4E9TA

Multicopper oxidase cueo (data6)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 139
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA03
1NPNA 1OV8A 1AS6A 2QPEB 4KOCA 3EH5B 4GY4A 1AAJA 5EHFA 1V10A 2Y69B 4G71B 3WKQA 2YAEA 2IWKA 3FSWA 2BZ7A 3IEAA 3WNIA 2VMJA 3UABA 2FT7A 1AZRA 1NZRA 3V9EA 3ZIYA 5I6KA 5F7BA 2BP0B 2CBPA 2DWSA 2QPDB 3S3CB 4AZUA 4L0PB 5B1AB 2FWLB 4YVNA 4G7RB 1ASPA 8PAZA 1GYCA 3IN0A 1GS6X 4AX3A 1WAEA 1NIAA 4PCYA 3FSAA 3QJUB 3FU7B 2RACA 4G7SB 1I53A 5B7MA 1ADWA 4F7KA 2FTAA 4P5SA 1E5ZA 2HRHA 3IBOA 3C75A 2DWTA 6PAZA 2J56A 3GXUB 4HHWA 2FJSA 4BDVB 1JOIA 4YSAA 1AZNA 3AW5A 1KBVA 5I5MA 3X2QB 7PCYA 1N70A 1W6WA 1E5YA 1L9QA 4DPCX 1FA4A 1WA0X 2XX0A 2PPCA 2BZCA 3SQRA 5I6LA 1ILUA 1BXVA 3H4FA 2HRGA 4N8UA 1IKOP 2AVFA 2XV2A 3PAUA 3EHBB 4YSSA 1AZCA 2YXVA 1KCWA 3FSVA 4N4YB 2AZUA 5AKRA 1A8ZA 4TXVB 1URIA 4BXSV 4YSCA 1R1CA 4HCFA 1WS7A 4DP4X 2IH8A 3NSDA 2R7EA 4GXFA 2YQBA 4DP1X 4QLWA 1E30A 2IH9A 5AZUA 1SHXA 2IDQA 1TU2A 3NSYA 4HIPA 1GW0A 2CAKA 2WO3B 1AZBA 3JT2A 5B1JA 2AANA 3FU9A 3QJSB 4FA7B 2BO0A 3OMNB 5I6NA 2PCFA 1ASQA 1J5DA 1DYZA 4DP9X 4E9VA 1FFTB 4A2FA 1AOZA 2BHFA 4DPAX 2VN3A 1T5KA 2HX9A 2CJ3A 4HCGA 2J57A 1BYPA 5PAZA 4YSDA 1NDTA 4DP6X 4ZK8A 3X1GA 2HZHA 3PLYA 4E9SA 3NJJA 2N0MA 1CURA 3AG3B 5I5JA 2YAOA 1BXAA 1PZBA 4BXVA 1ET8A 4UAHA 3CZUB 1JZIA 2BP8A 3T6ZA 3QJTB 1CUOA 3NJHA 3UACA 2VSKB 4YSUA 2AFNA 2GC4C 3ZX1A 4ENZA 1KV7A 3QPKA 3T6XA 1OCOB 2X87A 4BWTA 1TEFA 9PCYA 2PLTA 3NP4A 3ZBMA 2BWDA 1IUZA 4GP8B 2W88A 3H56A 1IC0A 1PLAA 2FQGA 2JXMA 5B7EA 2EILB 2XUWA 2UXGA 2TSAA 2DYRB 3AG2B 3T6VA 2VSMB 1AR1B 2OJ1A 1NINA 5IY5B 5I28A 2JKWA 1W6LA 3WNJA 2Y1AA 4UF7C 2H5UA 2H3XC 2EIJB 4W9ZA 2DY2A 3PXLA 2PP8A 1SJMA 2IDTA 2XLLA 1W8EA 4HHGA 1GSKA 2E86A 3MBWB 1MZZA 3V9CA 3WI9A 1BQKA 3FQ1A 1JXGA 2XXGA 4YSTA 1GS8A 3AZUA 3WIAA 1PMYA 2EINB 3NJKA 1EHKB 3X1EA 1J9QA 4A2GA 3CDZB 4BWWA 2VW7A 1PZCA 4QKTA 1A4BA 2UXFA 1SDDA 2X88A 1AS8A 2MTAA 1JVOA 1OE3A 1SFDA 1V55B 4K9JA 4KO9A 3NJFA 4X4KA 3NJIA 1MDAA 3NT0A 1EZLA 1RZQA 2WO2B 3TU6A 5I6PA 5I26A 3QJRB 1L9RA 5D4HA 4YSEA 2I85A 4A66A 5PCYA 4HZ1A 4CSZA 3ASOB 1NWOA 5B3SB 4E9WA 3IN2A 2XXFA 1ZPUA 3OD3A 3CG8A 2FNWA 3S3BB 2YARA 5D4IA 5FC9A 1KCBA 3EF4A 1FWXA 4GP5B 1JZJA 3NJMA 2ZWNA 1IBZA 2BW5A 1QLEB 4M3HA 1ZDQA 2FT8A 1TKWA 3BVDB 3CVBA 2OV0A 1PY0A 3HB3B 3DIVA 1BYOA 1HFUA 1JERA 1AIZA 3AY2A 2VM4A 3X1BA 4JHUA 1XB3A 1NIDA 4RH4A 1JVLA 5B1KA 1HAWA 1RCYA 5TK4A 4NERA 3ASNB 1ETJA 2GC7C 3CVDA 4DP0X 4A2HA 4G70B 4YSQA 3L45A 2HX8A 5I6MA 1PLBA 2XV0A 4KO6A 1ID2A 3ABLB 3EH4B 1V54B 4M4RB 5B7FA 2IWFA 3DTUB 5AFAA 1MG2C 2B3IA 1ZIAA 2FQEA 3NJNA 3ABMB 2BP8B 3ZDWA 3FPYA 1ILSA 1ET5A 1WS8A 1PZAA 3T71A 1A4CA 2YAFA 2CALA 1J9RA 3GYRA 4DP7X 4KO7A 4NB7A 4E9XA 1J5CA 1OOWA 1L9OA 1JXDA 1PNDA 4HAKA 1KDJA 5F7AA 3G5WA 2GSMB 2P80D 4WTQA 2GIMA 3H4HA 2YXWA 2GBAA 3NSFA 2PPDA 2VW6A 1E67A 1N68A 3PPSA 2WSDA 2UXTA 1L9PA 1QNIA 3DKHA 1L9TA 2XWZA 1OCCB 3S8FB 4A2EA 1GY2A 2I7SA 1OCRB 2VW4A 2FQFA 2MRYA 3TA4D 3WG7B 3JTBA 4NAJA 1NIFA 1M56B 2DV6A 2PPEA 3FQ2A 3TBCA 3KW8A 4BWUA 2UX7A 3FU8A 1E65A 1RKRA 1KDIA 4KOBA 1AQ8A 1MG3C 1XMEB 1J9SA 2BW4A 3FPXA 3HEIB 2BWIA 2ZXWB 4A2DA 2NRDA 2GHZA 1GY1A 1SHWA 1KGYE 3FSZA 3FYIB 1WA1X 1M57B 1OE1A 1SDDB 4YVUA 2QT6A 1MZYA 3TBBA 2EIKB 3OMIB 4E9RA 2ZONA 1AACA 3FYEB 1OE2A 4HALA 4KO5A 1NTDA 1A3ZA 4WKXA 1TEGA 3NYKA 4P5RA 1AZUA 3NJLA 1PNCA 1PCSA 3FQYA 3FS9A 3KW7A 3T9WA 2PP7A 1NWPA 4W1TA 4E9QA 2YAMA 2B08A 5B1JC 1BXUA 2TSBA 3PAVA 2ZOOA 5TK2A 2IAAC 1KBWA 1CYWA 1NIBA 1AANA 3ABKB 1PAZA 4AKOA 3S8GB 2GB2A 2DYSB 3D12B 3ABGA 2BP0A 1HAUA 2YAHA 1RZPA 1BQRA 1JZGA 3PCYA 4PAZA 4DPBX 5I6OA 2YAQA 1L9SA 4G72B 3SBPA 2PPFA 3NSCA 2PPAA 2OCCB 2R7EB 3CDZA 4MFHA 4A67A 2IDUA 1SFHA 2PP9A 2XVBA 3FU7A 1CC3A 3X1NA 2XYBA 4DP8X 4E9TA 1SF5A 2UXVA 1KYAA 1BAWA 3SBRA 2HLEB 2XV3A 4KNSA 4KNTA 3U25A 1AG0A 1X9RA 3T6WA 3X1FA 4AKQA 3WKPA 4BDVA 3QJVB 2FT6A 2Q9OA 2VM3A 3NP3A 2J55A 3N2JA 3UGEA 1JXFA 3ERXA 7PAZA 1AG6A 1XB8A 2GI0A 2IDSA 2W8CA 3QQXA 6PCYA 3UAEA 1DZ0A 1IBYA 2YAPA 2QDWA 4UANA 4JHVA 4HCIA 4A68A 1F56A 2FQDA 3OM3B 1J9TA 2EIMB 1GS7A 1NIEA 1JZEA 1ZDSA 2HX7A 2XU9A 1AS7A 2HXAA 1GR7A 3UAAA 4GP4B 1SNRA 3QJQB 1PF3A 4F2FA 2IWEA 3FT0A 1ZIBA 4JKNA 1BEXA 1CYXA 4CSPA 4GYBA 1ZV2A 1SF3A 1M9WA 3OMAB 5D4JA 3MX0B 1QHQA 3AG1B 1UATA 1YLBB 4AKPA 1JZFA 3OQRA 1OF0A 4Q8BA 2LLNA 4YSRA 1PLCA 3AG4B 1NICA 5E9NA 2CCWA 4F2EA 2AZAA 2PCYA 1BQ5A 1B3IA 3SBQA 4AI7A 3RYMA 3N55A 3GDCA 4Q89A 4E9YA 1JZHA 5LDUA 4EF3A 1VLXA 4YSPA 4FAAB 2JFCA 5I5IA 5ANHA 2Q5BA 2CUAA 3BQVA 1ASOA 1A4AA 1NPJA 3EH3B 1A65A 4DP2X 1WA2X 2UX6A 3CVCA 2P80A 2A3TA 4DP5X 4G7QB 2J5WA 3S3DB 2XX1A 3IE9A 4BK5C 1OCZB 2QDVA 2H47C 4YSOA 5A7EA 3PAZA 4YL4A 3UADA 2IDFA 1X9UA 2I7OA 5B1BB 4KNUA 1XB6A 3NJGA 1ET7A 3TASA
chains in the Genus database with same CATH superfamily
