA 1TTBA 4CUCA 3VFUA 2WO2B 1JPEA 5AQ0A 4QRUB 5LJYH 5MP6L 3B9EA 3NCMA 3RYMA 2OTUA 3SE9L 4FQHA 3TBWB 1ZANL 4Z3HA 1R0AL 2UWEE 1CB4A 1KPUA 1PKOA 1QI5A 4HG4K 2VITB 4WY7L 1KBKA 3HRZC 4XX1G 1TTAA 5F88A 1CMOA 1C9SA 1HAUA 4MJIE 2BSSA 2XWXA 4WZ9A 2NSXA 4G8GE 3Q2WA 5I17B 4MAUL 5CEZH 1JGUL 3KL3A 3ARFB 3T6QC 4LCWD 4QY8B 1G0DA 2J8UA 1OSZB 3KPSD 3HG2A 2F1BA 1J11A 5INCA 1AYRA 3QQDA 1RMFL 1CGSL 3HI5L 5SV3A 3X3FH 1MXGA 3EYOB 1JYVA 2JJTC 3FC8A 4PJCB 2DMHA 3D4YA 1I85A 5EOQH 3V9EA 1FIGL 1MCSA 3QP3A 5DD3H 2X0WA 4FXGC 4GO6B 1S9YA 1ZGLP 3DRTA 3HUJE 3QA3B 3UYPA 2Z7YA 4POYA 3VGGA 3FQXA 3MLVH 2GEQA 4N0FB 2P1YA 2FX7L 1T03H 4K5OA 4RRPG 2WWOA 3IKCB 1BGXH 2ZXQA 1I9JL 3MRJA 3O6LH 3ZL2A 4Y2OA 4IJ3C 1CFTA 1X7QA 1OSPL 4F27A 3GRWH 1YEJH 2CBTA 1JNLH 3NA9L 5D4JA 3SDCC 3CSBA 3VGEA 4KUZH 4DKAA 2OCCB 5BW7C 2F5BL 3JQOB 1N5YL 3E6HB 5HHME 4HUXA 2H2SC 5CLWA 1EMTH 2L4OA 4JANA 4Z7IA 3REVA 5JDJA 5MEQA 1FSKC 1FJ1B 4LSUH 3T3ME 2R1YB 4GLRH 1ZTXH 2DKSA 1IM9D 1SHWA 1JFQH 4OFKA 3IRZA 4NRYA 1V8HA 3V6OE 4EI0A 2E9GA 3CN1A 4PREA 4Q2ZB 1SJHB 3L4XA 4AYMC 3HR5A 2Z7WA 1O0VA 1IIIA 3DHJA 4I9WE 4X6CE 3WEXB 4F7MA 3EJRA 3AM8A 2LU3A 3KD4A 1HC1A 2WUBL 4XO5A 4N68A 1CXLA 4U1GB 5J06A 2F54D 1FORL 1A6ZB 1NBCA 2Q8BL 4QF1B 1WPCA 3OHXB 1VFBA 4Z7WA 2YKLL 3BP5B 4LB8A 3WHXA 3K6SB 3OAUH 2GJ6B 4TLTA 1DBAL 5C0RH 3Q6GL 3LEVL 2HTKC 1NSNH 3BAYA 4BIKA 3GRWA 4MQSB 1EEYA 1ULVA 3EGDB 2DLHA 1IC4H 5GS2D 1LO2H 3K4DA 4JFOB 3JWDC 3QIWA 1SOQA 1TQBB 1CGYA 3DXAB 2PP7A 3RX9A 1BFOA 2X70B 1V3KA 5IR1B 2K8QA 2UZPA 4EDWL 2EIBA 5FGCB 4ENZA 4K3HA 4J5VA 1IQWH 3VXQA 1HQ4A 4J6IA 4KVNL 1E3XA 3EJPA 3NACH 1NEZG 4D0DA 1FHGA 2BC4A 1H19A 1BVOA 3MSPA 1NGWA 3CDZA 4B5EA 1EJOH 4ISVB 1RP8A 4OLXH 4YC2B 4F8TA 5B38G 4FERA 2M1KA 5J3HC 1ZD6A 2F7IA 4JQVA 3C6LA 3Q43A 5EUKA 3RUGF 4EDXA 2FR4B 1SM3H 4IK6A 4L8DA 4M3KB 2EH7L 1THCA 4FFYA 2Z8RA 3V2AR 3ZDYB 1TVHB 5IREA 4MB4A 5DLMH 1CG9B 4L37B 1X5FA 5E5RB 4TPRH 3EDJA 4DGWC 5IVXF 4A2GA 4WI0B 2FUQA 1MCOL 3DOSB 2IXQA 3TONA 2BCKB 4ZPVB 4MD4A 2ADIB 1SQ2N 4XX1E 5C09E 1B6UA 4GLRI 4R7VA 5HPMA 4JFFA 1BVZA 2DBLH 3IFPA 1HSAA 2PCFB 1S78C 4RNRA 4XHJC 3WY3A 1U2CA 4AH2B 3T1WA 4PEEA 1VGKB 1N6VA 4QTIH 3EFOB 3B9VA 4KRPB 3L3GB 1Q72H 4FYQA 5HJ3B 4AZUA 4DKFL 4E41D 4EI5D 1R5VA 15C8H 1O5DT 2F1EA 2HH0L 2LT9A 2WSKA 1WS8A 4MAYC 1H8LA 4Z0BH 4YOKA 4XNYH 1HE7A 2F6AA 2ZKXA 4U4IA 3VQLA 5T33L 2ZIDA 5SX5H 1NL0L 3RWEA 3GBEA 2W0KA 3UACA 2CKNA 3RHWF 4FNLL 1D9KB 4Z7QE 2CJ3A 3QUMB 3U1SL 4ELMA 4GAGL 4DZBA 1BAFL 3ECWA 2VB5A 2W92A 3UP1A 2WCGA 2JCCF 1BEYL 5ABZA 3FULA 3L3OA 3C08L 5DJYA 4XMKL 1FHNA 2OJ1A 1IL1A 3BVVA 4F5CE 1K8IA 2R0KL 3QZWA 4O9HH 4YHOL 3LKQB 5T1LA 3SD5A 1F1AA 1JN6A 5EIIB 1G7HB 2HPOA 4AEFA 1WWAX 1T20A 3DK0A 2WKGA 2BMKA 3HRZB 5DVNA 1CF1A 5TE6H 3JZ7A 4X4MA 4NKDB 3SPVB 4ZMVA 5AZEL 5CEXA 1IKNA 3HFML 3Q2LA 3W2DH 3F6IA 5FDWA 2DLTA 1JMXA 2XA8L 2QGDA 4JG0L 5ADOL 2GY7B 1P84J 1Y1UA 2QDVA 3B4NA 2KZWA 1IBGL 1FZJB 3T6VA 1NC4A 4CVXA 4HDIB 2AQPA 1W72L 1Y6MR 1OD7A 4LCUB 1WHOA 3TVMA 1U3ZA 1YQVH 2HA1A 3BKYL 4E9WA 4FLQA 1VFAA 1D6EA 2AEQL 3QEUB 2EYSB 5L2KA 4MA8H 4GUPA 5KJ7E 3HG4A 5GS1A 1EANA 3STLB 3WFEL 1BAFH 2F74A 1T03L 1NDTA 5IB5B 3HTLX 1B0GA 4UANA 4W4OA 3VXOB 4MVBC 1SDAB 2DIBA 4F9LC 4QOKE 3QJFB 1JZGA 4GAFB 2F08A 3SO3C 4U6HA 1UC6A 1QNZH 4ODHH 3GWJA 1NOFA 2IPTH 3VXQB 1WFTA 4D7BA 5KVDE 3IKCA 3FBQA 1V7NL 3HZKB 5D93B 1HOCB 1KBBA 3QJHB 1AGEB 1NUFA 2B15A 2C4FT 2CALA 3KPQA 3SCMB 5BVPH 5KSAB 4XNXL 3S6CA 1A14H 4RISH 1U42A 1W0VB 3QDJD 2XVBA 3BUPA 4JZOA 3V7AG 5HGBA 2FX8H 4L0YA 3KYKL 2BNRA 1O75A 1FSKB 1IEAB 3B5GA 4KFZC 4OGXL 5AZEH 2X9ZA 3TCLA 2P8LB 4UT6A 1WWBX 5CGYC 2VJXA 3UZVB 5IGXH 2BOBA 1UWYA 4F58L 4MNQD 1GL4B 2AXJA 3UO1L 1Q9WB 2YMOA 5BZWA 1FZKA 1N8OE 2WLJA 1TJIH 3AY2A 2F8IA 5INCB 4MD5A 5KBKA 2YMXH 2TRHA 1U8OA 1AOZA 3IT8D 4N6RB 3ULUD 3SJVE 1F3RB 3EGXA 4JO2L 4IBYA 3LPGA 1Y6NR 3IAGC 1J7VR 2BSRA 3LEYH 4ELKB 4Q9BA 5AVSB 3U0WL 5CZVL 2HTKD 4IBLT 3B2PA 1C16B 4X5WB 3E8UH 3QAZB 4KRMB 4F1SA 3KS0H 4QLWA 3LRMA 4ODHL 4NENA 3LKRB 1UYWL 4QT5A 2J1KA 1X4ZA 5JZ7D 1BAGA 3BOVA 4HU2A 3OX8A 3VFUB 1T22A 4U1LA 4DVBA 3LRSA 1CXIA 1ERNA 3S34H 2CHZA 4Y89A 5LGHL 4A7QA 5TDPB 5CMAB 2WLHA 4GXUM 1G1YA 2EYTA 1OGTB 2OMUB 3QWOB 4MJIA 5JR1H 4XVSL 