4E9VA

Multicopper oxidase mglac (data1)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
317
structure length
317
Chain Sequence
b'AEREFDMTIEEVTIKVAPGLDYKVFGFNGQVPGPLIHVQEGDDVIVNVTNNTSLPHTIHWHGVHQKGTWRSDGVPGVTQQPIEAGDSYTYKFKADRIGTLWYHCHVNVNEHVGVRGMWGPLIVDPKQPLPIEKRVTKDVIMMMSTWESAVADKYGEGGTPMNVADYFSVNAKSFPLTQPLRVKKGDVVKIRFFGAGGGIHAMHSHGHDMLVTHKDGLPLDSPYYADTVLVSPGERYDVIIEADNPGRFIFHDHVDTHVTAGGKHPGGPITVIEYDGVPVDDWYVWKDKDYDPNFFYSESLKQGYGMFDHDGFKGEFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Multicopper oxidase
publication title New insights into the catalytic active-site structure of multicopper oxidases
doi rcsb
source organism Uncultured bacterium
molecule tags Metal binding protein
total genus 100
structure length 317
sequence length 317
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9vA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9vA02
2R7EA 2YQBA 1WA2X 2H3XC 1GSKA 1KYAA 1R1CA 3ABMB 3TASA 1QLEB 4CSPA 1SF3A 4KNSA 2AZAA 2OJ1A 1NDTA 4A2GA 3C75A 3FU7A 2MRYA 3D12B 1SDDB 2GSMB 2YXWA 2BO0A 1ET5A 3AG1B 3NT0A 1IBZA 3MX0B 2BP0A 4HZ1A 5I26A 4ENZA 4QKTA 1RKRA 2VW4A 4HCIA 2JXMA 3CDZA 2J57A 4HAKA 1PNDA 3WNJA 3H4HA 2BP8A 3FSWA 3NSFA 2FQEA 1AG0A 1A4BA 1PZCA 4ZK8A 1QNIA 4JHUA 3SBPA 3UACA 5IY5B 1JERA 2ZWNA 2BP8B 2FQDA 2JKWA 2IDFA 3NJGA 4DP0X 1BQRA 4BWTA 2E86A 2YAPA 2GB2A 3IEAA 2BW4A 7PAZA 1NWPA 1SHWA 1NIBA 4A68A 1NWOA 3H56A 3X1GA 3QJRB 5B1KA 2OCCB 5I6PA 4E9TA 3HB3B 1AG6A 4G7RB 5AKRA 1V10A 2GC4C 1A3ZA 4K9JA 2JFCA 3DIVA 2DYSB 1M56B 2IDUA 1AOZA 1JZFA 4E9WA 4E9YA 1RZPA 1PZBA 2IDSA 4FA7B 1RCYA 2X88A 4AI7A 3TU6A 2BWIA 4YSSA 1AQ8A 2HRHA 3BVDB 5B1JA 1AIZA 1L9TA 2ZOOA 2HX9A 2FT6A 1XMEB 3ZX1A 1AS7A 2QPEB 1E65A 1NPNA 1L9PA 4YSEA 2XV0A 4KNUA 3QJVB 2DV6A 5B1AB 3RYMA 4GY4A 3X2QB 2VW7A 1OV8A 1L9SA 5PCYA 2H5UA 4YSOA 5TK4A 3QJSB 1TEFA 1E30A 1KBWA 3SQRA 1VLXA 2PPCA 2I85A 4A2HA 1HAUA 2QDWA 3FS9A 3FSZA 3N2JA 4W1TA 2UXGA 3IN0A 4A67A 4P5RA 4G7SB 1WS7A 2XLLA 4YVUA 6PCYA 3QQXA 5I28A 2YAOA 4N4YB 4KO9A 3GYRA 3NYKA 2DWTA 1NIEA 1QHQA 1PMYA 1XB3A 2PPEA 2PP7A 1BAWA 3AG2B 2TSBA 3X1NA 5PAZA 3CVBA 4GP8B 3FSAA 4BWUA 2A3TA 2IWEA 4L0PB 1B3IA 5B1JC 1ASQA 1TEGA 2B08A 3NSDA 2VM4A 2IAAC 4YSCA 2UX7A 1GYCA 1W6WA 2NRDA 3X1BA 1WA1X 1E67A 1JZHA 4YSAA 1BYPA 1L9OA 4A2EA 2BZCA 4E9RA 2EIKB 4DP5X 3SBQA 3NP3A 2XUWA 4GYBA 1JXGA 3MBWB 2GHZA 1KBVA 3CZUB 2CCWA 5I6OA 1SDDA 2FJSA 2W88A 2MTAA 2PPDA 3S3BB 1JZGA 2FQGA 4G7QB 1SJMA 4AX3A 2I7OA 2FT8A 3AW5A 1X9UA 4YSPA 1GY2A 1OCCB 2CJ3A 4G72B 1ILUA 1A4CA 2AFNA 2XVBA 2AANA 2Y1AA 5B3SB 1AANA 2EIMB 1AS8A 4DP7X 1ZDQA 1J5CA 4DPBX 4FAAB 4YSUA 2XX0A 1BEXA 3OMAB 4GXFA 3FU9A 3WNIA 2XX1A 1NIDA 4NAJA 4G70B 3GDCA 3NSYA 3WKPA 2XV2A 1JXDA 4BDVA 3ERXA 4BWWA 4DP1X 3N55A 2PPAA 1ZDSA 1J9TA 3ASNB 1FA4A 3ABGA 4Q89A 2BW5A 2AZUA 3BQVA 4BDVB 4GP4B 4BXVA 4MFHA 4CSZA 1SNRA 2LLNA 1ID2A 1RZQA 4HCGA 1HAWA 1SF5A 1W8EA 3UAEA 4YSDA 1KDJA 2BWDA 3H4FA 3ASOB 4E9QA 2DYRB 1XB6A 3PLYA 3UADA 3EH5B 5I5MA 3NJJA 1KCBA 6PAZA 4P5SA 2WO3B 4KNTA 5I6NA 3T71A 3DKHA 3S3CB 1NTDA 3TBBA 2CAKA 2WO2B 3PAVA 5B7FA 4DPCX 5B7EA 4PCYA 1PLAA 2ZONA 5D4HA 2W8CA 2FT7A 3PAUA 3NSCA 3OMNB 1JXFA 1L9QA 2FQFA 1X9RA 1PLBA 1MG3C 4WKXA 4KO6A 3ZDWA 3TA4D 2BZ7A 3G5WA 3JT2A 1OCZB 1BQKA 1ADWA 3QPKA 1FFTB 1J9RA 1AS6A 1MDAA 2H47C 4WTQA 4X4KA 1AR1B 2DY2A 2YAQA 5AZUA 1A65A 2UXTA 4AZUA 5I6LA 1KCWA 2EILB 1IC0A 5E9NA 1PNCA 5I5JA 2YAMA 1GW0A 1F56A 2FTAA 3IN2A 1NIAA 2YAFA 4KOBA 3FQ2A 4A2FA 1TKWA 1J9QA 1URIA 1BXVA 1PZAA 3OM3B 1CYXA 3IBOA 1KDIA 2BHFA 1DYZA 5F7AA 3SBRA 3AG4B 4E9VA 1ET7A 3S8GB 4DP9X 4M4RB 2VN3A 2XV3A 1MZYA 2I7SA 4JKNA 2EINB 4HALA 3PAZA 1XB8A 1GS6X 1KV7A 1DZ0A 2B3IA 2VSMB 1SFHA 5I5IA 1PY0A 3L45A 2VW6A 1BQ5A 3WI9A 5ANHA 4E9XA 3NJHA 2PP9A 1MZZA 1JZEA 1L9RA 1TU2A 1WA0X 2QPDB 1AZBA 3UABA 1BXUA 1JOIA 3EF4A 2HLEB 1CC3A 1EHKB 5F7BA 1AAJA 2GIMA 3FPXA 1OOWA 4HHWA 4DP4X 1ILSA 5FC9A 3CG8A 3X1EA 3OMIB 1V54B 4DP8X 3NJIA 5D4IA 1ETJA 5AFAA 3T6WA 3FYIB 4F7KA 4KOCA 3QJTB 2Q9OA 4AKPA 1BYOA 1JVOA 4UF7C 2YAEA 1PLCA 1YLBB 3WG7B 3FQYA 4DPAX 2CBPA 3CVDA 1J9SA 5EHFA 4PAZA 4YSTA 3V9CA 1NIFA 2J55A 3AZUA 1MG2C 4F2FA 4GP5B 2PPFA 1OE2A 2IWKA 2HXAA 1AZCA 4YL4A 3OD3A 4G71B 4F2EA 3FQ1A 2WSDA 3ZIYA 1V55B 1W6LA 2R7EB 2N0MA 3NP4A 3OQRA 4YVNA 2XXFA 4BK5C 4KO5A 4NB7A 1ET8A 4AKQA 2UXVA 4A66A 3EH4B 4DP6X 2XU9A 5B1BB 3UGEA 3FU7B 3CVCA 1CURA 1SHXA 1IUZA 2BP0B 2GBAA 2EIJB 1NINA 4HCFA 3DTUB 3ABLB 1SFDA 4RH4A 3PPSA 5I6KA 3QJUB 2GC7C 2PLTA 1UATA 1GS7A 1I53A 3CDZB 3U25A 3WKQA 3AY2A 1OF0A 2VSKB 3T9WA 2P80A 3UAAA 2XYBA 1EZLA 2X87A 1BXAA 5TK2A 3T6XA 2FNWA 3PXLA 2YXVA 1ZIAA 1OE3A 3HEIB 2XXGA 2RACA 2IH9A 2YAHA 4DP2X 2YARA 2AVFA 1T5KA 3ABKB 2VMJA 1A8ZA 2XWZA 2PCYA 1JZIA 1GY1A 1ZV2A 1WS8A 3FT0A 2J56A 1A4AA 3NJNA 9PCYA 3QJQB 1E5YA 4N8UA 1NZRA 3IE9A 2QDVA 1M9WA 5I6MA 4YSRA 1N68A 4UANA 2FWLB 3EH3B 1N70A 1IBYA 4W9ZA 4QLWA 5A7EA 1NPJA 1JVLA 2UXFA 1PAZA 2PP8A 4AKOA 3FPYA 3ZBMA 3NJKA 1FWXA 2CUAA 2Y69B 3KW8A 1M57B 2J5WA 2TSAA 1OE1A 4UAHA 2P80D 2VM3A 3NJLA 1NICA 7PCYA 1AACA 1OCRB 3T6VA 3AG3B 3T6ZA 5D4JA 1OCOB 1IKOP 1GS8A 1KGYE 1WAEA 1ZIBA 1E5ZA 1J5DA 2Q5BA 3PCYA 4KO7A 2HZHA 4NERA 2CALA 1ZPUA 1JZJA 3TBCA 1HFUA 3X1FA 3EHBB 2ZXWB 2IDTA 3S3DB 3WIAA 4M3HA 2IDQA 3FYEB 4EF3A 2UX6A 1ASPA 2DWSA 3FU8A 4A2DA 3S8FB 1AZNA 3FSVA 3V9EA 4HHGA 1PCSA 2HX7A 2HRGA 1PF3A 2QT6A 5B7MA 4BXSV 2PCFA 1AZUA 4YSQA 1AZRA 8PAZA 4JHVA 4TXVB 3NJFA 1GR7A 2IH8A 3JTBA 3NJMA 2IWFA 3KW7A 5LDUA 4HIPA 2GI0A 2OV0A 2HX8A 4Q8BA 4E9SA 1ASOA 3GXUB 1CUOA 1CYWA