1IQDA 5TDPB 5EDSA 1HQ4B 4HUKB 4U1SB 3FB8B 5G4NA 3C8KA 3EFFA 4Y5YC 5T1DH 4EDXA 3TBTB 3UTZB 3EH1A 1YEKL 3QO1B 3FTUA 3DK0A 4PJ5A 3SGDI 3QRFM 2LU5A 4JPWH 5I8CB 2CZNA 4G6FB 3SDCD 1UH4A 4PRBA 2GJ6B 2QPDB 1LO3L 2QPFA 1YEIL 4DAGH 3MREA 5B39A 5JW3L 2O93L 3GI8H 3Q9QA 4YHLL 2R2HA 4ISVA 1B88A 3AQDA 4KHTH 1GOFA 1E9OA 3F01A 5DC4B 3NFPA 2ZOWA 5IHZB 3EAKA 4MSWA 4UM9A 3HC4H 5CILL 4Y4KA 3WTXA 4ZQKA 5J5EA 1ZJBA 2HP4A 3KYKL 4G3YH 3R7RA 5E1AA 4HT1L 1MPAL 3PHOA 3MNMA 3BMWA 3ZDXB 1T0OA 1KIUB 3DJRA 1MJUL 4BFFA 3PWJB 4NKOA 3IKCB 3X2QB 4GEJA 3UTPD 3V9FA 1J1OH 5E8PA 5CSGA 1HH6A 4FFZL 2LGNA 3VXRD 5C86A 3D51A 4FTVB 4QTHA 3JWNG 1SXAA 3KLQA 3WJJA 5I6LA 5KVDL 5FCUH 4MGXA 2A9NL 4XP6H 2X89A 4X6FB 3ZKQD 2N0KA 2ATPB 2DD8H 2YKKA 5SWZA 4F7EA 1JZ2A 4M29A 4Y7OC 4WUKH 4YSSA 3KNBA 4MXQD 5DK0A 3FSVA 5C09E 3P30L 1BP3B 2GTQA 2Y06L 3WTSA 3GSXA 1KTDB 4MMZA 1DE4B 1OAZH 1UG9A 2P8PA 3FO2B 4HPOL 1C1EH 4TSCH 4HOMA 1BMWA 4QLWA 4WO0A 4L9LB 3Q5OA 4XMTA 2MCPH 1T1YA 2LFEA 4X9BA 3MJ8A 4B9GA 4QRTB 4P2QE 4S1SH 1UENA 3CFDB 4UBDD 4ZXBC 5MI0C 2X7LB 1HXYB 2EJ1A 3D34A 5KVMC 1ES0A 5EOQH 2AV7A 3KR3H 3Q3GB 1T0MA 1OAYL 3EO1B 5DRZA 1UA6L 4MMYB 3RNKA 4PG2C 3WJLA 2I60H 2Z35B 4HKJA 2W60B 5TFSH 5CU5A 5LCVA 3HZMA 4ZK8A 5I0XA 2OL3L 8FABA 1JPTL 1L0YA 2WTRA 5GGRY 3R1GL 2XOTA 4P04A 1EJ8A 1C12A 3KGUA 3AMLA 3QISA 4G7YH 3ZKMC 4Q9RL 1A9VA 1L4IA 1TMCB 4PS4L 1AI1H 3LXUX 3WLBA 5FF6A 1U8PA 5E5MB 1CS6A 1PZBA 1U95B 4XI5D 4Z3HA 2GEQA 5CO1A 1J1PL 1KXQA 4G59C 1UH3A 1B0RB 4KBPA 3ILPB 4MTMA 1YECH 3FH5A 5E2VL 3S98A 3ZDYB 5IESH 5JQ6H 4WWKC 4DF9A 4DW2H 3FCUB 5DURB 4PVMA 2ZXGA 1DO5A 2YSSB 1K72A 4ODSL 1OGAA 3M8OH 5T33H 4AVJA 3KPPA 2NTSP 3ZN6A 5K59F 4RDQF 4HPYH 1CMOA 1CTNA 2JB6A 4B9YA 3G6AB 1JN6B 2FBRA 1BX2A 1FDLL 1JXJA 4LF3B 2QLVB 3GMQB 1A9EA 2BFVH 1AD0A 1AZZC 3S96A 3PHAA 2XZQH 1IKNC 5IY5B 3OKOB 2FATL 4GRMB 5SV3A 1XF3B 5G2NA 3ENEA 5DZPA 4HIJA 5AYUH 3U2IA 2KT6A 1E9QA 4FJ6A 4JKPL 1CR9L 3GSRA 1AKJD 2ADJA 2YC1A 3DRTB 2QLYA 5C0CD 4UTBA 3L3DA 1FVCA 1JUFA 1JXGA 1QSEE 3AWFA 5GIRB 3LKSB 3L1EA 5MEPA 4KXZI 3FB7B 2ZXCA 3IFNL 2VLKA 4ODTH 4UDUB 3CFEA 1Q9WB 3FU6A 3PGCB 5KYXA 1UT2A 4XPHL 1FYTB 3L1OL 5KSBF 4UTAL 3EJZC 4NEHB 3VACA 3FQTB 5IM7B 4UM8B 1H6EA 4LZKA 3WN5A 2IAMD 1FGVH 2A74C 1KIQB 5F7EH 3MRKA 3L3JA 4L23A 1CD0A 2WYTA 3PWUB 4M1CD 5CLYA 2D7TL 2Q1EA 3BPOB 4GAFB 1DQTA 2DWYA 2OMBA 3LN5B 3SY6A 3FDWA 3ML9A 4WI0A 3F7RA 1F4AA 3IMVA 3V4VH 1J8RA 5KZCD 1J0HA 2VR5A 2WLKA 2AS5M 4PJDB 3ZGIA 1ZPUA 3OD3A 2E7BA 3HNTH 1MHEB 1RZKH 3MRIB 2FNWA 2R0WH 1N6VA 2X2HA 1FIEA 3VXMA 2J25A 1CB4A 1DN0B 3T09A 1XQ4A 3VGAC 2ZG1A 3VE0A 1VADA 4YUEH 1BVKB 2ZXBA 3CSBA 3HUJF 3M17B 3RWGA 2NNXA 3QI9C 1GRWA 2VLJD 3BVDB 3CU1A 3P0GB 4QRSB 4GQQA 1UM5H 1JWUA 4JFED 2H41A 3VMOA 5CBAA 1FNGB 2KUTA 3MRDA 1S7VA 2DQCL 3TCLA 4PS3A 5FWRA 4LLDA 3VH8G 1WWCA 5B1KA 1RCYA 3U2SA 1X5KA 4DP0X 2CMRL 3L4YA 3N43B 3RUGF 3L4CA 2EDYA 3INUH 4GAJH 4F7PB 1BGXH 3PL6A 1U8LA 1VSCA 1XCXA 4ODUB 4WWID 1JV2A 1NMAL 2GJZB 5BV7B 4OI7A 4N0YH 4Z8FL 2KERA 3NCBB 4GW1A 1HXMA 2J21A 3BN3B 2J7LA 3VWKB 4NLHA 3MUGB 4X6CA 5IIEA 4E42A 5TQ0L 1U8NA 3BRGC 1WS8A 3BEWB 5K1NA 3GYRA 2XQ0A 5D7KD 1PVHA 3BZFB 1OOWA 5IJKC 5FKAB 1RZGA 4PW9A 1AZVA 1NAKL 4MAYC 2H1PH 4KRPC 4XXDA 4OH2A 5I1CH 3C2SA 3JXAA 2VJ8A 2JXMB 3CC5B 1E67A 1WICA 3MR9A 3MNDA 4L3CB 4DN3H 1ULVA 2DQUL 2PWHA 2ZP0T 4MNGE 5GGUA 2B4CL 1KPRA 4NP9A 3PRZA 4X80H 2ITCB 3WDHA 4X5LA 4I2XB 1YC7A 5C7XL 4HGKC 3E38A 2HRPL 3KLAA 2BIOA 2Q86A 3UTSB 3EFFB 3ARBB 1RZ7L 3DX9A 1JPST 3OAWA 1A02N 3MUUA 4ZS6D 4NWUL 3FAXA 2Q6WA 3DX6B 4QKXB 3EYSL 3IJYB 3W38A 2DV6A 2WINA 2FEEI 1A1MA 3CMGA 5FYLH 1FNSL 3KWVA 1R4XA 3VXSD 5KWYC 3MV8A 2EXWC 3VXNA 4ODVH 3MREB 3G9VA 3IDJB 4A2DA 2NRDA 5D7LE 1F4WH 3H9ZA 2W0FB 2PUQT 1WA1X 4IIQC 1M57B 4KQ4H 4L4TD 2J1KA 3BUYA 4JKLA 1P1ZB 4MSWB 1F1AA 1PLGH 3DYPA 3ZDZE 2VDNL 2Z3FA 3N41F 5I1AB 4E5XB 5HGGS 1W9XA 3DBSA 1YEDA 2EEXA 3GLAA 3O4OB 3WE6A 3PHOB 3H6AA 4R7VA 3UZQA 2GSGA 2Y1VA 1SUHA 2E6PA 4KH9A 4QXGL 4YDVA 3CN4A 2YEVB 4GT0A 3U4BH 1AZUA 1BXXA 3NJLA 3EDEA 1QHPA 1S5HB 5FO8B 2G0LA 1U33A 5J6GA 3ECWA 4W1TA 3UERA 1SMOA 5CMAA 3HE7B 2FJGA 3BUDA 3K71A 4KTEL 2A6JA 4PJAA 4OT1L 4ZW7A 2NMSA 2LHAA 4JO1L 1CYWA 5EU3B 2XVGA 4NWTH 2WUCL 5SWZB 1PZUB 1ZD6A 1PAZA 1UGNA 1IGIL 3UIZA 2AJUL 4I9WD 2R8SH 3DBXA 1HHJA 5ILTH 2FHFA 1OB0A 3CXHK 3GSXB 1MCHA 2P8PB 4NN7C 2O26U 3J8F7 4C4KO 4XCNA 1R33A 1T0PB 3MA9L 5KYUA 4P2OC 1ZLSH 1DTUA 4L3FA 4M02A 4ZOEA 2OMZA 3ETSA 5D1QA 4ZW5A 1RAMA 5C08D 1I8UA 3KCPB 4URTB 3BT2H 2OZ4H 4EN2A 3OL2A 1S9XA 2VJXA 4U1IB 4Y5YA 1T0MB 2DMCA 5DS1A 5T5FL 2OJEA 3MACL 3U7WL 4BH7A 3KBHE 4PRHE 4FFVD 3DXAB 1ZVYA 2Z31C 3KPLB 2E6QA 4N2HA 4HKJB 5ITBH 1NH6A 2AJSL 1M1XB 3QRBA 2VM3A 4RA3A 3UPCA 3DJZA 2FWSA 1V7ML 2WTRB 3M1BA 5AYTA 1T5XB 2JKXA 4QHKJ 4Z7IA 3KGTA 5CJ5A 3RI5F 4ENED 3IJ8A 3QQ9C 5HI4C 4XNYL 4IEFA 2VZUA 3WLBB 4N3UA 3RKDC 4DO5A 2Y6TE 4TYUA 4X6DB 1RZKC 5DS8A 2CXGA 2XWEA 4HX1A 4FDWA 3SPCA 1SOSA 1QSZA 4U3SA 4XE5B 2HVBA 3NOIA 5GGSB 5DJDA 3CX2A 1Q72L 3ESUF 4I0PB 3KPPB 2E56A 1LQBC 3ZJAA 1MCSA 1GYVA 2VB5A 4N8CH 4GUPB 5FEBA 4IJ3C 1IE4A 5TPWH 2PO6C 1OTTC 4B50A 4AMXA 4JPKL 3RTQA 4WTXA 1AD0B 3CFTA 3S96B 2CJUL 3Q2CA 5ADOL 1PZ5B 3AITA 2E7DA 5K59E 4PSPA 5E9NA 1EO8H 4XVUD 1PKQB 1QLRB 4H8PA 1JVKA 2PYED 5MERA 3TO2B 2Q76A 3MLTB 2EH8L 1JGIA 5D5MA 3GSRB 4W6YB 4AGPA 1U3JA 4EF3A 3P0YL 5JR1L 3WV0A 1HZHL 2F54D 