4E9TA

Multicopper oxidase cueo (data6)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
total genus 139
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9tA03
2IDTA 1V10A 3X1GA 3EHBB 3H4HA 1ETJA 5B1BB 3FPXA 3UABA 4DP8X 4YVNA 4YSSA 2TSBA 2DWTA 3V9EA 4GP5B 1KDJA 1HAUA 1ID2A 4W9ZA 2ZOOA 5I28A 1HFUA 4YVUA 3WIAA 2BZ7A 2EINB 1ZIBA 4KO6A 4A2EA 4A68A 2H5UA 3TU6A 1L9SA 4CSZA 2EIMB 1E5YA 4UANA 3ZBMA 3TASA 1SF3A 2VM4A 2XVBA 5I5MA 3NSFA 1WA1X 2HX7A 1PLCA 2MTAA 2YAPA 4N8UA 4DPCX 2PP8A 4KNSA 4M3HA 1E30A 4AKQA 5B3SB 1A8ZA 4YL4A 4DP0X 1ZDSA 4WKXA 1DZ0A 1E65A 5LDUA 1M57B 4ZK8A 4GP8B 1QNIA 2OV0A 1OE2A 1GR7A 5I26A 3NJGA 1BAWA 1WS8A 1FWXA 2JFCA 5ANHA 4E9WA 3HB3B 3PCYA 4N4YB 1NWOA 2LLNA 5B1JC 4NERA 3FSZA 2FWLB 3CG8A 1KDIA 2FT6A 2EILB 1CYWA 1MG2C 4NAJA 3UACA 2AVFA 2CJ3A 3WKQA 2VW4A 3AY2A 3CVDA 2Y69B 3S3CB 1NIEA 3T6VA 2YARA 3N2JA 3S3DB 1IBYA 5IY5B 3C75A 5B7EA 4A2GA 1PMYA 1ZV2A 3BVDB 2J57A 1JVOA 3FQYA 1A65A 2BO0A 3PLYA 5D4IA 1F56A 3GXUB 3AZUA 1NIAA 2OJ1A 2XYBA 4DP5X 2GBAA 2H3XC 3OMIB 4QLWA 1JZHA 1QLEB 4BWUA 1L9QA 1T5KA 5TK2A 1MZZA 1L9RA 2FT8A 4JHUA 3ASOB 3KW7A 1RKRA 1FFTB 4BWTA 1OE1A 1IBZA 4KNTA 3X1NA 5B7FA 3PXLA 2HZHA 2PPFA 3WKPA 3IBOA 1OF0A 4G72B 1AG0A 3JTBA 4HHGA 1BXAA 2A3TA 1GYCA 2PPAA 2UX6A 4E9YA 2DYRB 1AS6A 1ASPA 2YXWA 3DTUB 4GYBA 2OCCB 4L0PB 1URIA 2J5WA 4G7QB 2PPEA 1TKWA 1M56B 2WO2B 2AZAA 4P5RA 2FQEA 4DP1X 4DPAX 1KBWA 3CDZA 3S3BB 4HHWA 2QDWA 3QJVB 1SF5A 2BW5A 5PCYA 4UF7C 3EH5B 2P80A 6PCYA 2IWEA 2AANA 3CZUB 1SNRA 5I6MA 3TBCA 4Q8BA 1JXGA 1UATA 2WO3B 5I5JA 2I85A 4W1TA 4PAZA 3IEAA 2GI0A 1X9RA 5B1JA 2UX7A 2UXTA 5PAZA 2GC7C 1KGYE 3FU8A 4DP9X 3FU7B 4KO9A 3RYMA 2VW6A 3X1EA 2IWKA 3T6WA 3V9CA 1W6LA 1BYOA 3S8FB 1JZFA 1SDDB 3U25A 5I6LA 3AG2B 1SHXA 2FQDA 2N0MA 2YAEA 2XXFA 2YAMA 3EH4B 3NP3A 4AKPA 3NJFA 1IKOP 4YSCA 2XX0A 4BDVA 3PPSA 2Q9OA 1EZLA 1NWPA 1J9TA 2NRDA 3QJSB 4PCYA 1AZUA 1PZAA 2Y1AA 3MX0B 5D4HA 3FS9A 2YAOA 3FU7A 3ZIYA 2GB2A 2BP0B 4KNUA 1NIBA 2YAHA 5F7AA 4YSTA 3FPYA 1A3ZA 4BXVA 1W8EA 3NSDA 4AI7A 1L9OA 4ENZA 2BWDA 4A66A 5I6OA 4E9RA 5I6PA 4X4KA 1W6WA 2FQFA 4DP4X 1ASQA 2Q5BA 3PAVA 4YSRA 3ABKB 2R7EA 4G70B 2VMJA 1V55B 4EF3A 3H4FA 2GSMB 1TEGA 1XB6A 1OCZB 3FYIB 3ASNB 3FU9A 5I5IA 2XV0A 1BQ5A 4DP7X 1PZCA 1PF3A 3DIVA 1BXVA 1OOWA 1A4BA 4KOCA 1TU2A 4BWWA 2HX8A 1PNCA 1PY0A 3FQ1A 3OM3B 3JT2A 6PAZA 1SHWA 1SJMA 3WG7B 2WSDA 1PZBA 5B7MA 2IDSA 2XV2A 2PPCA 3T9WA 2H47C 3MBWB 4DP2X 1KCBA 4MFHA 3CDZB 4YSAA 2BHFA 1BXUA 2QPDB 3OQRA 1E5ZA 3BQVA 1ET7A 5E9NA 2CALA 3KW8A 1NPJA 3NJNA 1SFDA 5AZUA 2I7OA 3T6XA 3NJJA 3UAAA 4F2FA 2XU9A 3AG3B 1PLBA 1NZRA 3SBQA 2DY2A 1NIDA 3QJQB 1AZNA 2PP7A 1JZIA 1V54B 4GY4A 1KYAA 3S8GB 3QQXA 4F2EA 3TBBA 2IDFA 3D12B 1PAZA 2CUAA 3UGEA 2IDQA 2R7EB 2EIKB 4K9JA 2E86A 3EF4A 1WS7A 2PCYA 1AOZA 1KBVA 4HCGA 5A7EA 4A2FA 2XLLA 2ZONA 3OMAB 1SFHA 4GP4B 2P80D 5AFAA 2XWZA 2PP9A 3QPKA 2DYSB 7PAZA 1MZYA 1OE3A 1OV8A 1VLXA 2JXMA 1OCOB 2VSKB 3NJIA 3X1FA 3SBRA 2BP8B 4G7SB 2IWFA 2JKWA 4YSPA 1WAEA 2B3IA 3NSYA 3CVCA 1CURA 3ABGA 2FNWA 1GS8A 3UADA 3SBPA 2EIJB 2MRYA 3FSAA 2DV6A 3GDCA 2RACA 2ZXWB 3QJRB 5B1AB 3IN0A 3PAZA 2J55A 1J9SA 4G7RB 4HCIA 1JERA 4CSPA 1AAJA 1AACA 1NIFA 1XB8A 2BW4A 2HX9A 3WNJA 1CYXA 1KV7A 1JZJA 1JXDA 1NINA 3L45A 1ADWA 2HRGA 4AKOA 2VW7A 1XB3A 3NP4A 4KO7A 1GW0A 4AX3A 4DPBX 2FTAA 1BQKA 1HAWA 4E9SA 2FJSA 1WA2X 2QT6A 1B3IA 1CC3A 3X1BA 2IH9A 2BWIA 2QPEB 3UAEA 4JKNA 4HZ1A 1NPNA 1L9PA 1AR1B 2CAKA 3PAUA 4HAKA 2HXAA 1AZRA 2GHZA 1AIZA 2W8CA 4A2HA 3H56A 4NB7A 1J9RA 1ET5A 1WA0X 1RCYA 2CCWA 1M9WA 4JHVA 4M4RB 1FA4A 1EHKB 2IDUA 2I7SA 3NJHA 4DP6X 4HCFA 3TA4D 3NYKA 2HRHA 3FSVA 3OMNB 1PCSA 1RZPA 4YSOA 1JVLA 3ZDWA 1I53A 2J56A 2FT7A 3HEIB 1OCRB 4Q89A 2B08A 1NDTA 1MDAA 4RH4A 4KO5A 5B1KA 2FQGA 2AFNA 8PAZA 1DYZA 2ZWNA 4WTQA 4BK5C 1ET8A 1IUZA 2XV3A 1ASOA 3WI9A 1NICA 4YSUA 1RZQA 1XMEB 3ABMB 2VM3A 1PLAA 4F7KA 3SQRA 1A4AA 3NJLA 4E9VA 3FQ2A 1BYPA 1GS6X 1JZGA 1AG6A 1AZBA 3NJKA 1GSKA 2PPDA 1TEFA 2YXVA 4A2DA 2AZUA 1ILSA 1OCCB 1ILUA 3OD3A 3GYRA 9PCYA 1QHQA 1AQ8A 4AZUA 3NT0A 4GXFA 1MG3C 1GY2A 1L9TA 5I6KA 2UXGA 4E9QA 3T6ZA 2YAFA 4A67A 2XUWA 1N68A 3ERXA 2X88A 3AG1B 2X87A 1JXFA 4FAAB 4G71B 1SDDA 4UAHA 7PCYA 1CUOA 4YSEA 1AS7A 2DWSA 2PCFA 1J5DA 2VN3A 2XX1A 2BP8A 2YAQA 2UXVA 2HLEB 2PLTA 1R1CA 4BDVB 3FT0A 1JZEA 3ZX1A 3AG4B 3NSCA 5TK4A 3DKHA 1PNDA 2UXFA 1BQRA 1IC0A 3QJUB 2BP0A 1AZCA 1E67A 5AKRA 2BZCA 1JOIA 4BXSV 5I6NA 4E9XA 2XXGA 1GY1A 1A4CA 1AS8A 3G5WA 1ZPUA 4YSQA 3CVBA 1AANA 3ABLB 3QJTB 2VSMB 3AW5A 1KCWA 2CBPA 2IAAC 4P5SA 2TSAA 4HALA 3T71A 4FA7B 4YSDA 5FC9A 5EHFA 2IH8A 5F7BA 1X9UA 3FSWA 1ZIAA 1GS7A 3IE9A 3N55A 3NJMA 3WNIA 4KOBA 4E9TA 1N70A 1NTDA 1ZDQA 2QDVA 4TXVB 4QKTA 4HIPA 2GIMA 3EH3B 3X2QB 1J9QA 2YQBA 1BEXA 1YLBB 3FYEB 3IN2A 5D4JA 2W88A 2GC4C 1J5CA
chains in the Genus database with same CATH superfamily