chains in the Genus database with same CATH superfamily
1A02N 1A4JB 3NCCB 4XVSH 2OSXA 1THCA 1WA2X 2H3XC 4CNIB 5H37A 2OMUB 5I9QB 1DJIA 2XQ0A 3H1ZA 4NKDB 3ARGA 4R97B 1N7MH 4BSWA 1NUGA 3I6GB 1A7QL 3RTQB 1MHCA 3EW3B 2M1KA 3QDJD 2DWEA 2XI9A 4X9GA 2F1BA 3H3PL 2BO0A 3FH7A 1N2RB 4MRCA 5DLMH 1NCIA 3U9PL 3MJ6A 3C60B 5DZJA 4YHML 2LLLA 4L37B 4ZJ9A 1U8IA 4BRVA 1MREL 4KKCD 3PDDA 1LEIA 4N2KA 4F15C 4GG6F 3MQIA 3JWDC 1SMDA 2KI6A 4KMTL 3IB4A 5JPMB 5DJCB 1CICC 4EIGB 3BVTA 5FS5A 4XO4A 5T8IA 3VD1A 2HWZH 5CLTA 4K94L 4BUHA 1IARB 1A64A 4JHUA 5AYQA 3UAJA 2NY4D 4GSQA 3DHUA 2P4AB 3KLSA 1M7DB 4XCEA 3U7YL 5ALCL 1C12A 3U36B 3IXAA 4HGWA 2MHAB 4HKZA 4B9GA 3NJGA 3X13B 4EI5A 3BYYA 5G4OA 5F7MC 2KDYA 3QYNA 1WHOA 2YUZA 3BGMA 4HS6B 3IEAA 1IEAA 3BVNB 1SHWA 2VQTA 1NIBA 3OKDA 5HYFA 3S7GA 3DJZA 2ZXAA 3D85A 4E9TA 1HS6A 5D6CB 3CQPA 3TO4D 1KLGA 3LPWA 1DSWA 3T2QA 1OY3B 2E6JA 1Q0YL 2WNXA 4G1EA 2EXSA 4R90L 4OF5A 2IDUA 1Z0MA 2CO6A 1DVFA 4J7RA 1QI4A 1OZTG 2DQFB 4AIZB 2O6EA 4C58B 1BGXH 5KYUB 2RBLA 4ZX5A 2F58L 4APQA 3MV8B 2ERJC 4PJ7E 2X4RA 1PPIA 4XMTA 5LAXB 5JUEH 4HQQH 3IBEA 3P77B 3Q2CA 3GNML 2F9BT 4PRIA 1CLYH 3BAIA 5HVFB 5B38A 1JYWA 4IRSB 4JG0L 4KNUA 4MKMA 3QJVB 2VR9A 5I1CL 5EMYA 5C0FA 1DQLL 2DQHH 3FN0L 2H7WA 1ZT7B 2P3YA 5ICXA 3QDJE 3TNMB 4AYSA 4H8WC 4OGQC 4OSUL 1UA3A 4KVCL 5FB8B 1O6VA 4XVTH 3CFMA 1ADQA 5JW5B 5J6GA 1RZGA 1GZQA 3FUNA 1DUYB 4JQVC 2Y1ZA 4PP1D 3QI9A 4ICWA 4TYUA 5F0JB 3VQ2C 2ZX5A 1MCSA 2D31A 4L3FA 5H94B 3HG0A 5T3XD 1XCTB 3GYRA 4XZUA 1NCWH 3GSOB 4XMPL 1VEOA 2FO4B 4JFFB 4MMZC 5T1DL 2BMKB 3DXAB 3U6XS 2WHVA 5B8CB 2J8HA 4GH7B 1EDHA 3F7YA 3TPUA 1YEWA 5IHWA 4UT9A 3RKDD 3ZTJH 4EBQL 4E0RB 1IE4A 1QLFB 3NSDA 4TQIA 4XNUH 5KVGH 1FORL 2ESVD 1F41A 2Y6TE 2O6DA 4NQVB 3B7SA 2J7LA 1U8LA 3TA3A 3AM8C 1KTLB 3U6RB 1HYSD 4F7CA 3N1QC 4TUOA 5BO0D 4AY0A 1MWAL 3VRJA 4F7EA 2V7NB 1K4DA 3WFBL 4PVNA 2NW3A 3X14A 5IW1A 5HDBF 2GUOB 4DGVL 4Q9QH 2D3NA 4Y4KA 4UZSA 5DRNA 3PHAA 2WANA 4TVPH 1WFUA 1E9OA 2MTAA 1N6UA 2QR0B 4OCXH 4EUPH 4ZQKA 1HOCB 4NO3A 4X8GA 3MRPA 5L9DH 1F2QA 4LGRB 3FO0L 1KF9B 4I8DA 1MFDH 3PNWB 1PCXA 5ENWB 4OTXH 1E3FA 3RVWD 5AWNL 3QUKB 4L8SB 1KTDA 2GT9A 4GXFA 4LU5H 2GTZB 1YMMD 4X0KB 1DLHB 1NUDA 4GLRI 4RQQA 1G43A 3LEXB 3T2OA 2FX7L 1I9IH 2JTYA 2IAND 3IGAB 2Y25A 3MJ8A 4PREB 2NQCA 1K5NB 2Q0ZX 2X1XR 3NSYA 5D5MA 5IJCC 1KXVC 2IJ0C 3TPKA 2DIAA 4TNFA 4DKFL 3ZDYE 2APVA 5TH2A 1MFBL 2CO7B 1ZDSA 3CTTA 1EZVX 1UT1A 4UQ3B 4WO0A 3RAJH 1VEPA 2UYLA 3LVTA 5DZ9A 1HXYB 2YC1B 1SXNA 3P30H 4FXLA 4WW2C 4K3EH 1EAQA 4JUSA 4F20A 5T3XE 3WL9A 4ERSH 1EJ6A 3HNSL 4OQTA 1I1CA 4YO0A 3IJ8A 3WFEH 3MCLH 3S96A 4LLDB 3BKMH 1U8QB 1KT2B 4PJEA 1CIDA 3VWJA 3ZMRA 1X5XA 4QTIH 3FRUA 4JREC 1HH6B 4UINL 1XB6A 3RHWK 2ZF9A 3EH5B 4KJYA 3SDCB 2ESVE 4WTWA 2FGWH 2ZCKH 3CZJA 2IBZX 4U4IA 1MCIA 3MRDB 3PRZA 4N22A 1JPTL 5AL0A 2CZNA 2W0KA 4ODTH 3ZUCA 3T0EC 3AY4A 3P3SA 5A7BA 5ACZA 4P2OD 3HR6A 2EC8A 5DF0A 4CC4C 2BK8A 4NZTL 4WO4A 1N59B 3JT2A 1PFCA 3PFUA 5BQ7B 1Y6NR 3EGSA 4RAUA 3D0AA 4GQRA 3EZ8A 4H7VA 1A65A 4LZKA 1QTYT 1DDTA 3BAJA 3MRHA 4NGHL 4OAWB 4PJHF 4M4PA 3UBXI 3QUXD 2IG2H 2IBBA 2AEPL 1VRSA 2B1OA 5K93A 3D69B 4HLZG 5I1JH 1INEL 3RUGE 3F7RA 2EXTA 1DSFL 2EEAA 2VWEE 4A7SA 3ROOA 3EYQD 2HJFB 1Q72L 1YMME 2IOIA 4G83A 5FXCH 1D5XB 2AF2A 2CBOA 4PJFF 1BAFH 4I1PA 1MRCL 3TBVB 2IANE 5KAQF 4RMQA 2PTTA 1T3FB 1XR8A 2C9QA 2XN0A 4Y4HB 5F97E 2X10A 2YMOA 3SDDA 4JRXD 1TQVA 4M4RB 3ETBF 1KWGA 1ZLVH 1A7QH 1T6BX 4FNTA 1G7QB 1XB8A 3CAFA 3R4DA 4JZNB 1FVDA 3GGWB 5E4EB 4X4XB 4PJAB 1DFBL 3L45A 3FU6A 3U9PH 4YHMH 2WV3A 2FR4B 2PP9A 1MREH 4BFFA 3G5YA 4WKZB 5F7FA 4CADA 3VCLB 3PGDB 3CLEH 3G6JF 4KKAD 1FNGA 3QPXL 2FWUA 1YPZA 2H9GB 1II4E 5TQ2L 2G4EA 2VUYA 4K94H 4NQXA 4OJAA 3BE1H 4GUCA 2ZD0A 4ZW6A 4LHUG 3UJJL 3QQ4B 4BZ1H 4G80A 5ALCH 4OZFA 4MDIB 1KIQB 5DS1A 2RJMA 2OA9A 3FQNA 1MWOA 1PX4A 2E7CA 3AREB 2N1TE 3CN4A 3K5RA 3KPNA 4ZFZA 1IEHA 3IWVA 3DOHA 4RZKA 5KANG 3K91A 12E8L 3EJPA 3QORA 4ABUA 3U1SL 5EO0A 3S98A 4AQAA 1KFAL 4CMHB 1CXKA 2YOAA 4P4KC 5LQBL 3VWKA 4LMQI 3L6FB 1W6LA 1V7ML 4CN1A 5DLLA 2F58H 3T2NL 4KKZA 1GGBL 2L04A 4YBLC 2ZJSH 2EDOA 4F8PA 1LL1A 3PV6A 4LSTH 4PI2A 1YHPA 1U58B 2CNYA 1X6LA 3GNMH 3RIFK 4PJGB 4BELD 4JRXE 3NIGB 2JQZA 4HLJA 2HJLB 2X9YA 1RLBA 4WUKL 4X6EA 5A43C 5I1CH 3Q1SH 3S4SA 3F6LA 5CEXA 4MQ7B 4RMUA 3FN0H 1UB6A 1L5GB 4R7VA 1FV1A 2EYSB 1WCBA 4I87A 4A2MA 3QS3A 4HXAL 2DWXA 2G3MA 1CFSA 4AYEC 4OSUH 1B88A 4JY4A 4KVCH 5F3BA 4WGKA 3L16A 1QFPA 1YG9A 3LIUA 3WKQA 3OVUB 3HRPA 4HUUA 1Z5HA 4M7KL 2KT6A 5MEPB 3C5ZB 1AHWA 1MLCA 3ILPB 1GGCL 4JLRA 4MCMA 3V4VA 3VXNB 2Q7YA 5KSBE 3RPBA 5IBLC 3ZDZE 3EJYD 1HH9A 4HUXB 4UTBL 1OARL 1KG0A 3CPUA 4NQED 4CVUA 4S11A 1FGNL 2H6UA 3F12A 3QEHA 5GQBA 2HLAA 4Q4EA 4FG6D 2FECI 4QKXB 4X4ZA 5I1IH 1HWHB 3MDJA 3UTTB 5IB5A 1R5WB 2DD8L 1QZNA 2VLRA 5T1DH 1GYAA 1A1OA 4A1RA 3U48A 5FM5O 3BPOB 3NDYE 4LPCA 5FGBC 5H35A 4MVBD 4EBQH 