1OZUA 3BQVA 3TYFB 1G43A 5GGTA 1NPJA 4WK0B 1L7TH 1JGLL 4GG8B 4PP1C 5D6CA 4ZXBA 4YGAB 3CFEB 1YY8A 2OQJB 5AVSB 1CLZL 2P80A 5DS2A 4Y2DC 3RU8H 1Z9OA 2YWYA 3MJ9A 3B2UD 3KXFB 3QUMH 4NNXA 4RZCB 5CAYB 1DQJA 2AMUA 3U48A 4J23A 3EKCA 4FQCL 4QHKI 1KTBA 4MVBC 4IGBD 4KTDH 1IAIH 1WAAF 3WN5B 4OIIH 1QKZH 6FABL 1UACL 1E6JL 3MRKB 4UILL 3TH2T 1AY1H 3BX7C 5FW7A 5HDBB 4AEIL 3MJ7B 5GZOC 1NPNA 3JZYA 1AS6A 4KDWA 1PEZA 5KOMC 3HZKA 1BZ9A 1AFVH 1WWWX 5KSBE 3KD4A 5CSZB 1KEML 2WO4A 2IWKA 3IAPA 1YNTF 5I1JL 2OMUA 5ESAA 1NZRA 4HIIA 5AYQA 2EUVA 5DHYB 4MJ6B 5E2TH 4AZUA 5D93C 1F86A 1M7DA 4J4PC 3LX9A 2OW6A 3BAXA 3QRGL 4R5TA 3L6FB 4U1NB 1P53A 2KZBA 2G5RA 1FVEA 5D1ZD 3H7BA 4JPIB 3ZL4L 3CAFA 4YAQA 3VQMA 3VE0B 2NX5E 4IIZA 4ONGH 5HGHB 2BOBA 3F65A 4MS8C 1LMKA 1BIIA 1KCSH 1T7VA 6CGTA 4G7SB 4JFFB 5CIPB 1ADWA 4JFYB 2GY7B 5I6XB 4J28A 1J8SA 5B39G 4IOFD 1KBBA 1Z5LB 4LLVA 3RVWD 3SPJA 3ZZ1A 4B96A 5E9DE 1MHPH 4R26H 5CBAB 5GJSH 3QFJA 3Q6GL 4M5YH 3TCLB 4BCXA 2ZXDA 2XHNA 4JQVA 1MEXL 3MLWH 7PCYA 5HVGB 3HUJE 3NFSH 5DUML 5F0JB 4XMPH 4MZ3A 3JT0A 4RWHA 4CRPA 3VW3H 2VDLB 4NP4H 4K5MA 5DFTA 1A5FL 4KZ0A 2VDOB 5I75B 3UOAB 4JN2B 4HKZA 5AW8B 4NNYA 2BINA 3A0OA 3EGSA 4FQLH 4JGUA 4JEGB 5CN2A 3VX0A 2OMWA 3PUCA 4MA8L 1HXMB 4M7ZC 3SKNA 4NFDA 2APWA 1P84J 4N4YB 4X6CB 5DLMH 4E42B 3EH2A 1FJ1A 1U8NB 5IIEB 3RUGE 3M07A 4TNFA 3T1WA 2GY5A 5T1DL 2YQBA 1OTUD 4D3CH 3ULSB 4ANXA 5JHDE 2A74A 4JPWL 5DK2B 2ZE0A 5IROC 4C57C 2G2NA 4XXDB 3NIGE 2X4PA 4ZRGA 3AXHA 3O2VH 1VPOH 4DAGL 4KZCA 1FFQA 3NJXA 3GI8L 2QFPA 1FNFA 4HS3A 3RVXC 3IMRA 5FX3A 4AQ1A 4KHTL 1H9DA 3T4YA 1YEEL 4HUXA 4WI2A 5I9QC 4H2CA 4M8QA 2MSPA 3HC4L 4CGTA 2RH0A 3TXAA 2Q6WB 4YHPA 5FPIA 1HQRB 3HE6A 4HU8A 4X4ZA 4KK8C 2AQSA 4G3YL 1G7QB 2X2JA 5AOZA 2WINB 1A1MB 2DLEA 1WFJA 1N0XH 4XWOC 3RZCD 1BQHA 2BSDA 2RQ8A 3MV8B 3VXNB 4CC0A 5DLLA 4WUUE 5E7FA 1BFTA 1J1OL 1F4HA 4KKBC 3ARQA 5C92A 3K6FA 5C6PB 3VFVA 1D3CA 1MCJA 1BPLB 2EKJA 2WSPA 3BN9C 3BUYB 4UUJA 1WWAX 5FCUL 2EXYD 1G4MA 4XP6L 3MODH 3E2HC 2DD8L 3WE6B 1AD9A 3NP4A 4WUKL 3VXUA 5HD8C 5JOEA 1O6SA 3UZQB 2GSGB 1HH9A 3APDA 2HJKB 2EYRA 1OAZL 4M8VA 4TSCL 2WPGA 1C1EL 2ESVD 4UQ3A 4OGXH 2X4RA 1UB6B 4GXUN 2MCPL 2ICCA 1T1ZB 5CMAB 3VFOA 4QTIH 1CT8A 4FA8A 2VUOA 1GJWA 2O5XH 3HNSH 4S1SL 4NDMA 4C56A 3HCVA 4MDJA 5L2KA 1T89A 2B7DT 3WU1A 1SJMA 1E40A 1LWRA 3QJXA 3KR3L 5E2WH 5EOQL 3T0VA 1RSFA 1W8EA 3MNZA 1LE5A 5CKGA 1ZVSA 2R0ZH 3V9CA 5C6WH 5C0EB 3WI9A 4HFUH 1VCAA 4I18C 3QDMB 2IBGA 4UZSA 3DGGA 3V0IA 1PZDA 2I60L 3HUJA 5AL8A 5KVGE 3VYOA 2AJYH 5TFSL 2KPNA 3NJKA 1UWEH 1SVCP 5EC1A 4P5MA 4UU9B 4HUWA 4O51A 4M7LH 2K4AA 4YR6B 5KYUB 5JMRA 4JRYD 5CN1A 2ZCHH 2G3NA 1QWNA 4G7YL 5D1QB 1C5CH 1FFNB 3DETC 3QQDA 3HZVA 3VM7A 4MKMA 1AI1L 4DJMA 4EBQH 3CFCH 4Y0GA 1MDAA 4F15B 1DUYA 2XQYK 2XTJD 3RUGA 3POHA 4J6RH 4XRCA 2UWEA 3TU6A 2ADFH 1XF5A 1WD8A 4EIZC 1QP1A 4H8HA 4BSWB 1YECL 2DB8A 4AE1A 5IESL 5JQ6L 4NQDA 1F8TH 4EJ1C 5B3SB 4DW2L 3M1BB 3TZVD 3M8OL 5T33L 3UO1H 4KFZC 4WTWA 2RR3A 4HPYL 4ZSOE 2A83B 3U4AA 3E3QC 5EO1B 4ADJA 3I6SA 3RE0A 2R1WB 4IIQA 4YHYC 1UOWA 2CIIB 2VZ3A 5EC2A 3CFKB 3TBWB 3LV3B 5CZKA 4ZMXA 2ZUUA 4EZMA 3SSGA 4P48A 2XZQL 2CA4A 4BUQA 4HX1B 1UXWA 4OZIA 2FT8A 2WD0A 3VYPA 5AYUL 1IM3A 3VI4B 4U3SB 3NSJA 4D7BA 1O7SA 1VZHA 1R3KA 5DJDB 4PY8J 3ZUCA 1J11A 5HHXH 2KI6A 1FG2A 3TN0B 2VUKA 1MCWM 1Q9LA 2KPWA 2R69A 3VG9B 5J89A 3IPBA 4GFXA 1WFNA 4A2HA 2K45A 4FYTA 4N5EC 4ODTL 4WHYH 1WZKA 1XGYH 3RTQB 3ZT7A 2BCKA 3V0DA 2GCYB 4Y4FC 1T6VN 1NGYA 3ABLB 4ZPVA 2A77H 3QK0A 2L7UA 4M43H 1A7RH 4NQEE 1BIHA 4Q58C 1FGVL 3P9LB 2Q76B 5F7EL 1LDSA 1ZIAA 5D5MB 3ALXA 5DJCB 3ARFA 5E00B 1EO7A 3DOIA 5CNHA 3T71A 1RZJH 5KVGL 3QJFA 1GHFH 2JCCB 3MA7A 1JTTA 4FL4B 2JI3A 3RWHB 1A8JH 1YY8B 2K78A 3GRWH 4N68A 1ROCA 3K72A 4LPXA 4PJDF 1E5UI 5CD5D 4WTQA 5KW9H 2WP3T 5E4IA 3VUAA 5FYLE 4U7SA 3AROA 1UD8A 3ZHKA 2Z31A 3HNTL 4AE0A 1RZKL 5J11B 2R0WL 1P6FA 1L9PA 5TQ2L 5FS5A 3S36H 3WKNA 2OA9A 3F62A 3GFUA 3O3BA 1RPUA 1PY9A 2XA3A 3R0MA 3LQMA 4YUEL 4BRVA 5KYWB 3HPLB 3Q9PA 3NRFA 3T4AB 3FT9A 4LQ1A 4HD5A 1E8XA 3SDDB 1WAAE 4NAJA 3V4VA 3BPCB 3NFNA 4DO6A 4HIIB 4PY8I 1UM5L 1NMBH 4G8GE 4OZHE 2E76C 5K39A 1M7DB 4KX8A 3KE0A 2QVIA 4LHUA 2XN9B 3HG3A 2Y4SA 1MFVA 4L4VE 1FVEB 1HWWA 2B3RA 3L4ZA 2WZ0A 4YAQB 3QUZA 3INUL 4PJHB 1BGXL 5IOPA 1BIIB 2LLLA 2OPCA 3OMIB 5C8JB 4N0YL 1QG3A 1HN1A 3ZT5A 4FI8A 3IT8D 4RIRB 1TZOA 2NW3A 1GZQB 1SYVA 4QOKA 3QFJB 4RETB 2I32A 4WKXA 1AO7E 3PY9A 3OWRA 3JWDH 5JDSB 2VR9A 1J5HA 1N12A 2YPLD 3F8UB 2CRMA 3UGUA 1XCWA 3ZK0A 2H1PL 3ZHLA 4OI9A 5I1CL 1IC7H 1OP4A 3JTTA 4NNYB 4QLRA 4DKFH 4G9FA 3SDAC 1NIBA 1SN2A 4DN3L 1ZOXA 3W57A 1HZKA 3SKNB 3FUMA 4HEME 4WVRA 4X80L 1A4JA 4FI6A 4L8CB 3BDYH 1HAUA 1FJ1B 5HYQB 3D2TA 1O7VA 1UZGA 4Y2DA 4AGQA 5L88H 3DMMA 4MMXB 4TLTA 4WY7H 1T5WA 4RAHA 3GXPA 5F1KC 1HHKA 1NKOA 1JE6A 4IKKA 4MCYA 5IR1A 1SFHA 3EDKA 2O5YH 2N56A 5I2IB 1HESA 4HMDA 1MVUB 2NSMA 5FYLL 2Q7YA 5DC9B 3L8QA 3TYGH 2D73A 3ZO9A 1KEGH 4ODVL 4F8NA 2O61A 4LCYA 1USQA 4NUPA 3VXPB 5IVZA 4R96A 2EE9A 3ZTNH 3SYQA 3AACA 4FXKB 1IEBA 2FNBA 1F4WL 2HLAA 4XO4A 1ZLVH 2SEBB 3QCTH 2MKLC 2PN5A 3QJVB 2DBJA 3FRPA 