4EAGA

Co-crystal structure of an chimeric ampk core with atp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
98
Chain Sequence
AKWHLGIRSQSKPNDIMLEVYRAMKALSYEWKIINPYHVRVRRQNVKTGKFSKMSLQLYQVDAKSYLLDFKSLTLQPTGHHTMEFFEMCAALIIQLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EG:132E8.2 protein
publication title AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 21
structure length 98
sequence length 125
ec nomenclature ec 2.7.11.-:
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16579 AdenylateSensor Adenylate sensor of SNF1-like protein kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.80 Alpha Beta 2-Layer Sandwich TATA-Binding Protein Kinase associated domain 1, KA1 4eagA01
2Y8LA 3TE5A 3OSEA 2V92A 2QR1A 4EAKA 2QREA 2OOXA 4EAGA 4CFFA 2QRDA 2QRCA 2QLVA 2EHBD 2V8QA 4EALA 2OOYA 4EAIA 1V5SA 2V9JA 2ZFDB 3T4NA 2YA3A 2Y8QA 1UL7A 3TDHA 4EAJA
chains in the Genus database with same CATH superfamily
2JHJA 1M3QA 3EAYA 5KL0A 1QN3A 1EBMA 4HJHA 4WXAA 3ENCA 4IL8A 1Q9UA 2DKCA 4EAGA 2VJ0A 4CFFA 1K35A 4TPSA 1KY6A 1KY7A 5HSHA 5JMVD 1YTFA 2FGTA 2QLVA 1PCJX 2EHBD 3ASMA 2F7LA 3F10A 1YQLA 4EAIA 2LAEA 2ZFDB 3VN5A 3OSMA 1VKLA 1LXTA 5JN5A 2D0CA 2MJ7A 1KYFA 2H4LX 4D7QA 3CVTA 1TGHA 1VOLB 2Y8QA 3H1ZA 4ROCB 1N3CA 1QN4A 3OGDA 2HL8A 1NGMA 2DKDA 2JPIA 3DPUA 3RSMA 3D4VA 1AISA 1T6AA 2OOXA 2QREA 1PCZA 1LWYA 1PCMX 4C7PA 1PZDA 1QN7A 1VOKA 4WX8A 3OSTA 4RODB 1P5DX 3D7QA 3OC3C 2NOHA 1YQKA 2OOYA 1QN9A 3NA5A 2YH5A 2FUVA 1K2YX 1XSZA 4I8OA 4QG5A 1R4XA 3ENOC 3F0ZA 3I0XA 1D3UA 3CWTA 1M5Q1 5BMPA 1QTPA 2DKAA 1P5GX 1UT4A 1TBAB 1WQAA 4MRQA 3I0WA 3KRMA 1C47A 2HKPA 5EPCA 2NOZA 3TE5A 1YQMA 2V92A 2IV8A 2G30A 4PY5A 3CWUA 2O3OA 1QN8A 3PDKA 1VTOA 1TUOA 2QRDA 2R5XA 2JOIA 1KYUA 5BMNA 4EJYA 1HU0A 5IYDP 3SNSA 1DIZA 2HL9A 3HS9A 1QNCA 4EJZA 2V8QA 1JDYA 3OLPA 2XHIA 2HZSA 3I3WA 3IH7A 1LWVA 1FN7A 2JHNA 3HS8A 1W80A 2PWWA 3CWAA 1B9KA 1CDWA 1WJWA 2I5WA 2Z8UA 1QNEA 2NOIA 2D0BA 2NWVA 2MZ8A 2Z0FA 2NOFA 1TBPA 4Q11A 1MP9A 4EAJA 1QN5A 1E42A 3KTUA 2NVMA 2FKFA 4DULA 4BJUA 4D7RA 2Y8LA 2D0AA 4B0AA 1JFIC 3UW2A 3CW7A 1PVSA 3OSEA 1QNBA 1YTBA 2QR1A 1KO9A 4EAKA 1LWWA 1KFQA 3C04A 2H5AX 1QN6A 4WZSD 3RPJA 3BKQX 5IYBP 3OH6A 1M3HA 1QNAA 2QRCA 3OH9A 2NOBA 1MPGA 1NH2A 3DPTA 4EALA 1VTLE 1NVPA 4ROEB 1V5SA 2IV9A 2V9JA 1YQRA 3OCIA 5IYCP 1N3AA 2NOLA 1J3MA 3T4NA 3CVSA 1QTSA 1C4GA 3N89A 3PMGA 3CWSA 2YA3A 5F9CA 1KYDA 2HZMA 1N39A 2NOEA 1RM1A 1C9BB 1UL7A 3TDHA 1KFIA 3ULXA 2NLVA 1UT7A 2FKMX 1EUVA 5AN4A 3EIKA