3MNVB 5EOQH 5D7IF 1A7PL 4L8CB 1FORH 5GZNC 5EUOF 3A23A 3W0WB 4UANA 4Z77A 1G7LA 4L5FL 4QLWA 5A7EA 2ZIDA 5ITFB 2MCPL 3SDAD 4ZFGL 5F7UA 2VC2B 5DVPA 4G5ZL 5D1XC 5CD3B 5J3HD 3IMTA 3PJNA 1M57B 1MWAH 4X6BB 4GKNA 4UAHA 2FBRA 4Z7WE 3WFBH 1R24B 4AJVA 1L6ZA 4DGVH 2BH0A 3B3BA 3MRFA 3S37X 7PCYA 4HK3J 3HZVA 4ODWA 4WU7B 3CBJB 3P0VL 1J1XL 1DJYA 3DX9B 2MEJB 2LT9A 3N41B 4KZCA 4MQTB 3VI4E 4QHLB 2YPKB 3CLFL 3FO0H 4UV4L 5KYYA 5C70A 2PR4L 1MCWW 4WFED 3FT4B 5DJXB 1P9MC 3D05A 4MJID 3SKJL 4Y1AB 3M7OA 4P3WA 3BH4A 4GRWE 4Z7QB 5I30H 1U21A 2GITB 2OSLB 2X9WA 3GBML 2QADD 2HG5A 4B41A 1T0NB 1KCLA 2P9RA 1I1AB 2FX7H 2ATPB 3RWFA 2HT3C 4F8TA 1P4LA 4FYSA 4H8QA 5IMLB 1LE9B 1KIPA 2A74B 1AOHA 4GO8A 3O6ML 3Q13A 2VT0A 2EO1A 3GF8A 4DKFH 2AV7B 1MFBH 3RZCD 2APXA 4Z7UE 4YN3A 4PW9A 4NZRL 5KBDA 4L1HA 1MEXL 2WQRA 2UY6B 4NQEE 1P1ZB 1UURA 2DBLL 2LU3A 5IB3B 1LLAA 5DFWH 1FN4A 3WY3A 4OZGE 1F3DH 2O5ZH 1WGVA 3ARFC 3FFOA 1F90H 1FYHB 3N40F 2NXYC 1YJDC 4WJKB 1NMBH 5G55A 4UINH 1EDYA 4PJ9D 1GSKA 1SVBA 1T4KB 35C8H 2NNAB 2YA1A 1VJSA 4Z18A 2EDRA 4U6YA 5D1ZC 5KSUA 3O6FC 2R1XB 3Q2VA 4KNSA 5I2IB 4XMVA 3GKWL 1JPTH 1NEZG 3DX7B 5KOMC 4A2GA 5JZ7D 5JXEC 3EDFA 4P3CL 3VFNA 3VFWB 2APBA 1AP2A 3QIBB 4PB0L 5HYSB 1ROCA 5FDWB 1OVZA 5T1MB 3KVPA 1FI8C 5I26A 4RCAA 4PPTA 5C6TL 3VD5A 2Z65C 4G8FB 4G9FA 3G5ZB 1I75A 3K6OA 3BH8A 4HFWA 2KUTA 1FL6B 4PTTB 5IJVA 4PWJA 3H4HA 5EV7A 2K9UA 1BQHB 3TVMC 4NGHH 3MJ9A 2NY3D 4F8OA 3UGXA 1QKZL 1ZK5A 3QZNA 3PHQB 3ZOAA 1INEH 1LDSA 4JRLA 4MJIE 5T1LD 3SBPA 1DSFH 5F7KC 4F37K 4PCTA 1Q72H 3ATAA 1FFOA 4WI6A 2P5WD 3BQUD 4UQDA 1ED3A 1MRCH 1X5GA 3MO1B 5E6IC 2FLMA 1LNUB 1M05B 4K15A 1MELA 5K9JL 4JRFA 1W72A 5K9OB 3EO1A 1ZK9A 4XMKL 1IBDA 1PD6A 2E9IA 3EOYG 2E3VA 5E2UL 5EBMA 4EIZC 3F84A 1U91A 3DUUB 3LV3A 4ZTPL 3QUZA 1AOZA 2OZ4L 3T4YB 2IDSA 2XTJC 3BW9A 3AQZA 5T1JA 1FG2B 5FUOL 3AABA 3O4OB 4YHKL 5TE7H 4CUCA 1W0VB 2IADA 2BWIA 5LXVA 2ZOOA 3VB8A 2V3DA 3VRIA 1AQHA 3SO3B 1TF4A 1GPOH 3DMMC 2YMTA 3QPXH 4TNGA 3IETB 4J39A 4KXDA 4G3YL 5GRJL 1F4YH 1L9SA 1T1XA 4YSOA 2WP3T 4P2CG 2F5AL 1LK2A 3ULAB 3UJJH 3V6FA 4ISVA 1CJYA 3HC0A 1JWMA 2LABA 4PRDB 1DCEA 2I85A 2E7LA 5FF6B 4DKAA 4XI5C 2JJSC 2VLKB 4AE1A 4PJIF 1U95B 4NQQA 3ARYA 1CVRA 4P5RA 4AQ8A 2XLLA 1NGYB 1TCRA 4CSTA 4X6DE 5CCJA 1YN7A 2A73A 1ACYL 12E8H 4FQXA 3GRWA 2XY2A 4Q7DA 3U1SH 1MJ7L 1KFAH 1GOGA 4RGOL 5LQBH 1NFIA 3WAJA 4Y5VA 1V7MH 1TTRA 1HKLL 2P5WE 3FSAA 3T2NH 1B3IA 1AQDA 1F5WA 5K9KB 2ALWA 2WC7A 2Y7QA 3KGUA 4EXKA 4M03A 2JE8A 4RZCB 1J0JA 4S0TD 5CUSL 1J5IA 4JDEA 2VXSL 1CF1A 3D2UB 1IGJA 4WUKH 5L6YL 5BS0D 5E8NB 3LD8C 4L4VD 1EGJL 5C0GB 1U8HA 3NFNA 5CSZB 1R46A 1Z9LA 2G75B 4DP5X 4HXAH 5IMMB 4ODBD 3KWWA 2BPBA 1S9VB 5HYEA 3WFDL 3HJEA 4I5BA 2OK0L 4M7KH 4QLRA 4IMLB 1D5MA 2I7OA 1IQDB 3MLZL 4TOYL 4WWKA 1TITA 4XC1L 3DTDA 4S1QL 4UTBH 1AS8A 1OARH 1QQDA 2DM2A 3CN0A 1JPST 4TUJA 4QNPE 4FAAB 3AGWA 2VL5A 4YXKL 3TEZA 5IV2B 4JM2A 2DD8H 1H5BC 1RSYA 2HH0L 4TVUA 4K3JH 3D39B 4BGDA 3E8VA 2PO6C 2IXQA 2ITFA 1ZV9A 4Y4FB 2XV2A 3ZK0A 1NCHA 1A7PH 4ACTA 5E8PA 4HEME 4XMZA 5FO7B 3EDKA 3R1GL 4L5FH 4WWPA 3MJGX 5F3HB 2MCPH 3TBTA 2HFFA 3MRGB 1HHKA 3VFOB 1HYRC 3P2DA 5C9JB 4G5ZH 4BH8B 1KEGL 2IPTL 4BDVB 1R33A 4ZYKB 2IWGA 3FF8A 4Z7OB 2LLNA 1WFOA 4W9CC 3FSOA 3MHZA 3Q3GA 1XF4A 3WFHB 2MMXA 2IBGA 3H3BC 3HUJA 1FFQA 5KAQG 4WI2A 2WWMC 2JJVA 3PLYA 5E03A 3P0VH 2SEBA 4UDUB 3N0PB 1O7DC 5HHPB 1SYVB 2OMZA 2PYEA 2J1YA 3CLFH 4UV4H 1X4ZA 1QSFA 3B2PA 3O3EB 1AI1H 4PVLA 4L4VE 2W94A 3PP4H 3SKJH 4G8EB 3NAAL 4NP4L 4KO6A 5HPMA 3GBMH 4XXDA 4KI5C 1BFOA 4XVJH 4L1BA 3G5WA 5EO1A 3ATDA 1B3JA 3QFGA 4XPTL 3L3OA 3O9WA 3PIQB 3SKUD 3BVXA 2YAQA 1KCWA 4AENB 3EGXA 4OJDH 2XIDA 3HB3C 3MU3A 5E9NA 1MEXH 1ADQH 1WWAX 2R4RL 4ANUA 2DBLH 2YAMA 4ZAKD 5EF2A 4J28A 4CVWA 2CBMA 2EVIA 4QT5B 2DH3A 1KBBA 3QC5X 2OR9L 1FBIL 1M42A 2BOCA 3PJSB 4LIQL 1XV8A 3MLVL 4JRYD 1F0LA 2A2QT 3B9VA 3HE7C 3OC5A 4NI6A 1T1YA 2ZKHL 2Y1VA 4AM0Q 4Z78A 4I0PB 4KK6C 4Y16C 2NMSA 3PWPD 4DEPB 5F7AA 3TS8A 1BVLA 1FZOA 4NO0B 4J8RA 2NUPA 6CGTA 3BCDA 2YSSA 1ZVHA 3L9EA 4BK8A 4NKOB 3DX4A 2XFXB 2V17L 5TDPA 4PBDA 4FCHA 2BY1A 2R83A 5CBAB 4P3CH 3ZPDA 3KPRE 2VSMB 2Y2TA 4DEWA 1U8NB 1RJYA 4PB0H 1E6OL 1NMAL 2BVOB 1RUQL 4WSKA 2E5EA 3FQRB 3DI2B 4NQSB 4X6FB 5C6TH 3PHOA 4PJ7B 5LBSA 1NGQL 3US0A 3HE6B 4LF3B 1BJ1H 1WUZA 2FJFA 1U8CA 1X5LA 3GMMA 3RVTC 1DVSA 1JRHL 5MI0B 3R19A 3RILA 4ZUWA 5ICZB 2IGLA 2FYYA 1U3ZA 1QKZH 2LOEA 4BH7A 1E8ZA 2HSIA 4LCYB 1A0QL 3KVQA 3QDJB 1FO0A 5D4IA 3PYCA 3JYCA 4GW5B 1KOAA 3PS6A 5L0QC 2ZPKH 4HS8H 5E56A 2ADGB 4ALAC 2W0PA 4AZ8A 2X12A 1XIWC 2CBPA 2A6IB 3KLHC 1J10A 1OLLA 2R0KH 5K9JH 3DDFA 3LKPA 1OO2A 3WFCH 5AD0B 1Q9LB 4XMKH 5E2UH 5D2NE 4OUOA 5SWZD 2EABA 2B20A 3GSVB 3VMPA 1CBVL 4WFFD 5TGBB 1V8HA 3EBIA 5ADPL 5EU7C 4ZTPH 3BUIA 5TTRA 4NAMA 2NY4B 2OZ4H 2Z8WC 4H1LH 4ZPVA 4ABVA 1OB0A 1XTLA 3KCPA 4F7TB 5FUOH 3VGAC 1OTTD 1ZA3B 2YEQA 4JRYE 1OM3L 2XIIA 3H9HA 5FO8B 2BHUA 2CLZA 2Q76B 4EVNB 5KBNC 4JZJC 3MC0A 3PWPE 1KY6A 3QISA 4X4YA 2WKOA 4NN5C 3NQKA 4HA1A 2ARJB 4FKEA 1QFWL 4IU2A 1I7ZA 3OXSA 5CN1A 4E5XG 3U0PA 3KPOB 4G3YH 3TO4B 5GRJH 1Q0XL 1H6UA 2OQJA 3FH5A 1NINA 4PLKC 3IYLW 3PPSA 2DEYX 2PLTA 1TO5A 3GXIA 1RK0A 1QACA 3TTYA 5DMYA 4LEOB 2P49B 3O41B 1NOFA 5D93C 