2GJ6E 4KQ4L 3SOBH 4TVPE 2ZQKA 3T4YB 1I1AC 2OX5A 1PLGL 2F7RA 5I0WA 1A14L 4IRZH 4J4PA 4MJIE 3UGEA 4P4KA 4YHPB 4WGWB 1F11A 3TT1H 5I19H 3HE6B 2Z92A 2IDSA 1BHGA 3QA3B 1M3JA 4LSPL 4YDZA 2O6DA 4XNQA 5G5DA 1G1YA 1BQHB 3P9MA 3B7UX 1ONQB 1CCZA 32C2B 3GJFK 1XR9B 4OZFH 4JFQB 4W4NA 1F56A 4YK4B 2UV3A 4JDVA 2V2WA 3ARBC 4L8DB 2FSEA 3LXBA 1ZDSA 5BO0D 1XR8B 2HPTA 3VFVB 3SZ6A 3ZDXE 3D85A 4LU5H 1XAKA 3N85L 4I0KA 5J12B 4F2FA 2QVTA 4HS8H 1CLVA 3K46A 4NWTL 3LH2L 1AD9B 1ZT4A 4LPYA 4PLOB 3VXUB 3BH8A 3MV7B 4X4ME 4DUVA 5IEKA 4M48H 2R8SL 4BZ1A 1O6SB 1ZHKA 2W07B 1X5XA 4FG6C 4YO0A 2L0DA 5CIPH 5GS3A 5ILTL 3V0GA 2AQ2A 2EYRB 3PNRB 4Y5VA 3OQRA 3RIFF 1YNTA 5I23A 2YO3A 4UQ3B 1S7TA 2FCBA 2X4RB 5FUOH 1QR1B 3KPQB 5C07D 3TF4A 1QSFB 3VFOB 1ZLSL 1Q8MA 5JA8B 2XZCL 3W5MA 3HI6H 4F92B 5L2KB 3V4LA 3BT2L 3NDYE 1WRFA 4GJTB 4HVBA 2QHLA 5LDUA 2VDLH 1H15A 3MNZB 4Y19A 5MENA 5TE6L 3WNLA 2VDOH 5T1LB 1PY4A 2CUAA 3SJVA 3HMXA 1DEEA 1YMME 1OAXH 5IROA 5IF0A 2C9UA 2P8MB 1WA2X 2UX6A 3VFUA 4JAMA 4BINA 1RZJC 3H8NA 4PM1A 4UINH 4O51B 2ROXA 5IQ9B 1Q90A 4NSKB 2QVKA 1HCVA 3S37X 2NSXA 2BNRB 1B0WA 3ARGA 3O3EB 3S36X 2WBJB 3VXOB 2OZ4A 3WENA 2IDFA 3HAEA 1QSVA 3ASWA 4I1NB 2ARWA 4X6DF 3S35X 4J6IA 1XEUA 4AW7A 3QDJB 4N2BA 5DMGC 3TASA 3X11A 4NQCB 2ZD0A 1QQDA 1ACCA 5LGJA 3IDGA 3AY4A 2UWEB 4LPCA 4KK6D 3BP4A 1XF5B 3ILDA 3UC0H 2KH2B 3KLSA 5EHFA 4TVPL 1E7VA 4N6RA 3QJZA 4XBPB 3FSWA 5I1HH 4EEEA 4NQDB 4NO5A 3TTYA 1JYVA 1EHNA 2CLVB 5E6IC 2PF6A 3UTTD 2EDDA 3E6HA 3ZIYA 5FAAA 2BVEA 3FCSA 3SCMC 3MV9A 2P4AB 4V33A 1H8OA 2EADA 3DNKA 2WWOA 4JREC 5TPWL 4J27A 3IN0A 3RIKA 4Z5RB 1SLUA 1TZIA 2OR8A 4FZEH 1MCWW 2LW3A 4PGBA 1I53A 5B7MA 2QQKH 4OZIB 3ZU8A 4MJIA 1EO8L 3GXIA 2J88H 4FFTA 1VESA 1COBA 1GGUA 4LBEB 4AVHA 4GRLC 5ISZD 1Q9LB 4TVUA 1I85A 2NNAB 2ZUWA 3B9KD 3F85A 1OCWH 1L7TL 4XN9A 1NJ9A 4ODHH 3KPMA 4TTDD 4DPCX 1FA4A 1HL8A 4JFOB 4TQHA 3VXTA 3G6DL 3JWDC 2AW2A 4NOFA 5B21A 5L4MA 3C8DA 3RU8L 1SBBA 3LRSA 5DI8B 3V4UH 1NGYB 3QUML 3VXQA 2VCOA 3P77B 1RK1A 5FECA 4HUUA 4KTDL 1Z9SA 4XPFH 4I18A 4X6BA 2P48B 4OIIL 2VL5A 1QKZL 3EOBB 1AZCA 2WJ5A 4XP5H 5DYFA 5HDBF 1M7UA 2K7QA 1MJJB 1A8ZA 4WW1B 5D7EA 1AY1L 1D6EB 1FYTE 3ARFB 4JANA 5F3HA 4YSCA 5KVEH 3K8MA 1JZ5A 1KTRL 4RGNB 4LKXA 4NENA 1AFVL 2GIYA 4QRRB 2R7EA 3QJFB 1OO2A 1E30A 2IH9A 4PRIA 1CD8A 3KL5A 1I1RA 4KMTH 4MJ5A 1AHKA 3K72B 4TS6A 5IW6A 1UASA 1RI8A 2N1TE 4S10A 3ZTCC 5E2TL 1TENA 3L5WA 4JFTA 5H94A 3RGBA 2OR7A 2XI9A 4Y9GA 1J86A 2V4LA 3I3EA 4XNZC 1JFHA 3U0TB 4ZTOH 3O3BB 2JB5H 3SKOA 4RMWA 1L6ZA 4KTGA 1YMMA 4ONGL 2VERN 4EUPB 1FGNH 2NQCA 4PJDE 4Y89A 1KCSL 3RJDA 5JHLH 1SY6H 1LO2H 5CEYA 4NUGH 1DJIA 3ELQA 4EDWH 4FMKA 3BGMA 3FUEA 1RZIB 4KKRA 1MHPL 4R26L 5FHBL 1GGCH 1PKOA 2YGVA 4MCZB 5GJSL 3W37A 4JK0D 1ECZA 3ZT6A 4M5YL 2XY1A 2ZZUT 4LHUB 2DAVA 3G04B 4N26A 5I1DB 4LOFA 4J3UA 2E8ZA 3NFSL 4XMPL 3VW3L 1BYNA 3EO9H 3QUZB 4ADGA 1OSPH 2EDMA 1S7WA 1X3DA 3H9YA 1ZS8A 5IG7A 4GRWH 1N9PA 4LKCA 1UA3A 4RESB 2VAAA 5GS1C 1E28B 1T7XA 1JWSB 2XY2A 4LARH 4A7VA 4F8LA 2XBZA 2NW3B 5DLML 3MAWA 1C8PA 2DL9A 4JRXA 1TPXC 2FQGA 5B7EA 5FW8A 4QO1B 3U6RA 2XUWA 1IIKA 2FUTA 3V0JA 3S2CA 4ZW3A 2AK4A 2UZXA 3GUTA 3WEMA 1KF9B 4D3CL 2NZ9C 2OMTA 1NINA 5CFHA 5I6XC 4X5XA 5I8EB 1R9FA 3N1MC 5DGRA 2H5UA 4L1LA 4Z7OF 3FXIC 4KNQA 4U6HA 3O2VL 1QUPA 1VPOL 4CN4A 4P9ML 1E5BA 1TZGH 3QEUA 3U2JA 1NFDB 3RURA 3FQ1A 2XA8H 2OULB 2HFGH 5F88B 4BZYA 4Z6AT 3TOPA 5IB2A 3DMMB 3WIAA 1EBAA 1N4XH 2NR6A 4K0OA 5BOZG 1U8QA 5IJDC 4JRFA 2VW7A 3MLXL 3WDJA 3MCKB 4U1GC 3DSFH 5I0DA 2YGQA 4YFDB 2X3AA 2Q7YB 4KO9A 1N0XL 3UTSE 4NPJA 2ID5A 3IJHA 4X4KA 4W4OC 5SWSE 2O61B 3QEQA 1JYWA 3MRQB 3P2TA 1SQMA 4NHCH 5A43C 4QJ3B 2FR4A 1OAKH 3CX5J 2UY7A 3DPBA 3GMOB 3FFDB 3MODL 1A4KA 1KJVA 1L0PA 2MIZA 4P4KB 4WEEA 3GHBH 1Q0YL 4NXSA 1JGEA 1RH8A 2GKIA 2FRGP 3LXAA 3QNYA 1CDJA 3FQNB 4EI5D 3IETA 3PDOB 4HOZA 4QF1A 3P9MB 1EMTH 5LXGH 1ND0B 1SGKA 2MWCA 2WXIA 1H3WM 2P1YA 4ZUTA 4OGXL 3RVVD 2V2WB 2NY3B 2I69A 2CBQA 2WXGA 4NPKA 4QTIL 5GZNA 3BEVA 1H0DA 1TKWA 2O5XL 3HNSL 2ZUXA 4KXCA 4P5TB 5ICXA 4JQXC 2FZ3B 1ZVNA 1OWRM 2AJVL 5D8JL 5E2WL 3AY2A 5IEKB 3V79C 1XB3A 2R0ZL 3BH8B 4ZD3H 4NUJA 4RRPA 4YO0B 5HHNA 4OAWB 5C0AD 4BFOA 4P0DA 4Y5VB 2AJYL 3L45A 4M93B 1UWEL 2FDBP 1L3NA 5IHLB 1RJLA 3Q2LA 4N8PA 2CUHA 3MLSH 4M7LL 1IFRA 3HG4A 2LQRA 1EZVY 5I8OH 4M5ZL 1AIFA 1G6RA 3KLHD 1T4WA 1C5CL 2NY1D 3H1ZA 5FUZL 4EBQL 2ICEB 5HGBA 1RP8A 1C08B 1TNNA 3CFCL 2P8LB 3HKZA 4IKJA 2MKWA 3LD8C 4J6RL 2A6IA 1DVFA 4NXKA 4QYOA 1VDGA 5E0FA 3B2XA 2BP5M 3IAQA 1TVBA 1BF2A 3TO4C 1F8TL 1XBRA 2NY0D 3MCYA 4AQ8A 2IAND 1EFQA 1X7QA 3HRZC 3DXAE 5JOPE 2Y2WA 3QIWC 3UO1L 1N68A 5GGRB 3ETTA 4GRWF 1UVQB 3HAEB 2KYIA 1MCBA 5E8EA 4WWOA 4ZUWA 2IV8A 3IMWA 4FQQB 4HWBH 1I1AA 3DX3A 1OY3B 2R1YB 3SPGA 3TH4T 3X11B 5F44A 5LGJB 3IDGB 4L37B 3D69A 3TNMA 2Z7UA 4N6RB 5FA3A 3TA4D 5FLVA 1ZT1B 2XN1A 4FTDA 1IFGA 1MUJB 3O2WH 2DI7A 2DLHA 3E6HB 4X6DE 2BHZA 4AYEC 1BD2E 4WGVB 4KOBA 4LDOB 4CSSA 3D39B 2VQUA 4HUNB 3CDGB 4XZUA 2BW4A 1WV7T 5HHXL 5KBMA 5SWSA 3WS3B 4F15C 4WNQA 3BPLB 1HYSD 4N3TA 3LOWA 1SHWA 1ZLEA 3U9PH 3AWGA 3U82B 2GUYA 5JTWA 4OF7A 1TZIB 