3Q06A 4XNMB 4X6FB 3TZVD 4BH7B 3QYMA 4R90L 1IC5H 2FBOJ 3ML9A 5KSBF 1IGTA 2AZUA 3CHSA 4WU5B 4XCYA 4AYDC 3VYNA 3IDYB 3IN0A 4L2YA 5DLML 3RBSA 3Q8CA 1MJJB 2XRAL 4UILH 4I89A 2CPCA 4ODUB 4CU8A 3M07A 4YSRA 3ZKXB 1P4IH 2YARA 3MRFA 2E86A 3LNIA 4G6FB 4LKXA 3ASNB 2YUZA 1NEUA 1WIUA 1QRNA 1KC5H 1TVBA 4G7RB 4OLYH 5AUMB 2WIMA 3KLAB 1OLLA 4Q9CA 3WNJA 3GS0A 3S35L 4I7ZC 3FQNA 1AIFA 1GZPA 3EYUL 1PF3A 4NPYB 3MXVH 1C5BH 2RMNA 4APXB 4LRNL 4J1UA 1KB5H 3R8QA 3SCMD 5IJVA 5TQ0H 5AKSA 4L8CA 3GPSA 1UM6H 3VQ2C 4PJAB 1ONQA 2D0FA 5FA4B 1DDHA 4PCTA 5EOCL 5JHMA 4DEWA 1DN0A 1ZA6A 3DETD 4XAKE 2WKOA 3MV7E 4R83A 4DCQB 4D8OA 4N8UA 2O61A 2NNAA 1P6WA 4G3YH 1UZ8B 1YEFH 4FQCH 1S3RA 3GSUA 1K6QH 1NGZA 3L4ZA 3ZGIA 1HYSC 3GLEA 3FTXA 3PWNA 1I1AC 3TIDB 5AAPA 1HSBB 4FJYA 1AZZC 2VLKB 1JZHA 1VENA 2PYEB 3FTSA 3VX0A 4NQDA 4DP9X 4KZDH 2H9GA 4W9CC 1J05A 3BAJA 5DURD 4DERA 1KNOB 2GJPA 2JF1A 1J5OH 1OAXH 2WGXA 3I6SA 4FXKA 3AQZA 4N5UA 3ZYJA 2W9DH 4Z7VF 2WXNA 5B1KA 4DOHB 5M94B 1ZSDA 4FLOA 1PZ3A 1IT9H 3CSFA 3L08A 5HD8C 1FN4A 5IROA 2RQEA 3V55A 3IBOA 1KPVB 2FD6L 1AFVL 2DYPA 3ZKSD 2SEBB 3WN5A 1OTTD 1HINH 2VXUH 3NIGF 1N2RB 1T2QL 2X7LA 1P7QA 1SNRA 2KQMA 3WXVH 3OD3A 2B59A 4HIHA 4EE2A 1GPOL 2XLLA 1U6AH 4NNYA 3BKJL 2I7SA 4X0NA 3LKSA 1UKSA 4HF5H 3L95B 2I24N 3UGEA 2GTWA 5D1ZI 3QIUD 4GPVA 2ICES 4ICXA 1YNKH 2FHCA 4MNHA 1M42A 1OCZB 1SUJA 4XH2B 1F0LA 1F4YL 1T0NA 5TFSH 4M7JH 1UUNA 1JWUA 1YEKL 2YBRA 3Q13A 1ZY9A 3ZQ9A 5F1OB 2GCYA 5DUBA 3BGFC 3BAKA 2EUVA 4XH2A 4RBPH 4X5LA 4OCSL 2ZWYA 2X4PA 4QRRB 4AYSA 3U30C 2QQLH 4QXWA 3L6FB 5DJAA 1P1ZB 4HK0A 5KANG 4BKLB 5CBEB 5K1VA 3L95A 3KR3H 4M7LT 5LUMA 1BZOA 1NDMB 5B39B 2FGZA 4NZRH 4GSUA 3V0JA 4P2RA 3J27A 5C09A 1X5JA 2IANE 2YXFA 1IILE 1KCVL 2FJFA 2WLZA 5EG6C 3EBGA 5FECA 2CJUH 5JOEA 1MRFL 3FYIB 4ZUWA 3NIGB 4LOUD 4HX1A 2D8KA 1P5VA 4Y7OC 1SLXA 3CC5A 2LHAA 4U1MB 1XH3B 3MRFB 1MH5A 4XVTH 2J55A 2V2XB 4H1LB 4JO2H 4LBEA 5AOIA 1EO5A 4WU7A 3Q6FA 4IOIB 1TCMA 1OZTG 4ZUUB 3UEZA 4APQB 4L48A 4K3DH 3QRGL 2DQHH 4KDVA 2YC1B 4J3VA 1F3JB 4WY7H 4GMSL 3W38A 1J05B 4PI0A 1I75A 2VW7A 2VMDA 2VIRB 1PFOA 2X2UA 3O2VL 4L3EA 1FC2D 3ZSTA 3QO1B 1BYOA 3BUDA 5DS8A 3HZVA 5EUOE 2Q1EA 1QSEA 4DP1X 4F7CA 4OZGF 4KXBA 3P77B 4J3UA 1UZ8A 3D39E 3QWRA 2C9RA 1SJEB 2YXWA 5DJ0B 3PJLA 3DIFA 2M83A 3LMJL 3DXAD 4Y4FC 4ZSOE 1Q0EA 1IBBA 3ARFC 2F8XC 1IC1A 2PW2B 4UAOC 4JAMB 5T1MB 5FA4A 5H4YA 4M7ZB 4HOWA 4HUUA 4OU3A 1OPGL 2APXA 3IU3B 4V1DA 4X4ME 3GFUA 2WIIA 4KK9D 3JWOH 4AIOA 4YSTA 3QK0A 2ZXEB 4XXWC 1YMME 1S5HB 4WWOA 5F9JB 4ZUSB 5KN5B 3S98A 4X0KA 2FT8A 3VGHA 3V0EA 4R97C 4HS8L 4G9FB 4NUJB 3TT3H 2ZE0A 1MLBA 4OI7A 1O7VA 4N0YH 1TCRA 4IU3A 3MRMB 1L7IL 4QHPA 1XO8A 3NFSH 1OM3H 2DQJL 2UYLB 2C5DC 2H32H 1LGVA 4H8WH 2XX0A 4PJDA 1F4WH 1LJMA 1ZT7B 4HKBB 2GJ6E 4BZ1L 5D8JH 2VISA 1CFQA 4X8GA 4ZYKB 4HHAB 4MXQC 3VSTA 4RMRA 4UU9A 1IMHC 1FVCA 4JGNA 3SYAA 2VXQA 2HT2C 1MG3C 1HHKA 1FZOB 2B0SL 5ACZA 3TNNA 3B3IA 4LKCB 4PSPA 2HJKA 1WHPA 5E8DL 5I6XB 2HKHL 3BUTA 3IDJB 1LDPL 4Z23A 3SOTA 4ODSL 5DS1A 3AZUA 3QIBD 4YDLB 2X28A 4O5LL 1Y0LB 3L54A 5ELIA 3FUDA 3CLFL 1RJYA 4R97B 1EWHA 2V9UA 1SBBA 3H0TB 3RQ3A 3L3KA 5G4MA 4HT1L 1J8KA 3QEUA 5IM7B 3IGFA 5EA0L 2WK2A 3IXAA 4WHTB 5DD5H 3GB7B 3NFPA 1T4KA 3F65A 1OAXL 3RKDD 5A1AA 2VH5H 2VLLA 2EINB 3ZE0F 4G8EA 4P9HH 1QNIA 5AVWB 5IT2L 2NX5B 3BSZL 5C07A 3ZVVA 4IRZA 3EJTA 3KDMA 4KK8D 2VR6A 2BXZA 4R4BB 3TEZA 4JCWA 1X5KA 1CBVH 1MVFA 1A5FL 5GGTH 1KUMA 4MASA 1OF0A 2CM6A 2NY7L 4PJ5D 3OKDB 1RLWA 3PP3H 5C3LD 2IH8A 5HYIA 3P4MA 4JFPA 1FDLL 1I1AD 4WWNA 4ALAH 4WGWB 1MF2H 3LKQA 4TPRL 3K72A 5HGDA 2EP6A 3MV8B 3WELA 2BS9A 5AB0A 1M1XB 1EHLH 1RFDH 3G5VA 3KPQB 1LP9A 1I3RB 5TH2A 3CLFH 3PL6B 4GRWB 4W9LC 3VFVA 1NBQA 1XMEB 1KJ3L 4AUYA 5CILH 1NUDA 1D9KA 1SY6L 5A7EA 1Q1JL 3GSVB 1A7OH 5D96B 4C8XA 1T1XA 2IQAA 4UV4L 1G7QB 2EDXA 2YZ1A 2FJHB 1KG0B 4U6YB 3QZWG 1X6NA 4L5FE 1RV6X 4RGOH 5DD5L 1KWKA 5C0CA 1BSIA 1WBXB 3TF7C 1ZGLA 1XD0A 3FJTA 3AY4A 2QJDA 3I3BA 4M6AA 1A4BA 1AGBA 2FWOB 4EAEA 1EFXA 1T0MB 3FQUA 4L3CA 2GK2A 4HDIA 2BRRH 3EJZD 4JFFB 4LVNC 4JK0D 1PX8A 3QPQC 5E5UB 3FU9A 1FVDB 2E59A 4Y9CA 1I9JH 1BQ5A 4JR9L 4Q8BA 4WI0A 4Z7VA 1R19A 4ANKA 3X11A 5KS9F 4YX2H 5E00B 3SDCA 2BFVL 1IM3D 4KUZL 3WIAA 1HCZA 