3OG4B 4EBQL 3JV5A 3FPXA 4K9EC 4UQ2B 2F74A 4YSSA 4P59H 4JFOB 4ZTPL 1OGAB 2MCAA 1UACL 2WYZA 2GCYB 4GXVH 5E94B 1L4IA 4GKZA 4KJQC 1F3JA 5GSRB 1ID2A 1A1OB 3NFNB 4K9EH 4PP1D 5D2NB 5I28A 3MREB 5L2KE 4QOKA 2X4OA 4A68A 2H5UA 4PTUB 4R97C 1KNOA 5IW6B 2R39A 4N2NA 4UNUA 2LVCA 4Y4KD 3HS9A 5E8EA 3SDDA 1ZHLB 2A0LC 1KIPB 4H0GA 5GIRB 1Z6JT 1HXMA 3AWFA 5IW3A 4NZRL 3KYNA 3QPQD 1UENA 5IQNA 4TULL 4ONGH 4AGNA 1H15A 2GAZB 1ZLUH 4PMEA 1ZDSA 2Y25A 4RSVA 4IS6A 4P9HH 4WKXA 2ZKHL 4AT6B 3LEYH 3SKMB 4D3CL 1FNFA 2OYPA 3D9AL 1HOCA 3I85A 3M46A 3O3AA 5GGRA 3IPBA 5C0FA 1ZANL 5KYNA 3KJ4C 2DRUA 1ZT1A 1WS8A 3EOAB 3ZGHA 4ECNA 1S9VB 4IGBD 3L7FB 4GO6B 4RSYA 3D18A 5JHAA 1IJNA 5BVPL 3PWNA 2VXQH 1SLVA 3PCYA 3RJDA 1P4LA 2I27N 2ZX8A 3WFHB 1IO4C 3N1QC 3HRZA 3D08A 1SMDA 2R59A 4K2UL 4YLCA 2OK0L 4Y1AA 5C0FB 4JGMA 2G3MA 4GSQA 5AAMC 2R0WL 2XACC 2IPKB 4G9FA 1SEQH 1KDIA 2EILB 1L0YA 2WXRA 2NNAA 4DGVH 1TJGH 1NBZB 2BFVH 2UY7B 4P2AA 1G9ML 2NCEA 5KSBE 1UYWH 4RESB 2VO8A 1S5HA 2P7TB 2V7NB 1JYVA 5ISZB 4DVRL 2DB8A 2V4LA 3UTOA 4K3HA 5DMJB 5J1TC 2C9RA 3FT1A 3BIKB 2NY3C 4AYFA 1TYRA 4XI5C 4U6VL 4FFVC 4O5LH 1UJ3C 3DHPA 4PTUA 2ZKXA 2FGWH 4H25A 1Q9KA 1DVFC 2ZAIA 3H54A 3K8MA 2VLME 5IK3B 5JPMA 5ESQA 2APFA 4M29A 4XN9A 2GQHA 4KMQA 1XCTA 2CGYA 1A7OL 4UOW0 2EYSA 1HZHL 2WBJA 4X6EA 4Y5XA 4ZBJA 1UA3A 3WKYA 2VXQA 2XC8A 3D69A 2GSGA 3NRPA 1BD2A 5ERWA 4PS4H 1FQ9C 1E4XL 2WSKA 3B5HA 4JM2B 1RK7A 4P2QD 1Y1UA 3UEZA 2L3BA 1F45A 2X2IA 5GRVL 4OCRH 2P5EA 2FEEI 1Z0MA 2HKHH 5E70A 2WUCH 3W0WE 3ZSTA 4KGLA 2J12B 1HL9A 3N44F 4CJ1A 2XCMC 2YA0A 1YPZB 2ZXDA 5TQ2H 4KITB 4LSUH 1WEJL 5EUKA 1DFBH 4UQ3B 3D39D 4HBCH 1KC5H 2F6AA 3KLAB 3WKML 2V33A 3WE6A 5AWNH 1JE6A 4AQ1B 4MJ6B 1D5BB 4YHIB 4L8CA 1NH6A 4LT7A 2RBLA 4M3KB 1B88A 4EVNB 1OP4A 5D93B 3GBMH 2IC2A 4D9LH 3B7RL 3EG9B 1KYDA 4K8RH 3OJDA 5CLWA 3GIVB 1S7UA 2B16A 4JRXD 5J57B 4JZOA 4OGAD 5F7EL 3D5OF 4HT1H 4AJYV 5EG6C 3GLAA 5AW7B 2VERA 4K94C 1SHSA 1PCXA 5T1LA 2CMRL 3V6BR 2FSEB 4HUMB 3VI4E 1UH4A 4YSCA 1FVDB 4KUZL 5DUPH 3MSPA 2VDPH 4BDVA 1RZIA 1IFHL 2A5UA 2IPKA 1NAKH 3FB6B 1A4JA 2Y1AA 5D4HA 2YAOA 4JBSA 1FNSL 2VR4A 4FQXB 1GOFA 4YSTA 5JOPD 3QW9A 4MLIA 1BX2B 1KG0A 1L6XA 3MLPA 4F27A 3BD5A 1R5VB 4KI1A 4IK6A 4ZPVA 1HTYA 1QA9B 3KPSA 4ZD3H 2HRPH 5KBDA 1U8JA 1CFVL 4GW4B 1QYGH 2B1HL 3ARFB 4F8TA 4KK8D 1HH9A 2XSKA 3TVMC 1PG7L 4BCYA 2YPLD 2RCSH 4JFWA 1I8UA 4YIQA 4MAYB 3PJSB 2IGFH 2BIHA 5DGQA 1OAUL 4UQ3A 5JZ7D 2GSMB 2WWMC 3P77A 3EJYD 3FOLA 3TVMA 2B5IC 2AJZA 3L5JA 4N2HA 3NSXA 2JELH 3Q13A 4R2GD 2QR0B 3A6BH 1INDH 3S37H 4PRIE 3DPDA 5D71L 5SV4A 1JNHA 2WKGA 2SEBA 5FIEA 4BFIB 3QORD 4WWKD 4B27A 2OP4L 2L7UA 2XV2A 4OF5A 3QBTB 1NMCB 5I0VA 5JR1L 1BZDA 4EZMA 1UM5L 2Q0ZX 1BXUA 1KTDB 2HT4D 1QRNE 1VCBC 2YPKB 3DX3A 3KH3A 3NK3A 2FLMA 4JO2L 4OTXH 4XO5A 3KR3H 4IEFA 3OB0H 4YDIL 5AKTA 5HVHB 1BWMA 3NJNA 4QRUA 2M26A 2E76C 4PJ9D 5AZUA 1Z66A 3VX1A 4EZKA 3O4LA 1TZ8A 1CE6B 3OXRA 1UQSA 4OU3A 4XO4A 5BXFA 5SWSE 3S6CA 2VLLA 3BD3A 1TTRA 3P0VL 4DF9A 5DHVH 5GGTL 3PY9A 5DURB 2KS0A 1ZVYA 4PJDA 3OL2A 1YG9A 2ED6A 1UZ6E 2WAHA 4AC2A 3H2PA 3MJ9L 2X4RB 4ZS7H 1RERA 4G2AA 1AGFB 5I76B 1AGEB 5BZXA 4ZFOL 1TQBB 4FFYA 2OYLA 1WO2A 2ZQKA 1SQ2N 2D7TL 2NTFA 1LP9F 3B5TA 3IDMB 2X1OA 1T22A 3IJHA 3OHXA 4V2BA 3G6JE 1GMEA 4P23B 1S8DA 4HUUB 4LB8A 3ESPA 4RZCA 3SE8L 4MD5A 4DGVL 5E2UH 3L7EB 1FRGL 4IBTA 5MP6H 4QRSA 4LBEB 1PIGA 5T5FL 4TVPD 1IRAY 5T1LB 4BKTC 1CCZA 2Z4TA 2FSEA 3Q8AA 3HC4L 1GOGA 2VDMB 3WNOA 3ZTNL 2ARJA 2ZJSL 1T5XA 4AUJA 5A3IC 3F65A 1SOQA 4M7LT 4O5LL 4Z7UF 2IAMC 5G4NA 5ITFA 1L0PA 4HMDA 3K6DA 3NCYP 2Y6SC 3QDAA 1D7FA 2CK0H 4WI0A 1HINL 3SPHA 2CO7A 5H94B 1FL6B 2J72A 3UTQB 3ELAT 3MMEA 1L7TH 3G3LA 1B2YA 4PW3A 3B7YA 1CO1A 3NP4A 2WXJA 4KO7A 2B7DT 4B97A 4PRIB 1HZHH 1KGWA 5K9JL 4BM7A 2EVJA 3HG4A 1B0WA 2Z31D 2HTKD 3N04A 5JOPE 1EDQA 2R23B 4PJ8C 5K1VA 3RX9A 4P2OB 4PMFA 1IGTB 1B0RA 4Z7OF 4YHOL 4K73A 2Z0UA 3PAUA 4ZW7A 4DPRA 5IWLA 3H85A 1IM3A 4Y19B 3PUCA 2WBXA 2HN7B 3SE4A 4AXWA 4F7MA 4Y4HD 1HXYB 2GITB 1RCYA 2WLIB 3G9AB 4GG8A 4R0LC 3MA9L 2GIYA 2EYRA 3H55A 2EE3A 1J1PL 5JW4Q 5B8CC 2NY3B 2V8MA 5A2CA 4UQ9A 3JV0A 3PGFL 2GY7B 1IEAB 5IBLD 3WNMA 2G5BA 4HBCL 1IM9D 3PJNA 4L5FH 4JK0D 1RUAH 1J5OH 4PFEA 4ZMAT 5H35A 2NYYC 1DJGA 3N9GH 1ROCA 3EJPA 1YECL 2J43A 5C9JA 3BISA 5IMOA 1CZ8H 1FIEA 3BD4A 5DJ2A 5LVEA 1EEZB 4LKXA 4BFRA 3AUWB 2BIOA 4OJCA 4TUOB 5E8PA 5AVTB 5IHWA 2HVKB 5DT1L 5I30H 4Y5YC 3V0WL 5K9QI 3MRPA 5DK0B 3MMEB 4LPCA 5DUBA 3NJLA 4YHPB 5ES4B 1JZGA 4HAFA 2C1PB 3HC3L 4JM2C 1XEDA 1GSKA 4N8VG 3GEWB 3QARA 5IJVB 5FLUA 4A2DA 4NDMA 1OCCB 1P4IH 4I87A 1ILUA 1UXWB 3Q0HA 2ZIDA 3IYLW 4OZGF 4KAQH 5JDSA 1WF5A 3BP7A 4KJYA 4DJMA 4GXFA 1PD6A 2EDLA 2XXCB 4J4PD 5L2JA 4MYWB 1IVTA 4CVXA 2XFGB 5EDSA 1TCMA 5IESH 2BOCA 1N68A 5LQBL 2VDPL 1MCPL 1SMAA 5GS1A 3L3HB 4ABUA 2JLLA 3TBTA 1XGQB 3GBEA 3MV11 1L5GA 3I3EA 4YAQA 5C07D 1VKXA 3RFZC 4MAUH 4ZUSB 1AS7A 1MFEH 3BSZL 2RH0A 1HKFA 1P53A 1D5IL 5CIPA 5ADOL 2BVYA 4N0UB 4OCXL 5D7JC 1TTFA 3SDAC 3TBYA 2H6PB 4F37K 5I1HL 3QJUB 4JB9H 5DJ6B 3W11D 2EJ1A 5E4EC 5I6NA 3MTXA 1UT2A 2A74B 1W80A 1MF2H 4PHXA 4P8QA 1FL3A 1AFVL 1T7WA 3VG0H 4JHBA 2GJ6E 1NGWB 3QWNA 4RGMC 2AEWA 3SODB 4ELMF 4CUCA 3CHPA 1QBML 5E8NB 4NKOA 3WL9B 5B39B 1AP2B 1T0MB 2KL6A 2VJ8A 2WMPB 3NFPB 4FQHA 3M88A 1ZIAA 5D71H 4DKTA 3TBWB 1EH9A 1T7VA 3N55A 2W81C 4M48H 1J8HB 3FFCA 5DUBB 4X42A 3AREA 3DBSA 