3OAYK 3N42B 5CF3A 4YDJA 3UAAA 2VDOB 1EZLA 1HNYA 4RGMC 4N24A 5BO1L 5TK2A 5EEYA 1EIBA 4Q4IA 1BZ7A 4XP1L 3SPVA 4JKLA 4K8RC 1FRGL 1X5JA 1ACYH 5CP7A 1JV5A 2YAHA 4CMMB 4M8QA 4QO1B 1E4XI 2EJ1A 2AKRB 2EP6A 2WSPA 4DSYA 5CHNA 4RGOH 3HCVA 4GW1A 1IGCH 1KPVB 1Y1DA 4LCUA 3NABL 1HKLH 4HUVB 4HPYL 3SCMC 4HG4K 4MNGA 3RBGA 1QUPA 2JKIS 1G5AA 4WV1A 2WBKA 4IKKA 3B9EA 4YC2C 3SY0A 3SQOL 3EH3B 3KL3A 4YFEA 1UACL 5IR1B 1UXWB 3ZDYB 2VXSH 3CC5A 4OR1A 4XP4L 2F15A 1ACZA 3F01A 5JIKA 1FZMB 3FPYA 3KD4A 4MAYC 5SWZE 3ZBMA 4EN3C 5ALBL 2P46B 5L6YH 4WFFE 3FQTA 3GSRB 4GXVL 1IKFL 5ABDE 3I2CL 4OI8A 2YGPA 5DMIL 3UPCA 1FNSL 2I9LB 3CHPA 3FC8A 1B90A 4MXQC 5EO9A 4NWTL 1NICA 5LLIC 1VKXA 3DVGB 2WQSA 3T6VA 2CUMA 2X7LB 3D34A 2VMEA 5SX5H 1CD1A 3OAWA 3WFDH 5DJZA 3ZW3A 4I77H 3QPQC 2OK0H 5AW0B 5E2WH 3CE1A 3KYKL 4TOYH 3MLZH 4MD5B 2ESVB 5C2UB 3FOLA 4BSVA 3HR5B 3IAGC 1WZKA 3REVB 4S1QH 4UMSA 2CGRH 4A6YA 4MZIA 2OR8A 4OCLC 3SN6N 4WF7A 1JI2A 4YXKH 1CXHA 1U8KB 2L7JA 5HJDA 1E28B 1S7WB 3T2PA 4P49A 2WXGA 1X7TA 5IVXF 2COVD 1CTOA 2FATL 2ATKA 3C8DA 1QFOA 3AMKA 1NDMB 3KPLA 1NFAA 4Q9CA 4NFDA 2W92A 2OCJA 1HIML 4WK4B 4RMBA 1BLNB 3M88A 1MF2L 3RGVA 3UL4A 1WPCA 4Z3IA 1CO1A 4L8DB 5AKTA 1C5DA 1X5YA 2IPTH 2BNQD 3RUGB 1ML0A 2IWFA 2C3VB 1A1NB 2G0KA 3OKOB 2B14A 1YMMB 4R2GD 3QZWG 2AGJL 4X42A 4YPGA 4KU1A 3EYFB 4MKTA 2N4IA 2IANB 3RDTA 4AYFB 4FFYL 5DEZA 1JVKA 3QWOB 2GBTA 1BQUA 5EZLB 3TO2B 3OG4B 2BVUA 4PV9A 4JFYA 5DZAA 2CRYA 3ZE2F 4ELMA 1ZT1B 4BKLB 2OJ1A 3B7UX 3NZ8A 4Q97A 2WWKO 3UZVA 4PP2B 3TJEH 3HBPA 3HKZA 3AG1B 1ONQA 3ALXA 3NAAH 5F7HA 4NP4H 3NT0A 5T3ZL 1H0DA 5HD8D 4MA1C 4LLVA 4LVOC 4FJZA 1TR7A 2ICWJ 1CCZA 2AXWA 5I75C 2JIXA 1FQ9C 4DKEL 2JJWA 2YQGA 3VXUD 5T5FL 3BZDA 3VFVA 3TF7C 4C54A 2Z7YA 1Y1UA 1NPUA 1ZJBA 3QGVA 4J4PA 4UILL 5KVFL 5I6XB 3M17B 4I0KA 1IGYB 2BIOA 2VJ8A 4EZJA 2R4RH 5LG1A 1TOXA 2AXGA 3WXWL 5GGTL 2BP8B 4D8PB 3A4FA 1FBIH 4Z9KB 4LIQH 3MLVH 3IDYC 2E86A 4BWTA 5I17A 2ZKHH 2OI9C 3AS3A 4JN2A 5GS2D 3BZFB 1YUHB 1E5UI 3TN0A 3WS3A 1MCPL 1N3NB 2YD1A 4TS6A 3QJRB 2VDQL 4HISA 3E3QE 4A37A 1NAMB 2P26A 2DIBA 3DIVA 5DQJA 5C7XL 5IB4B 3QUXB 2G5UA 1RZPA 1UEMA 4N0UE 2BNQE 4N3UA 1E6OH 1HZHL 1NMAH 1RUQH 2C1OB 2CLRA 3BPNC 3PFQA 1UXSB 3ZRFC 5AAPA 1TJXA 1UD4A 4JFQB 4OB5L 3BYTA 4WI0B 3VD0A 1LP9E 5FAAA 4RWYL 1UZ6E 5IB1B 1XMEB 3DX6B 4GAYA 4GXUN 1JRHH 2X9ZA 4LCCA 4JRXB 3O8XA 5B1AB 4C8XA 4Y5XA 3ZYIA 1RK1A 4LVNB 4P5TC 1UQSA 1N12A 3K2KA 3KYMB 3SQBB 3G5XB 5DWUL 5E5UB 1A0QH 4Y5YB 4ANWA 3P54A 3LY6A 5D1QD 4UNTA 3MGOA 5D8JL 5SX4I 4C4KT 4A2HA 3CGTA 4ETQB 1DBAL 4KI1A 4AGLA 4MX7B 4I18B 4QOKA 4N9GA 2JCWA 2C1PA 1X5KA 9CGTA 3L8QA 5KS9E 3VXUE 4FQQB 4MD4A 3VM7A 5KSBB 1JNHB 2IPKA 3CSYB 3ZDZB 3FDWA 2DEXX 3DV4A 1CBVH 5IW3A 3I02A 5ADPH 3WNNA 4UQAA 1Z1WA 3CVIL 5BW7A 1BAWA 1ZVSA 2LU7A 3MRJA 2ADJB 3QRFM 4QXGL 3QQNA 5CJBA 3CVBA 3AWFA 3LZFL 3QULB 3L95B 2LVCA 1Q9WA 1YC8A 3BPCB 5T3XL 1I4FA 3OZLA 1OM3H 3DRQA 4F9LC 4L4TD 2OMVA 4NM8L 3PABA 2HT4C 3CZLA 4HU2A 4ZUSB 1ORQB 3DVNB 5GSRB 1D7FA 4PRAB 3W2DL 2ZUSA 2VSDA 4QRPD 2OMUA 3PWJB 4JO3H 3WJMA 4E9LA 1Q0XH 2WZ5A 4JMNA 2QQKL 4E9RA 3I6GA 2X2UA 3RTQA 2FIKB 3IJYA 3TEWA 4RA0C 4Z7WB 3HVDA 4N26A 1WLHA 2CCWA 2ORBL 2CDEA 2VO8A 3SYAA 4DT2A 4XZ4A 4LL4A 1JZGA 3GM0A 1N2RA 1K3IA 4GQZA 4A7GF 3A24A 4L37A 4AX3A 4D2NA 3S5LB 5IJDC 1TZOA 1S7VB 2AK4D 2AMGA 4XP1H 3ZQ9A 2XVBA 2V2WA 3OX8B 3VI4B 3MV9D 1FRGH 5JPMA 4B5EA 4M9OA 5DJCA 3COOA 4DGYL 5CZXC 5BZDB 2XX0A 1TQBC 4R5TA 4LHUD 2NSQA 2X4TB 1FYTD 5JORA 4GRWB 2NYKA 1CICD 5D1QE 1IZKA 4J3BA 1TZ8A 3A22A 5AVSB 3NABH 3VXMD 1JN6A 4HPYH 4WU5A 4OFQA 4P2YA 4PJ8A 3WKPA 2XDHA 4GRLA 2D2CC 3X13A 3N55A 4O58L 3FULA 3EBGA 4HS6A 4LLAA 3SQOH 1UACH 4GINA 1NCOA 4Z7UB 1I1FB 1XGYL 5GISL 5GRVK 3VXRD 4KRPC 5ALBH 3BQVA 4XTRC 1WP6A 1WC7A 1OGTB 4GXVH 4NQEB 4UDTB 2Z6FA 1HQRB 3LDBB 2ZUQB 3I2CH 3TZVB 4OZGB 5DMIH 4I48A 1W8EA 4LCIL 4LSVL 4TUKL 3LPOA 4NWTH 4OCRL 4ZO8A 4AIZA 2Y4SA 5C0NC 2X44D 5KYUA 1ETZB 3GZPA 5E9DA 4PWKA 3MV8A 3SJVA 2VOTA 6PAZA 2F53D 4L4TE 1S7TB 4HCRL 5I6NA 3MCKB 3TBBA 3P77A 3T4AB 4DPCX 4ZX3A 1PLAA 2O5YL 4R3SB 1BZQK 2BSCA 4NZUL 5E4AA 1I8LC 4IRSA 4Z0XB 2Y5TA 2H6PB 1T0OA 1OAUH 2J21A 1FHNA 1ZT7A 3TNMA 3KGTA 2YBRB 1E50A 1P6WA 1ES0B 3E6FA 1ADWA 3QPKA 1G7JB 4WTXA 2GHWB 2FATH 5FB8A 1M53A 3VA6A 5JW5A 3AITA 4Y9GA 3U1QA 5I0ZA 4R4FH 1X3DA 1DUYA 4IGBA 5IK3B 1AQMA 4TQ8A 1HIMH 4H8VA 4OM1L 4YAQA 3INUL 2AK4E 4OCYL 3W56A 2DYPD 2IFFL 3JWNC 1O75A 3EO0A 3RWDB 2EE6A 3MV9E 1MF2H 5I5JA 4ZXBC 4DN3L 1MUJB 1KJ2B 4PRHD 5H94A 3WJLC 1IC7H 3WYRA 1CGWA 3DBXB 4B9IA 5JPNB 4UT6A 1EJOL 1FIEA 1S7QB 4MJIB 1FYTE 2FO4A 4JFFA 5ICUA 5BQDA 2BMKA 2E6QA 3DXAA 4HGMA 2AGJH 3RWIA 3K46A 1NAML 4FTVD 3EJRA 5LNEA 1YEFL 3GRWH 4FFYH 3BFQG 5ETUB 2BOBB 3WHE1 4E0RA 4HJEA 4Z3TA 4OVVA 4HKBB 2EYTB 4NQVA 3RZCB 4OLUH 3MBEA 1IQWL 3MI6A 3VXRE 3U6RA 5JOFA 4N2OA 1GA2A 2I60H 1L4IA 1BJ8A 4WI9A 2EDXA 3MRNA 3T08A 1HINL 1ZA6B 2AXHA 1XGTB 2BVYA 4LLWB 5T3ZH 4B97A 1LE5B 2V7NA 4FFZL 3OAZH 1M2OA 1B2YA 3RJQB 2M2DA 3ZZLA 2F8VA 1TYJA 4KTYA 3DPBA 4FKHA 4KV5E 4XBGA 4DKEH 4P46C 1I3GL 1CFNA 1JHTA 1JOIA 2GFBB 5T5FH 4FL4B 1CC3A 1EHKB 4P0DA 4PJ9B 1QWUA 3ZKSD 5GZOD 3N91A 5TJWK 3L5IA 3QO0B 2ZZUT 4UILH 5KVFH 2UWEF 4EZKA 4P23C 1T5WB 2JK5B 3QJFB 