3X12A 2HJLB 1NIBA 3L5HA 4Z7WE 2C3VB 1ZLWK 2KERA 1K85A 4JKWA 4EJ1C 3F64A 4JFTA 3CZFA 3GS7A 5JO5A 1C7TA 1YNTB 3FB5B 4KROC 4ZBJA 5K9JH 4W68A 1DQMH 4E9QA 3T4YB 1OCWL 2WAQA 4TQIA 1XXDC 5I74C 2ITCA 2Q2EB 5C08E 3H1ZA 5INDA 4YGVB 2Y7SA 2O93L 3QUZD 4JY5L 3TBYA 3ZIMA 3KGRA 2E6PA 2YXMA 3KLHD 1SVCP 3T6WA 3ZK0A 3S36H 4IJTA 4XMUA 1C1EH 5JLZB 3VO0A 1NINA 2B4CH 2JH2A 2F5AH 1Z9SB 4NRZB 3POHA 43CAA 2B77A 4LLVA 4HGWA 1E5AA 3DSNB 1U8QB 1K4CA 2FIRT 4LK4A 1T7XA 4WI2A 5FS5A 4XP5L 4S1SH 2D7QA 3CLWA 3W5NA 1HCFX 2DM4A 3GXTA 3IJYA 4Y4HA 3WY4A 4UT7L 5SWZE 2EXSA 5AB1A 3WFHA 4HMEA 4QKXB 2Q5BA 3JTBA 4U3XA 5B3NA 3OMZA 2GYSA 5DO2C 3X1NA 5CO1A 1YEHL 2HN7B 5FA3B 5IROC 3KYKH 2XTJE 4I85A 4OGXH 4PTUB 5DK3A 5JXAH 4JG9A 4M56A 4JRYE 3TPUA 1QBMH 4WFFE 5EF0A 5I9QC 1AR1D 4ZMXA 1JTOA 3CE1A 3MRGB 2WXPA 3K71B 1MOEA 4X5PA 4YFEA 4R5XA 1VZGA 4PW9A 1MJUL 1FNEB 2V2WB 1T1XB 3NGBC 4ODSH 4OH2A 3DSFL 3X1EA 3C5SA 2DJUA 5I1LA 1COBA 3BEVB 1AO7A 4HUCA 1HWWA 4RVBA 1SXAA 1BZEA 5A2FA 1H3XA 3F05A 3GNML 3N5AA 4N0CD 2NYKA 4G8GA 4RIRA 2ZCHL 1N70A 2ZWZA 4S10A 1CDHA 4LDLB 2WZPA 2XFXA 3GMQA 2CLZB 3TNNB 5C0GB 3K5RA 3WJMA 1SUHA 1OP4A 1I9IH 3K46A 3MV9A 4L05A 4TVPD 3UAJC 3GHPA 4QJ4B 4QWWD 3D39D 1XF5A 2AVFA 3I2CL 4IKIA 1I3UA 2G2RA 4W9JC 4EN3D 1JZ4A 3EIFA 3SYOA 5JMRA 1WO2A 3W82A 2XVLA 5I0VA 1WIOA 4G9DA 3TOPA 2HVBA 2IFGA 1PZBA 4XRCB 4JFVA 3AAZA 4HULB 5MHSE 2DKMA 4QD2E 1IEBB 1ZA3A 5GSRB 3VA6A 5E1AA 2BH0A 3OZ9L 4TTDC 1M3JA 3Q8BA 1OVZA 2NX5A 2EXWD 4K8RH 1QFOA 1DJYA 3SKUD 3F01A 1BEYH 2IADA 4ORZC 4ZAKB 4MS8C 3RFZC 1E28A 2BNQD 3FRUA 1BXVA 5KYYA 4YHYC 1F3DJ 4IMLA 5I1AB 1E4KA 3UJJL 3EYFB 5GRJL 4XNAA 1VKXA 1C08B 3IFOB 1WTGT 2NQ3A 4W81A 3DVNB 1U8NA 3BGMB 2Y24A 1AZBA 3GTNA 4AUUA 3ZRCC 1E3FA 1L6PA 2AKRB 4DEPB 3V6OA 1T5XA 2BVTA 2YD7A 4GRWF 1QUNB 5FW8A 5ISZA 5CJQL 4R7LA 2VDPL 4ZD3L 4OB5L 4LPTA 4OGQC 4WTZA 1URIA 1CYWA 2AEWA 3BH9B 3DNKA 3KYMA 5EB9A 4KDWA 1BXXA 4AIZB 4Q89A 3PGFH 2IPKB 2MQGA 5KS9A 2DL9A 1DCLA 3AREA 4Q56A 1M1SA 2G75B 3Q6FB 5I5MA 2YN5A 4Y5XA 4X7SL 1XF2B 1HNFA 4TVSa 1CLCA 2EABA 2XXCB 4Y1SA 4QLRA 1UD6A 2GSIA 4LEOB 5B3SB 5BRZB 4JY4A 2YPVH 4LSQH 4DQOL 3ECVA 4X4XA 2DI7A 3MRMA 4QY8A 3QORA 4EI6A 1R0AH 4P5TD 2G5BA 4XN2A 2ZUQB 4OCYL 3U46A 1UOKA 5I19L 4K2UL 1A9BB 3EJCA 3BDYH 3JTTB 1E4XI 3G04A 5K59F 4X9IA 2HKFH 1KWGA 2R4SH 1HXMA 3CZNA 3C9NA 1R9FA 1FFRA 3Q3GB 5T5FL 3JWNC 5A6MA 1KPUB 4WTQA 3EJYC 4R84A 3WXWL 1J5OL 4J39A 2ENYA 5JNYB 3ZTCC 3Q1SL 5H35B 3FCGA 2C8NA 2MNWA 4JAMA 5TGBA 4DTGL 3IVKB 1Y18A 1PAMA 1U91B 5ITBH 2VSMB 4QRRA 1M6UA 5DC0A 1LK3H 2Z4QB 3CXFA 3OXSB 3HBZA 3I6GA 3MRLA 3FBKA 3ETSA 1DBBL 3OL2A 1TR7A 3G6JB 1T0NB 4HGKC 4F8NA 1KTDA 4G1MA 3QC5X 1MEXL 1V3MA 1SFHA 5I8EA 5ACLA 2EIEA 1M7IB 4MYWB 3H4HA 2QEJA 1KENL 1NOAA 1NMBH 4M43H 4UZGA 4EDWH 4GKZA 1HXMB 3ZMNA 3BZ4A 4PJ8B 4QXGL 1U3HA 1A3QA 3GKWL 1ACYL 1SJXA 4AGOA 1CDJA 4Y16B 3IU4H 2WY3B 2FO8A 5D4IA 5GS2H 5J6HA 4U1IA 4G7YH 3LNEA 4DN4H 3U4KA 1F6LL 4BQ9A 2PP9A 2VUOA 2OULB 4B96A 1ZJAA 4ZQKB 3DV4A 3AQYA 4PGDB 4ATWA 1P2CB 4U2ZA 4PS4L 2VZSA 1BBDH 3NIFB 3BLBA 1QRNE 2FLMA 1HZHL 4JGUA 1S7WB 4Y16A 5HVGB 5E6IA 1EEZB 3K91A 3VG0H 4LCCA 3WE6A 2PW1B 1OGAA 1TU2B 5C09B 2E9WA 4HPHA 2VQTA 4LHUD 2C34A 4KUCF 3U7WL 4AGMA 3QEGH 4LGSB 1HEHC 2CJUL 3FTGA 4KO7A 4CRPA 2B14A 4AYGA 1XL6A 3RY5A 1M53A 4I0PB 1KYAA 5I6MA 5HHOD 4E41E 1UXWB 3NQIA 2E46A 2A0LD 2EDTA 2H3NB 4Y4KA 3SGEI 4HEME 2Q7YB 4GSDL 1MVUB 1PS3A 3LQAH 3S5LA 3V0FA 4HC1L 4F9PC 1HDMB 1WA1X 4GQPH 4M43L 4PJAE 1PY9A 4R8WH 2COQA 5E08L 2P8PA 4A7VA 1U91A 2P9RA 1BFVL 2GG1A 1KGIA 2FH8A 4NQXB 4OLYL 1AQHA 4KROD 3FTGB 2RGSA 1PY0A 2VM3A 3QNYA 5HHVH 4MJ2A 3E2HB 3RNKB 4L8CB 1I8KA 3OVUB 1LK2A 2CDFA 3EYUH 3NH7L 4R0LB 1AGFA 3BO8A 2B59B 2LU5A 1AYOA 5IWLA 2R15A 4MAZA 1YMMB 4HKZB 2A73B 5LCVA 1X5IA 4AM0B 2NW2B 3OLIA 1R46A 2R8SH 3NTCL 2BHFA 2R2HB 3MUUA 3OKNA 4W6YB 3NCYP 5FUCE 1FN4B 3JUYA 1I7TA 2GJJA 5BV7B 1KLUB 8CGTA 4LEOA 5HDQH 4H7VA 2YPKA 1ZLEA 2HTLD 2OMVA 3VXSE 4B41A 1CGTA 1WWCA 1XF5B 3V5HA 4G82A 3GXPA 4ONHA 2DYSB 2XG5A 3JWOL 4N2DA 3KBPA 4NHUA 2CKBH 2ICWI 3OB0H 4F80A 5FOJA 3T04D 1W91A 3MGTB 4MX7A 2D3JA 3O6FB 3PLYA 5GRJH 4OLUH 2G0KA 3UAJD 2RJMA 3D8MA 5D71L 5E08H 4E68A 5F9WC 1FFNB 3NFSL 1OM3L 2BHZA 1RUAL 