2YQBA 3APFA 1REIA 5A16B 5IHHA 4UT9A 3LB6D 3U0TB 2IDTA 5AZ2L 4YDIH 1ETJA 3RHWK 3SY0B 4YVNA 1RJCA 2LFEA 1T04A 3RBGA 1HHJB 4DT2A 4I2XE 3FO1A 1WAAE 1DVFD 4GSUA 4CBPA 2YOCA 4Y19D 3ZZSA 1DDTA 1KB5H 2XG4A 1HFUA 1ZK9A 3EFOB 3G6JA 3K8KA 3MFFB 3D2UD 4Y4KA 2EKJA 3FCGA 1U93A 3KM2A 1CVRA 3F04A 4OSUL 5IJDC 2BIPA 4LASH 2CKBA 3ZBMA 2X41A 2Y3AA 1TVHB 4LNRB 4NZTL 4YS4A 2A38A 3FB5B 4ORZC 3TEWA 1I8MA 2HX7A 5D1XA 1MJ8L 2MHAB 3A24A 1YUKB 2G4GA 2M2DA 2Z7UA 3AXLB 5E5MA 2JI3A 4QRRB 3PDOB 1R3KB 5IB5A 3DV4A 3CC1A 1JZ6A 1R3LA 1F4XL 1J0JA 2Z1PA 5FWRA 1A8ZA 3KYMB 1EJFA 3FN3A 5E2UL 3MGOB 4NPYA 5DRZA 3VA2C 2JJUA 4HZLB 3UMTA 3WLWD 4Z7NF 5E08L 4W9HC 1S3RA 4FQLH 3IM1A 3PHQA 5ALCH 3VD2A 4JCMA 5FV1L 1EHLH 4I1PA 4KX7A 3MZTA 3UOAB 5BMFL 4NQEE 4KPHH 5EU4A 4KHTL 1V3JA 3LQMA 4GKSB 4WNQB 4Y4FD 3H3PL 3EOBA 2ZOKA 3BI9X 3PHSA 1TPXB 3V0VB 1NWOA 2EC8A 2R8SH 1BZQK 4NOFA 3FDWA 3VQ2C 2ATKA 2VMCA 4PJAA 3QWQB 3VU1A 1CYGA 4ELKB 4NC1E 4G6ML 5KOVC 5LCVL 3HVDA 5CCKH 1BJ1H 3QNFA 1KENL 1SBSH 4AK2A 3HZKA 3TXAA 1HK6A 2ZYSA 3O0RH 2FIRT 5E6ID 1YYLL 5B7EA 2PYEE 1PMYA 2XKNB 2J57A 5I1IH 5A2BA 1IAKA 4MMXC 2YZ8A 3CSBA 3BPCA 3MOAL 1R34A 5C9JB 4RGNB 2Q7YA 2GK0A 3OC8A 3Q48A 4TYUA 3SJVA 4U7KA 1DLHA 5E5RB 1WAAF 4A1RA 4JDTL 4IBSA 4FG0A 4B9GA 1RUQH 2ZKYA 1WT5C 2FZ3B 4FLRA 4NWUH 2CHWA 3RNKA 1LO4L 4PI0A 5FW6A 1EHNA 1KBBA 3VQ1C 4TLSA 3PGFH 3D0VB 4GW5A 3QI9D 5I18H 1IEBA 1S9VA 4CMHC 2CUHA 4NC2B 4L5FL 3O45B 1KCRH 1MY7A 2P8PB 2HZHA 4P4RB 4QRPA 3WMQA 4ZG1A 4UMSA 5JA8B 1KCSL 2IBGA 4J6IA 4JDZB 1AR2A 4ZOEA 1A64A 1WUNT 1BXAA 2KLSA 1N0LB 3NEXA 2UX6A 2IV9A 4K5LA 3D51A 3ZLQC 3ZKXC 1OAKH 4OY9A 1H3XA 3CX5J 1XD1A 5K1NA 1JG9A 3HLAB 1NCCH 4ES9A 3S96A 3HC3H 5AAWA 4G7QB 3NEOA 3ULVE 2PPEA 3DIFA 3BO8B 4UTAA 2K6ZA 4GRWB 1JNHB 4BGDA 1SJVA 1AO7B 3SGJC 2A6JB 2XN1A 4PJIB 1CMOA 3L4YA 4B9IA 2Y3NA 2LTQC 1QBLH 5CJQH 5BO0D 3S96B 4AL8L 2QTVA 1OAQL 2FL5A 1LO2L 1OW0A 1A2YB 1XH0A 4YDVA 4XNYL 2ZG1A 5I8OL 4F9PA 2WZ5A 1JTTA 1X9RA 1DEEA 2ZOLA 2WNXA 4B7IA 2IPTL 4KROD 4TTGA 2NT1A 3JV6A 1MFEL 3FU8A 4FCHA 4YHLH 3TM6A 1PTZA 3W38A 1MLBA 1XCXA 3HPLB 4AQ1C 5F6IB 3UP6A 5FYJH 3RZWA 4HQQH 4KNQA 5AVWB 4KKLD 3TOPA 3HI5H 2YUZA 4Y5YB 1N6UA 5I6LA 3Q5OA 4GRLD 4U1KB 1WITA 3LIZA 3QXUA 3NP3A 3PU7A 4XMZA 4QT5A 4OZ4A 4YFLI 2GPZA 4GRLA 4Q4IA 2OMZB 3P0GB 3VXMA 4FYQA 1J9TA 1CG9A 2X4TB 1NA8A 5HI5C 3WXVL 4WU7B 2Y06H 1Q1JL 4WEEA 5C0DA 3A4EA 2EEDA 3PQYA 3O2VL 1UD4A 3KL5A 2OSLA 1DR9A 4FKKA 2VDLH 2AK4D 4ELDA 3SB3A 4I9WD 4DEUA 3GM0A 4IBUA 1IVLA 1FC1A 4ZOAA 1AY1H 4FNRA 4LLVB 1KCUH 3ARED 1C1EL 2BC4A 4OLVH 3WHXA 2AQ3A 4X4XB 4E41B 2ZUYA 3I50L 2G3XA 2WOYA 3PWJB 3B43A 1SXAA 4LDCA 1IKNA 3F6IA 5E1HB 3H4FA 2HRLA 2B1AL 5DQJB 2BOBA 2XTJC 3LQAL 1A6TB 3AXLA 3MUGB 5C6TL 3MV7A 1ORQA 5HYQB 3DX0A 3PHOB 2RGSA 1AQDB 1PDKA 1QFWH 2CDFA 3VFNA 2XIIA 1EAPA 1ZD6A 2LOEA 2QZQA 3GSRA 4OZIF 5HGGS 2XY1A 5D5MF 2WSDA 1B3JA 4ZNCD 4XMLH 5DJ8B 1DJSA 1IGIH 3TL5A 1JK8A 2Z91B 4JM2D 3P4MB 2PR9A 4NQVB 4ANVA 2ROXA 1EHXA 1CD8A 1AC0A 2VLMD 1X4YA 2XPGA 1NGYB 4FI8A 3L4WA 1SLXA 2AQPA 5HHQB 1RULH 2R1XA 1MWAH 3LPFA 4ZAKC 2OFQA 5C07A 3ZKQD 2WJ5A 1GGUA 4OZFG 3RVUC 3SE3A 4WI9A 3TC9A 4Y5XB 4HIXH 3WTSA 1NEZG 1GPOL 3CFUA 3DOSA 3DO3A 1KPVB 5I1CL 1PLBA 3BWAB 3L1FA 5D7SL 4JUTA 5TPWH 2ZOTA 1RFDL 4MDIA 4Q2ZB 2X1XR 5EUOF 3S36H 3TBBA 1JF6A 3GIZL 4P5MA 4HKXB 3B2VL 1I7UA 5HDBF 3SCMC 3ZDXB 1ZMYA 5FCSH 2WWMD 2YOAA 2IAMB 2OW7A 2DQDH 4PJ7A 1UURA 2PCYA 4XCEA 5CBEA 4QRPE 4BK5A 5E51A 1ETB1 3BFOA 1N64L 3FZUC 5HJ3B 3JWNC 4FC3E 3C6LB 4YDKH 3ZDYE 1Z3GH 1NCUA 1NOFA 4U7MA 4YQXH 1KIQB 2BSCA 4EZLA 3EOBB 5E5LA 2C9VA 2ZZUT 3SBRA 2VKWA 4WQOA 4P9ML 4KC3B 1HS6A 2IWFA 3D33A 5EA0H 1K8IB 2R0ZH 5CP7A 3ARGD 3ABGA 2EVGA 4Z5RA 3P9LB 4OV5A 1FORH 2HTLD 3OKEB 3VI4A 5D8JH 1FAIL 3NPSC 4XZUB 4S1DD 4WU7A 3CFJB 5C0DB 3VXOB 5KW9L 4S1DC 4ZUSA 1D5ZA 3WJMA 1I8LC 3D18B 5LN8A 5K5YA 1U6AH 1BFTA 5DJYB 4Z7NB 1FH5H 1KJVA 2XBTA 3QNZA 1R3HB 3FFCD 3RDTD 5F7MC 1A1NA 2NQDA 4PWJA 3POHA 1ADWA 2P42B 3HRZB 2VW7A 1UXLA 1SJEB 3WYRA 4X6CE 2XPZA 1QATA 5LBSA 4NNPH 1MCRA 3I6GB 4X4ME 1HILA 2FJSA 2QT6A 4N68A 1AGDB 1SUJA 3GZKA 3V6OA 1A6ZB 3VRLF 1Q0XL 1CFQA 5I17B 5J06A 3V0HA 5GJSH 2X42A 3RIAF 4V1DD 2WUBH 2FL5B 3I02B 1E2WA 4R4FL 4G80B 1MJUH 2P5WD 4WW2C 1OAKL 3DA0A 5JQ6L 2WYTA 4JPVH 1P4UA 4LDEB 4ETQB 4IIZA 4K7PL 2WOBA 4MNQB 1DEEB 5F70A 3PHOA 3PWPA 5HGDA 3W37A 2X6AA 4HKXA 2V3DA 2AJYH 1G7JA 3FHEA 4H26B 2ZWKA 2VC2B 2N0KA 3V5KB 2F8OA 2ADJB 1PZSA 4YBLB 3TWCH 4I7ZC 4L4TD 4KK9C 2NY7L 3QE5A 4OLZH 4H25B 4P07A 1T2JA 3VM5A 3VFUA 1FYTB 2XI9A 4OLUL 3CPLB 2WLJA 2J56A 4KV5F 5CJQL 4H88L 1R17A 4Z0XA 4DKEH 4JKWA 5D1ZC 4UCFA 3IMUA 3TN0D 3C5ZD 1XIWB 5C0EA 4WTQA 5E94A 2NMSA 4KJWC 3LHAA 1YMMD 1XF2B 2ENJA 4W6XB 2KZKA 5IMOB 2UY6A 3KBFA 1LE5B 1KLUB 2AV7B 5I6XB 2BP5M 4RETB 4OV5B 2PPDA 1EQWA 1Z5YD 4KTEH 5SWSA 3SKJH 2PUQT 4LSQL 3O3EA 3GZQA 1MJ7L 1LGVA 3ZK0A 1IGTA 3GYRA 5LLIC 1GGBL 2YD1A 4MB4A 1GA2A 4JJOA 5IFAL 3NT0A 5EUOA 5IF0B 5INCB 2Z6FA 1M7IB 5E4EB 2HSIA 1SZNA 2DWEA 4H40A 4KY1L 2RR3A 4OJEH 3T5WA 5IUCA 1IMHC 5HI3C 4MYPA 2ICEA 3WGUB 4RGMB 4HD5A 2VCOA 3WHE1 4M00A 4O2FA 3DLQR 