3ZTJG 2EDBA 2CR6A 3B8YA 1M7IB 1V54B 2D03L 3SGJA 3WXWH 1ETJA 5GGTH 2ZG3A 2ZX7A 3ZE1E 3QUKA 4L8SA 1KENL 2FGZA 4UF7C 5EOTB 3DROB 4X0KA 1DLHA 3C8HA 3QZLA 3LEXA 4ETYA 3D4YA 4MXVF 3U2IA 2QGDA 3IGAA 2L8AA 4PMEA 4PREA 4MYPA 1R19A 4Y2OB 2H1LM 1U92B 5A2IH 2VDQH 4X6DB 3O2DL 2CO7A 2J5LB 1OE2A 5JMOC 1OTSD 4KH9A 4UQ3A 4PRHE 1SHMA 2HFTA 4EUPG 5C7XH 2YC1A 1W0YT 5HHNB 1EK3A 2W91A 2ZCHL 3CHQA 3QIWB 3LNFA 1HZHH 2IMMA 3BD3A 5KSAC 1SEBA 1U8QA 1KT2A 2P5WB 3BQUB 4OB5H 3V6OE 1DQQB 4O02B 1CFTB 1HH6A 3PDOB 2C34A 2C4FT 2CO1A 4RWYH 3X3FL 1UOLA 4GMSL 4HPHA 3CZFB 2CMRL 1UKQA 3SDCA 1ORSB 1YYML 3T0WA 2YD5A 4XN5A 1QHPA 1XR9A 4X6CF 4NFCA 3U2SA 3ABLB 1OM9A 2WZAA 4Y9FA 5DWUH 5GGSY 5I6KA 4OFYD 5D8JH 4M61B 1EJFA 3LTVA 4ZNEE 2BP3A 1DBAH 1CD9B 3T0ED 2E74C 5CXPA 3L1FA 1N59A 3SE8L 2JJTA 3ZLQC 5GS0C 2Z3FA 1JPGA 4KX8A 2FNBA 4I7ZC 5B1CA 3MXVH 5JHMA 3PGCB 2IH9A 4LARL 5DSCB 1DVZA 3CVIH 5HXMA 2R15A 1I9JL 3D69A 3MV7D 4QXGH 1IM3A 1F18A 1PD1A 3BO8B 1A4AA 3DPDA 4N0RA 3LZFH 1P84J 2V2XB 4W4NA 2HJFA 1I3UA 4OCMC 1NZRA 3OB0K 4PD4J 4GG6E 4HC1L 1AGEA 2BJMH 3MGTA 1HTYA 2WK2A 3QXUA 3TBVA 5MEQB 4BGLA 1T3FA 2X4NB 1SJHB 4MQXC 3ESPA 3W2DH 1U8MA 4MHHG 4M4RA 1NCCH 3KLKA 4Q6YA 5J1SC 1YNLL 4PGBB 2QQKH 1KXTB 2D4FA 3LZLA 5KWYC 1Z9SB 2ARWA 4JZNA 2R23B 3ZO0A 3U30B 3GGWA 2GJZB 3P9LB 2O72A 5D4JA 1KLFB 4PJAA 3TYFA 4F27A 3WIHH 3IJEB 4R96B 1IKOP 3F83A 5HHVH 1D7BA 2X53A 1DUZB 3B8SA 5BXFB 2IH3B 2E9GA 2NYYC 3IDIB 4IK7A 3L3HB 4MAUH 2CALA 3EAKA 4Z76B 3HS0B 4C4BA 5GGVL 3KDMB 2EXWC 2IAMD 1HFUA 3FKUS 5CGYC 1JNNL 4DGYH 1HWGB 2H9GA 4L4VB 2ZOLB 2VJXA 3P4OB 2A9DA 4DQAA 1I7RB 1SY6A 3I6LD 4NP9A 3FW6A 4GQ9H 3ENEA 1VPOL 3QQ4A 4FI7A 4QHMB 5EH1A 1ASPA 3BAKA 4NBZB 3T0EE 4MDIA 4UYQA 3FFDB 4FF9A 1KIQA 5E1IA 1DLFL 1NGWA 4A2DA 4O58H 1EHNA 3IMRA 4YOKA 2OXGB 1FLRH 5DUML 1S46A 3A67L 1X9QA 3T0DA 1LO5A 2O30A 4BXSV 4MNHB 5C07D 4JHVA 2DQUL 1AGCB 4JJOA 4L9LB 1R4XA 4XXCA 2XWRA 5J9PA 4LCIH 4LSVH 3MV7E 4TUKH 1UCBL 3BWUC 5AL8A 5F1IA 4OCRH 2A6KB 4A7TA 1CYWA 3L6FA 2IO5A 3OKYA 1J8KA 4P4KD 1JXJA 4XCNB 3IMSA 2PXYC 1CXEA 4HCRH 1AXTH 4CRPA 1OSPL 3VFPB 2BY2A 3CD4A 2MOGA 4N1HB 2DI9A 2BINA 2O5YH 3JV4B 2WUCH 3Q44A 3ZL2A 4N5EC 3QAQA 1TPXB 1VZHA 3C75A 4KKPA 3QE5A 4PJ5D 4XCCL 2OXHB 2GK2A 4MQ7A 3KPRB 1E9PB 1L5GA 3BXNB 4KKLC 3BLPX 2EYSA 2Z4QB 4D9QD 5KW9L 1DVYA 1T83A 3LKQA 1KJ3H 5ICYB 4JS7A 2EH8L 2JXMA 2WKLA 2CUIA 3MYJB 3NA9L 4GQPH 3OSKA 3INUH 4ZFOB 3QA3A 4HHAB 3VXNA 2IFFH 3CWGA 2W59A 1JGUL 3PWVA 2XN9D 3DA0A 5AAMC 2YPLE 2ZUVA 4PV8A 4N8PA 2MJWA 4X7DC 1EJOH 1WJ3A 5HDBE 3RQ3A 3R06B 4KZEL 5IBLD 3FCBA 2I32A 3CHSA 3NACL 4ZMVA 3UTTA 3I6LE 1B0WA 3JWNG 3QYMA 4JK0D 2K3HA 1M71A 2QKIA 4K0OA 2R9HD 3UMNA 2CIIA 1K4CA 1QUNB 1YEFH 3ARGC 5EFIB 1FHGA 1MJ8L 3DURB 3K6NA 3EF7A 5JLZB 3H56A 5AEAA 1AJ7L 5L88L 2H0EA 2MCAA 4L8CA 4I0CC 4DTGL 5F70A 1MJJB 3EKCA 4OUUB 3W0WA 5I8OL 1A3ZA 4HW6A 5D2NB 2W0LA 2WCPA 1IQWH 2DYSB 4O02L 1TO4A 5GZND 1TQSA 4XODA 5C07E 5CD3A 3BN3B 1N0LB 4ABWA 3BP7B 1MCLA 4Y2DD 4YXLL 4X6BA 1OGSA 3FO2B 5D1XD 3LAFA 4HUKB 5IHZB 4HJIA 2YIHA 1R24A 4JRYB 1EEZB 3T0BA 1JBJA 2R4SL 4WU7A 3NFPB 1I3GH 2NY0C 4KFZC 3PWPB 4L2LA 3DX9A 3UAJC 5D7LD 3RYMA 2XG5A 4RMWA 2CRIA 1ZLUH 4DFIA 3K4DA 4S2SB 1A9BB 5BUAA 2YPKA 1PG7X 3TX4A 2F7IA 3TCLB 2WVVB 1KN2L 4HT1L 4PJ5E 3OR6B 3L4XA 4EI5C 2D03H 4JVUA 4U1KB 2V9TA 3DIFB 4KPHL 4XMUA 3UOAB 2I26N 4XPBL 2QDWA 2OSLA 3G9VA 2XA8L 4D9QE 1H8NA 1ZSDA 1I9EA 1T0NA 3AC0A 4FQ1H 3SOBL 2ATPA 3TBWB 5IMLA 1LE9A 1ZEAL 6PCYA 3MROA 1QI5A 3EFDH 4ORGB 2OMYA 1R3JB 1F3RB 4M62L 5HVWA 1DVFC 1RY7B 2BRRL 2HT3D 3CFEB 3O2DH 2EEXA 1DJSA 4G11A 2XN9E 1NC4D 4HXBL 4APQC 2W65B 3GJFA 2UY6A 1TQCB 3F05A 1P1ZA 5IGXL 4JQXA 1P4UA 2ZCHH 2UZXA 3L5XL 5I74B 2IWEA 2OMXA 3OB8A 4R6UA 4M5ZH 5K33A 1ZGLM 2VM4A 1JXKA 3GMNB 3ARFD 2P28B 3X3FH 4PJHE 1BVKB 4JDVB 2NXYD 4GMSH 3VD2A 2E0PA 32C2B 3ELAT 1WE5A 2CMRH 3MUHL 5E2TL 1PZSA 2NNAA 3T77B 1TTCA 4PW4A 5SWZB 4JFED 5I2IA 3L7FB 3DVIA 4GYBA 1BWWA 1CFBA 2OSWA 2PN5A 1J9CT 2GHZA 3O6FD 2ZUXA 4OLVL 3QI9C 4HIXH 4PJFE 1TU2B 1XF3A 2YFNA 3L9BA 3VXSD 5ID1B 4YK4C 5T1MA 5JXED 4S1RL 1R6VA 3NCYP 4E2OA 4NJ9L 4UNUA 3SE8H 3G5ZA 4F9PA 2P8LA 2CJ3A 4OLYH 4AEIH 2NSMA 2AANA 3FT3B 4U7KA 1O7VA 1FL6A 5D7LE 4PTTA 2ZNXA 4ZMYA 1N0XL 2W5PA 5E7FA 5I8EB 1BQHA 2IGTA 2WVUA 4LARH 3V52H 3O0LA 1SJEA 2Y2YA 3KGRA 2DBJA 2SODB 1I9JH 3PHQA 3OKNB 1YN6B 2BNUB 5F7EL 3FBKA 4NAJA 5AW1B 4JUTA 3TA3C 4ONGL 4N20A 4DP1X 5CSGA 4M7ZB 2ENSA 5E5LA 2RFXB 1T7YA 3MO1A 1E5CA 5CFAA 3EO9L 1PGRB 1LNUA 2A77L 2E27L 2JTDA 4DK6A 3BDBA 2FAUA 3VXQA 4YL9A 2H4EA 4KTEH 1YNLH 4Y4KC 5E8EB 1KB5B 1SXBA 4F7PA 1YPZF 4TSBL 2D7PA 1UYWL 1T66D 5E2JA 3MYZA 2OTWB 3ASOB 3T4YA 2BFGA 2DYRB 3OR7B 4W4OA 2W60A 3HLKA 4XN8A 1W0VA 2WXRA 3RX8A 4XVOA 2EDQA 3T71A 1A66A 5DQ9A 5C0AD 2CAKA 3AXLA 5B7FA 3LPGA 3V4UL 3P3UA 5EIIG 5D4HA 5GGVH 2VZOA 1SBBA 2NY2C 5IB2B 1O9ZA 1JNNH 4UB0H 1G9NC 2EEBA 1R9FA 3ZDWA 1A3RL 3DMMD 3L17A 4YFLI 2XWDA 4ZFOL 1EUUA 1VPOH 1MNUL 4KAQL 2BSRA 3WDIA 3VXSE 4PRDA 1BCIA 4WI3A 2VLKA 4XNQB 4FZ8L 3K71A 2F54E 2W80C 4I3GA 1KJMA 1U95A 4NYLA 5DUMH 5BZWA 5BUGA 1NGYA 3A67H 2C4FU 2GPZA 1QD0A 5L2JB 2DQUH 3VWJC 4LBAA 2PW2B 3GJFK 4X0NA 1Q38A 4HJSA 1P7KB 1NCJA 1ZTXE 1NIAA 5FO9A 1SM3L 1UCBH 4DK3A 