3GSNL 2PMZA 4F20A 2WC7A 5AB2A 3UTTB 5IKCB 1AO7B 2O5ZL 1W72B 3UG4A 3QCUH 4HJTA 1QWNA 1OT4A 3OXSA 2EXTA 4Z7OE 3EO9H 4PY7A 1SF3A 1U8NB 4DW2H 3HAEB 3MYJB 3QFJB 1ZLUH 3FQYA 3HC0A 5DZLA 3VRIA 3NRPA 2VDPH 1XZWA 3Q7JA 2YWZA 3Q2CA 4MB3A 4HC1A 5L6YL 3D0AA 4ZOEA 4C54A 5AL8A 4BRVA 3VXMD 1T2XA 1IM3B 3AG3B 3Q3GA 4KITB 3T8MA 5BO1H 4GY4A 4HK3N 1SRDA 5F3BB 5FA3A 2WO4A 4AXWB 4OUOA 4ONOA 2L7EA 1AIFB 1A2YB 4MXVE 1MCRA 4ZMTA 3WFHB 4K7FB 3S3DB 3PHQB 3MROB 2OZ4A 3BWZA 1OXYA 4CNIB 1OAJA 3QHTC 3B2MA 4UT6L 3QQ9C 1R3LA 4N87A 1AD9A 2R0KH 4O9HL 3P9MA 4X6DB 4YHOH 4XN1A 5ICYB 3W0WB 4GBXB 3RIAK 1RL1A 4G9DB 5I19H 4A68A 1NLDL 4EUPB 2P80A 3QYCA 3UYOD 2FH6A 2EIDA 3C5ZA 4KH2A 3V52H 4WU5A 1WA0X 3PGCA 4ODXA 1V3JA 1X5ZA 1IEAA 1SQMA 2AAAA 3C6SB 1EO8L 2WNWA 2ZOOA 1PFCA 1WH0A 5DF0A 5JHLL 5E9NA 3DX1A 3IYLW 4FLRA 2FBJH 4EZMA 3ZT5A 1QI4A 2ODIA 4MLIA 5JLZA 1MWAL 3HC3H 3UTSA 4AG4H 4FZEH 5ESAB 1OGTA 4OZFB 2BFGA 3W39A 1WYJA 1YECH 4ANUA 2W65A 4GRWE 4UTCA 5CFHA 1MNNA 4ALAC 2X4TA 2VDMH 3NBNA 2QPDB 2E6JA 1JFHA 4G80B 4NQQA 1UJ3A 4GW5A 2XZCL 1ETZA 4YFLI 3UAAA 3FUHA 5IIEA 2CDEB 3I6LE 2F74B 3Q48A 4L2LA 4ODVH 1E9QA 2XKUA 5D5ME 3ZQWA 4P05A 4BK8A 4ALAL 1JRHH 1TJGL 1C8PA 3V0VB 4ZSOB 4P23D 1VFAB 3RGBA 2DLFH 2HJLA 3EOBA 1QPPA 1KV3A 1IAKB 3EXJA 1MAJA 3ILDA 1A6VH 4FGMA 1WAEA 3JYBA 5IVOA 2V4LA 1Q1JH 4GKLA 4GAJH 4N2OA 4JO5A 3PDOA 1PG7X 4FQXB 3MJWA 4YWGH 1CDBA 1KY6A 2FEJA 3K6IA 1NBYA 1TFPA 2PYFA 3MRCA 4YFLF 5HHMD 4Y2LA 2CBPA 3OR7B 1RK1B 3QDJA 5IEHB 3DMMC 2XYBA 2F19L 3QXDA 3JVGC 1J1XL 3MBEA 3PWLB 2NXZB 2BOBB 3QDMB 5ETUB 1U8QA 1T66C 3B56A 4UZUA 3QQNA 5SV4A 1OT2A 3ISYA 3MV9B 5FCUH 2H6PB 3HG1D 5DVMA 1NAML 4W6WB 5DUJA 3QZWB 3KWUA 1XL4A 3ULUL 4IQHA 3TH2T 4IHOB 1JPFB 2KH2B 3QXWA 1EUTA 4I77H 4TL4A 5DD1L 3EFDH 4L1DA 3RNQA 3FUIA 2HRLA 2D31B 1EZVY 5IK3A 4ODVL 1IZJA 2VRAA 1DANU 5C08B 3CCHA 3BVDB 2IMMA 3ZMRA 1JRHL 4Q58C 3QNFA 4A63A 1DVFB 4JFUA 1R17A 3QUYC 2ZPKL 4LSRL 5D1XE 1H5BA 2K9UA 4DUWA 4NERA 3ZR5A 4A39A 2WKLA 4JN1L 2X3BA 2QZQA 5DO2D 1PYWB 1B90A 3AU0A 4JO1L 4KJPC 1NIEA 2AJUH 3QXUA 5H37G 1G87A 2H1PH 1I8LC 2W60A 1DQVA 3E2HC 3RRQA 1IGFL 3VCLB 2ESVE 5I16B 4O2EA 4PQXA 5ANMA 4N25A 3VA2C 4MAYA 3D1MC 4URTB 2ZCZA 3WFCL 1S9VA 1CFNA 1JGDB 1ZV5A 4ZRGA 5EOQL 5CNHA 3ARFD 2XV2A 3N1GC 4RMVA 3LDBC 4M02A 4DHLA 2ALAA 4XP9L 1DBJH 3TZVA 3UPRA 1J8HA 2Y06L 4KY2A 1G94A 2IGFL 1B88A 3TU6A 4BFJA 4FXTA 1ORQB 3PWUA 3T3PE 1I4FA 2NY3B 2ZKHL 3H0TA 2JELL 3D30A 5JIDA 2PNDA 4UQBA 4MDJA 5MEOB 3RPBA 2W91A 5BRQA 3ZL1A 1G7QA 1JD9A 2IGTA 2ZCLL 1QR4A 2ZSWB 2FEDD 1ZLSH 2NSMA 1NCAL 2E27L 3L3HA 1MWOA 2W65B 5JQ6L 1YUHB 1CS6A 2XSKA 2ITCB 4XB7A 5MENA 1I3RA 3BZFA 5DC2A 1I7RA 5EORL 5EU6A 3L3DA 1VGEL 4F5CA 5DJ6B 1RAMA 1B2WL 3TVMC 5ID1A 1JZDC 5KVGE 3GMRA 3T2LA 3VJ6B 5CP3A 5KVEH 2B7DT 4WW2A 4FXLA 3UTTE 3MNZB 3ARDD 4WTWA 4P99A 4M6ML 1EHLL 4PG2C 5AFAA 3TIEB 3AADB 1KBGH 3WJJC 2VRQA 3QJRB 4HAKA 2ADIA 5DA0B 5GRVL 1GH7A 1KCUH 1S7QA 4XBGA 5C07B 2YAOA 3ARXA 2IANB 1IC4L 2PO6C 3VWJC 5AVXB 1J5HA 4X6BA 4L3CB 3PUCA 4WJKB 5T3XD 5J12B 4YZWA 2YEVB 1WUNT 4Y1TA 3SPGA 4KZCA 2XU9A 2BIQA 4P57A 2W60B 2FX9H 4ZSOA 4X8XA 2XXFA 4FEMA 1AD0B 2YK1H 3ATEA 5F7KC 1MCCA 3VSUA 1QTYT 2FBJL 1RJLA 1OZUA 4AQAA 2K1MA 4JHUA 3SE4C 5EO9A 3VXNA 4YC2C 4X6DE 7FABH 4EZLA 1YECL 1PPIA 1JWSA 3HLAA 4M03A 12E8L 4JMXA 2ZD0A 4JLRB 2VNCA 3KPPB 4PWFA 5H8DA 2YEZA 2X4SB 3AITA 1P7QD 3LKPB 4NKMB 5EUOB 1TEGA 3F7LA 3L5XH 2JLLA 2UXVA 2A6KB 1ZV2A 3U4AA 1MIEL 4FQLL 3ULSB 4YHPA 2VIRA 3IS1X 4ORGB 3BRFA 1YPZF 4HYTB 4IRJD 1D5MA 1SXBA 1UA6L 5E56A 3ZU8A 2NW3A 4BDVA 3MACL 3F83A 1PBYA 2VDKL 3MU3A 4MBOA 5F96H 4PJDE 3RFZB 4LHQB 2D73A 5HSFA 1VEMA 3BH4A 2GJ6A 4N20A 3T8XA 4BWUA 3QIWD 3BP6A 4EZJA 1TFHA 1JHTB 3ESVF 5LGYA 3TV8A 3NABL 5I1IL 1OSZA 1PJ9A 4ZUWB 1T0PB 4E9TA 4FQXC 1J1XH 4AV5A 2EVGA 2VLKE 3K6DA 1VEOA 1SDDA 3WKQA 4XO8A 5FLVA 3DTXA 1DSYA 2VLKD 3MJ9L 5EBMB 4GB9A 3OGCB 1MSPA 1DL7H 4QRQA 4QXUH 4XMXA 5B39A 2NXYD 3PAYA 5J1AB 4PP1D 1D7FA 2WN3A 1OP5H 1DSFL 2ED9A 4K5LA 3QBTB 3SGJA 3T3MB 1B0RB 3L4WA 2JTYA 4FQHB 2B3IA 3B9KD 2Y69B 3H9SD 4PY7B 1E4HA 4GINA 2P43B 4JDZA 4UQ2B 3X1BA 5BXFB 1TITA 3KGTA 4XB3A 3TBSB 4JCLA 5FEBA 5GJTH 4Y2OB 2OSLB 1A65A 1HH9B 4MSWB 4IJ3B 3CSYB 2XX1A 3BYTA 