1XGYL 3P3RA 1TQWA 4HAFA 4AV0A 2A77L 1HKFA 3QUYC 3RJOA 1U2CA 4IU2B 4M43L 4U2ZA 5BO1H 4R4BA 5C09D 5JPMC 3OGOE 3UBGA 2ZUVA 4RFEB 4R7XA 2OYPA 3L3GA 2F1BA 3PJLA 5ALCH 3NYKA 3IK2A 1X4ZA 2R51A 2UZIH 1RIHH 2JCCF 3OKKB 2CE6A 5AVQB 4TV3A 1GHFL 1PKQE 4Y4HC 3FN9A 4N9GB 2VSDA 1DQMH 4P2QD 5IOKA 2VAJA 2WIIA 3GRWL 5ABZA 5KW9L 3VXQB 3CVHH 4AQEA 2NNFA 2ZYHA 1RK1B 4I3RL 4AZ8B 3STZA 3OWEA 3NEOA 3TN0C 1JJUA 4WU5A 4LSTH 3MKKA 3S36L 1NCIA 4GO9A 2DQJH 2YAHA 2VR6A 4KK9D 4JANB 3KXFE 4RGMC 5F3HB 1R46A 2YAQA 1N6QH 3QORC 4WI6A 2R7EB 5EZLA 4PLNC 1UXMA 2BMKA 3CDZA 1DQQB 4PV8B 3GRWA 2IDUA 4A67A 4PRIB 2PP9A 5KSUB 4MJ5B 4AWJC 4JFDA 3QULB 5HDBE 5HHPA 3IMBA 2XYBA 4E9TA 5TF1H 3V4PH 2AI0H 3D18A 1IVTA 4U7MA 1BA9A 3OR7A 3DROB 4OFDA 1QUNA 3A67H 3MO1A 1KB5B 1XFPA 3SKOB 2ITEA 3IS0X 5E6IA 2NY4B 3WKPA 4U49A 3GB7A 5CWSB 4DFHA 1KC5H 2JJSC 3DDFA 3WEOA 4NQSA 5JIMA 4H5SB 2GI7A 4FHBD 2WW8A 3QUKB 1EUUA 2EUXA 1DO6A 1EFXA 5KBDA 5DHVA 2X9WA 5FFGA 2VO8A 1JZDC 4DGVL 4D0CB 1M6OA 4M7JL 3FRPG 4JFFE 5A16A 5CEZL 2HPOA 3JWDL 4HCIA 3MFGB 5I76B 1IVLA 1GCYA 4MCMA 3RY6A 3IGAB 2K6WA 4RMVA 5EV7A 2BXYA 3T4AC 5ICZA 3QHZH 4P57B 2O6EA 3GSNB 3Q1SH 3ARED 3CU7A 4TL5A 1L3WA 5D2NB 3SDDC 5L9DH 1UKQA 3OR6A 4PCTA 1IC7L 4DKFL 1ZS8B 1EBPA 1PF3A 4NN5B 1ZTMA 1I4FA 3U9WA 5AD0B 2EDNA 4LKCB 1BVLB 4CSPA 2VAAB 3A6CL 3CHRA 3QQ4A 1ZV2A 2WK2A 2IQ9L 1CWVA 5HDWA 1KXVC 2CLRB 4B3VA 1QSED 3ATFA 2R56H 1I7UA 5L88L 3V5DA 1MCRA 2UZXB 2R2EA 1RUKH 3EUUA 2OMTB 4PJ9B 5KN5A 1D9KB 3WUWB 2H32B 1JNNH 2O5YL 2R2BA 1KJ2H 3IGLA 4GINA 4ORZC 3P73A 1NC4D 2BOCA 4MA7H 4PI2A 1H8NA 1RJZA 5AVVB 3TYGL 1ZE3C 5I71C 2XIIA 1KEGL 3BYTA 3QEUB 3S5LG 3ZTNL 4NN6B 4OGAC 3CQPA 5ANHA 3ULVH 1MI5B 3GMPA 3QCTL 3UZVA 3HC3H 4HH8A 3HHSA 4YBHA 3SOBL 1B4JH 1KELH 3BP7B 1ZEAH 4O5LH 3CVCA 2P5WB 3VDAA 3OAYK 3Q8BA 1LGVA 3DC0A 4IRZL 4NCDA 5D96B 4Z7OE 3TT1L 3Q6FA 1N3NA 1P6AB 5I19L 3FUFA 1UM4H 2H47C 2ZNXA 3SY0A 3N40F 2PXYC 5BUGA 1Q94A 5B1BB 4HKXA 3IJHB 1AGDA 2VXSH 4IHOA 4D8PA 3BGAA 3O6MH 5GRVL 4NZRH 3LPPA 4MMXC 3EH5B 5DWPA 1XF2B 4X4XA 2QZQA 5J1TC 1QNZH 5DHEA 3WKQA 1LVEA 3DPBB 3WEXA 3O9WD 2X41A 1A4KB 2VMJA 5I1IH 5AVUB 4MNQA 4HS8L 4R97B 3S3CB 4P06A 4OZGF 4D9QE 3PIQB 3CHOA 3QR1A 4EUPH 4M48L 4Q9CA 2BY1A 4QF1B 4Y2OA 4OZFA 1ASPA 3BCFA 4QY8A 4Y7MA 4AX3A 4ZUTB 3UG3A 1NIAA 5FUOL 3EHBC 3APCA 4N24A 1IKFH 3VGBA 4P23D 1TKWB 3VFPA 4XP9H 3HI6L 3SYPA 2HRHA 5FGCE 4WFHE 1U21A 1MRCL 3IBOA 2DWTA 5EU5B 2HA1A 1BZQK 1CFMA 4UT6H 2VDLL 1RSYA 2KHAA 2M2DA 4HEPA 2FJSA 1G0XA 2EDFA 4HSCX 2VDOL 5KVEE 1JZ4A 3QZBA 1T2QH 2CM5A 3K1KC 1E5YA 1GOHA 1OAXL 4YHNB 4G8AC 1ZY9A 3DRQA 5AAMC 3GXTA 1WISA 2AHIA 4GBXB 1RJLB 4LOUC 1QEWA 4UINL 3W0WA 3OHMB 2AXJA 4JG0L 3DSNA 3MNVB 1SBSH 2N59A 1WPCA 2IEPA 4ZDHA 3V6FA 3PV6B 2FHBA 4XVJH 3I6LE 4R4NC 5CP7A 1A2YB 3QE5A 2X1QA 5C6TH 2X40A 3LHAA 1QZNA 5D7JC 4XBMA 3HG2A 4JW3A 1G7IB 1N5YH 1DVFB 5DJ0A 3LDBC 2BHYA 3UC0L 1D5ZA 3H9SA 4U1KA 5AZUA 1SHXA 1KY7A 1J18A 5I1HL 5KYNA 1TU2A 4KJYA 3UZEA 1ZHBA 4IU3B 2V9RA 3ME0A 4LCWB 3EJYD 4W4OA 5IBLC 2ZUYA 4J2QA 1WGVA 2MPAH 2BC4A 5D7LD 5TTRA 1PL3A 1DYZA 2E9JA 3RWCB 4F1SA 4S2SA 2ZG2A 4ZAKA 3LN4A 2VXUH 4FZEL 3W39B 2L4OA 3PU7A 5F7KC 2V7NA 5C2BH 4ATWA 3PE9A 3TNMB 2QQKL 1W80A 4URKA 2JKRM 5FA3B 5ANME 4GRWE 2WBJC 2J88L 3QIBC 1AGFA 1MFDH 1TCRA 3LZOA 4FQXC 3GWJA 5EZPA 1NGZA 3QH3A 3IGKA 3DO3A 4N5UA 5HJDA 1IILE 3W2DH 1YEWA 2LTQB 3F84A 2D4DA 3C8HA 4HP5A 4ZMQA 2IG2L 1FAKT 4UAHA 2QGBA 1OCWL 4NRXA 2WP3O 2FD6H 4ODHL 4FQHB 1WDAA 4ZO8A 3VD5A 4YN3A 3T6ZA 4JB9H 3ULVF 2OZNA 3FSOA 4JQXA 4MX7A 3T0XA 2CPUA 3V4UL 4NIKB 5D1XB 4H0GA 1P5UB 1WIPA 2VLME 3CSYA 2F19H 4GT7A 3UCRA 3KWTA 2O30A 4QRBA 2F7PA 1NGXB 1AGEB 4XP5L 2F5BH 4X5QA 2BIMA 3H56A 4L05A 4BD4A 3BI9X 5JPNC 2BM3A 4FQIH 5KVEL 3IF1B 5B3JF 3U4KA 2UXGA 2D4FA 3KPSE 2HVJA 1WBYA 1XGRA 5ID1A 3KPRA 5I28A 4LP5A 1IAIM 1K2DA 2WY3B 2Y1AA 1A9BB 2H3XC 3OKMA 3A24A 3FUKA 2H2PD 4W81A 3STZB 1T1WB 2JCCE 4P46B 4PRHD 5D7IA 1CYGA 4MS6A 2WQXA 1XTLA 2GTZA 2XXGA 3BZ4B 4ZTOL 4YSTA 2JB5L 1NGWA 3APNA 3DLQR 1UWFA 2P5EA 5JHLL 1SY6L 3ULVC 3QIWA 1LO2L 4G8IA 2BMKB 3CDZB 5EZLB 4ANVA 1RPKA 3QCVH 4J3VA 4NUGL 4O58H 2COVD 4EDWL 1T3FA 4U1HB 7CGTA 3TNNA 1GGCL 3FUIA 4MD0A 5AW9B 2WTOA 5DUBA 3D18B 5B38G 1BQLH 3CMOH 1XIWA 3TJEL 4BV1A 3UX9B 2WCSA 4K3HA 1QUNB 1FL5A 5A2IH 3EO9L 3V0VB 1SY6A 1OSPL 4NPYB 4Y16B 4BJLA 1AGBA 3ZE0B 2XN9E 3ASOB 2GITA 5CJQH 2J8UA 2KLRA 4NAMA 5C71A 2BS9A 2YWZA 3T3PF 1KLFA 1IC4L 3II2A 3VRLF 4ES9A 1M6OB 5KBKA 1F5WA 4YLQT 2JIXB 1BCIA 3EJZD 4I13B 5DSCB 2NXZD 1QRNA 5BQDA 3CK0H 3BGFC 3DJSA 5ICZB 2H9GB 1A7OH 1GGBH 4IRSB 3ZLQC 3HBQA 4PBVC 4ZX3A 4ELMB 4LB8A 3CVBA 5JPMA 3OR6B 3BSHA 1BDYA 1HHHA 1IGFH 1BOGB 2PCFB 1I4FB 1OM9A 1WIUA 2UY6A 3N50A 2LU3A 4WTZA 5I30H 3QQ4B 1U2YA 4ZUUB 5IK3A 4LDCA 3L4TA 1UUNA 2XA8L 2A6KB 2HFGL 5AVTB 2CR0A 3M6DA 5AWNH 5F9JB 1N4XL 4YBLC 3FB5A 1KN4H 3SZKC 5DJ6A 3EH4B 2R2BB 3P69A 1ODUA 4P3DB 3MI6A 4N8VA 3P73B 3O3AB 2D3LA 3QDGA 2BOCB 4JPSA 1U8HB 3G6JB 2O1AA 1RLWA 4ZYKB 4OQTH 2VH5H 5AZ2H 4NHCL 4HD9A 3SPVB 3KPSA 3GMPB 3TURA 3UZVB 2GQHA 3WY3A 1GW6A 1XSKA 2OI9C 3NBNA 4XXWC 5KSVB 4FULA 4HC1A 