5JIDA 1JD9A 4J23A 3VH8G 3IBOA 3P9WB 1FFPA 1KWKA 2EC9T 5JW3L 4EDXB 5K9KA 1B0RB 3AY4C 4RZCA 1OSPH 3CH8A 3FO1A 4U33A 1GMEA 4NENA 2OMNA 2E7BA 2FD6L 1YEIL 2ICES 4O9HL 1B2WL 1K9TA 2Y7MA 2HCZX 3W11C 1ZHLB 3WN5A 3ZT5A 4V33A 4WO4C 4U49A 5C0GA 4N0UB 4Q14A 1PY0A 1AE6L 2BNQB 2R8SL 2G75A 4BUGA 3QHTC 3ULVC 1KNOA 5KBPA 5D7IE 5EBWA 1FIGL 2EH8H 2AJZA 1L9RA 1LP9B 5EUOE 2R1WB 3BX7C 2EIEA 3NA9H 2EICA 1D6VL 3RA7L 5C0AE 3FUJA 4ONOA 4UM9D 1N64L 1JGUH 1QRNA 3CG8A 4Y9EA 4YLCA 3WE6A 2HRLA 1JF1A 4XP5L 3CSGA 4KZEH 4KOCA 3SODB 5IV2A 4KVPA 2NLJB 3FRPA 4Q9RL 3BAXA 3SDDC 1LMIA 1UUSA 4ENED 4HU8A 1U42A 4FTDA 3C08L 3PWUB 4Y4FA 1S3KL 1AJ7H 4I1NB 5KS9B 1MG2C 1BBJA 1PZDA 5I8OH 1IX2A 4M7LL 5FO7A 4U0RB 2F8IA 1JZ8A 2Y22A 2EECA 5F3HA 4O02H 2FIRT 3K2MC 4BH8A 2YRLA 1T7WA 4BD4A 4JJHA 3AAZB 3OHXA 4HK0A 4YXLH 4DQOH 5IOPA 2AI0L 3DX1A 1KELL 4ZYKA 4CBPA 3H54A 3ILQD 1K85A 3CU1A 4Q2ZA 3F8UB 1F6AB 1WWCA 4NKIH 5TDNB 4C83B 4D7BA 4QGYA 5KOVC 2FRGP 2YPVL 1XH2A 4LFHG 5AW9B 1T80A 2VXUL 1BD2A 1IC4L 4AK1A 1SYVA 2GBAA 1A6VL 2WNKA 5IROA 2WIMA 1KN2H 4HT1H 3MA7B 4FQJH 1GHFL 3QJUB 4K73A 2VTFA 4MRBA 3BKYH 4G8EA 4KPHH 2VRQA 3AGVA 3GUTB 4NWUL 4XPBH 2HVKB 3HHSA 4PRPD 5J11C 1DZBA 5EIQA 3IGUA 4JO1L 2IF7A 3W37A 4BFIB 3QORC 1ZEAH 5HTSA 3F7PC 4R0LA 3V0HA 3DO7B 1FJ1A 4FFWD 3CBKB 3E6HB 4M62H 5EU3B 4ODVL 4FABL 3KG5A 1V05A 3VWKC 1C7SA 2XXGA 2Z34A 1NL0H 2CDFB 4XN2A 4AENA 2F8XC 1DN0A 3NN8B 1T5KA 2R27A 3CZEA 2VMJA 4HXBH 3D18A 5BJTB 3MNMA 5IGXH 3D0LB 5EEXA 5LN8A 3GMOA 3E0GA 1UH4A 1QFWI 4P5MB 5D1QB 1UTDA 4QT5A 1AQKL 1W8NA 5KBKA 3FCTB 1DTUA 3FAWA 4UUJB 3PJSA 1J18A 4IM8A 4Q52A 1JHLH 5KEZA 1M9WA 1DL7L 1KB5L 3QS2A 4NQTA 1IBYA 4EN2A 4I0PA 1GVIA 4XNDA 1BM7A 3B1TA 1N18A 3BT2L 5L4IA 4MJJA 4NO0A 4B7IA 1MN4A 4Y16D 3GJEB 5C0EA 5B38G 1XL6A 1OE1A 1WZ1L 4NKOA 4P2QD 5MENA 2BCKB 4IK6A 3QHZL 4M6ML 1QO3B 2DI7A 3PL6B 3QNYB 3AMLA 4AITA 5CBAA 5D6DA 2EDLA 3GHBL 3GSXB 1AHWC 1U8NA 1KBGL 1CDYA 1J8HD 2BVOA 4LP5A 3MCG1 1GS8A 1KGYE 3FQRA 2FH8A 1WBXB 2IMNA 3OC8A 4NQSA 1GL4B 1AR1C 3LXBA 4NJ9H 3BP6A 4HDIA 4L4TB 3HZYB 5FYJH 1YEHL 5ELIA 1I9RL 2JKTM 1DVTA 2AC0A 1HVXA 3FB6A 4N86A 5GHWL 4N6RB 4IHOB 2RCSL 1UWFA 4GS7B 1KCUL 3GQFA 1CLZL 2WSKA 3ELQA 3EYOB 4H20L 1O7DE 1X4XA 2K0RA 1LXMA 3NJXA 2VCOA 4LCYA 5ID0A 1RH8A 1WHPA 4FMVA 3DI3B 3OF6D 3QDJA 2K78A 3B2VL 5F7EH 4GW5A 1EZSA 5E23A 3M8OL 1OAJA 4W70A 3NSJA 4PRPE 2V2TA 5EF0A 2ADGA 4ODUB 1GZPB 4WI7A 4F91B 2A6IA 2YXFA 1TQWA 3EO9H 2AK4B 3R0MA 3M45A 2A77H 2E27H 1ZMYA 4NCC2 1NBZB 3MV9B 4MA7L 3KLHD 2Q3AA 3E38A 3S35L 4DKTA 4EKJA 1Q94B 4PGDA 1NGXB 2EH7L 2CRZA 3GSVA 3QCVL 4HJ1A 3L3KB 4LHUB 1JFQL 4TSBH 2QPUA 3JV6B 1MIML 1UYWH 5ANME 1FYTB 3ZKMC 4L3CA 4WENB 1CICB 2FWSA 5E70A 3EHBC 4PJIE 4F7TA 1P5UB 3V7MA 5FO8A 3TASA 3IRZA 3VFUB 2Q76A 4EVNA 2WB1A 4Z8FL 1OD7A 3D12B 3VXRB 3WCYA 1G84A 3CFCL 4P2QE 3KPOA 5C0CA 1RMFL 3KLAA 4BE6A 3BC9A 1EAJA 1A3RH 3UO1H 2VZTA 2F7OA 3CPLB 4ENZA 2VW4A 1M3IA 1MNUH 4KAQH 5CFHA 1J8HE 4XOCA 2YQ2A 3O2VL 5LG6A 3CSFA 3O41A 4FZ8H 2K8QA 5FGCE 4YDLB 2HRPL 4H1LG 2NY7L 4XNXL 3K74B 3M1BB 1SMOA 4O5LH 4JHBA 2A4EA 1XFPA 4PCSA 2QSVA 2WAHA 4HJGA 2FJUB 4LSDA 4CMMA 4QTHB 3F00A 2H0PA 1V3JA 3ZE1B 2AKRA 1SM3H 2H2SD 1HL4A 1HEZA 4GEIA 3UP1A 3V0EA 4HUVA 5JW3H 1NWOA 1NEUA 3HN5A 5I6PA 5AALA 1UD6A 3QYCA 4WTZA 3SPGA 4FFTA 5FO2A 4DF9A 3F65A 3SCMD 2DYPB 1UXWA 1YNKL 2XSKA 2V5YA 2FD6H 1YEIH 4O9HH 1B2WH 4PRHB 2H0FA 4UT7L 5DEJA 3GSRA 1QA9B 1AE6H 2VDLB 4JPSA 4EN3D 3ULUC 1A7RL 3ISRA 3G9AB 3MKKA 4MAYD 4CVXA 4JM2F 5T1KA 1AKPA 5EU7E 3DVGA 5DR5H 1FIGH 3N44B 3ROLB 2HX9A 1I8UA 2BIQA 3GLZA 3QZPA 4UYPA 1YEDB 3N9GL 2VR8A 1BOGA 1D6VH 3RA7H 1Z9PA 1JPEA 4L3ED 4HSCX 2ESVA 1N64H 4N2CA 3QPQD 1BF5A 1MW3A 3H6JA 3MACL 2ZP9A 1KIRA 1VLXA 5D7HA 4CJ0A 4XBMA 1U8KA 1OQOA 1QLRB 1E28A 5EUKB 4BFKA 4Q9RH 4YE0A 4AV0A 4AGQA 1WS7A 1G4RA 4WJ5B 5F8QC 5A2JH 1ZTMA 3C08H 4G7VL 4H8UA 1W80A 3RWCB 4QRRA 3QUZC 1ZD6A 1NCTA 4KO9A 3IS0X 1MRFL 4FQHB 3IDNA 2A38A 4M7LH 5KJ7E 1DO5A 2R69L 1OL0A 4DCQB 3GMRB 1EVTC 4TM9A 2WXLA 2YEZB 3LEVL 1BHGA 4L8DA 4N90D 5CR8A 4F1ZA 4A04A 4D0CB 2AI0H 4L0PB 3RUGA 1A3LH 2C3VA 1VESA 2GUYA 5FKPB 2OL3A 2AAAA 2LFGA 3O4LA 2UX7A 4DVBB 1FGVL 4NJAL 4V1DD 4GG6B 2VDRB 3TL5A 3WDJA 2YPVH 1WRFA 3FCUB 4HWZB 4NN6B 2VXUH 1IC4H 4TVSa 3UYPB 5EZLA 3W9DA 2AK1L 3I84A 3OZKA 4YIQB 3B43A 3D0VB 1O9VA 5C0JB 3WO4B 3UTOA 2EIKB 2ADIB 1ZT1A 2R2HB 1JWUB 3GSWB 3KS0H 2E7LC 1GHFH 4PP2A 5CIPB 4KROC 3LHAA 3RY6A 4BFGA 1B0IA 3S3BB 4AQ8C 4NWUH 2QMKA 4AXWA 4MJ6B 4JQIL 1OGAD 1WD8A 2ZG1A 2B9AA 3AW5A 4JO1H 2UZYB 4FQXC 1CDJA 4X7EC 4NHCH 1UJTA 1L0PA 5A6MA 2EIMB 3US1A 3IKCB 5IQMA 3IS1X 4NRXB 2EC9U 4L3EE 2D7NA 4JREB 1JFHA 1NEZB 1UWYA 4Y5VC 3OMAB 2BERA 3M17A 1P7QB 4G8IB 5F8RC 1OT1A 3NPSC 3RLSA 3QAZB 4W6YB 5DJAA 5FGRA 1HXKA 2C9AA 3L4CA 4K23L 4TPRL 4RNRB 1X4YA 3K4ZA 1DBMH 2BS8A 4GG8B 3MLUL 1HHJB 2XICA 3DDGA 3T0EB 1ESOA 1DL7H 2XJLA 1BM3L 4HMEA 3JWDL 3SGDI 5DMKB 3ETBJ 3BZFA 2MOVA 1A7OH 4H2CA 1A47A 3QZBA 2BW5A 3LIZL 2WZ6A 4M5YL 2VDNB 2WZPA 2AZUA 1ZLSL 1C5BH 5C8JB 3VFMB 2ZXBA 1ZE3H 3ZT7A 3LN4A 1WZ1H 2K6YA 3QHZH 4M6MH 5IB4A 1KDJA 1NLDL 3QUXA 4N90E 4ZOAA 2A9CA 3H4FA 3MUJA 2P48B 3MV7B 4EAEA 5I71B 1KBGH 3MFFA 5I5MA 2C1OA 4WWKC 1UXSA 4WI0A 4V1DE 1AXIB 