4QHUB 4Z0XA 3HE6D 3PWPE 2YSSA 4NGHH 4XNQB 4KX8A 2O6PA 4OD3H 1HE8A 3PWPD 4RFOH 3NSCA 3QRBA 1MZYA 2ITFA 4HCRH 5F1IB 2OMTB 1BDYA 3OKMA 3L13A 1PU0A 4DGIH 1GY1A 2BHYA 1SXCA 1P7QB 4LSVL 2LAAA 3SKJL 5KYWA 4KJYB 3TN0C 2Q76B 3LMJH 4U6VH 4MQXD 4EXPX 2DLEA 4K5PA 5ICYA 1W9XA 1BM3H 2ZX8A 1EXUB 2FHFA 5DMKB 4LQ1A 5FYJU 2ED8A 4ZXBC 3RGVC 1C7SA 1FL5B 1PZUB 4L8BB 1MFBL 4BFKA 2BINA 3QJVB 2QVIA 3K1KC 2BK8A 3BESR 3P4LA 5CINL 3QT2A 4NO5A 4YHKL 3UAEA 2NX5E 5E99H 4DJMA 4D9QD 3A3YB 2PYEA 4U7SA 4AE1A 4OIIL 3ZSSA 1QTPA 3QNYB 1U4EA 4ABVA 3W11D 2EJ1A 5LDUA 4OFVA 3MJ7B 3QHZL 2PW2A 9PCYA 1KTBA 4P04A 2JXMB 4F15B 1KTDB 4GSRA 4GOSA 4X7TA 1RURL 1HOEA 3MV7A 4KJWD 4BHUI 4OD3L 3I75A 2FT7A 2G60L 2LLNA 3L17A 4UIMA 4AGPA 3KG5A 2WTRB 4AEEA 3I02A 1PZ5A 1SHXA 1LVEA 5DQ9A 1VCAA 4TSCH 1LLAA 2X4UA 2Y23A 2PXYC 4KGLA 3CFKA 4YLBA 5EIIG 2ZNXA 2OQJB 2L8AA 1DVYA 5DRXA 5EC1B 5DQDL 4MHHI 4NYLB 4ZTEA 1JNHB 1GC1C 3P3YA 3MRPB 3ESUF 2KKQA 1CIUA 1M05B 2ITDA 4Z7VE 5K93A 5BV7L 3SE3A 3OKOA 5LO7A 1ZVYA 1FNLA 3GF8A 4YBHA 1L4IA 2G5BB 3M86A 1L0YA 3KLAA 3QIBA 4DEPC 1MCOH 1H3TA 3AG1B 3ZKMC 3VI3A 4YHKH 3T4AC 2BVQA 1KCUL 1KY7A 1V3LA 3G08A 4Y2DC 3U25A 2R2HA 2EDWA 3E8VA 2WXOA 4S1QL 1YEIH 3A4AA 4XNUL 4JHWH 1N7ML 1U8LA 4Y5XB 1XF2A 1G7PA 3K2IA 1NFKA 1ZGLM 4JFDB 3O6ML 4CGUB 5IW6A 3MLPA 4A2FA 2VC2L 3CFQA 1HESA 3H85A 1Y6KR 3BO8B 1XCXA 4MCZB 1G9NL 5TQ2H 5FO8A 1QPXA 4FNSA 3T08A 4BKTC 1I3GL 1RUQH 3NPSC 3FHAA 4X6FA 1J9RA 1SMDA 2OL3B 2BNRD 3O2WL 3IMBA 3CUPB 2QVFB 2A3TA 3IFLH 1T6BX 1CLYH 2OX5B 4XPGH 1A6WH 1IBDA 4WLCA 3CFIC 3GJFK 1CGUA 2KDGA 3TM6A 1CDYA 1ECZA 4P2QA 4H26A 5F0LB 4KKCD 4TRPL 3PL6C 5K33A 2WD0A 4RX4D 3ZHNA 3QFJE 3HI1A 4WKZB 1AHKA 5SWZA 5E8PB 2ORBL 2NY0B 3ARDC 1UA6H 5KYYB 1RFDL 4GXVL 4YO0B 3QNXA 4DGYH 3ARSA 2CAKA 3ESMA 4JPIA 4KOBA 1DJGA 1IM9B 1JGLH 4XXCC 5D1QD 4G8IA 1N6UA 1N59B 4HBQA 4WCYH 1Z0MA 1S3KH 1G7PB 4PJ6A 4YBLC 5CLYA 4XHJD 3QORB 1F90H 4AMWA 2KZKA 4FLHA 3RLSA 4QEGA 2EEDA 4N9OB 3ZPDA 1PCSA 4NWTH 5DRWB 2GSIB 1J1PH 1UM5H 2VDQL 3BP6B 3CFEB 1OTSC 4LGPB 2Y7MA 5I5JA 4CDHA 3O3DA 4FXKB 4AMXA 1HWGB 4KJYA 1KXQA 5JYMA 1BLIA 3MLZL 1FZMA 4LEBA 4PJ9A 5EFIB 1JZ3A 1P9MA 3HBPA 3IGAA 1EFXD 1XGPA 3VFWA 3WJMB 1M4KA 2QQKL 3FFCE 5F6HJ 1OGAE 4P46D 2A4EA 1YEGH 1MFCH 2ENQA 3VFPA 4LVEA 3SODB 1WEJL 4JRYD 5E8EB 3DURA 2OSLA 2HXAA 4JLRA 5SX4I 1EA9C 2EDHA 4BA0A 4PRPB 4EOWH 4RA0C 3CDFA 1X9UA 2Z4QA 4YDNA 3APDA 3GMNA 1IGJA 4JZNB 2BVPA 5I1EL 3D69A 5AWNH 2X09A 4E41B 4LPWA 1AOHA 4PJAA 1J9TA 3WS3A 1OO2A 1I7ZB 3OPZL 3V4UH 4NUGH 4PBXA 3O3EB 1S7SB 1TYJA 5E6IC 3CPUA 1P1VA 5J11B 3MOBL 4NZFA 4P49A 4PN6A 3KGSA 4OZHA 2WBKA 2FWUA 5D2NB 3FQNB 5FO8B 2WINA 3MN8A 4GUQA 3GSNA 4O2FA 1VRSA 4UWQB 5F89B 2OW7A 1G5GA 4UQ3B 3P0GB 4JB9H 1QYGH 4X4XB 5CCKH 2NY2B 2XZCH 1JXGA 5C92A 4Y19E 2GT9A 3RJOA 2GJRA 3QEQD 1RSFA 4Z18A 4MQ7A 4ZO9A 1XAUA 3T8XB 2BVEA 4NO2B 5IB1A 4Z5RB 2R23A 3OF6A 3LZQA 2GUYA 4FRWA 4JREB 3II3A 4IGBA 4H25A 5DRZA 2CO6A 1DQLH 3FCSA 4NRZA 4JPWL 3L4CA 4RQQB 2Q6WB 1DVTA 3BIKA 3KYMB 1IKFL 5ISZE 5JHLA 1KFGA 4Y4HD 3N06B 2LU7A 5D7IE 4KZEH 4RGMC 3TN0D 2YEZB 4B5ZA 3RJDA 4NNXB 2VLJD 2HFGL 5IG7A 3OM3B 4XN7A 3JWNG 4DVBB 3AU1A 1JWSB 2ZXDA 4G2AA 3PQYD 1GKOA 3SDAD 2NXYC 2C1PB 4LSTL 5IROD 3ZZQA 1CICB 2O5XH 2D3VA 2BW4A 5FGBA 3STLA 5BMFL 3MV01 4NO3A 3BCDA 2ZSVA 2AVGA 5C70A 3L3OC 1RXLA 1Z5YD 3ULUH 2BWQA 1GR7A 3EOTL 3QEQB 4ELKA 1CFVL 4N2FA 1NFDE 4FKEA 2ADJB 5AVYB 5K39B 5FO7B 1A6UH 4L4TE 4YSSA 1NLBL 4FNUA 1SOSA 3HMXA 5BUPA 1FQ9C 4OV5B 1VZIA 3RIKA 5BZWB 2IWFA 3QS2A 1XEUA 2JE8A 1CGSH 4OAWA 2D3LA 3OLEA 4IKJA 4P5KB 5C3TA 3G5WA 4LRNH 4K71B 1TQVA 4RGNE 1HYRC 1KBWA 4ZZKA 4XPBL 2ITEA 1ADWA 4XHQA 2Q87A 4OCRL 1UATA 2DF3A 4HS3B 3BT2L 4HH9B 3TYFA 1IAOA 4DN3H 5IBLD 1DLFH 1ZEAH 2JKLA 2PWFA 5E70A 5C09D 3V6FA 2HAZA 3MGAA 3D3VE 3KDPB 1EHNA 3UBHA 3OWRA 1CLYL 3WIFB 3AJ7A 4D0BB 2NX5D 4UT9A 4PRIB 2NY1D 1W16A 2E7BA 3D2TA 3ERXA 4H40A 1MHHB 5INDB 1DVUA 4WHCA 4TRPH 2X12A 3PL6A 3SGKA 3VACA 3MLSH 2ZAGA 1P7KA 2DIJA 5TK2A 2X6VA 2V9RA 2VAAA 3DX6A 5DHVH 3DROB 1PX3A 2NY4D 4JFED 1I7UB 1HZLA 3QDAA 5FXCH 5GS1B 1ORQA 4U3SB 5EZOH 3G6JE 4J12A 3D34A 2RD0A 4LSUL 4TUJA 4WO4A 5DZOA 3ZYOA 1FFOB 2BP8B 3C60C 1ZLSL 2NT0A 2EE6A 2JJVA 1AP2B 5ADPL 4XN8A 