4G3YL 4N5EC 3OJMB 1FFOA 3IF1A 3U2SB 1ES0B 3DX9B 2PCFA 3EGXB 3VRLE 4LHJB 1VADA 3ATFA 3L3IB 1JHTB 1BA9A 5D1QB 2D3JA 3WNNA 2WCSA 3KVDD 4PJFA 5IJKA 1YEWA 3GO1H 4HS8L 1I7RA 2AMGA 3BGMA 2JMRA 5DWPA 3ZDXE 4AEFA 3QXWA 1T1XA 4Y1AE 4OJYA 1E67A 4E9XA 4ZXBB 1GY1A 1G9NL 2HMID 5J13B 1I9JH 3G5WA 2F08A 2KHAA 5EEZA 2WXPA 1A6VL 1KTCA 1K4DA 5E23A 2C3VB 4JDEA 4U6TA 1IM9B 5LGJB 2AJUL 2Z7ZA 1KY7A 3ETBJ 5DJDB 1XXDC 2R9HD 2WQSA 1UWXK 3F12A 1JGDA 1S7RA 1D5MB 5BW7A 2IH8A 1X9UA 4TS6A 4J3OG 3PV6A 1JMZA 4G8GB 5I5RA 3DUSA 3DMMD 1VGEH 4Y2LA 4PS3A 5BW7C 2AAAA 1H9VA 1OZUA 2LLLA 1CICA 4E5XA 3OR7A 4QJ5B 2IGTA 3BYYA 2EVIA 2IO5A 4B9PA 3L3OC 5CINH 4HS3A 3IGLA 3EXJA 1BZOA 4DKFL 5LGKA 3BW9A 3RWEA 3AS2A 2JB5L 5I76A 5EUOB 5INCA 5IF0A 1PZ3A 2DWTA 1A6AB 3E6FB 2DQMA 1CQKA 2APVA 3KL3A 5CSGA 5E2VH 2A9AA 1BD2B 2HVJA 2NOYA 3E6HA 3GGWA 4K23H 4X8XA 2K3TA 4L9LC 4WWPA 4IQHA 3CPLA 4AITA 1HE7A 4I0PC 4MA3B 4P49A 4I1NB 3RWHA 3V0AC 4XNUH 1ZEAH 2YEVB 5CN3A 3EHBC 4NT6B 5JA9A 4JMXA 4KXCA 2O5XL 3TASA 2Z92B 2WWKT 4JFUA 5DSCA 2VR8A 2OMUA 4JMNA 5DO2C 1KJMA 3UPRB 2IQAA 3LEYL 3BDBA 1HI6B 1YY8B 3D4GA 1ZHNA 1N2RB 4Y8AA 3TO4C 1ZANH 5DHMC 5FO8A 2WMPA 1EPFA 2WXMA 4HIJB 3OZ9L 4YQXL 4LQFL 3ZKSD 4HJJH 5FYKE 4EIUA 4KXZH 2P43B 4ABQA 3FT3B 2BXYA 5K39A 3FO0H 2ARJB 3VB8A 3WXWL 5D2LB 3MCYA 1M57B 2F5BH 1XX9C 3PWVA 4WJ5B 1MWAB 3QCUH 1WAAA 4ISVA 1NBZA 2W5PA 4HPYH 3NJGA 1BAWA 3FUJA 4DGIL 2O5NA 4LIQL 3RGVC 1X5IA 2X05A 5D8JL 4HSCX 4N4YB 1JZ2A 3O8XB 3M6DA 3NABH 1OQOA 3C60A 2B1OA 4PY8J 2UY7A 3FQTA 4LKCA 4G8IA 2BDNH 5T1MB 3FSZA 4WZ9A 3WKNA 2DQUH 3CG8A 4HBQA 2DQFB 1J0HA 4G59C 3VU2A 1CYWA 1AIFB 3OVUB 5AVQB 4HUVA 3S8WA 4WK4B 3B6SB 1BW8A 4NBXB 3MJGX 5BS0D 1E5BA 4B9KC 2QTEA 1LP9B 4AJWA 5GGTA 4A2GA 5K33A 2J6EA 3Q8BA 3LV3B 5EF0A 3ARTA 2EVHA 4M8UA 3DK2A 1UGKA 3MLSL 5FOBA 1KJMB 2ZUSA 1CFTA 2VLRB 3OV6A 5I24A 4GBXA 3UJJL 4FADA 3HMXL 1UM4H 3GXDA 1IARB 3DECA 2XQYG 2AXFB 2HJFB 2YQ3A 4GAAA 1H8NA 2WXKA 1E4XH 2K9UA 3SGEH 6FABL 1SN2A 5KJ7E 3V6OC 3ASOB 4WHDA 1OAYH 2XNAB 3J07A 4NKDB 3RLSA 2IQ9H 3TT1L 3UBXB 4YHPA 3VYNA 3QAZC 4GW1B 1RIUL 3CFKA 4LCWE 4JFVA 4FQIH 4FA6A 3IJ8A 3LEVL 1ZSHA 3P9MA 4NO3A 4C58B 5C3IA 32C2B 3K74B 3L2MA 1R5IA 1UXWA 4GQRA 4XT1C 1JN6A 5ECGA 5GRXG 1JZDC 2F8IA 4U2YA 3EFDH 4X50A 4BFEA 3C5ZA 3F05A 4M93C 4N1EA 3V6ZA 1X5GA 1AKJB 2ISDA 2BJML 2QADD 2YGQA 2ZUXA 5HPMA 5I1GH 3PF2A 5AWNL 3E3QE 2CQVA 1NGPL 2XBDA 3S98A 1Q0YL 1VPOH 5E6UB 3LIZL 1IC4H 4M5YH 3UTZA 5JHDD 4KXDA 1MH5B 3DDFA 4M1GL 5D6CA 5F3HA 2XKNA 5GRJH 1MCWM 5CZVL 4D9LL 4ODWA 5ACZA 2YSSA 4TVSa 3BWZA 4R7DA 3VSQA 3RVXC 3GM8A 4GMSH 3N41B 3X12B 5CF3A 4NENB 1BVLA 3EH5B 3FC8A 1EAOA 2YKKA 3I3DA 1NGYA 2AANA 4ZNEA 5IEKA 3UTTD 1FHNA 2BY0A 4GEJA 5F7EH 2I85A 2R2BA 4F33A 4TUKL 4LSUL 1WEJH 1WC7A 4JDEB 5GRUL 4F7PA 4XPTH 1IAMA 3QDME 3EYOA 2XPYA 4PRIA 2FVNA 4LP5A 4OZHE 3K72B 4ZQKB 2Z1KA 4FG2A 5I71B 3SZ6A 2IWKA 5F89B 3GO1L 5H94A 2BSDA 2RB8A 3DGGB 3NZHL 4DOHE 2CJTA 2V3EA 2G2RB 4QNPF 1MEXL 2VR6A 5HP5A 1R3KA 3KPSE 2YR3A 1DUZA 2NRDA 2F7PA 4L8BA 2EO1A 3VFRB 3IDNB 4JFYB 1ZPLA 5C0CD 3FZUD 4LOFA 3V7AE 3B6SA 4MJIB 4G6AC 4HWBA 1G7PA 3T2LA 1DUYA 2GSIA 4K3EH 2CH8A 5I1DA 1XSIA 2FO4A 1LK2B 3FQRB 1S78D 2X6MA 3ZTCC 3O3DA 4DP4X 4DCQA 3MRBB 4UI2A 3RWGB 5KSVA 1BV8A 4NUGH 5IMKA 3NJVA 1NUGA 4CN4A 3QIWA 3FYIB 1ZHBB 3JTSB 3RY6C 4OF7A 5DZOA 5CP3H 1CD1A 3VXME 5EF2A 2UWEE 1X4XA 2YRLA 2DI9A 4PLKD 1QNZL 4F3FB 1CE6A 2E75C 3HG1B 3T4YB 1G9NC 2CHXA 3MR9B 3H9ZA 4QHUA 3B7SA 1E9PB 3NVQA 1FDLL 1FJ1A 1CDJA 1RIVL 3GSVB 1UWGL 4UDUB 4C54A 2ATPA 3MRJA 4U1LA 1HEZB 2C1OA 1NCNA 5KZCD 5EEWA 2HFEB 2H47C 5TDPA 5EOCL 4ZUWA 1E8ZA 4OZHF 4NQEB 3HPJA 4MAYC 5DVLA 2CDGB 4BRJA 5JW4R 2CGRL 1IGJA 3IDIA 1IEHA 3OZ9H 3GSVA 2PXYD 3ZT6A 1NPJA 3ZUCA 4HJJL 4P05A 5HI3D 3DX6B 1PFCA 3LN4B 3QZPA 3L6FB 4G8FB 2VDQL 4HUKB 4JUSA 4OJFH 4MZRA 3QP3A 2NXZD 4UILL 4ZTEA 3MV7E 4IHBA 2OW6A 2JJTA 1QLEL 2WTPA 2YLHA 2QVFB 1NIDA 3QG6A 5DRWA 4BQCA 2QL1A 3B3IB 3BPLB 1EO8H 2CCVA 2IDFA 5EIQA 5JXEC 4QUOA 5F7UA 3RWGA 5EIIG 1FRGH 4QRRD 3SDYL 2VQUA 4PWIA 3BZFA 3CZKA 3QXDB 4MD5B 1MCIA 3FAXA 4FULA 4HJTA 1LK2A 5T3ZE 3NUKA 4M7KH 1DLHB 5AZEH 3GSRB 3F2LA 2J8UB 3IDGA 5JDJA 2PP9A 2WLHA 2R69H 4J3OF 1JGIA 2PYFB 3H3BC 2B39A 2VLRE 3ISWA 2VRKA 3MA7B 4JQXC 1XCWA 3B56A 4ZS7L 1G6RB 5GZNA 4BD4A 2VUOA 3BSHA 3U9PL 2CK0L 1HINH 2NUPA 3QEUA 2B3IA 4A38A 3BVVA 3ZYJA 3WMSA 1WHPA 1U3HD 3SBPA 3RPIB 2EDQA 4QMEA 3Q05A 2WQ8A 5ABAA 4LVNC 4P5KA 5HYJE 5DHEA 3GI9H 5MP6L 1UACH 4HUXB 3WIFB 2VITB 4RMQA 1MLCA 5DHDA 1KFGA 2F19L 1TZGH 1I3UA 3HC4H 5AENA 4Y2OB 1BYNA 1HIMH 2YMXH 3JVGC 4DZ8B 5EU3A 1YEEH 5C0AB 2HP4A 3F7QA 3O8XC 3F58H 3R1GH 1CWVA 5ESVB 1PEWA 1VACB 3QSKB 2QV4A 4WWKC 4PJAB 5BJTB 5CFHA 1IAII 2YPVA 1S9XB 1T20A 4YHNA 4U6XA 3X12A 2BX5A 2UWEA 3R0NA 1JD9A 3HHMA 4PB0H 3WSQL 2PN5A 3MVSA 1U8IA 1AR1B 1NANH 4JY5L 4NBZB 4HAKA 2ZNXA 5E6ZA 2HXAA 2C4FU 3NMEA 4JVUA 5IB5B 3UTSE 3X3GH 2AJ3A 1AIZA 2EADA 2XA3A 3FO9A 1MRDH 1MW3A 1UOLA 2DQCH 2FX7L 3C6SA 4G8AC 5I1GL 4WTZA 1WA0X 1VFOA 4TUOA 5E8PB 4JO1L 1YECH 1EHKB 1IC4L 3OWEA 4KV5E 1IIKA 1BM3L 4B9YA 4RISH 1QFWI 3HHSA 1MHPH 3PJLA 