1YEHH 4MXWL 2YJQA 5M94B 5B7EA 3LRSB 3EYVB 2VQ1A 4X83A 5EIVA 3BP5B 2MWCA 3DX6A 3BIBX 4NIKB 5IB1A 3VFRB 5ABZA 7CGTA 4JM2C 1LD9B 2RCSH 4JRXA 4LSUL 1K8IB 1KCUH 3QCTH 1CLZH 4JE0A 3WKML 5FCSH 1MH5A 3BSHA 1K72A 3K6SB 1FC2D 3KYMA 4UIMB 3SQBA 1OCZB 4Y5YA 4M8RA 3B2VH 4IEFB 4P5TD 3RG1C 2XZZA 1P9MA 1GJWA 1O5DT 3M8OH 5C0RL 5IEHA 5J0BA 1OGAE 1N4XL 5GRZA 4ETQA 5ABAA 2X41A 1W0WB 3LQAC 4I18A 3V0DA 5JHDD 4H5SA 4JL2A 1C9SA 1IC0A 4FQQA 3NH7L 1A6PA 4AVHA 1FSKC 3P9MB 4MA7H 1JNHA 3NIDF 2IAMB 3CSYA 4ZSOA 3S35H 7FABL 5HGHB 2YPLB 1AGBB 2EH7H 4ZG1A 5JTWA 5IESL 3QCVH 4H8WL 5FWQA 1JFQH 1MIMH 5HDBB 3SKMA 1ZY9A 4QRAA 2ADJA 3CFUA 5DJ8B 1BXVA 3OM3B 3QULA 3L95A 5L2KD 4A7UA 1AD9A 1MZYA 3NZUA 3RX5A 4ZUSA 3BESR 3N43F 1J0IA 2EINB 5AVVB 3UC0L 4TVPE 4K3DH 2NXZC 5GSRA 4NNYB 4B0MB 4Z8FH 1UUNA 3UXFA 2HT4D 5C07B 3CFCH 3PWJA 4D0BA 2DMKA 1RMFH 1UKTA 3HZMB 5HHOD 1RJLB 4EZMA 3GHEL 2WIIB 3L3OC 2FIKA 3O9WC 4I89A 4P4RB 4G7YL 2GCYB 5I76B 4Z7WA 3UEZA 5E0QA 4AH2B 4AUYA 4I9XA 3VI3A 4PGEB 3LS4H 5TPWL 4RSVA 3PP3K 2HRPH 3S5LA 1CU4H 1S7VA 5CLXA 4YHYB 3QXAA 3VI4A 3BSZA 3OX8A 2JKSA 4FJ6A 2ENQA 4PJ5B 4AM0B 5AFAA 4EO5A 4GKSB 1F6FB 2DAVA 3JZYA 3U9UA 3UTSD 2X70A 1XCXA 1NH6A 4GXUM 1YLBB 3NDZE 4UMGA 5CZXD 4FA8A 5KG9A 4KKBC 4ABQA 2XWXA 3L4YA 1J9SA 1F4HA 3UPRB 3F7VB 4M1DL 3BAWA 15C8L 3ZYJA 4ELDA 4WGVB 2H2PC 1S8DA 1TVHB 5JHDE 1M2VA 3PU7A 4EIBA 3KPQB 4N2IA 1QATA 2IWKA 3M86A 1YNKH 1H9VA 1ZKAA 4Z7UA 4F2EA 1I1FA 1Q9KB 2WSDA 3LQZB 4ANKA 5HDQL 1V55B 5TD4A 2VDRL 1UD3A 4UT7H 3JWOC 2B1AL 2VDMB 1OGTA 3TZVA 5IVXE 3DGCR 4OZGA 1A7RH 5FKAB 4KRPD 1FDLL 4XTRD 3OXRB 1AXSB 2CIKB 2X9XA 2BVEA 2ICWA 1ETZA 5DRXA 2CK0L 5L2KE 4KHTL 4PJHB 3UGEA 1I7TB 1S7TA 3CVCA 3FU5A 4HKXB 5F9WC 5C0ND 3DBSA 1HL9A 3MCKA 3CX2A 2OULB 3T4AA 1YY9C 3EJZC 4KMQA 5C2BH 3DTUB 4FNQA 2RD0A 4WDIB 1H6EA 1EFXD 2LV4A 3QDGD 4Z0XA 1GS7A 3BZ4B 3FTVA 4Y2DB 1QSED 1XF5A 3NK3A 4PJFB 1RIUH 2YBRA 1G7MB 1O5PA 1BXAA 1ES0A 3UPAA 1G7JA 3II3A 3CCHB 3DGGA 3FT9A 4G7VH 1IU1A 3ZE2E 5IK3A 4PJXA 1MRFH 4JPQA 5D7LB 1UFUA 4XWGL 2AJ3B 4PRBB 4E42B 1TLKA 2R69H 4PWGA 4LP4A 3RWDA 2XWZA 5EU5B 1MUJA 1KJ2A 2A4ZA 3TIDB 5JPNA 3DBXA 1A7BA 5C1MB 1S7QA 3RWJB 4ZXBD 3NJNA 5T5NF 3UTSE 2VDNL 4FC3E 4MBRA 4B60A 3BLKA 2CH8A 2NZ1A 3UZEA 2O61A 4O2FB 5JQ6H 1FGVH 1HDMA 3KCWA 3IDXH 4MA8L 4NJAH 3A6CL 3O0RL 1D9KA 4HWBA 1OSZB 3D3VA 3NJKA 4QRQB 4U6VL 4DW2L 4NZDA 2TSAA 3Q9QA 4HKBA 3RZCA 1KYUA 3FZUC 4ANVA 1NC4B 2PF6A 5GSVB 1AACA 2X1WL 1L9NA 1RUKL 2DL9A 3JTSA 2APTA 4LLWA 1NCGA 3C5JB 4N0FA 1LE5A 4JQIH 2Z8RA 4LSSL 1TLMA 3PCYA 3LHPL 4WSJA 1WDAA 3H3KA 2NXYB 1YSOA 3GO1H 3WNKA 2DF3A 4P46D 3QO0A 2JVUA 3Q6FA 1T5WA 4WJG3 1MFVA 4XPFL 3QDGE 1M7IA 4EF3A 3SDXF 1RAMA 4EDWL 4P23D 4WV1C 2Z1KA 1QSEE 2DWSA 3B4NA 3O6FB 4TPRH 4I2XE 3V0JA 2G2PA 1EEYA 3B9DA 5GRYA 3VXSB 3MLUH 3TWCL 2MQGA 4K5OA 4X7TB 4IYKA 1BM3H 2RALA 1FFNA 2CPUA 2F54B 3JWDH 3WV0A 1JTTA 5KN5B 1SPDA 2HX7A 1MHEA 4Y2OA 3MNZA 3LIZH 1TFPA 4M5YH 3S34H 5INDA 3KH4A 3BIAX 4X6DA 5DK2B 4ODSL 5DWPA 2GI0A 2P8PB 4ESKA 1MHHB 3MA9H 3IDJA 3JWNE 4HKJB 1O6SB 4XNZC 3SKNB 5ADOL 3DJSA 3QIWA 3APCA 4ES8A 1LWHA 4JL1A 5HPOA 1I8KB 3R18A 4Y9CA 4AUUA 3QUGA 4HV8B 2P5WA 3BQUA 2Y5EA 2Q10A 4CSPA 5FGSA 1CFTA 1G5GA 5J12B 3CZFA 1XEDA 2VDKL 1ORSA 4LSUH 3CDGB 1ET5A 4JFDD 2YD4A 4WI8A 1QABA 3WKMH 3ARBA 1INQB 2VIRA 1VEMA 1KPRB 3MX0B 2XBDA 3LZQA 4JVPA 1EXUB 4GEJA 3LX9A 4HIEB 4WHTA 4QKTA 3QWRD 4XX1G 3QXVA 4OQ1A 3N1FC 4M61A 3FHEA 5FV1L 2KLSA 5D7IB 2B59A 4HGKC 2X05A 2DKUA 2ALAA 1NC2D 2AXFB 5EUOB 5MHSE 2BSTB 1TZAA 4MD0B 5I66A 3EOBB 4NO5B 3IJHB 5F89A 2EVFA 3HC3H 5C0AB 2X4OB 4E5XB 1WAAF 3NH7H 3LRHA 3B6SB 5KYWA 4WZ9A 1NSNH 1MXGA 1DFXA 3NOIA 3PGCA 2FZ3B 5IESH 4H8WH 2IDFA 1MHPH 3RIAF 5DSCA 3RDTC 3DMMB 4HSAC 5ISZD 3PNRB 5FA3B 5CEYB 4S0SD 3BO8A 3VGFA 4N5UA 4OJEH 2V2XA 3X1GA 3DARA 1BREA 2VDML 1EWHA 5AKRA 4NQCD 4Y7MA 5MEQA 1D5BB 4HEMA 4AGNA 1VCAA 1EAPB 2X4NA 2FJHA 3FCSB 3QZOA 2MH4A 4YR6A 1SLXA 3T0VA 4F80A 2X88A 1O0VA 3H2PA 3CVHL 4TQPA 4U6XB 4MQXD 3GHEH 1KXTA 2AXJA 4IMKA 5IBTL 3DYOA 4G7YH 1Z9SA 3VVWA 3MTXA 4J4PC 1I3RA 3STBA 3KHQA 2GJZA 5D70H 3P9LA 1NLBL 2QPEB 3IJEA 4NFBA 2WXQA 4R96A 5DVLA 2ZAHA 5BXFA 2IH3A 3IDIA 1X7QB 2XHNA 5HYJD 1CZ8L 3VDAA 1YEEL 1TEFA 1HI6B 4YHPB 4R7DB 1XH0A 5BCAA 3VMNA 2WXJA 4MCNA 2P24A 1I7RA 5CGYD 3TN0C 1UVQB 2P8MB 4RA3A 5DZVA 2EVHA 5JOPE 3QQDB 5F88A 3RTLA 4QHMA 4YHIB 3UG3A 5JW4Q 15C8H 3EZJB 5CMAB 3FFDA 3TH4T 1G9HA 3II1A 1VCBC 1RUAL 1RHHB 3LCYA 1NIEA 1QHQA 2OXGA 3QVAA 4UM9B 2Y9RT 2IQ9L 5HDQH 3AG2B 1ZOXA 1M1SA 2VDRH 4GKZA 1CGSL 3QEUB 2B1AH 1AGCA 1X5AA 4NKQB 2A3TA 2VR5A 3LS5L 3V4LA 5ISZE 4TV3A 1FDLH 3P0YL 2W07B 4U1MB 4LCCC 5E00B 3O8XC 4HPOL 4JPKL 2HN7A 4J3VA 4Y5XC 3X1BA 2CK0H 2BRQA 4KHTH 3BJ91 4IIZA 4XCNA 5JYLA 3CUPB 1YQVL 2X4QA 4NNPL 4OIAA 4NQCE 4XAKD 4ZOBA 5IG7B 1C16B 1USQA 1HXMA 3VFPA 3MUY1 1RURL 4YHLH 3C6LA 3NP3A 2WWKT 5DZOA 2ZWYA 3L5WB 3F5WB 5I6OA 4QRSB 2OXHA 2FL5B 3U4EB 2ARJQ 4N5ED 3KPRA 3QZWB 5D71L 4ZW3A 4G7QB 2Z4QA 1U4FA 2FT8A 3M1CA 1XF2B 4KKLD 5ICYA 3WEAA 2X6CA 1OT4A 2Y1AA 1CTNA 4K5LA 1QTPA 4JAMA 1PY9A 5F1SA 4YDKL 4DP7X 2QJDA 3EYSL 5BW7C 5I19L 3D52A 2KZ1B 1G7PB 5HYJE 3S36X 4ZOCA 4HAGA 2B2XL 4KKRA 4J5VA 4K5PA 3WNIA 3K5SA 4GBXD 1G4MA 4YHOL 