1E4JA 1C8QA 1TSHA 3ALPA 3M8OL 5CCJA 4HUKB 3PDOB 4QTHB 1OW0C 2W59A 3VTAA 2GFBA 3SGDI 3QZLA 3GT6A 4I3SH 5EZIL 3TIEA 3UERA 4CKVX 5ISZD 3KCPA 2DOCA 1S9VB 1KPRB 1J1OH 4AY0A 1RERA 4LGRB 4QJ3B 2K7QA 3CFTA 5DJDB 1B2WH 3VE0A 4PD4K 3BHBA 5IVXB 1DE4B 4ZFZB 4NQEE 2BOLA 1YMHA 4HHWA 1RJZB 3WTYA 4PJ9C 2BSDA 3PRZA 4LBAA 2WWKO 3VQMA 3EHBB 2FDBP 1XSOA 3RE0A 7PCYA 3LH9A 3MNWB 4CA4A 4OCXL 2MHAB 3CZSA 1GOFA 2CDGA 5KG9A 2VDLB 1NGPL 1OB0A 2AXFB 2Y36H 1G9ML 1VLXA 4DGVL 3AS0A 1E8YA 2KHAA 2LLLA 5JIKA 3GC3A 5C08A 1IVLA 1BCIA 4NNXA 1HHIA 4DPRA 2GITA 4X2UA 1KXVC 4M1GH 5I1EH 3ZR6A 3VH8B 4G71B 3G5VB 4WI9A 1JGVL 4PUBH 3JWNE 4N0FA 3ZDYE 3BE1H 5HPOA 4PV1C 1YNTA 5E8OB 2YK1L 2ZX9A 3CH8A 1UFGA 4O4YL 2CO6B 3HA0A 4AKPA 3VMPA 3E80A 4DTGH 2A77L 2FUTA 2G4GA 5LBSH 1WC7A 4NO2A 1S7XB 4MMZB 4PJDB 4ZUVB 2V6HA 5DJDA 2D3NA 3N1PC 4XNZC 3RZCC 1SHMA 3S4SG 4W9KC 4AH2A 4X7FC 2NY5L 3ABGA 4JZJC 2ESVA 5D1ZA 3ES6A 3NCCB 5BJTB 4HBCH 1ZHBB 4P3DA 4ZJ9A 1ZJBA 3GSNB 2C7UB 2H2PD 3CFDB 4D0CA 1AP2A 1XGRA 2CCWA 1TZOA 2ZP9A 3RGHA 1TG8A 4PTTB 3GB7A 3MNMA 3NFPB 3X13A 5K9KA 3MACH 4RFNC 2PWDA 5CZRA 3KBFA 2CMRL 5EUKB 2UXGA 3TS8A 5KYUA 4APQD 4UNTA 1OP5K 2R1YA 6PAZA 3B2VL 3O0LA 4Y9GA 3QHFL 5IBUG 5T5FA 1I9RL 1AKPA 4K15A 5IB3B 5K9QG 4LFHD 5EC2B 3E0GA 3HAEA 3LVEA 3MYJA 3QFJA 4Z7QF 5AW5B 5I74B 3RVWD 1HL5A 5LXVA 4YDKL 4JFZH 2QR0B 4D0DB 3AU1B 1MI5A 2BLFA 1OAYL 1CFTB 1X7QB 4LMQI 4WGVB 5DJ0A 1ZMYA 3ROLB 4Q9QH 2H41A 3FO9A 1TQCB 3KWVA 5E2TL 1E4XL 1I1YB 1NCWL 2YD2A 3IDJA 3O9WB 2WO3B 3E1F1 4Q0XL 1W0WB 1JPSL 3NCBB 4WENB 4HWBH 5EBLB 3V6FB 3O41A 2Y9RT 4WWPA 1HHKB 4PYGA 2Y06H 3A6BL 3IGAB 4RH4A 1BPLB 4G6AD 1FPTL 4FEIA 2DBJA 4LOUC 4F7EA 4JFHE 4DP2X 3PGCB 2J6EH 2VISB 4AJVA 3BUQA 1VZHA 4J3OC 1BXUA 1KIRB 4FQIH 4M5TA 3PWLA 1J9QA 3H3BC 4JFEB 3FH5A 4HCFA 4LSDA 5LGJA 3FAWA 3HZMA 3VG9C 1DFBL 2PYFB 1O9ZA 2J8UB 4KTEH 4NJAL 5E1GA 3VFGH 4X9YA 5FO7A 4LASH 2CM5A 4G8EB 2NY5C 4X6CF 2X4OA 1A2YA 1E5YA 2L04A 3QHFH 4LNVA 5CKGA 2QFPA 3TC9A 4KNTA 4HIJB 3OWEA 4BZ1H 4JHAL 1IAKA 4WJ5A 2Z0UA 3DO7B 5IP4A 3EJUA 1BQSA 2AW2A 1TJXA 3DC0A 3D85B 3LIZA 4QOKB 1QFWM 3VWKC 4FI6A 4LPUA 2C7FA 5EU7E 2N0KA 3CSTA 4DUXA 4LEXL 5MHSD 5D5MA 2RIKA 3S36L 2ZX6A 2FEEI 3MTXA 4NN5C 3EDKA 1AKJA 4N2CA 2ISDA 1JWUB 3DJSA 5DHYA 5DTFA 2X4TB 5HHPA 2CCLA 4TNWF 4N3TA 2B1HH 5DJCA 1PNCA 5E8EA 2WGNB 3VD4A 4K5NA 3BN9D 1ZLVH 1FUNA 4I0PA 2A9DA 4CC1A 2JI2A 4OZHE 1DEEB 4KRPC 2X6BA 4ZS7H 4PCSA 2A9NH 1JZ6A 5EEWA 4ANVA 5K1NA 1CT8A 3WNLA 2XBTA 1WG3A 4XC3H 3WTWA 3S36X 4Q6KA 3OSKA 5AALA 2D7TH 1UGNA 1N2RA 4OZGA 4PV8B 4AUJA 1V7MH 1JSYA 4LLAA 2QVTA 3CZEA 4HWZA 3EFFA 2AJSL 5GGSB 1IC0A 2H1XA 4AM0Q 4NB7A 5CEZD 2YOCA 3FB7A 1KPVA 3H3PH 2OTWA 1EUUA 4B3VA 1YEHH 4U1JB 1A3RH 3A5VA 5E4IA 2WAHA 3KE0A 3O8XA 4OCWL 1FLTX 1L9PA 4Y1AD 4ZDHB 3S5YA 4AM0A 5FECB 3QUZA 2LTQB 5IY5B 5C9KA 5A3IC 2A4CA 5D7IA 3VGAB 2XTSA 4FC3E 2R29A 3D0LA 4Y19D 3SJVD 4N2IA 2IWGA 3MDJA 1KBPA 4HZAA 2ZWNA 1ACZA 5EEZA 1UCBL 3MCKA 2DQ6A 4L4TD 3AXLA 4QHNB 4GRLA 4ZT1A 3GSUB 3DJTA 5JHDE 3NCJL 3VFOA 2ZCHH 3RUGE 5KYXA 3P1VA 4AYID 2WBWB 2EIKB 3QI9C 2BY2A 4FTDA 1KLGB 2A9NL 4YPJA 3EJSA 3G9VA 5GRUH 4NNPL 1BFSA 2VUKA 4XGZA 2IALB 3QCTH 4BWTA 5LKNA 4BWWA 5FFGA 4GKOA 3QJZA 1BD2E 3F6JA 3IK2A 3MCKB 4QHNA 3FO1A 1H0DB 1HU8A 3CD4A 3S3CB 4HIPA 3Q44A 1F4XH 3MGTA 2F7OA 3SY6A 1NBVH 1MQKL 4YFDB 1K8DA 1P4LB 4DEUA 5I1HH 4APXA 2ZAHA 3HAEH 5AW4B 1OM9A 3PXLA 1ZOXA 3AB0C 3MLRH 4OJYA 3EYSL 2J8UE 2EO1A 2Q86A 3H9SE 2YPLD 1GY2A 3ETBJ 4H1LA 4HIEB 3D2UB 1HNGA 4U3HA 4Z78A 2ARJA 1MCJA 2O26U 3TO4A 1MELA 4KVCL 2P26A 3O3BA 4Z78B 4LSSL 3LN5B 1RVFH 2BX5A 2CK0H 5C1MB 4Z7WF 4IMKC 5KW9H 2YOAA 1PNDA 5DMGC 3FT2A 4ODTL 4HKZA 1AGDA 2B20A 4PU2A 4ZTOH 3ARWA 4L4JA 3ULVH 3VFNA 2RA1A 4YO0A 1A1NA 4HA1A 5D7SL 5HI5C 3VD1A 4PGEB 4PCKA 5E9DA 5MENE 3TIDA 1RI8A 3CQQA 4Z7UE 5CSGA 2AJ3A 5AOLA 3N42B 1IE5A 2QFRA 5J0BA 1MW2A 4H26B 1AS8A 1HDMA 3MLWH 3WD5H 4WK2B 3I75B 4HZ1A 1G0YR 1ZHLA 3BD4A 4JY5H 4CL7A 5D7HA 5BXFA 2ED7A 3BGMA 1NCWH 3GMPB 3DWTA 5CCGE 4MNHB 3VFOB 4E9YA 1RIHL 5TGBB 3IVKA 1UT2A 1DDHB 3AXHA 4Q0XH 3ZTDC 2K45A 1PIFA 1PLGL 1FPTH 2CBMA 4I18A 2VDLL 4I77L 5CINH 3RZCB 3QZBA 5DD1H 3WSQL 3BJLA 3QJTB 4KVCH 4X6CA 1ASOA 2EH8L 3QEHB 3ECUA 3ZE1E 4BFIB 