3QEQA 4KDTA 4B7LA 3WTVA 3FSVA 2ZG3A 1OPGH 4OQTL 5FDWB 2EXWC 2UYLA 1EGJL 3EOYG 4IBQA 4ORGA 2HUEA 1LK3H 2X6VA 2Y2WA 4PJHA 4OJDH 3LN5B 4Z7VF 4U6YB 1OY3B 3U2IA 3V4VB 1AGBA 4GQPH 3QUZC 4NNXA 5JO5A 1T0PB 5HYQA 1FN4B 4Y1SA 1A3RL 4AXWB 4F7MB 3AM8A 4JY4B 1F41A 4JE4B 2BSSB 4JGJA 2JQZA 1NMBL 3FQ2A 4OD3H 4WV1B 4HKZB 1KTLB 1F3RB 1ZS8A 4TSBL 1WGOA 1LDPL 4U3SB 5D1ZB 4Z7OB 2IBZY 1AD9A 5DHYB 5CEXB 2COQA 1T2QH 3EO0A 4PRHA 4TVPH 5HHME 3QJHB 3V0DA 4L8DA 5EB9A 1FFQA 3PP3H 5T3XE 4KZEL 2KERA 4OIFA 1GY2A 3TWYA 4EAEA 3MGTB 3MLZL 2NXYD 3T6ZA 4IRZA 3O6FB 3VXSD 2M83A 2Z34A 4LHUG 3KBEA 3O11B 2H32B 4QHPA 3L3KB 3WLBB 1A6WL 1OAXL 3WY4A 4G6JH 2CRIA 5E00A 3SDXE 1L7IL 4G71B 3ALXA 1JI1A 1YHPA 3GQFA 3LXCA 3QDGB 1BBDL 2BLFA 1VZIA 2HLEB 2YBGA 4M6OL 1INEL 1RZGA 1MCWW 4YMPA 1HDMA 3JWOH 2AXHA 3BVNB 4FYRA 3ZZLA 1KIUA 2IFFL 4OCRL 1U8HA 3S37X 1CLOH 1UKSA 2XXGA 1MAMH 2IPUK 3VGHA 3BP6B 3QJXA 3FQNA 4G9FD 5ADOH 4H7VA 3O3AB 1QSEB 3JT0A 2BVPA 1HL8A 4JB9L 4WI5A 3QQ9C 4CC0A 5L2KA 1QX1A 3KZ8A 3S5LG 1PZ5A 1ZS8B 4JLRA 1GHFL 3LEXB 4N2CA 3SGKC 1VEOA 1MF2L 1JHKL 1T1ZB 1VJSA 3BWSA 3ZE0B 4A7GA 4X5XA 5FPIA 1I1RA 1RIVH 2JCCA 4PP2B 4KTDH 1UA7A 2IAMD 4UWQB 4Y16B 4M5ZH 3TYFB 2VQTA 4E9TA 5IEHB 1NTDA 2PO6A 2BXZA 2ITDA 1O6VA 1UKTA 2PR4L 4PWHA 4URTB 5EO9A 1ONQA 1YLBB 1CGTA 3O11A 3U9UB 4ACTA 2EDRA 3IJ9A 4U3SA 5D1ZA 1E9PA 4OM1H 1U91A 4NZ8A 2WBJC 2OMXB 3X1GA 3EJTA 4EI5C 2QHLA 3WN6A 4JO4L 2ALAA 4L8DB 2WO4A 3HS0B 3UTSD 3GSOA 3BSZA 1UH2A 4JJ5A 3FTSA 1F1GA 1W91A 4BSJA 3H9SD 5TH2A 3IFPA 4R84A 3RB5A 4K3JH 4AYFB 4MNHA 4R7NA 1FV1B 1I85A 2G5UA 2BHYA 2JQMA 3ECWA 3LIUA 4GKLA 1L9SA 4KUZH 2OMBA 4HETA 5DUPL 1NCWH 2FYYB 4JRYE 1SF3A 5JO5B 3OPUA 1SLWA 1TJIL 4G5ZL 3V0JA 2IDCA 3O6LH 3K4DA 3PWUA 4QRFA 3L1EA 3P4MA 4WTWA 4WO0A 3WFBL 4YK4B 4AV5A 4PJ8A 2EIBA 3BGFC 4CDGC 2V17H 5KAQF 4OIAA 2E9BA 3SO5A 5AG8A 2WCPA 1MAJA 4NKIL 2WANA 1H6EA 3TH4T 4AM0Q 3PV6B 1UGNA 4G1MA 1QW8A 4G8GA 2PW2B 4PRDA 4OZFA 2P52A 1U2HA 4J3BA 4YL4A 1UG9A 3P11L 3PGCB 4UYQA 1FLTX 3KWTA 4P5TB 4XCCL 3JUZA 4ZMQA 1BWWA 1G4MA 4CGUB 3W5MA 5GGUA 3PWLB 4KJPC 3H3KA 4K7PX 4NJ9H 4M61A 3FFCE 3ZO9A 2O4EA 1HH6A 5CR8A 2YK1L 2VMDA 1E4XI 3RVTC 3L9EA 3SSGA 4Z7UE 3QISA 2NPLX 2AJSH 4M62H 5ICUA 2BMKA 3BPLC 4M43L 5BZWB 5AVXB 2H41A 3PGDB 3GK8L 4ODSL 4FRWA 5AW2B 3RJQB 3TCTA 5F72S 2H3NA 5BMFH 1J1OL 5C0RL 4ZMYA 2ZCHL 3ILPA 3W5NA 1QQDB 2DQEL 3CVDA 5F9JA 4HW6A 1JXKA 5KVGE 2WWOA 3U6XA 1LO4H 4L18A 3BVDB 2V2XB 2ICEB 3TH2T 3QEQE 3KPRB 1R6VA 3GRWL 2A6DB 4JY5H 1M6UA 1Z1WA 3KXFE 4JANA 4RFEB 3UO8B 2OQJA 3AU0A 2D7NA 4JFEB 1SRDA 2Z8VC 4L37B 2NTFB 5ISZE 1AZVA 2EC9U 2OSWA 1CDHA 1H0DB 2FEDC 3DK0A 4AQZA 1WICA 3H9HB 5JIPA 5KSBB 3IDJA 3MOAH 3VVVA 1YPZA 1DN0B 4TQHA 2MOGA 5D72L 5GGTH 3K80A 4JHAH 2NXYC 1HEHC 4FTVB 5MEOA 1CTOA 1IQDB 4G5AA 3DIDA 3ZMEA 1D2PA 4X6DE 4UQBA 1OF0A 4PJCE 4GKOA 4FQXD 5CGYC 3AREC 2Y2YA 4KXZI 4RFNB 3ZRCC 3VXMD 4P2OC 3FAWA 2YHGA 4N0YL 3MXVL 1CXFA 2CK2A 3DTUB 2CO6B 2DQGL 5FX3A 2GHWB 3I6KB 4PWKA 4PJIA 1B90A 3HJEA 4CKVX 2J5WA 4JRYA 4U1IA 1LO2H 2HJLB 4PBVC 3WN5A 2WO2B 3QUZD 1VZHA 4X8JA 2A9BA 2NQCA 3HNSL 5T1DL 3ZTNH 4AMXA 2AKRB 4DPAX 2ZJSH 2CO1A 5B8CB 1IBHA 4J4PA 5KTEL 1P2CB 1KELH 4OCLC 5C7XL 1AXSB 4G7VL 5DEFB 3SO3B 1MQKH 2WXHA 3FH5A 4B53A 4PRHD 5E1GA 5T33L 2NNCA 5DD3H 3BQUA 3ULUD 1NCAH 1P5VB 1I1YB 1HNFA 1H5BC 1A3LH 3WTUA 4U3HA 2C9SA 1F3DJ 3G5ZA 5TDNA 5B4MD 3O9WA 5B38G 3CZSA 1YYCA 5L2KB 2IH1B 2WIIA 2DWDB 4LLQA 4G6KH 3KLHD 3RUGA 3MKKA 4JFEA 4QD2E 3MNZB 3DSFL 1UA6H 3CFBA 2A4EA 2I07A 4JFFA 4G9FB 3IDXL 3QPXL 5EBLB 4EI5D 2JCWA 4KHXL 1Z9OA 2ORBL 4WCYH 4A6YA 3O8XD 5CD5C 2WP3O 4GLRH 5F0LB 1IT9L 3NJFA 4JW3A 1IKOP 2XX0A 2XIBA 4BA8A 4XBMA 5FYJL 2Q9OA 5ALBL 2CD0A 5D7JD 3SDAD 3UCQA 1JGVH 2YSTA 3MX0B 1XGRA 5CN1A 4EN3D 1ZHLA 2GB2A 2R1YA 4WJ5A 3OKDB 4JGUA 1LEGB 4RMSA 1H6UA 5IJVA 1MCFA 2EIZA 4PJCF 3PP4H 4WFEE 1XBRA 2BVUA 4M5ZL 1XZ0A 3RGVD 2A77L 4H8PA 4L29A 2WXQA 5C8JA 4U1SB 3RQ3A 3VJ6A 1OEZW 4AT6A 1KGCE 1QPKA 2N7SA 3M1BA 2N1KA 1OK8A 4PLOB 4YSRA 3VW3L 2YGVA 1IU1A 2X70B 4IBLT 4K07A 4FXGB 5EZIL 5T3ZH 5BRZA 2ZYRA 3UPRA 4KMTL 1MFNA 5G4MA 5GPRA 1XT5A 3FU9A 5D1ZD 3WDHA 1DANT 4HXAL 1CXIA 3A4AA 5IV2A 4YE4H 2FECI 4QOKE 2CJSA 3DVNB 2BHUA 1BVNP 4AWJC 6PAZA 4LXFA 2DWEB 3SE4C 3ULVH 2P26A 1OGAA 4GOSA 2XRAH 5AYTA 2PPCA 4LVEA 2Z31C 1F11A 3GBLA 4PG9B 1E6JL 3NN8A 1U36A 4AIXA 2YUVA 3B2DC 5JQHC 1JDAA 4NP9A 4O58H 1KPUA 3KGTA 4MAUL 1N5AB 4F5CE 3ZDZE 3H42L 4EN3C 5FLVA 3HNVH 2YGPA 2NR6A 2VH5H 3T1FB 1WIPA 2BOBB 1DUYB 2GSIB 2PXYC 4P59L 1RHHA 2AEQL 1FLRL 2Y6SD 3RKPA 1CTMA 4JPIB 1XTMA 4X6CA 3SE9H 3VFNB 2XN2A 1MW1A 4NO0D 5I1HH 4IU3A 2ESVE 1NZRA 2XWJB 4PVLA 4KVCL 4PGBA 4MWFA 1WIOA 3CZGA 4U1SA 3N43F 2YO3A 3VJ6B 4CN1A 3VVWA 3K5RA 5JIKA 4ANXA 2C3VA 4I89A 2YK1H 1JRHI 1MFDH 3IE4A 3RPKA 1QBMH 5FOBB 4MMXA 5I1CH 4ONHA 3TFKD 4YXLH 5I66B 2DLGA 2WKOF 5FECA 4FABH 3RY6A 3AADB 1W72B 4JE0A 2ZCHH 2OAAA 1MCCA 1LILA 5AW9B 3OX8A 4M5SA 4TUUA 5DZAA 3DPBB 1HQRB 2DQEH 2DJ4A 4JKPH 5KYXA 5CZXD 4P9HL 1CDGA 4BE6A 2WZPD 1SVBA 3UG3A 3CVCA 1CURA 4JZNA 2HUHA 3UADA 4M1CD 3INOA 2A4ZA 5BV7L 2I32A 2VXQL 2DEWX 4PGCA 