4NXSA 1ECZA 2VDNH 3GDCA 3LB6C 4AT6B 1M4KA 1JXDA 5BOJA 1JPFB 1BEYL 3EADA 1J9TA 4PRPB 5DHDA 5EEZA 3NA4A 1QUNA 2DPKA 4UTAL 5I9QC 3O0RH 2ROYA 1ZTXL 1ND0A 4OIIL 4R97C 3ZY7A 1LK3L 2UWEE 2BVTA 3FQXB 3RTQC 1LO3H 3QIUA 4G6JL 5GIRA 4U6VH 4DW2H 5DUPL 1MJJA 4OUUA 3QNFA 2AEQL 1RZQA 2J44A 5D2NA 3P4MB 2G5RA 1H15A 3I75A 5ANMB 2F5BH 3FONB 1N0LA 1RUKH 2HVJA 3BP7A 4W6XB 1QR1A 2NOYA 4MXVE 3Q8AA 3FO2A 4PJIB 4RIRB 2XBTA 4LSSH 5JPMC 3LHPH 4FFVC 1IJNA 1EEZA 1SQ2N 2JKRM 5I5RA 2P5PA 4J3OC 1DQIA 3NFPA 4JFWA 5DHMC 1J0ZA 1CTMA 2R56L 4XAKE 3PWPA 3Q2NA 5CJ8A 4OF8A 5EF3A 3N0AA 3MJ7B 3QFDB 2NY0D 4S2SA 4WKXA 1KPUB 3QEQA 4P2QB 4ZS7L 3UAJD 4PJ8C 1N5AA 4XPFH 1T7XA 5DD6B 4IBZA 4GRLC 3MOAL 4FHBD 4HH9B 4EDWH 5DRZA 3RJDA 1IO4C 1MDAA 1AIFB 3DIFA 3H9SE 2ZWKA 1BMZA 2ZX8A 3AWEA 3TWCH 3ZRSA 4AZUA 1B9ZA 1KC5L 5J13C 3FTYA 2EILB 4QAMB 5FGCB 4XNAA 3VD9A 3LRGA 2BSSB 2YLHA 2R0ZL 4CJ1A 2RQEA 1R3JA 3D85D 3HMWL 4IRJA 1PEZA 1ZHBA 3CFEA 4X6CE 1CN4A 1BZDA 1DSYA 3IN2A 4ODSH 4KOBA 4NUGL 4ZFFA 1DVFD 2G60L 3A4DA 1KCRH 3BRFA 5DFAA 3WLWD 3ZTDC 1BIIA 3HBQA 5HY9B 2FVNA 3BIKB 1F6LL 5JXAL 4P9MH 3SKOB 2GSGB 5I1GL 4IRSC 4DGIL 2PCPB 3KJ4C 1QYGH 4P59L 1BVKA 4H25B 4JDVA 3SSGA 32C2A 1KV7A 2EUXA 4HZLB 2VDKH 3BWAB 3D4ZA 4TMPA 3T77A 5SWZA 2OL3H 1Y07A 3VFTA 2HLFC 2HFEB 3REWA 3L7FA 4E9XA 4HIHB 1RSFA 1GYWA 3GB7B 1JF5A 2BIMA 2JCCB 3MRBB 1ZHNB 4IGBC 5EEUA 4BA8A 2QHLA 4DNLA 1TU2A 2NUTB 2JB6A 2DQDL 5ID1A 3QUMB 4JMXA 4YFDB 3V0GA 2GIMA 2CHZA 3QI9D 4XOAA 1NFDF 2X4PB 3VGAB 2DWDB 1VADB 2B16A 3DGDA 3BZEB 3FT3A 3SBWA 1KTKE 4DP8X 2VAAA 1RJZA 2BSEA 3HG3A 2G2RB 4AYGA 3LSOB 5JIIA 1PLCA 2Z91B 3B9KB 4L5FE 1PX8A 2CO2A 2DKMA 3WG7B 1P1VA 1U8JB 1SMAA 3ZZ1A 3ARDA 3BH9A 2BNUA 1YMHB 3LH9A 2QMJA 3CXHK 1SHSA 3MBEC 1CDGA 3JUZA 2NCEA 4KRMB 1YY8B 3HHMA 1MCWM 2RFXA 5LO7A 1A14H 1TJMA 4KK9C 4YL4A 2CKBB 2YKKA 4ODXB 4RGMB 1QRKA 2X6AA 3H7BA 4MA3A 3NP4A 3CVHH 1TYEB 5E8EA 4Z7AA 5T5NG 1F45A 4P05A 3D5OF 4ONHA 2OTWA 3CIQA 4NC1C 1NLBH 1E4JA 1IBFA 3P02A 2EKSB 3OR7A 4PB9H 5DDHB 2AV1B 5B1BB 4AYDC 2OZNA 1A22B 5D7SL 2J8OA 5BRZA 3X3GL 3SGJC 2C7FA 4WUUA 5AVXB 2AITA 1CZ8H 4FQLH 1KUMA 1YEEH 3V4PA 4L8SC 5IFJB 1LJMA 2J2ZA 3T0AA 1KGJA 4YC2B 3DV6B 3GXPA 1WT5A 2MNJB 1S7UB 2VSKB 4EN3B 1BVZA 5JOEA 4MAYB 1P84K 4LKXB 3STZA 4PD4K 1KJVA 2R1YB 3DSFL 1BX2A 4K9EH 2J73A 3WBDA 4OI9A 4TSCL 2QPSA 2EDJA 1YECL 1JL8A 2IQ9H 4FHJA 1JGVH 4YDMA 5I1DA 3WIIL 1ZV2A 3PWLB 5LCVA 3RL2A 3VB9A 2J56A 1CGSH 5C0DA 2PW2A 1OEZW 1E5YA 5DD3L 2ITCB 4WCYL 3WDHA 2AQTA 3VM5A 3VWJD 2K9FB 2OMTB 3NCWA 3P0YH 1XWVA 3SDCC 1N68A 2RR3A 1SYSB 3L2MA 4HPOH 4JPKH 2Y07L 4NKMB 4M1GL 2BXYA 1C5CL 3UZQB 1WD9A 1YQVH 4NNPH 4EDXA 1J12A 1IMHC 5GGVY 1B0RA 1RURH 2WPGA 2QGBA 2NX5D 1E2WA 1AH1A 1ZHLA 4N2DA 5I1HH 4DERA 2JJTC 1YJDH 4N0UA 4B3EA 3KNBB 5D71H 1ZIBA 4WO4D 3MMEB 1J5DA 4LSQL 3G6AB 3A21A 5FFOA 2AQ1A 1RZIB 4M1CC 4V1DB 3QJHB 5I73B 2BVQA 3Q2LA 2R1WA 4YDKH 4FCAA 5IT2L 3EYSH 5I19H 2BCMA 1TDQA 2O93L 3BZ5A 1QPXA 3AB0B 2B2XH 4OJYA 1R3LB 3OQ3B 2ADFL 2R39A 3T09A 5A16B 1JS4A 5B4MC 2IH1B 1R3IH 4X9IA 1OAYL 1V7NL 3FU8A 3B3IB 2FSEA 3N6YA 2HTKD 1BEYH 1OGAB 2MSPA 4UTAH 4HUWA 4RGND 4F3FA 5GS1A 5AOIA 5AW3B 3SDDD 4PJCA 3WEMA 4G6JH 5I75B 2DQIL 4IU3A 5DUPH 2JQMA 2Y7NA 4OVUA 2AEQH 2UVEA 4QAWA 5IMOB 4Q8BA 2VLME 1U6AL 2V8LA 3DTXB 3DRTB 1K3ZA 2W38A 4YQXL 3KE0A 1YCSA 1Z3GH 4GFXA 5IWLA 3SE9L 1F6AA 3ZMEA 2P5ED 5EN2B 2WBWB 3FU0A 1I3VA 1IC5L 3GMPA 2VUOA 2L3BA 3KLDA 4NX0A 3IDYB 4J27A 1HE7A 3F6IA 1A6WL 4KMLB 3P73B 1PQZB 1G7IB 4DK5A 5C0IB 3CZSA 3ZE0F 4EUPB 1XO8A 2NX5E 5TF0A 3QUML 2FHCA 4ZS7H 4ZUUA 3MA7A 1T1ZA 2QQLL 2DJMA 3MOAH 3V0WH 4DH2A 3HNTL 2J57A 2YRPA 4LMQE 4OCWL 1X5MA 4E36A 1BFTA 2OW7A 3FSWA 4OF0A 5GGSB 4ZDHB 2VQUA 2DEWX 3GIZL 1D7CA 4G8AC 4XXCC 2WXFA 2FB4L 2R0ZH 3E6HA 4NZFA 5EU3A 2J6EL 3ZL4L 1FPTH 1EMTL 4B9ZA 3APNA 3EOAB 2CXGA 1A5FL 2N59A 2G60H 4P57B 4MJ4A 3VWKD 3D0LA 2GB2A 4JCMA 1DEDA 2D7TL 1OSEA 3VXPB 4P5MA 4P5TB 5D1QA 5F2FA 2FEEL 3FCTA 5BRPA 5HGBB 4UUJA 5AVZB 4UZUA 3BWZA 2C9SA 4RGNE 5I1GH 5JHDB 4P59H 4O51B 2XA3A 5AOJA 5C0BA 3FUHA 5KZCB 1BFVH 4U6TA 3WUWA 3T1WA 1XXFC 1T83C 2QSTA 3GJEA 4NRZA 1BG1A 4P06A 4U7MA 4YDIH 5AOLA 4HWUA 2DTSA 3CFDB 5IVXB 3PL6A 3QNYA 4MB3A 4HIJA 5IKCA 4FXKB 4QWWD 2DQDH 3WGUB 2AEWA 3MRRA 1ZVNA 2P47B 1WBXA 3MLSL 2P5EE 5L2KB 5DS8A 1DJHA 1TFHA 2ZE0A 3HZYA 4L4TA 4LPVA 4NDMA 3X11B 2E75C 5PCYA 3V5DA 2HWZL 1YPZE 2QSQA 4IHOA 2PPCA 2QKIC 1YEKL 3EYOA 3BPOC 3K1DA 4YHZL 2IPUG 4QY8A 4DZ8B 2WLIB 2WYZA 4L18A 3ATFA 2ZKWA 1H3VA 2ICEB 4GFTB 1QFUH 4Z95H 3W39B 4ODUA 1J0HA 3CQFA 4NZJA 2UVFA 3NYKA 3ZE2B 4OGAC 5LN4A 2G9HB 2GAZB 5F9JA 4GOSA 1NBZA 3MV9A 1NBYB 4JBSA 4HAFA 1NGXA 1CLOL 5JNYB 3IM1A 2C3WA 4MTMA 2K45A 4UQ2B 3L3GB 1JD7A 3OPZL 3QT2A 4AYBA 2BHZA 1P5UA 1F3DJ 5GGRY 1LWJA 2EKJA 4OCSH 2Z4TA 5D7SH 3EHBD 4JFOB 3X3GH 4RRPM 3VFUA 5IHUL 3GBEA 5CP3A 3D8MA 2IOOA 2XUWA 4PBWD 4C56E 4W9DC 3RGBA 5AVTB 2WNGA 4L0ZA 3VXRA 1GGTA 2PPDA 4K71C 3DX2A 4A39A 3DIDA 3HTLX 4X9FA 4XVTL 1SJMA 3CPLA 1J88A 4URKA 4JW3A 3L9YA 5JHLL 2AFNA 5B3SB 4X5XB 1DDHA 4CKQA 2EXYC 5DS2A 4FYTA 5A2KH 4LIQE 4YSUA 4MDJB 4JQXC 4TSCH 4FG4A 3M1BA 4HWEL 4LE8A 3S37H 3FU9A 1NCWL 5C92A 3WIIH 4JGUA 3CFJB 3MRLB 1A2YA 3QW9A 2X4UA 4HEPA 3PDGA 3QDGB