5HHOE 2YSTA 1DVQA 1PZSA 5IMOB 4ZDHA 2CJTA 4GXUN 1FL5A 4W9EC 1TVBB 3N9GH 5DR5L 4J4PD 5AUMA 3GJEB 1KB3A 2N7BA 1I8MA 2LQRA 4PMFA 1XH2A 4CC0A 3VI4F 3CDGB 4AIEA 1DBML 1HQRA 2DQIL 3QRFM 2VN6A 2ZG1A 2F18A 4LASL 1MFEL 2VXQL 2X4RA 3U6RA 1W6LA 1FFPB 3BVNA 2WANA 1QVOA 3I85A 3GXMA 1BPVA 4F57L 2PXYA 3C2SA 4LIQE 4U05A 3VFSA 1I8IA 1A4KA 2MEJB 3VGDA 6TAAA 4JBSA 2NQDA 4I0CC 2CUAA 1HT6A 3B5HA 4MAYD 4NQCB 5C0GA 4ZW5A 4JG1H 1S7UB 4QXTB 4Z0XB 1AACA 4WV1A 1HAWA 5ISZB 1NWOA 2VC2B 5FFLA 1Z5HA 1DBJL 1MUJA 4OY9A 3N85L 4A2EA 5HHPB 3FAXA 1O6SA 3BRDA 1E6OH 1MJ7H 3LRSB 2XWEA 1YNKL 3MV11 3ZZLA 2R9HC 3ARRA 1UH3A 2WLYA 1HZKA 5DGRA 4DCQA 2AXHA 1U8HB 2ZJSH 4XAWL 4TUKH 5HYEA 4F2FA 3VXNB 1G7IA 3AWGA 4GRWH 3A67H 4F3FA 4EKJA 3MJ7A 1YEIL 4XNUH 4LLDB 4P5TA 3C5ZC 2EYSA 2YS4A 4EI5C 5CGTA 4GQZA 1WAAA 3SHSA 3X13B 4JO8A 2BIMA 2GB2A 1DQJB 2DQTH 2VQ4A 5TD4A 3MJGX 4KJWC 3H3PL 2R2BA 1O6TA 2R0WL 3SO3B 2Z35A 3TLRA 3ULVF 5C0EA 2FZ3A 5MEND 3KXFA 5AW1B 3ARZA 1YLBB 5EU6D 2XQYG 2BSEA 4RGND 4IDJH 4WWID 1AQDA 5D1ZC 3ULVC 3ZDZE 1E4WL 4DK3A 1EHXA 3B1UA 3EADA 1EVTC 1XXFC 2APVA 1J8SA 4HGMA 43C9B 4IBWA 4EXKA 4JE0A 1Z9SA 5T1LB 5J12C 1CLOH 2LR4A 3N44F 2JNZA 1T7WA 2XFXB 3BZFB 2XWBB 3ZKMD 3ETTA 3L3OB 2ZOKB 4R8WL 4GBXC 3FFCA 4ZO7A 4ZK8A 5CMAA 4L1HA 1MHCA 2QADD 1YC7A 3L3HB 4MJ5B 5F1NA 4HLEA 1X9LA 1XEDA 4M5ZL 4XPHH 4OZIF 2XZQH 4XMWA 2AMGA 1J48A 3KZ8A 5G4OA 3S8GB 4D9RE 4QT5B 3V95A 3ZTJG 1RZ7H 4AQAB 3T3PF 3V4PH 5TJWK 2X87A 2GJZB 3RWFB 3QGVA 2C3XA 4FCAA 1N19A 5JW5B 4X5WA 1QKZH 1VAHA 4Z0BL 1B3IA 2ZOWA 1P7BA 2V3FA 4WI3A 3SZKC 1JVLA 1YEWA 2JIXD 4I2XE 3PJNA 3ZHFA 3LN9A 2IIJA 3TCXA 3TFKD 4Y5YA 2J12B 3EH5B 1MRCL 3BW9A 1SPDA 4P2OB 5FDWB 5IEKB 2HRPL 2HFTA 4QMEA 4D8PB 4KAQH 1LXMA 4OFIA 4CN4A 3HRZA 1WA2X 4E9VA 5D70L 1LILA 5FUOH 3ILPA 1SFDA 1SJVA 3BUYA 1FCGA 2YFNA 4W4NA 5IJBC 2HKFL 1HHGB 1MQ8A 4XAKD 3MKGA 2H26A 4NCC2 3TJEL 5T3ZD 4WO4C 4MDRA 3F7PC 1ZGLB 5C7XL 3DV6A 1S9KC 1QLFA 3CV5A 4KV5F 1MHEA 1RUMH 1FVEB 1INDL 1D5IL 3HZKA 4GSXA 4NLAA 3ULUF 2ZICA 1LK3L 5C97A 1SVZA 4CBZA 1KZQA 1CL7H 4JW3A 1RZ7L 1TZ8A 4HV8B 1DBBH 1JF6A 3BAWA 4FMKA 1M56B 4NSKA 25C8H 3WMPA 5LHDA 5JOFB 4OSUH 1MCNA 2OS7A 3IRCA 1BFOB 3GTVA 4L18A 3U79A 1XIWA 2IDUA 2PPAA 2OXHB 2XBDA 5FHAH 2H2PC 4P07A 4GFXA 2PLTA 3MRKA 2AABL 4MS8D 3GMMB 1CGVA 3KHOA 4CADB 4R9HA 4K3EL 3MA7A 3B9KA 4JL1A 2F2HA 1NCOA 4OT1H 4P57B 3FT3A 2I69A 1A3LH 1DE4A 4DP0X 2AJXL 5E00A 3SDCB 4P9HC 2IBZX 2WBJC 3QIWC 1GYVA 2OI9B 1EAQA 4QF1A 2IDFA 3L7FB 5KBDA 3AVEA 3UAJA 3CMOL 1NLDH 4PJBB 2MPAH 1Q0YH 1MLCB 1OAQL 1FVDA 4KKBC 4LE8A 4NAQA 3MHZA 2W5PA 3FU0A 4UAOB 5CD3B 3IJSB 5D1QB 2QTEA 4NKDA 4XNXH 3SPVA 1FYHB 2BIIA 1D5ZB 4QPEA 3FT3B 4XPTH 2CRMA 5E03A 2XJLA 1KELL 2DQUH 1K5NB 2E8ZA 4KROB 5CP7B 3THMH 4JO3L 3VJ6A 2J1XA 3NCEB 1JZFA 1WTLA 2GBAA 1CICA 2CDEA 2MQ3A 1CTMA 5HYJD 4WV1C 2KQNA 2WSPA 4QO1A 1RKRA 1K72A 1ROCA 2VAAB 3DX6B 3LN4A 3NP4A 1Q9OB 2BC4B 4F37K 1L9TA 2GEEA 5FHAL 4WHYH 1W8NA 3ARQA 4GSDH 5IK3B 2YZ8A 4J3OH 4ACTA 4URKA 3W39B 3RTQD 4ERSH 2R9HD 4BUGA 3D25A 3LZNA 2YLKA 3RPKA 4LVNB 3GXDA 3OMIB 4OFYD 1EJ8A 4KK5C 4WW1B 4U0RC 4IEFA 4UNVA 1TQBC 2WLLA 3CZFB 4ZZFA 2AJVH 4EEEA 1QBAA 1WQVT 5DRZB 4ACPA 3C6SA 1JD7A 4P3CH 5DJ2A 5GGRY 2WM0A 4DESA 2FEEL 5F97E 1J12A 2WKOF 2DQTL 3RIFK 3MV7D 5LCVL 1J8HB 2PTTB 5F3FA 3ZDXF 3P73A 4TULH 4BINA 4KDTC 2GT9B 2ZG2A 1CK0H 5HDQL 3KM1A 2ILLA 5D6CA 1J9CT 1XGTA 3W9DA 4IDJL 2AK4E 2A9ML 2MWCA 4UOJA 1T0MA 5JW4R 1QWUA 3BZ5A 2VLRB 3NESA 3RAJH 2VITA 4WHDA 5KAQF 4DK6A 4OGYL 2VXTH 3WS3B 4M93B 1YSOA 2OMZB 5D71H 3IF1A 4JZNA 2VM4A 5GPRA 2PF6A 2EADA 5I66A 3AT8A 3DYOA 2AQSA 4LOFA 4P4RB 1QQDB 1WCQA 4JM2A 4G6KL 2JSFA 3B8YA 3CHQA 4W9GC 5E5MA 3LPFA 4DP4X 4QRPD 2XV0A 4DW2L 2R0ZH 2VN3A 2HLAB 5ESAA 5EU4B 1UT1A 2G5RA 3U7AA 1BIIB 3AWEA 3WNNA 1T1WA 2NPLX 4I4WB 3U9WA 3V4PL 3MV8A 1WCBA 2FNBA 4KY1H 2IVFC 4H8HA 1YYLL 4MDIA 3WLWC 1EZLA 3HZYA 3SDAC 3L9RA 3O2WH 3NYKA 3P4MB 4J8RA 3EGDA 4IGBB 1R24B 4RDBA 4Y88A 1QVOB 1TLMA 2IGLA 4IOIA 3NZHH 3K80A 3A4FA 3VI4B 3MBEB 3HG1A 1JK8A 2OSXA 3WHXB 1GZQB 2VLRD 3K6SA 1BGXL 2K7PA 3KHQA 4JCMA 3VRJB 3RP1A 2ID5A 4XMLL 1CTNA 3HB3D 3KEDA 2WP3T 3GLZA 4NLHA 3KXFB 2B1OA 5CHNA 2XDHA 4NI3A 3CHOA 5GGVL 1M2VA 4G43A 3TURA 1WZKA 