2WZAA 1V5JA 3AT8A 5ENWA 1N3NB 3GHBL 3O2DA 1L6XA 5CZXD 2VW6A 1SQ2N 1JZ8A 3FJTA 1IAII 5CGYC 2UXTA 1Q94B 1WHPA 1QI4A 1EMTL 5LXGL 2OK0L 1T2JA 2WLYA 2NX5D 2Z4QB 2N1KA 3I85A 2VMFA 1MN4A 4QHMA 2VABB 5KVFH 1OT4A 4H13C 3L5JA 3JTBA 4NYLA 3DUHA 5E9DD 4G83A 1M56B 1XF1A 2D03H 3FQ2A 1AR1D 4MNQB 4UOW0 4RRPM 2XETA 2YD6A 1XMEB 2I5YH 5E2UH 4HV8B 3GT6A 4ZD3L 5F89A 1JF1B 2F74B 3CIQA 1A3RH 2VISA 2X12A 4Y2OB 4QY8B 1M71A 4Z76A 3CDFA 3DO4A 4D7PA 3MGAA 3MLSL 3C5ZA 3MV7E 1P7KA 5I8OL 2JCWA 4HSAC 1KXVA 1WTLA 4OZGE 5DRWB 1P4BL 3C5JA 2VDQH 3WIFB 4HALA 2XJKA 2DICA 4Q6KA 4AUYA 4DUWA 4F5CA 4IKNA 4LGPB 2VN7A 3K0YA 2Y1YA 1QSFE 1WF5A 3FT3A 3GSNH 3JV0A 5LAPA 1SJHA 2ICWJ 5LLIC 5AALA 4K9EH 2R0LH 3DA0A 5FV1L 3DRQB 5HY9B 3QAZB 3U9UA 4UAOB 1QEWB 2VDMB 5LB1A 3C60B 3DSNB 3R06A 3X14A 3ZMNA 1N0LB 4YFLF 5EN2B 4B60A 4E5XG 4R0LA 2DYSB 1R5WA 4WHYG 4N0FA 2ERJC 1F45A 4HWBL 2H32H 3KYNB 1XGPA 3K2KA 4ONHA 2ZAHA 3VGDA 4XGZB 2FYYA 5DJ0B 3O6FD 3NABH 1Z6JT 1HHGA 4AUUA 1D5ZB 3H9SB 3N0PB 1SEQL 4U1KB 4AM0Q 4IBTA 4CMHC 2IPUK 4XAKE 3O2WL 1LO0H 4KJYB 3QDJE 5FDYA 3FU7A 4X5PA 1G84A 4NQCE 3ME0B 1SF5A 2UXVA 4NO2A 4UBDC 2ICEC 4WUUD 1W2KT 4KNSA 4M1DH 2WGNB 3FHEA 1DVUA 3C87A 3HS0C 3LZPA 3MKGA 3U9PL 4ZOBA 4WI3A 4IMKC 3LN4B 5HDQH 3DECA 3T2OA 5TDOB 4ABUA 4BDVA 3ZYJA 4PUBH 4FC3E 4X7EC 2CNZA 4TOYH 4A63A 2Z7YA 3QG7H 1F90H 3O4LA 1I7TA 4ZOCA 5BO1L 5C2UB 1TCRB 1CPUA 3QH3B 3X3GL 1Y7VA 3CLEL 5ALCL 4X98A 2DJ4A 2BVTA 2ICWI 1K4CA 5F7NC 1RIHL 3G08B 1NDGA 4FXGC 1IO4C 1DQML 4Y5XC 2HX7A 4TQEH 5FO7A 2XU9A 1WVZA 3OHXA 3RWJA 1GR7A 3GJFB 1SNRA 1EXHA 2ZAGA 1N64H 3P0VL 2V5RA 3AB0C 4R2GB 2WKLA 2NLJA 4LSTL 3EZ8A 3WMQA 3IJ9A 4WO4B 4F7MA 5LBSH 2APXA 2V9UA 5D4JA 5AAMA 2VC2B 1UATA 3FT2A 4JMXA 2AEPH 4XMVA 5BVJA 3ULVE 4AKPA 1N6QL 2NXYD 1T1XA 1CTOA 1MW3A 1N7MH 5A6LA 2DQIH 1OP9A 4KPHH 4BQCA 1A7PL 3II1A 1XGRB 2QV2A 4Z7NF 1EDQA 1H5BC 3CVHA 4XVSH 1F58L 4PV9B 5TF1L 2WC7A 4QCIA 3OKMB 4NKMA 3V4PL 3CFJA 4RGNE 4QRRE 2AI0L 1DFBH 2JTDA 1JZHA 2JKSA 3OB0K 1OIOA 4I48A 1AJ7H 4OI8A 3D0VA 3FF7A 4UYPA 4QHPA 1NGWB 2VLRE 3ZHFA 3BVNB 4F8QA 1KC5L 2CGYA 5IHUH 2DBLH 4FLHA 4PIBA 1H6TA 1R17A 1GZPB 4Q4IA 2F1AA 1T3FB 2B9AA 1NMCC 4HUMB 4NCC1 4TTGA 5GRJL 3TNNB 2WUBH 2N7SA 1QASA 3KVQA 1QLFA 2IAMC 5F96H 1FAIH 1XIWB 5K9JH 1HDMA 3NCEB 4Z7UF 4M1CC 4PRPE 3FZUD 4LNRA 4PWKA 4L1BA 3QHZL 5JXED 4IBUA 3Q1SL 4FQXA 1MWOA 1DVSA 5L9DL 1YPZB 1JWMA 1HK6A 3F7KA 1AGBB 3FFCD 5DQDH 5JW4M 4LRIA 3QNZA 2J8UB 2Y3NA 4J2XA 1WWBX 4IRJD 3VGFA 3FCTB 4WI4A 4JO2H 2R56L 2ZOKA 5EULV 1G7JB 3OPZH 5J7CC 4EOWL 3EGDB 4YNYA 3ZQ9A 4MD5A 3LZFH 2H6UA 4CJ0A 4Z3EA 3KG5A 5HYSB 3T1FA 4ZTPH 2CHXA 4R8WL 4CUCA 3T3PE 1KJ2L 4NQED 3VU1A 5GZOD 3QXDB 1HHHB 3T3MB 4MA7L 4OZFG 4PJXF 1R3HA 2FEDD 3PQYA 5GGVH 5SX5K 4DWHA 2J56A 1DDHA 4ZMTA 3C6LA 4Y1AA 5IK3B 4OKVB 5D6DA 2IPKA 4FYSA 4QGYA 4W70A 3ULVL 2IWGA 4FMVA 5DGQA 1FP5A 3HC3L 43C9A 4KKAD 1B4JL 1KELL 5BUAA 2V6HA 2PPCA 1ZEAL 4O5LL 1FF5A 1WSST 2PTTA 3S3JA 5AB9A 1NFDE 1BSIA 3D08A 2BS8A 4K9EC 4MCNA 2HRGA 4Q4EA 3QWNA 3T04D 3EO0A 1JPSH 4FXLA 2WN2A 2W9DH 5HHOE 3I9PA 1UTDA 4L29A 5AKTA 5HYFA 1ACXA 2VXSL 3VQ1C 1CGYA 4LLMA 2GJPA 5C9JA 3O6ML 4BXSV 4NZRL 2CKBA 3C6SA 3DX8A 4HOWA 1GJUA 4PR5A 2IH8A 3NSDA 4GXFA 4PJ9C 1QNZL 5E8DH 4QHNA 2K3HA 3PREA 4CNIA 4XCEB 5EF2A 5I1IL 3ZL2A 1BM3H 3LVTA 1QBMH 5ENWB 1SJEA 2Z1KA 4OU3A 1MCEA 5J6SA 3FTYA 4L4VD 5FK9B 4XHQA 4DGYH 4DPRA 2TRHA 4WDIA 3U83A 4A2FA 3G5YB 4DVBA 2G9KA 2OYKA 2ZWKA 4G8EA 4OSUH 4KDVA 1V3LA 3D06A 4A1RA 2WXKA 1E4XH 4AVKA 1OOAA 3BIKA 3PLYA 4UCFA 4NYLB 2X70B 4XP9L 4ZS6C 3WIHH 5HDLA 4MB4A 1U8JA 4MDIA 3QQNA 3UGXA 4MWFA 5BZDB 4UT6L 5AOMA 5IMOA 3UTPE 3RGVC 2H3NB 2VXQH 1E0OB 3L2NA 5F89B 2WXMA 3OZ9H 3BZDA 1T2QL 3B5TA 4QT5A 2VISB 1TQTA 4P2AA 2BK8A 4M9OA 1M71B 4Z76B 3A47A 2B77A 2KZWA 3EFDH 4JZJC 1KV7A 2MEJB 4HHAA 4X0NA 2ZJSL 5F93C 1AXSA 4F20A 1ZA6B 3C5ZB 3S3PA 3RVXD 1SBSL 3N0AA 4J3BA 5FR3A 2GK0B 3CSTA 4XVJL 35C8H 5C6TL 1IUZA 3F7QA 5DT1H 3TVMB 4RMSA 1DBMH 1HI6A 2YBRB 3O8XD 4APQA 4MXVE 3D33A 1A47A 3FT3B 4FNSA 2DM2A 1NBYA 1OF2A 1N5YL 1SJHB 1O5PA 4ETYA 3AG2B 2Y0SA 4PFEA 3T6VA 2AKRA 2OTWB 3KWWA 1ZAGA 2B1AL 4JGJA 4I7ZC 1DR9A 3J07A 3MZGB 5L0QB 3QO0A 4UF7C 2R23B 3R06B 2EIJB 3VDBA 3X14B 2AJZB 2PP8A 4RX4D 2IDTA 4GB9A 4TPRH 4LMQE 2MPAL 4RMTA 3OC8A 3BN9D 4R0LB 1MZZA 2EABA 3V6ZA 4XXWA 2GJ6D 1Q38A 1XGPB 2VXUL 1SDYA 4TVPD 3LRLA 1U93A 2J2ZB 2FYYB 4GBXC 5C2BL 5HD8D 3VRJA 2CDFA 2P42B 4K4KA 4LSQH 2DMKA 2C7UA 1EAQA 2OXHB 1MFDL 1OE3A 1P4LA 5EIIA 4M5TA 2XWTA 2W94A 5DEFA 4K3JH 2HVKA 2PTVA 3EBAA 3NJIA 4WK4B 3RG1C 1HU8A 1CQYA 2FD6L 5C3TA 3OKNA 4CA4A 4P2RA 4FFVC 4JB9L 2BVPA 2Z93B 1I1CA 5DWUH 1U8OA 3D39E 5CXPA 3SDCA 4BZ2H 1FCGA 4NAQA 3BESR 3CZJA 3FHQA 5DEJA 2F19L 1BG9A 1CFTA 1I7TB 3TFKD 3Q2NA 4JFZH 1UT9A 1TQBC 5FIEA 3R19A 4FTVD 3EYOA 3JV4A 4PRNA 3WSQH 2F5BL 5CINL 3WD5H 3UYPB 1JNJA 3ARDB 4X4YB 2HUHA 2H1XA 4X98B 4FQIL 4P05A 4ENEC 1K4CB 4YDJA 1FL6A 2OP4H 3GZPA 4GP5B 4PGCB 1IEAA 3G5XB 1NDGB 3FN3A 2ZWNA 3NUKA 4UDTB 5J56B 2IOIA 4PB0H 2X3CA 2X4SA 3OHXB 4CVZA 2K6ZA 4R5VA 1DZBA 5LJYH 4CVXA 2A6DA 3A4DA 3RWJB 1F00I 1PY0A 3DIVA 3P2DA 