5DFVD 1ACCA 1MHHA 3P3RA 4CSPA 1S9YB 4LLMB 2OMVA 2PTTA 1S5HB 2P7TA 2V7NA 5FM5O 2QGCA 2BW4A 2HT3D 3KJ4B 5MEQA 3BH8B 4LHUD 5EU5B 3BCDA 3P54A 1JXDA 1SEQL 2C9XA 3IFOA 4IBZA 1GW0A 3NZSA 2HTKC 1TJGL 4ONOA 3LJ3A 4MJHA 2D9CA 4P99A 5D6CB 4AOFA 4OCNC 4NZTH 3HMWL 3L2NA 4KFMA 4WHYH 4LVNB 4N2BA 1B3IA 3MRFA 4OZHB 4U1JB 4AVJA 5B38A 4DVBA 4HIIB 2IH9A 2NZ9D 1AXSA 1A25A 1NPNA 2YRPA 1L9PA 3IKKA 2CJUL 4APQD 4B3EA 4N0YH 3L1GA 5DEZA 3BVTA 2XT1B 5ID1B 1GOHA 1JWUB 5DLML 2MTPA 3FK3A 3N85H 5EBGA 4KRPC 2D9QB 4BRVA 3OKOA 4QAMB 2DQIH 3PWVB 3LQZB 4CW1A 1NOAA 1TSRA 1JIBA 2QQLH 2RMNA 1KTKE 2EKSA 4R7VA 4X9GA 4Y5VB 4MCYB 1NL0L 4XGZB 3TA4D 5IROD 1TUPA 3TVMD 5F3FA 4W9LC 4X5WB 1TETL 3HBGA 1WBXA 2FJGB 5SX4H 5SWZB 1ZHKA 5IVZA 3RWEB 3U9UA 5E8NA 2COVD 1AXTH 3HR6A 3VWJA 5GRYA 5T33H 3QO1A 4KKBC 3QNXA 4NO0A 4GRWF 4AV4A 1MFCH 3TIEA 8PAZA 4YFEA 4MRCA 1MVUA 2H2SC 2NY7H 3GGWB 2UWEF 4J8RA 4HXBH 1A7PH 1RZQA 4GUPB 5AB9A 5BOPA 2IBZX 1N12A 2WXIA 3HG1A 3T4YA 3HG3A 5C1MB 4WEUD 4LSSH 3PJSA 1BYPA 4FFVD 1BMGA 1JNLH 5G5DA 3O0RL 1MCBA 4I5BA 5AOJA 3LN9A 5T1MA 2JJTC 4AIZA 5EEXA 5M7QA 5B3NA 1J8HE 3NZUA 1DDHB 3E8UH 4PBWD 4F20A 1VKXB 2IAND 5DZPA 1UXSA 1MJJA 4WEBL 4RAVB 4JG5A 2BSRB 4NWUL 4UIMB 4Y7MA 1AZZC 3VMNA 4UTAH 3SKJL 5J6GB 4FXGA 3LRSA 3I2CH 4FFYH 5DRNA 5EFIA 2E9JA 1H3GA 5FYJU 3HG5A 1GGBH 3HG0A 5D2LA 4KI5E 2OLDA 2V8LA 1I7RB 2W91A 3B9EA 2BNRE 3QC6X 1V05A 3X14A 5KUMA 1NJ9A 3ARPA 1M53A 3PP4L 5F6HI 3V7MA 3O9WC 1FBIL 4JRLA 1D5MA 4AW7A 3K0WA 1RI8A 3B9AA 3MRRA 4HWEL 3ECQA 4OLYH 2FLBT 3KEDA 4EVNA 1IC5H 2APWA 4GAJH 3TN0B 1P1ZA 1NKGA 1JGLL 4Z3GA 3Q8FA 3LZFH 1JTPA 4FN0A 4NHCL 5DA4A 3ZRFC 3QHTC 5F7DA 1QI4A 1F42A 1ZT4B 2E6QA 3QJTB 3VFMA 4AV0A 2F5AH 3V0FA 5E03A 3T71A 1RHHB 4HALA 5TFSL 3GHBL 1Z5LA 2PYED 4IK7A 4YSDA 5EDXA 5GS0C 3ARGC 4XMUA 3VWKD 4LOEA 4UIKL 3WS3B 1GS7A 1WWCA 3ULVL 4XHJC 1LO3L 5GSVB 4X5RA 3NJMA 2XRAL 4Y5YA 1ZDQA 5DWUH 5D7LB 3HE6B 5CZKA 3DRTB 3AABA 1YEJH 3MRCB 5IB2A 1KCVL 1AQKH 1WCBB 2G2NA 5D1XE 5G5DB 3X2QB 4EO5A 4I1RA 1MI5D 2R15A 5D4JA 4IGBC 3VXSA 3L6FA 3SD2A 1ETA1 3HNVL 4LEEA 5F1SA 35C8H 1IKNC 3NIGE 2OX5B 4XX1E 4DUXA 3K71A 4MMYA 4ADJA 4OUUA 1GMIA 4HA1A 4F15B 4FS0A 3F12B 1U91B 2ZXBA 2QGDA 3LKSB 4KROC 1RUML 5SWZA 4G83A 1LP9E 3CBRA 4FTVE 1X5KA 5KVMC 1D5XB 1U8LB 3AAZB 3BWUF 2N56A 1E5YA 2P8MA 4L05A 5DLLA 1P1ZB 4XAKD 3WEXA 5A43C 1TTBA 4M56A 3UERA 2E7LC 2CIKB 2D7PA 3IU4L 2J4WH 2F5BL 1KXVA 4W93A 3QULA 5CLYA 3C8KA 5JHDE 5E2TL 4KNSA 3LEXA 4FABL 5D6DC 4HISA 4ZSOB 3RX5A 3DV6B 4FQHB 2J1ZA 5HYJB 4DW2H 3BPNB 3L4TA 1N0LA 4MNGB 4PLNC 1E5AA 3PWPE 4L9LB 3ZHLA 1T03L 2N1TE 3UROR 3QRGH 3S35H 3RTQC 2OV0A 5ETUA 4Q9RH 3I75B 4N9GB 1CD0A 2X9XA 5C08E 4TNWF 5B38B 3IAQA 2J20A 5K9OA 4I0CC 4KJPD 2VAAB 5T3XD 2JFCA 2K8MA 4CVZA 2BNQA 2Y7OA 4FMVA 3MUHL 1QFWL 4XXCA 4PJ7E 4HHAA 2R9HC 5DHVA 3UYRH 1MDTA 2Y07H 4NERA 3HFFA 1DL7H 4HPYL 5E95B 4NQCE 5C09B 5T5NF 4XOEA 5ANMB 5F7HA 3GSNH 2HKFL 3KLLA 3TEYA 2EXYD 3SJVB 2VAAA 2CJ3A 1WV7T 3RWCB 1I9RL 3O4LD 2V37A 3S3CB 3DXAD 4LGSB 2G2RA 4NSKB 3MGTA 2DWXA 1A9BA 1T89A 3MO1B 4P46C 5D7LD 1JVOA 2ICWA 3X13B 2FDBP 1EERB 3JV6B 4YZFE 3RIKA 4ODUA 3VD5A 1FFNB 1OAYL 3TT1H 3J27A 5CBEB 1XF3A 4A04A 4YOKA 2OJEA 5L2JB 1SYVA 2GT9B 3EYFA 2ATKB 2FJUB 3CK0H 3LS4H 4AQAA 3QT2A 2H8PA 3NPSB 3T0EC 1MZZA 4XP9L 1OW0C 3BT0A 2BSSA 1A02N 3K7UA 4TF4A 1AO7A 2ICEC 3M7OA 4K8RD 3S34L 3ZZ1A 3NRFA 4G9DB 5FUCE 4C56D 4HEPA 3TNMA 2Z93A 3MV9A 4KNTA 5FCUH 3II3A 2J73A 3MREA 1G7HB 1CS6A 2G60H 4NAQA 1ZA3B 3APMA 2X44D 5KVDE 4QXWA 4EKJA 1YJDC 5E9DA 4QRTB 1IQDA 2EO9A 3T0AA 2E7MA 1G6RL 3HLKA 2YXWA 3U0WH 5D70L 3K71B 4CU8A 1I1FA 5I1LA 4U1GB 5EC2B 2GVYA 3H0TB 2JSFA 4J3UA 3ORJA 5F8QC 4OCMC 2NY1C 1C16B 4WRLA 3VXUD 4NM8H 5GZNC 2BNRA 2MKWA 2E59A 4PHZA 1ZAGA 4HHWA 3QJVB 2ZSVB 4PG9A 2BW5A 2NR6C 2X0WA 1KGIA 2Q3AA 3QUHA 4PJ7F 1RUAL 2BNRD 5DMGD 1G9MH 2BK8A 4RX4A 3SQBA 1IM3B 4Y19A 1VPOL 1SEBA 4Q8BA 1PQZA 3HE7D 3H9SA 1GZHC 4N3TA 3UTTB 3IEAA 3ZHKA 3GS0A 3L54A 1G9MC 2AERT 1HHIA 4ZT1A 4HUXA 5HY9A 2ADYA 3EH1A 4O51B 5CLZA 4APXA 1MRFL 3T6WA 2OS7A 2Z93B 3MV9B 3RIFK 2PTUA 1DEDA 4EI6A 3IB4A 2WUBL 4HMCA 5AL8A 4L3FA 5EN2B 1MW0A 4KAQL 3ML9A 4OLYL 3VRJB 4Z7QB 3ZKND 2FQDA 1A7OH 2APBA 4CC4A 3X17A 1QSEA 5KVFL 3KYOA 3QFDA 4PJ5A 5EU6E 1IGFL 2X28A 2FEEL 2YBRB 4J28A 1DFXA 5E6SB 4XBPB 2E46A 1BAGA 1CXHA 1TT6A 2AJYL 4OCWL 3QEQD 1OK0A 4ZW5A 1S8DB 2B20A 4RZCB 4DQOL 2DQJL 2ENPA 1MVFA 3FS9A 1NCGA 3WO3B 3GHBH 3L7EA 1N6QL 1J7VR 4ABVA 5IQ9B 1JZ8A 5AYQA 5F7AA 5JHDA 3D06A 4K5OA 1H3TA 3DMMA 4ENZA 1CF1A 3UMNA 1HQ4B 2QQNH 3GC3A 4J2QA 4MNHB 4GRMA 4HIHA 4IKNA 4Y1AD 1M7IA 4X4YA 2HPOA 1DQIA 3FMGL 1ACYH 3PAVA 4CKQA 1A4KA 5DVMA 4A55A 4S1SL 5I16A 3O9WB 4XAKE 5HHQA 1B6UA 3L3GA 4Q6IB 4DO6A 2XN9D 4OM0L 3IGUA 5HDBB 3IFPB 3CDGB 3RDTA 3PFUA 3EH2A 2Z8RA 3HIZA 1P7KA 5I0DA 1RLBA 5F9DC 1H9DA 2A6KB 5EOCH 2X6UA 4PRHB 5EIVA 1GC1L 1HZKA 1T7XA 3FQ1A 4BFNA 4FNLL 5JIDA 1OL0A 4P5TD 2EE9A 3NGBB 3S36X 1N5YL 2ZX5A 5I75B 1M6OB 4M48L 3MTRA 5C0JB 1BIIB 3GS4A 4UILH 1D9KC 2HG5B 3FU6A 4G3YH 5DQJA 2ZWYA 2KLRA 3F84A 4F2MB 1KOAA 2WCGA 1G0XA 4JM4H 1E5ZA 3ULVC 1ET7A 1QEWB 