3LRGA 5I1CH 1CFSB 4HPOH 5FUOL 3BQUA 3CVDA 3TNMA 1GGCL 4W1TA 2BSSB 2XZZA 5FKAB 4W70A 3FO0H 2GBTA 5KTEH 1WFNA 2CBOA 4B9GA 2DMKA 1CFBA 4L9DA 5AZUA 2Y1ZA 4R6UA 2G9KA 3CX5K 3O4LA 1XR9A 4PJFB 4PJEE 1R5WB 3EJQA 4HH8A 1ETZB 5ILTH 1CL7L 3L1FA 3LKNA 3RUGB 3GXNA 3TFKC 3MUY1 2R29H 1PVHA 1SN2A 1A4JB 2NY5H 5EZLB 3T0EB 1WV7T 3RTQB 1ESOA 3LKOA 3P77A 3V7MA 4Z77B 2D7OA 3CUPA 3F2LA 4QYOB 3FQRA 2GTWB 4PI2A 3D4CA 4PRID 4HJJL 4PJ9D 3VD3A 3LEVH 1ODAA 1BM7A 4JG5A 4JDTH 1RZFL 4JFQA 4NNYB 4OCNC 4W4OC 1I8IB 2HMIC 3UYPB 1BREA 1QWHA 1AGDB 4DO6A 3KPRA 5BO0D 4HLZG 1J9SA 1S7WA 3QQ3B 3ZO9A 4FABL 5DFTA 3FQWB 3Q8FA 3BVNB 3O3DB 2OMVB 3BSGA 4XPAL 2OXGA 3FDWA 4GAJL 3H9SB 3VTMA 1K4DA 1EQWA 1HX0A 4ZMYA 2QQLL 2ATPA 4OF8A 2UY7A 3PHQA 1IE4A 4S1RH 5IMOA 2CLRA 3A23A 2VLJB 3UBFA 3V4UL 3O3AB 4OVVA 4FKHA 6FABH 2XT1B 2AEPH 1S5HA 5F9JA 1DANT 5DSCA 1UZ6E 2FO4A 3DMMB 1K8DB 5ERWA 4L3EE 1BYPA 1LP9F 5MP6H 3VSQA 4EF3A 3FQ2A 1MFVA 5A6LA 1DLHA 1NICA 3KPSE 2NZ9C 2J5LB 4ZO8A 2DH3A 1AXSB 1E6JL 4G6JL 5I1GL 3HC0B 2V2TB 2WPGA 1GHFL 1KJMB 3H9ZA 3HAEG 3L5XL 3QIBC 2AV1B 3H2WA 3G6JA 4RGNB 1JDAA 3W0WD 4NQED 4LF3A 1A7RL 1B4JL 1IAIH 1W72A 1TT6A 1CD1B 5KW9L 4FFYL 4ERSL 5KYXB 3GSXB 5IFJB 4XVJL 4XMPH 1DN0B 4BFFA 2L3BA 3O11B 3K6FA 3WEAA 4V1DE 3SQOH 2OL3A 3WMQA 4JPWH 1TQSA 3AG4B 3BX7C 3VFGL 2O4EA 4QTIL 3T09A 4NXSA 3SDYL 2I07B 1ZTMA 3VH8G 3P3TA 4M3JA 1AAJA 4MCZA 5F1SA 1OGAB 2P48B 3PS6A 2AJUL 1UB5B 2DL2A 2O72A 4UTAA 3ULAB 4NPYA 1AS6A 2ZYIA 2NT1A 3MODH 1QI3A 5E2VL 4JFDA 2BWDA 3TT1H 2VLJA 3AACA 4MJHA 5EDSA 3L9EA 4L8BA 4ES9A 3S88L 1HNYA 1ET7A 4G42A 1CK0L 2D9QB 2ZF8A 2NYYC 3WNKA 2JQMA 4QKTA 4UNUA 1GIGL 4C47A 2Q76A 3SBWA 2G75A 4ODWA 3RVTC 1PLGH 1UCTA 3D5OF 3LH2H 3LD8B 2YGOA 3OKOB 4KUCD 3HMWL 2H9GB 1KEMH 4CDGC 1TO5A 1T6WA 1TQTA 4WW2F 3M17A 3NZ8B 4P8QA 4QCIB 4YL9A 1CFVH 5CBAA 1DQDL 4P5SA 4ZW8A 1FFQA 3GGWB 1EMTL 3TTYA 3KPNB 3P2DA 5DVPA 5T5FH 1RULL 2D7TL 4NQXA 3L6FA 1MIML 5E9AA 1S78D 3LKOB 3PIQB 4XCFL 1T5XB 1I3VA 1DBMH 3LHPH 3SOBL 3MUJA 2GJ6D 2K6WA 4DUVA 5ITBL 3P3SA 1A7PH 2VMCA 4JGMA 3RUGA 5JQ6H 2Z3FA 1CBJA 4YHNA 1AJ7L 5JHDB 2V2TA 2F0CA 4KX9A 4K7PX 2OR7A 3EYFA 1E0OB 2MMXA 5E23A 3ZKNC 1K2DA 5J56B 1DLFL 4E5XA 1T7ZA 2CZNA 3ML8A 5C0BE 1ZPLA 5D7IB 3PHOB 2GW5A 2YD3A 1PZAA 3JTTA 1CGWA 3LXCA 1GZPB 4NO5B 3ZQXA 4OFDA 1NEPA 5J57B 5LBSA 3QIUC 2J57A 1E6OL 5DZJA 1X5HA 4O5LH 2SEBA 5HDBB 4JFFD 3B8SA 3OJDA 1X7SA 2F7QA 1BMGA 1QRNB 3JZYA 2H1LM 5ID0B 4P4KC 3H9SA 4LL4A 3SPCA 1WWWX 3VWJA 2V5SA 3NEOA 4JFEA 3WN6A 1AGCB 2CO1A 3GUTB 3FQWA 4WWKB 3RBGA 4PS4H 5HI4C 4EI5A 5I6PA 1F18A 1KXQE 3TCLB 1GGBL 1Q9KA 3EG9B 3QNZB 1KJVA 1A47A 2JI1A 2JCCA 2CLZA 5FX3A 5DXWA 2ENSA 1F58L 1MCDA 2HLAA 1OPOA 2OMUA 2V9QA 2ZX7A 3HNTH 3QWOA 5EU4A 4TVPH 5J6SA 4D9QE 4ETQA 4MQXC 1S7VA 2JJWA 1EDHA 1NKOA 4YMPA 2ZOUA 3QZPA 3ESNA 5CUSL 1MI5B 2GIXA 2G3ZA 2OL3L 4LP4A 1CXEA 4FG0A 5IB3A 2WLMA 2K6ZA 3D2UD 3T2PA 2N56A 1AQKH 4PJ5B 4X8JA 5HJDA 1D6EB 1CXKA 1G9MH 4ZTOL 4J1UB 4WJ5B 3FT9A 1ZT1B 2ZX5A 3PQYB 5F96L 3RY6C 4CW1A 5G55A 4AW4A 1QSEE 5ESVB 2P3YA 1GYUA 4KH9A 5C08D 4JHWL 4DKFH 4AVJA 2X89D 5GRXG 2WVSA 4XBGB 4OJAA 15C8L 2HH0H 5A2IH 3T77B 1X6LA 4KKAC 3W37A 1WISA 4PY8I 4ZW7A 2HJFB 1FRGH 1SBSL 4NRXB 1ZA3B 4Q6YA 4QAWA 1J87A 4G5ZH 3TVMD 2A38A 1LEGA 4LOVA 5DHVA 1DZ0A 1CD8A 3HG1B 3QZMA 1FBIH 1HKFA 2B5IB 4R90H 2C3GA 3ZBMA 1G4MA 1K4CB 4PBDA 5CSZA 3UJIH 3TZVC 3M1OA 3B2UC 3RB5A 4U0RB 3EKCA 4BSWB 4E0RB 5DUPL 4K0OA 5GS3A 5AB9A 4S0HA 5EBLA 4OKDA 1E65A 2A6KA 4G6JH 2NCMA 4EBQH 4HISA 5DVKA 3RZCD 2JJSC 3KL0A 3ARPA 4N26A 5FPIA 1MREL 3IGUA 3W9EB 2WXIA 4K71C 4Z3TA 4XWOD 4TOYH 1JVOA 1A7RH 1B4JH 4WEBH 4FQQA 4UTAH 4LLUA 1OEZW 4YZFE 5E7FA 4PJGA 1T22B 5DZPA 1BOGB 2V2WA 1FNEA 3S37H 3VXOA 1SN5A 4NWUH 1WE5A 3W3BA 1NMAH 1AE6L 4YBLB 4X7DC 3VGAC 2X4QA 4P2OC 1IBYA 5DK2A 1PD0A 1VCBC 1N12A 3QPXL 4PRNA 4RGMB 1ANUA 1Q94A 5HJ3A 2XQBH 4X98A 5MEPA 2WYHA 1W72H 2NNCA 3PWVB 1GS7A 1EDQA 2DW5A 2ZYSA 3T5WA 4UDUB 5HYSB 4FP8L 1OARL 1VGKA 1FV1B 1OCRB 1H6EA 1OAYH 3QI9B 1D5ZA 1NC4B 4CVXB 1TQWA 3TZVB 1VJSA 4DF9A 3TN0B 4MA1C 4PJBE 3ZZ1A 3DX2A 4XR8C 1MLCA 1QASA 3PWJA 1PW3A 3WKNA 3MGOA 1R1CA 3NOIA 4X99A 3V0HA 3WYRA 3GEWB 2OCJA 5ICUA 3FTZA 3U4BL 3CIQA 1GZHC 3BRGC 2PO6D 2DD8L