5C0CE 1A22B 1JERA 1ITBB 4OM1H 5BZXA 5IB5B 4BFBD 3QYNA 2GSIB 2Z8SA 5CS7A 1TLKA 4F7MB 3MDJA 3OX8B 1JCKA 5IHHA 4NERA 1HX0A 5EZOH 2E7HA 5ESVA 5BVJB 3VXRA 4LLAA 1I9JH 4LVHC 3WIIH 1AC6A 1WCBA 4KO6A 4WTZG 1QVOB 3BQUB 7TAAA 1CLYH 3QCVL 3CCHB 5JIQA 2R4SH 1MIML 1PIGA 3DOSA 4O58L 4QHLA 4F33B 3I9GH 2GFBA 1TZAA 2B3IA 4QCIB 4B5EA 4NKMB 4UOW1 3CFJB 3GSQA 1BQLL 3CMOL 4MD4A 2Y7SA 4I48B 4QAWA 3H9HB 1KG0A 1DN2A 5I0YA 3EOAA 2Y07H 2VDMH 5DZAA 1J9RA 5ACZB 3HOGA 4Z7NE 3KYMA 3POCA 1NOLA 3A6BH 2F5AH 2QGCA 5KVFE 2E7LC 1U3YA 4N8VG 5D7SH 2HKHH 5DDHA 3HG1B 5CJQL 5FM5M 3DO7A 1DQKA 3NSFA 4N5ED 1YN7B 3BKMH 3TESA 4IMKA 1I3RA 4IGBC 4LPVA 3KYOA 1QLFB 4N2LA 1THAA 4JLRA 1OWWA 5DURD 2NY5H 1HDMB 3CK0L 5GHWH 3S8FB 1A7OL 1GGBL 4NM8H 5IMLB 3PWVB 1OL0A 4XBGB 5EO9B 5ETUA 3RY4A 4RWYL 3FQUB 2WOBA 4MBRA 1B0IA 1IGFL 1K4DB 2X4UB 1QO3B 3NDZE 1SOXA 2EDWA 3V8CA 4IDLA 1A1OA 1GYUA 2YRLA 2WYHA 1DL7H 4FXGA 4Y9EA 2O72A 5DA4A 2CBTA 5J06A 1GC1H 3PJSB 4Y5XA 5D2NE 1KYUA 3AQXA 5AWNL 3TPKA 2IMNA 4JY5H 4LCUB 5D1ZC 4YNYB 1OE1A 1U8CA 4MD5B 1SDDB 3UIYA 5HYEA 2NT0A 1MZYA 3T1FB 4XNUH 1BBJB 4PP2B 5EG6C 1R5VA 1E8YA 4YQXH 3O41A 3K4AA 1AACA 1U3ZA 4IOFC 2WLIA 3RVWC 4NZTH 2GHWB 1R3HB 1SUJA 3PQYB 1G7PB 1FYTD 4O4YH 5J0BA 1BPVA 4DKEL 1DDHB 1BAFH 3C6LB 2VH5L 3UAJA 5H37A 5J1AB 5AZ2L 4QI3A 5D7KE 1RZ8B 3B7TA 3GJFH 5I16B 1WD9A 1UQSA 3DUSB 2C4FT 5G4OA 3CZEA 2AQPA 2EEAA 3EJRA 2VZOA 4MQ7B 1TVDA 2MMXA 1JYNA 3LH9A 3VFTB 3EYVB 2VC2H 2NUTA 1L0QA 2I9TA 5CU9A 1MI5E 1INQA 3KHQA 4KVCL 2CM6A 3B8SA 3RIAF 4L29B 5FV2A 1EEYB 1F97A 3NPSB 4OQTA 4QWWD 5BRPA 2P5WE 3IJSA 3FO9B 1BREA 2QSTA 5HJ3A 5I74B 4AH2B 5LDSA 1FE8H 4PR5B 5KVFL 3H3KA 2B1HH 2YN3A 3PGDA 2C9QA 1OTUC 5EPMA 4QHNB 3QIUB 3B2PA 2IAMA 3VXSE 4UIMA 3QP3A 2X6AA 4S1RH 1SJEB 3OMZA 4LCVA 1KB5L 2I5YL 4NQUA 2XV3A 2XPGA 5E2UL 1FFPA 4YDIH 1A6TB 3ATEA 4JJ5B 3ZMRA 2AVGA 1A3RL 2PWGA 4RFNB 3T6WA 3SDXF 4L4TE 3MVSA 3IAGC 2SODB 4OD2A 4KKCD 4FNQA 5EU6A 1NEUA 5LGKA 3ECBB 3ZE2F 2Y7QA 2P24B 2VDQL 4ZFOB 4FNLH 1WYJA 4XNXH 2FX7H 2VDKB 3B9EA 3GXNA 4NBZB 4ZODA 1JPGA 3UAEA 4MDIB 2X9XA 4ZFZA 4ZMVA 2NTFB 3GSNL 3RZCC 4KVPA 4PJIF 1NBVH 1XF4B 5KUMA 1G1OA 2J44A 3FQ4A 4QT5B 2ZOLA 3VWKD 2PWDA 3K2UH 1JS4A 4JVUA 1JXKA 1MCCA 2QVMA 4K9EL 4WJKB 2R0LL 4I1RA 2VLJA 1MVYA 4HHAB 1AXSB 4JFEA 5F9DC 1GZHA 4DEPC 1JGVH 2EXYC 2WM0A 1NL0L 2IWEA 4JKNA 3AT9A 5IQNA 1BEXA 4I9WE 4L8SA 4GAAA 3WHE1 4JFHD 4Z7UA 3CWGA 3OKLA 4DNLA 1QHQA 4APQB 1KIRB 4R4FH 1YLBB 4AYBA 1OF2B 3HFFA 3NABL 4GS7B 5F6IB 3KWWB 1NCNA 5C08E 4TLSA 5IW1A 1PG7X 1LO0L 2BY3A 2PCYA 3F6JA 4LOVA 3QO0B 1WE5A 3UTSD 1OAUH 3ARBD 4Q89A 5H2BB 5A3ID 5I17B 2O5ZL 5F0PB 4M1DL 1QR4A 1U8MA 3QQ3B 2Y2TA 3CPLB 4LCWE 5HDQL 4O02B 3ARRA 4L9DA 4KKNA 5AEAA 2BVOA 4P49A 3RWEA 4DZBB 5K9OB 2P7TA 4LXFA 4RZKA 4PUBL 2VR4A 4L1TA 2CDFB 2F6AA 4TOYL 4WFFE 2V2XB 3QG7L 3LS4H 4L3EB 1I9RH 1BOYA 1KPUB 2C7UB 3HIZA 3LEXA 2WQ8A 4PJXA 5LKNA 1KB3A 3ML8A 5K1VA 3HR5A 2AEQH 3P4NB 1QFOA 2XWTB 1OTSD 1YA5A 2NDGA 5DEFB 5CCGE 4ZQTA 2PCPB 4K7PX 3L1FA 2JI1A 5HGAB 2AEOA 1UD2A 2XTJC 2IALB 3NA9H 4P2RB 1PSKH 2DRUA 2GBTA 3OJMB 1V10A 2C3WA 3L48A 4TQEL 2NY5C 2YAEA 1U8OB 4PJGA 3ZKND 3SDCB 4EI6B 3NN8B 4X8GA 1AZRA 1N64L 1H3TA 3CSGA 1RP9A 3LEYL 3VXSA 3VI3F 3IPFA 2C4XA 2CBPA 4OCMC 3RPIA 3HE7D 5F1SA 3BWAA 1U3HB 4K07A 3TZVC 3JV4B 4NO0D 2WKGA 4PJ7F 2BRQA 5LBSL 5BPPA 1RURH 3F7VB 1GSMA 4JZJA 5D1XE 5B8CA 1MELA 3GBLA 4PJBA 5SWZD 1N7ML 2DQIL 2OMVA 1GC1C 3BVVA 4KPHL 3FSAA 4CVWA 3MRGA 4HJTA 4JQIH 5EBGA 2NCMA 4B5ZA 3VSQA 2X4SB 3BISA 5AUMA 1P4UA 4XVSL 5BS0B 4TNVK 3OGCB 1RUQH 3LQAH 5F1NA 1ETB1 3HZYA 2BWQA 1DFBL 1DJGA 2GT9A 5CFAA 6PAZA 3VFWA 5J13B 3VD9A 5LBSA 2F54E 4Z7QB 1AJ7L 4QRFA 1C9SA 4XOAA 3TBVA 1YDPB 2WV3A 2AAAA 5EU4B 2GYSA 4PJ8C 4H4NA 2JKJA 1S9YA 2Y7LA 4A7TA 4ZUSA 1GJIA 4MNHA 4FADA 1FBIH 2FJFB 3IDNB 1WCBB 5IHUL 2DBLL 2OCFD 5JOFA 3DXAD 3MNWA 1TIUA 3MGTA 5LGYA 1B6UA 1QI5A 4QRQA 2WUBL 4WO4C 1OB1A 1P84K 3QUHA 3DURB 3GSQB 3QUGA 3TEWA 1I3VA 3MGOA 1FAIL 5F96L 2MQ0A 4NCC2 2VQTA 5ICYB 4KHXH 1CICB 2I24N 5K9JL 1KG0B 2ODHA 5L6YH 1P6WA 1F02I 1LILA 4HG4J 3SDYH 2VZSA 1KBKA 3ZRSA 5DQDL 2VZ1A 1BD2D 5K93A 2Z0UA 3JT2A 2APBA 3L9EA 1SMAA 5KTEH 2AXGA 5SWQB 3DO7B 2EIEA 3FO1A 5CD5C 3MBEC 5CEZD 4HH9A 2Y6SD 4JO2L 1I3RB 1CFSB 3W9EA 4PGEA 3KYOB 3QNFA 1LE9B 4JLRB 4I0PD 4J8RA 1G9MH 2VN3A 3OPZL 2FL5A 3LZFL 1T5KA 1XBDA 4ZT1A 4R3SA 2Y5QA 3PAYA 4KZEH 2HZHA 3WJMB 3ZTDC 3NG5A 4LSDA 1WFTA 3QUXB 2HYMA 1UZ6F 4A2MA 5FM4A 5GGVL 2EO1A 4I77H 1CU4H 1FFOB 1JMXA 1II4E 2N0MA 3PPEA 2EQDA 3O3DA 3NVQA 4YHMH 5I5JA 2WN3A 1CURA 3LB6C 2EECA 4BXVA 1FPTH 3OLEA 4JHAH 4ELME 3QWRD 3FB6A 4E2OA 1KCKA 2FBOJ 2A0LD 2DZEA 4JE0A 4NBXB 4Y2NA 1CUOA 5LBVA 4QJ5B 3RWFB 2UZPA 3RNQB 3UROR 2J1WA 1RULL 4EUPG 1R5VB 3L08A 3CUPB 1JPSL 2W9DL 3DV6B 1OQXA 3ZKSD 4K71C 3WHXB 3KXFD 3MX0A 4S0SD 5EF0A 4S11A 4XPBH 3I02B 2PYFA 3FQRB 4YHIB 5EO0A 4D0DB 1KTKE 3P4MA 1UQSB 5DD6B 2WLNA 2X6CA 2DLFH 3CZSA 5E8DL 3G6JE 1I8AA 4GMTH 2YEQA 2C9SA 2H26B 5ITFB 2PYEA 3WNJA 1QBML 4WV1C 1T2XA 4W9ZA 4ZO9A 2BSRA 2I9TB 4ERSH 1NUNB 3T0EB 4DGYL 2E7LA 4QMEA 2R0KH 2DWEA 3IU3B 5IWLA 3IMTA 