3B3BA 4Y2DB 4CILA 3TPKA 5F9OL 4FI7A 2CXGA 1ZVSA 3I6LD 2OSLB 1JFHA 5DJZA 3SPVA 1USQA 4B6ZA 1LE9B 2A6IA 2RAMA 2LV4A 1GGCH 3AG3B 4LRIC 1OANA 3BWUC 2YD8A 1DBBH 4OQ1A 4L0YA 2E7CA 2PP7A 1V54B 5AZEL 1ZGLB 1RK0B 1A9BB 3LYRA 1CICB 3D12B 1XF5B 1PAZA 1Q9LB 4WUUD 4ZS6D 4HG4J 2F0CA 2AJUH 1M2OA 1WS7A 1SM3H 1H5BA 3IKCA 3HBQA 1IKFH 2DBLH 4JDZA 4RFEA 2YD5A 4HKBB 1HSAA 3M17B 5CEYA 3DXAA 1LQBC 2J25A 2DJMA 2DYSB 3S88H 3GSNL 1OAUH 1OD7A 4HLJA 1FNEA 1I9RH 2V2XA 3V6OE 5EEVA 1Y07A 4JANB 5CINL 1ZLDA 5L6YL 5J1AB 2EDBA 4CVXB 1P5VA 4XNQA 3OX8B 1PEZA 1I1AA 1GW6A 4TUJB 5IB4A 1XR9B 2R69A 1YEIH 2N59A 3EYQD 4QWWC 4XHJD 5MEPB 2ZXWB 1VB9A 2D2CC 3PAZA 1JERA 1ZTXE 4U3XA 3WJJC 1MW2A 1AAJA 1K3IA 3MLVH 4G42A 3C5ZC 3H6JA 4X99B 2VR5A 3CD4A 5DYOB 5FF6B 4K23L 3STZB 2JKJA 4EOWL 1MPAH 4HJ0D 1KV7A 4R2GB 3IPFA 3KR3L 1JWMA 5JHBA 5CKGA 3TO4D 4H4NA 2R27A 4DHLA 5CCKL 3HZYA 3LNEA 5C0CA 2BS71 5DGRA 1WA2X 3OMZA 3I84A 2NUPB 3QEUB 3GMLA 2FK9A 4PJEA 3V0VA 1AOHA 3B8YA 5FKAA 4HUWA 1MCDA 1U4EA 3V6FB 1E4WL 2WQVA 2YD6A 3DRQB 4Z7VA 5A6MA 4HUUA 3HAEB 3X11A 3WTTA 4I3SH 4PYHA 3CDCA 3CFEB 1PSKH 2P5WA 3HUJB 3FH7A 4PJ8B 5CU9A 4WHTA 4YDLC 4GMTL 5C0EB 1E4JA 3LN5A 5EBMB 1U3YA 3B8SA 2YWZA 1MREH 2VLKD 3SOBH 5EC2A 1MSPA 4NI3A 3V5DA 4JL1A 4YHYB 3IVKB 5H4YA 1OAZL 3QDMB 4OZGA 3MLUH 2OYMA 2Q7YB 3NABL 3N91A 2UWEB 2F61A 2VXTH 1SXBA 4FZ8L 4L2YA 1NDTA 4YH6A 1YO4A 3N40F 4R0LB 4ILDA 3PIQA 4PJBF 4RISL 1J0IA 2BNQD 3VMPA 1MHPL 1MN4A 2DQUL 3CH1A 1CE1H 4X99A 3KJ6H 1NOLA 5I9QB 2I9LB 3STZA 5FF6A 4H26A 1RH8A 1VDGA 1MFAH 1E28A 5IWLC 1A4AA 1LK3L 2WBWB 4QYOB 1R47A 3F7YA 1TEFA 2YXVA 2NY6C 4WI6A 1KB9K 2MQ3A 4NKOB 2BSTB 5BZZA 3VCLA 1U8CB 1IE4A 4XVUC 1AQ8A 3P4LA 5GGSB 2YXFA 3EBGA 1Y6NR 4AZUA 5JZ7C 1HSBA 3N43B 2HT2C 3VGAB 3QYNA 4BGLA 1CBVH 4ZXBA 1C5CL 4E9LA 3QI9C 4E9QA 4EDWH 2X2HA 3IXAA 3D39B 3R06A 3V4PB 2R1YB 3DJ9A 3L3JA 4WGVB 5E1QA 1F90L 3M17A 5F0PB 1F4YH 5CEYB 3HZMA 1HYRC 4FJZA 4RGNC 1LO0H 2AEOA 4L4JA 1JGEB 3MNWA 4FQCL 3P77B 3DX1A 4A6YL 4XP6L 2DWSA 4ELMA 4XI5D 4N8PA 1CR9H 4AYDC 2MOQA 3WFEH 3F6LA 2PLTA 4GNKB 3VXMB 3UCRA 1CL7L 3EFDL 3Q9PA 4JFHE 5CP7B 1HOEA 4AVIA 4JX0A 3MOBL 5FUZH 3MDJA 3RUGB 2BHZA 4WW1B 2BCMA 2BZCA 3D3VE 3VSVA 4BXSV 4JFSA 4ELMB 4ZFOA 5JW3H 2JCCE 5JOFB 4MNQD 2AW2A 2GUYA 4ONFH 4PJIF 4R8WH 3RL1A 3QYMA 3SGJA 2D03H 1JXJA 3MJ6A 4ZO6A 3VGDA 4PTTB 1LO5B 3KPTA 5IBUB 4F15C 3V8CA 4GMSL 3K2KA 2VDLL 1NEZB 3IE9A 3WV0A 1CT8A 5FB8A 3BAEH 5F7WC 1MCOH 2L04A 2CIIA 2X4OB 4JFQB 1BOGA 3F7YB 3L3HA 4TUKH 1AD0B 2JVUA 4MHHI 2Y1VA 1FPTL 4ADGA 2W07A 3IN2A 3IXAB 2CM5A 3R06B 5ISZD 2X89D 2WB1A 3SGEI 3IRCA 1J5CA 1QTPA 1TCRB 2F9BT 4PLJD 1ZE3C 4GRLC 3MRNB 5F9OH 1NFIA 4I18A 3CSYB 3BT2L 4LSDA 5AOKA 5C0IA 2AV1A 3RZCA 4N25A 5E99L 2BWQA 2CIIB 3SDXA 1DQLL 3NZHH 4FNUA 4G5ZH 3OKMB 1LEIA 3IMWA 2AP2A 4PCSA 1IBDA 4PV9B 2Y1ZA 3WIAA 5IJBC 3EYQC 4QWWD 2EINB 1SDYA 4LEOA 5I1DB 2E7HA 4BHUA 4E5XB 3I74A 2EIMB 4OLWH 3QQ4A 3EW3B 1OTTD 1OKEA 3ULVF 1AGDA 2AK1L 4GFXA 5DJAB 1B4RA 1AHWC 1YEHL 4IOFC 2FJHB 3Q5YA 3CH8A 1P6WA 4HPOL 5DZ9A 1S9YA 1CK0L 1JN6B 3THML 1ZJBA 5TJWK 3HI1A 3RNKB 2EO7A 4L8SA 1KJ3L 4NUMA 5D7LA 2AJSL 4M62L 3GUFA 2DW5A 3O6LL 2A83A 4X6DA 4GQ9L 4GP8B 5MERB 2N7AA 3ZMRA 3QG7H 4QHKI 5F9JB 7FABH 4HH9A 4LVHC 2ICCA 5CN2A 4AM0B 3Q2CA 4DFHA 3HG1D 4RIRA 4KTGA 1WBZB 4DGYH 3BEVA 1SLUA 4PRPD 2R2HA 4HUWB 1DE4A 1T3FA 5KVDH 1B0RB 1B2WL 1P4BL 3CVHA 1RK1B 1P9MC 1ES0A 3CLFL 3HG2A 4U0RC 3EGXA 4JRYD 4LCWB 3VWKC 1TMQA 4MQTB 5IB4B 3FRUB 3NACL 3CMGA 5ESAA 4HJIA 1BZ7B 1EZUA 1JPGB 4FTDA 3NQIA 4JFPB 2R2BB 3BZEA 4P3CH 2Z35A 1YEFL 5C09A 4AJVA 1D6VL 3NH7H 2B5IB 2JXMB 2WPGA 2Q8AL 4ZO7A 3KLAA 4AQ1A 2MNJB 5F97E 3KWWB 5GGUB 4QRAA 5GISL 3GSXB 4PRHE 1UADC 1FAIH 4N85A 2BCKA 2NYKA 4FI6A 2VDQH 1T83C 3LNFA 3MU3A 1NFDA 4Y1AB 3ZT5A 4DESA 1T7YA 4JKKA 3I9AA 4UT7H 5J11B 2R4RH 2GG1A 2AK4B 2OBGA 4JN2A 3U7WL 4D0DA 5HHXH 3LRLA 4N87A 1HCYA 4G6FB 1EIBA 1YEDB 3PXLA 5E08H 5DZLA 1QASA 4IOIA 5AAMA 3JTBA 1UXMA 1NANI 2A3TA 1EHLL 4WFGE 4M1DH 2V9UA 3KDPB 1MJUL 1MIEH 2HJFA 2WN2A 1NEUA 4I18B 4KHTH 4KPHL 3SCMD 1MFAL 3DUUA 3GJFH 1EAPB 4CMHB 1NMAL 2IANE 2B77A 1HI6A 1RUKH 4PRAB 1Z5HA 1MCLA 2XVKA 1QABA 5I15H 1HCFX 1N6VA 1LP9A 1WK0A 3SDCD 1NGXA 3IS0X 3OGCA 3CC5A 3HB3C 4WK2B 2F53B 4OLUH 4FXKB 5ITFB 3O6FD 4JN1H 5DUMH 1F4HA 2Y0SA 4TSAL 3SQOH 3CZUB 1YDPB 2NYZA 2Q3XA 1IC7H 4X7SH 2Q6WA 2PWGA 3DSFH 3RGVB 4OFPA 1EZVY 1QFUL 2CE6A 2F19H 3BDYH 1DLFH 2ESVA 2ZCKH 3MR9A 3NIGF 1OTSC 4H0LC 4AZ8B 2AXFA 4YHYC 5T1DH 5A6IA 4YR6A 2UX7A 5FKPA 1IZJA 1TJXA 4QCIA 1AMXA 1LO5A 1U8PA 3MXWL 2M1KA 5DHXB 3RWJB 5IHZA 5J9PA 1RZJL 3QCTL 4A6YB 1XIWC 1NCAL 1PGRB 2DQHH 4PB0L 5FO7B 3EZJB 4AGLA 4GIPD 1RJLB 2NX5E 3IXTA 5FUZL 1V8HA 3R8QA 5CNHA 1U8JB 5JW3L 1T22B 2J71A 4F7TB 1BPVA 4XO8A 4HEMA 1JJUA 1EDYA 3RWDA 4PCYA 3OAZH 1BVZA 5FFOA 1BM3H 3G5ZB 3W82A 3F7VB 4QF1B 2Q8BH 4N8CL 3ZIYA 1K6QH 3V4UH 3VFOB 3OXRB 4Z3FA 5FO8B 2LW3A 1A3ZA 4JZNB 1SOKA 4KJWD 2VZTA 1NAMH 1A66A 1ACZA 5F3BB 5KBKA 5DQDH 3FB6A 3S7GA 2W60A 4ZUWB 4BKSC 2XA8L 2BSED 1QBLL 4F33B 1OM3H 4JFDB 1KEGH 5GIRA 1NGXB 4M93B 2YD9A 3EFFA 2A77H 3ASNB 3MACH 3UAJD 