3GPSA 1KACB 2EINB 4OSUL 5HJ3B 2B59B 1DSWA 1GH7A 1FL3B 4EVNA 4B9KC 2DQFB 1M7IA 1E4XL 3CIAA 3BJ91 4G6KH 4X8JA 2DQGH 1UXSA 2FX8H 5EPMB 4IGBA 1UOVA 1DEDA 2QGDA 4OLVH 3WIHL 1WEJH 1I9IH 1IZKA 3I2CL 4WRLA 3IDXH 1IB5A 4YPGA 4JFFD 4B9JA 1G0YR 5F1IB 2VXQL 3ORJA 3BKCH 2NW2B 3OZ9L 2BH0A 1IT9H 3QCUL 3L9RB 4HLZH 1BLNB 4PLKD 1MAMH 5D4HA 2WLLA 3UTQA 3OKYA 4OD2B 2QELA 5EU6B 3EFDL 5EIIG 5HVHB 2VMEA 3CLWA 4QRPB 2YLKA 1LO5A 3BSGA 1TZ8A 5KZCB 4CSZA 4X5WA 2DIBA 1FZJB 1JRHH 4J3OH 3NK4A 5LVEA 35C8L 2Q8AL 2WVVA 3MU3A 3OB8A 3CG8A 5DT1L 3SDXE 1DBML 1F2XK 1KFAL 5CUSH 1G1KA 1ZT7A 5D1ZA 1BMGA 2XDHA 2DW5A 2WNKA 3MRPB 5D9SB 5HHMB 4A7QA 4A55A 4GLRH 3NZ8B 5AVYB 4D9RE 1R3IH 3HI1A 1W72B 3ZE2E 3R7QA 1NFKA 4QHUB 4U3HA 3FQXA 2AK1H 4NHUA 2VLJB 1BV8A 2JQAA 3P40A 2J3SA 5H4ZA 2H8PA 1QPXA 3VCLA 4XODA 3L5XH 3D9AH 2X4QA 4PJIE 2A73A 3BW9A 4TPRL 1CI5A 3X13A 3MCLH 1CN4A 4L8SB 1K3IA 4P2CG 1NIDA 4PYHA 4OVVA 4F9PA 3NCJH 3ASNB 1CD1A 2HFEB 1CI3M 2OLDA 4AOFA 3GKZA 3MRNB 1FZOA 4LSQL 4N0UB 5I66A 3HJEA 3FUJA 2C1OA 1J1XH 4LCCC 1BEYH 4HULB 1S4IA 4K3JL 1MG2C 3IFLH 4AV5A 5HYJA 3V7AE 2XTJE 4KRLB 1PQZA 1Z1WA 4ZMOA 4TSBH 3QXAA 4UZUA 1U8MB 1A4CA 4NUMA 1XEDA 1G9EA 3EDJA 1L9OA 2BVOB 5DWUL 1NDMB 2WWNA 2CXKA 1QMUA 4WU7A 3MJGX 1QFHA 1B6DA 2W9LA 3WFZA 5ACLA 3II3A 3LEXB 3T77A 5IVXA 4JFZL 4D9QD 2J5LB 3BPNC 4A7UA 3WSQL 1X5FA 3CZLA 5DO2D 3H3BC 3ZSTA 3UG4A 1BF5A 4IBQA 2BRRH 5BRZA 2OP4L 1L9TA 4TUUA 3Q13A 2V3DA 2CIKB 1TSHA 4BZ2A 4KK6C 4PB0L 3L3KB 4ODBD 1G9MC 2CKNA 4MAUH 2AJ3B 4PJGB 2X0UA 4WFHD 2JK5A 3Q44A 2Z0BA 1TZHA 4BWUA 2QR0B 3RPIB 3JUYA 4OM1L 3JYCA 3H2WA 4YZWA 2CCLA 2BWIA 4FFZH 4TLUA 3UJIH 4CADB 1CGXA 5EZOL 3OV6A 4HZLB 5KVDH 1I9JL 2X6VA 4LSUH 2FH8A 5IB4A 5B8CB 5E24E 3WIIL 4PJBB 1XZ0A 4U6XA 3QWOA 2CO7B 4AEFA 3PHQA 5FB8A 1CLYL 5DJYA 3QDMD 2R4SL 4J3XA 4F2ME 1CJYA 5DA0B 4H44C 1RY7B 3I9GL 3FYEB 3N1GC 4Q97A 5F1NB 4KO5A 4MA1C 4HPOH 2GT9B 3ARDC 1EXGA 3RX9A 5KJ4A 1LP9B 2QVFB 1R6VA 2ESVA 3C09C 4F1ZA 5CD3A 4RFOL 4H0HB 4A04A 1H3GA 5D1QD 3TBVB 2Y07L 2VDML 1ADQH 1PCSA 5DJ2A 3A6BL 2F5AL 1KBGH 4TTDC 4FCHA 5D7SL 4W9HC 1EGJA 2HKHL 5JOFB 4TSAH 2IAAC 3KJ6H 5EUOB 4E41A 5ESQB 4Z7VB 3BKML 4QRQB 2CDEA 4XPAH 2DS4A 3SKUD 1BVZA 2NYZA 2WYIA 4J3OF 4F8PA 3D12B 3GIZH 4BUGA 2BP0A 1OK8A 4U05A 1RZPA 2F0CA 1QD0A 5I6OA 2A2QT 1L9SA 5GHWL 2IV9A 1JPTH 4GAYA 5TGBA 3NSCA 5INCB 4NM8L 3BQUC 3OLIA 2NY2B 1TTRA 4JRYA 2R39A 4PS4H 3TJPA 1CC3A 3X1NA 3DOHA 3S9DB 4NRZB 4X9IA 1XCQA 2AXGB 4YXLH 5ELIA 1DL7L 1J1PH 5E8NA 1J8HA 4AGMA 1GC1L 4PGEB 1YPZE 3N1PC 5E2VH 4JY5L 5JO5A 3EJJX 2AV1A 1BJMA 4OFPA 3TN0D 4ZZKA 1NBZA 4XMWA 4XNUL 2WXQA 1CTMA 3TZVA 4YQXL 2VR3A 1KJ3H 4JM2B 4U33A 5H35B 3RTQD 4XPTH 4NZTL 1DZ0A 4O4YL 2OSLA 3D3VB 5BJTA 1BAFL 4JFPB 3EJUA 4J3OC 3H53A 3WFCH 2ORBH 2EIMB 2A4EA 1GS7A 4OFIA 3PWNB 2D0HA 3R4DA 1J0ZA 2EXSA 3Q2WA 1FN4B 3D4YA 4JHBA 2E74C 3F2LA 4Q6IC 3V0FA 1A25A 2VC2L 3QARA 5C3LD 1QYGH 3D4CA 4GFTB 3V5HA 1R3JB 3MX0B 4PRDA 4B95C 3IVKB 1W0WA 3MBXL 4XH2A 2EUZA 5E4OA 1EXUA 2DQHH 2PYFB 1AQDA 4BCYA 1FE8L 2CHDA 2CO6B 1JPFB 2B1HL 3PFQA 1XH3A 4FKHA 3VI3A 3L9YA 4F2MA 2PYEB 1EO5A 3G5VB 1Z66A 2H4EA 1FRGH 1BQ5A 5KYYA 5J3HD 4PJ7A 4S1RL 2IC2A 2D7TH 3N55A 4I3SH 4N1HB 4YDIL 3SDDD 2FIKA 2FJHA 1UJ3B 3PF2A 2YMOA 1P7QB 1XAUA 3DIFA 1N26A 4EN3A 4Q9QL 3ZY7A 3Q06A 1AQKH 1CG9B 2XN9D 3TCXA 3IDYB 5CP3H 3BMVA 4DP5X 1SVZA 3OXRA 1TTUA 1R5IA 3BSZH 4FNLL 1D5MA 4XNXL 2FX7L 1MWAB 2QDVA 4YXKL 3WUWG 3P4OA 1X9UA 5FO9B 1MQ8A 4JZOA 4H88H 4LMQI 1NBVL 2WQRA 2JKIS 3GRGA 4WKZA 2J6EA 4X7SL 2IXQB 3OG4B 4G1MA 2JQMA 3K2UL 2JI2A 4PJEF 2R29H 3Q01A 3QFJD 3UTQB 1EV2E 2G5BA 5IEHB 3P3TA 3QIUC 3RL2A 2O5NA 1LO5B 1DLFH 4FFYA 4OGAD 2ZSWA 1ZXKA 1QFWM 1JGVL 2YXFA 4O2FA 4OGQC 2WZ5A 5L2JB 3A5VA 2V8MA 4YFLI 1EAPA 4LVNB 3FOLB 1Z0MA 3BLKA 3OG6B 1NM4A 2WVVB 1JNHA 5CM1A 1NOFA 3GJEB 3B37A 4EI5C 4R4FL 1Z2KA 1JDDA 1VERA 2E3VA 1GYCA 4QEGA 5IZ7A 4HLJA 2Z9TA 4NT6A 1T0NA 4XMXA 2XXMB 1KTCA 2LAGB 1KCUH 4LP8A 3DYMA 3CXHJ 2FB4H 1OAQH 2W65A 3VCLB 4P5SA 1G9NH 4NKIH 5F0MB 1OAUL 2EVHA 3RVTD 4XXCC 4IS6A 3C75A 3IFPB 1E8ZA 1GKOA 2A73B 3BW9B 5HPOA 4OM0H 1SYSA 1IAKB 3HVDA 2YPLA 1AP2B 3EW3B 5HHQA 1N70A 1CD1B 1NAKH 4LO9A 1G4RA 1L9QA 5E70A 5AQ0A 2NZIA 4WV1A 4X9FA 5AOJA 1CK0H 1FZOB 1CDBA 1UOKA 3LS4L 1I9RL 3D7PA 3VFRB 3GSWA 1IM9A 4MA3B 3RL1B 2XKNA 2AEQL 4LLUA 3KBPA 1VB9A 2C9XA 3S0PA 2BSTA 3KLHC 4LHQB 4UB0H 1V27A 5AAPA 5L7XH 5HYJB 4Y9BA 2L7JA 2NY1C 1PQZB 4W9FC 3VH8A 1NEZA 2K7PA 4NWUH 1WS7A 1S7SA 2Z7WA 3NA9L 2I27N 1PSKL 3L3OA 5F6IC 5E1HB 5C0BB 3B3BA 1FH5H 5BRQA 3UTTE 1FNSH 1P9MC 4WU7B 5AOKA 4CDHA 4DEWA 1JYXA 1XVSA 1OEZW 4XNMB 4J39A 5D72H 4RQQA 3RDTB 1TQVA 3D48R 1DCEA 5IVXB 4FA7B 4HZAA 3IS1X 4HGWB 4YHKL 2XFXB 1RURL 4BM7A 1HEZA 1RK0A 2F53A 1VJSA 2QSCH 1ZHNB 4XVOA 5BRZB 4KY2A 2XVKA 3DVGA 1JFQL 3VXUD 5J8OA 2YLHA 1JNLH 2CO2A 3MV7D 3D05A 4LLYA 4JQIL 4YSDA 4JY4B 1G7MA 2MQGA 1RUQL 3LQAL 2WVTA 4QXGH 3UDWC 4LLWA 5IKCA 2YEZA 1W0VB 4JM4H 1Q4NX 3L54A 3NJJA 2WXPA 1QSFD 3QFDB 3TBBA 2YAOA 3IFOB 3L5IA 2HRLA 3T08A 4ALAH 1AHWC 5L2KD 1JZIA 3AM8C 3GEWB 2BP8A 1FBIL 4U1JA 2JLPA 1XZ0B 2F08A 3WFHB 1SHSA 1UZ8B