2I60L 4HU8A 1BQ5A 5DFAA 3BKMH 1LDPH 3NCEB 1GZQA 2PWFA 4LSTH 4XNXL 4XXWC 1OLLA 1FZOA 1OOWA 2ZCLH 5LGYA 4AVKA 1BG9A 4JN2B 3HLAA 4TVPL 4AY0A 5KSBF 4JPIA 4JZJC 1ZCRA 3ARSA 4X98A 3KPPA 2CRYA 3ME0B 3SCMA 4LGPB 4YZFF 1PZBA 3UTZB 4PGBB 2DEYX 1UZ6F 2OMYA 4HQQL 1OAXH 2HVJB 5FO9B 3ARFA 1KWKA 3BQUC 4X9BA 5H35B 2OM5A 3JQOB 1JPFA 3K4ZA 4H44C 3OR6B 2FHFA 2OTUB 5HPMB 4FXGC 4FJ6A 5DJDA 3OBAA 3MPCA 3B2UD 1X5AA 4N2FA 2ZT9C 5AD0B 1TDQA 2JB5H 4GO8A 1THAA 4YL9A 4FNTA 2XJLA 4AIOA 5J12B 5L88H 3T6XA 4PV8A 5JHLA 4ZDHA 2OCFD 5I75C 1G7LB 1DP0A 1FYTA 1U8IB 4W9DC 4LCUA 4PIBA 1HNGA 4WJG3 4OGYH 3WN5C 4N2GA 1BZ7A 1UJTA 2ESVD 3GHEH 3BPOC 3WJJA 3O2VH 2OTWA 5D1QC 2A2QT 3RHWF 1RAMA 5D2NC 2JE8A 3MBWA 4O02H 2O5ZL 3UGEA 4P2OA 4IW4C 1NC4D 4UTBH 4A2FA 3SPVB 2UZXB 4MZ2A 4BFKA 1QLRB 4MXWH 3QEGL 3F3HA 1ZKAA 4ZMOA 2PXYB 4FFZL 1XR8B 4YK4C 3RPIA 1ZY9A 1T0OA 1FL6A 1OV8A 4LFHG 4XP5L 4DAGL 1OCOB 1UXSB 2OI9C 2ZUVA 1NFDE 5JMOC 5DJXB 4A2LA 2DH2A 2VIRA 3K8LA 4F58H 2X9WA 2PR4H 4PN6A 1AHWB 3L2LA 4S1RH 4YXLL 1GJIA 3ZHFA 4HUCA 5JIHA 5LBVA 1F4AA 3OKNA 1SYVB 2GT9A 2H6PA 2XQYK 3EYFB 3QORA 1X7QA 2FNWA 5H8DA 2R83A 3RKDC 3LKPA 4K4KA 1OPOA 1CFBA 4J39A 4PJAF 4X6FA 3WFZA 4WNSA 2RACA 2Z0BA 4NENA 1N7MH 1V27A 3IN0A 1J9SA 2J8UA 3B2XA 1GCYA 4QRSB 3VGFA 3ZMNA 1OGTB 2AJXL 4F9LC 4UNIA 3LKQA 2UZIH 2WXOA 4ODXB 3IJHB 3OHXB 5GS0L 4F1ZA 1RULL 1BGXL 4ZJ9A 5CP3A 4DZBA 1U2YA 5ITBL 3NAAL 1ZGLM 5CWSB 5KANI 2MCG1 4MBRA 4HIXL 3AT0A 1TJIH 2YBRA 3FB5A 3QULB 4BCXA 4U49A 5IFHL 4R4BB 3H2WA 5TPWL 1NL0H 4X7EC 1TG8A 2Q6WB 3RGVA 4AQ8A 3GI8L 1MHCA 1MQ8A 3L4VA 1ZLVH 4Y89A 3UJJH 1KIQA 5IHLB 1KWGA 4XP4H 5IR1A 1CLZL 2C7UA 4ANKA 2DM2A 2DQDL 3L9BA 3BJ91 2X4PB 2YD0A 3GMQA 4AQ8C 3KLQA 1J8KA 2J8UF 2WKLA 3LDBB 3HHRB 4HCFA 2CJUH 5I82A 1UD8A 1HX0A 2HRHA 4LCIL 4MHHG 5IREA 4XCFH 4OZIB 5AVUB 4JN1L 5DUML 3KDMB 5GGSY 1BECA 4MDIB 1YJDH 5AB1A 3QI9B 5C0CE 1TYEB 2DQIL 2BVOA 5E4AA 4CSSA 4NQCB 3V0IA 3JXAA 4JLRB 2WBKA 4TPRL 5DJYA 1OT1A 3U4EB 1P7KB 4P3WA 4TSCH 5HHNB 3QDMA 1J1OH 5FYLE 4Z0BL 5SWZE 4FL4B 5KS9F 2VUYA 3I6LE 4X80L 5AAWC 1YA5A 4WLCA 1IBGL 4ZUUA 2WLIA 3SPJA 1D5XA 4ADIA 1FNGA 3VTMA 5E7BA 1GS6X 1KCLA 3QCTH 3LIZH 2JKXA 4M5YL 4UTAL 1SJHA 4ZX6A 1ZHBA 3JTSA 2AZUA 3VFGL 2D7OA 1CFQB 4KUCD 1PLGL 4R4NC 4NYLB 1ODAA 5LUMA 4FMKA 2GJPA 5KYUB 1JPSH 2VDNB 2BOLA 2ZXEB 4XMXA 2ZP9A 2CZNA 3QDJE 3WUZA 3T65B 1NGZA 3F5WB 4XCYA 3B1TA 4YFLF 5J6SA 4OLEA 3C6SB 5DS2A 2UZYA 3QJOA 1N0XL 2Y5QA 4JVWA 1QR1B 5JHDB 1BOYA 2ZWLT 4I3RL 4HULB 2BRQA 4XZUA 5GRUH 2Q8BL 3MUJA 2LFGA 2Y72A 4OI9A 4UINL 5JQ6H 3O3BA 1FFRA 2YXMA 5HVFB 4AQAB 3TA3B 1NAML 4I0PA 1OAJA 5E9AA 3PL6B 3AG4B 3QUXC 3BFWA 2A4CA 4RIRB 5EZOH 1MFVA 3WEAA 1AKPA 3LZPA 5DD1H 4PWGA 1BREA 5D7KD 1ZT4A 1U8MB 5E1AB 5AKRA 4X5PA 5JW5A 4XPGH 1FVCB 2FO8A 4NRYA 1AS8A 3KPRD 1OM3L 3FBQA 3BH9B 4OD2A 4NT6A 4MTMA 3VG9B 4X4ZA 3EYOB 3CVBA 4TL5A 3AXHA 1JGUL 2J1KA 5DWUL 1TF4A 5F44A 4OCSH 2IAAC 2BNRB 4P5SA 5KSAD 3FRPG 4MA7L 2X38A 3QIWD 5CZRA 2CHZA 2UVFA 2EH8L 4N0FA 1B9ZA 1JGLH 4M3JA 3RA7H 3T4AB 5D2NA 3REVB 2HVKA 4PRBA 5LKNA 1CN4A 1UH3A 5MENB 2CO3A 5ADPL 1BVKA 2CR3A 3E7JA 2J88H 5D96B 4N6RA 4HS6A 1UWEL 3R7QA 1A3LL 3HHSB 5TFSH 3FYEB 2CDFB 2VMEA 3MRGA 5EIIB 3STBA 2EH7L 2AEPH 3QR2A 4NUGL 4W68A 2B2XL 5B1BB 3UABA 3ROOB 4FG6D 1QFPA 3TNMB 2FB4H 4ZFZA 4EE2A 1QSFB 4TLKA 1T4KA 3FT9A 5T1LD 2J5LB 1TCRA 4NQVA 3IU4H 2J4WL 4MX7B 4KHXH 4BH8B 1PZUB 1PFOA 5E2TH 1C7SA 2C9PA 4QRTA 2Q76A 3U4BH 1ZIBA 1FYTD 3KLHC 4PGDB 2ICWJ 1NUNB 1TMCB 4J6RL 4XCNB 5K59E 4ZX4A 5DFTA 1FVCA 4Z7UA 25C8L 4IRSA 4XOCA 4P46A 5F9WB 1PZDA 3WEMA 3L4ZA 4RA0C 5T1KD 3HS0A 2A9NH 4JR9H 1LWRA 3D6GA 1G9NH 3SPIA 3MBXL 5DURD 2Z7YA 5MI0B 1I4FA 4AKQA 2J1WA 2ED9A 2VC2H 2XN9A 1A6VH 3VXRE 2D3LA 2BRRH 3UG5A 3C08L 5EEYA 2MKLC 3S2AA 5GGQH 1AGCA 2VZ3A 5ANMA 4UDUA 1J87A 1NGWA 1E65A 4ZFGH 3D0VA 5SWQB 5IEHA 1WFMA 2YQGA 3FTYA 2NNFA 3SPCA 3L3GB 2CNZA 4Q9QH 1LMKA 1VGEL 3JSSA 2EEFA 4DW2L 2XZZA 4YHZH 4MJ4A 4XTRC 2VDRL 3GNMH 5D7IF 3VTTA 2IVFC 2GK0B 1T03H 4O02B 1J1XH 3DHJA 1W0WB 4ZI8A 2O61A 3BIBX 3QORB 4H8WH 3PHAA 4DKFH 1Y18A 4RLDA 2AABH 2R69L 1BQHB 4ETYA 2WSPA 1A7NH 3FU3A 1W9XA 2VZUA 3TJHD 2YARA 3QUMH 1L9MA 3VD7A 3BVNA 5MENE 3U9PH 5DDHB 4CU7A 2FR4A 3L7FA 5TDNB 3T0WA 3ZXAC 3I75A 4N9GA 5FEBA 3H42H 1OB1A 2E9GA 4ZUTA 4WIQA 1EGJA 1F58L 4XNUL 4IOFD 1ZV5A 1AYRA 2H3XC 1X5MA 3S2CA 2X4SA 5I66A 2DEXX 1P7BA 2HA1A 2JK5B 3O2WH 5T3ZD 3WU1A 3PP3K 1AE6L 1QLEB 4I3GA 3FT3A 1KBGH 1T5KA 2EDJA 2ITFA 4JHUA 4IRSB 1T1YB 4P3DA 4CBZA 3ILEA 3DROB 4A7UA 4TRPL 1HIML 1G6RH 1UB6A 4PY7B 1FFTB 3JV4A 1SN0A 1R3IH 4EIGB 3R0MA 5EO0B 1IBZA 4ZXBD 3DVFA 3ARYA 4S0SD 4ETQA 2D73A 1E8YA 3VFPA 5T1KB 3TNNA 4QOKD 2I9LA 3CDGA 4PGEA 1WBYB 4M7LL 4HFUL 2DL9A 4HZLA 1KYOJ 1E6OL 2PPAA 4KX9A 1V7ML 3TIDA 4UUJA 4TSCL 4F5CA 4F2ME 1ASPA 2XTSA 3LKNA 4CRPA 1MRDL 1Y1DA 2FX7H 4C4UA 4L0PB 5EOQH 3G04B 2G9HB 1ZLWH 2XDHA 2Z91A 4NN6C 4D94A 3KPPB 1WZMA 3SCMB 2BDNL 3MRKB 1OWWA 1CLYH 2C3XA 1E42A 4DTGH 2Q7AA 1K3ZA 1CXLA 1TENA 2QELA 4P2RB 1OALA 4PJXF 2IADB 5IM7A 2XQYA 1SNRA 2BY3A 3KAAA 3F01A 4FG6C 3FCTB 1DVFA 4FQPA 3IDYB 3GJFA 4XPHH 4LHQB