chains in the Genus database with same CATH topology
2Y8LA 3TE5A 3OSEA 2V92A 2QR1A 4EAKA 2QREA 2OOXA 4EAGA 4CFFA 2QRDA 2QRCA 2QLVA 2EHBD 2V8QA 4EALA 2OOYA 4EAIA 1V5SA 2V9JA 2ZFDB 3T4NA 2YA3A 2Y8QA 1UL7A 3TDHA 4EAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8L A;  3TE5 A;  3OSE A;  2V92 A;  2QR1 A;  4EAK A;  2QRE A;  2OOX A;  4EAG A;  4CFF A;  2QRD A;  2QRC A;  2QLV A;  2EHB D;  2V8Q A;  4EAL A;  2OOY A;  4EAI A;  1V5S A;  2V9J A;  2ZFD B;  3T4N A;  2YA3 A;  2Y8Q A;  1UL7 A;  3TDH A;  4EAJ A; 
#chains in the Genus database with same CATH topology
 2JHJ A;  1M3Q A;  3EAY A;  5KL0 A;  1QN3 A;  1EBM A;  4HJH A;  4WXA A;  3ENC A;  4IL8 A;  1Q9U A;  2DKC A;  4EAG A;  2VJ0 A;  4CFF A;  1K35 A;  4TPS A;  1KY6 A;  1KY7 A;  5HSH A;  5JMV D;  1YTF A;  2FGT A;  2QLV A;  1PCJ X;  2EHB D;  3ASM A;  2F7L A;  3F10 A;  1YQL A;  4EAI A;  2LAE A;  2ZFD B;  3VN5 A;  3OSM A;  1VKL A;  1LXT A;  5JN5 A;  2D0C A;  2MJ7 A;  1KYF A;  2H4L X;  4D7Q A;  3CVT A;  1TGH A;  1VOL B;  2Y8Q A;  3H1Z A;  4ROC B;  1N3C A;  1QN4 A;  3OGD A;  2HL8 A;  1NGM A;  2DKD A;  2JPI A;  3DPU A;  3RSM A;  3D4V A;  1AIS A;  1T6A A;  2OOX A;  2QRE A;  1PCZ A;  1LWY A;  1PCM X;  4C7P A;  1PZD A;  1QN7 A;  1VOK A;  4WX8 A;  3OST A;  4ROD B;  1P5D X;  3D7Q A;  3OC3 C;  2NOH A;  1YQK A;  2OOY A;  1QN9 A;  3NA5 A;  2YH5 A;  2FUV A;  1K2Y X;  1XSZ A;  4I8O A;  4QG5 A;  1R4X A;  3ENO C;  3F0Z A;  3I0X A;  1D3U A;  3CWT A;  1M5Q 1;  5BMP A;  1QTP A;  2DKA A;  1P5G X;  1UT4 A;  1TBA B;  1WQA A;  4MRQ A;  3I0W A;  3KRM A;  1C47 A;  2HKP A;  5EPC A;  2NOZ A;  3TE5 A;  1YQM A;  2V92 A;  2IV8 A;  2G30 A;  4PY5 A;  3CWU A;  2O3O A;  1QN8 A;  3PDK A;  1VTO A;  1TUO A;  2QRD A;  2R5X A;  2JOI A;  1KYU A;  5BMN A;  4EJY A;  1HU0 A;  5IYD P;  3SNS A;  1DIZ A;  2HL9 A;  3HS9 A;  1QNC A;  4EJZ A;  2V8Q A;  1JDY A;  3OLP A;  2XHI A;  2HZS A;  3I3W A;  3IH7 A;  1LWV A;  1FN7 A;  2JHN A;  3HS8 A;  1W80 A;  2PWW A;  3CWA A;  1B9K A;  1CDW A;  1WJW A;  2I5W A;  2Z8U A;  1QNE A;  2NOI A;  2D0B A;  2NWV A;  2MZ8 A;  2Z0F A;  2NOF A;  1TBP A;  4Q11 A;  1MP9 A;  4EAJ A;  1QN5 A;  1E42 A;  3KTU A;  2NVM A;  2FKF A;  4DUL A;  4BJU A;  4D7R A;  2Y8L A;  2D0A A;  4B0A A;  1JFI C;  3UW2 A;  3CW7 A;  1PVS A;  3OSE A;  1QNB A;  1YTB A;  2QR1 A;  1KO9 A;  4EAK A;  1LWW A;  1KFQ A;  3C04 A;  2H5A X;  1QN6 A;  4WZS D;  3RPJ A;  3BKQ X;  5IYB P;  3OH6 A;  1M3H A;  1QNA A;  2QRC A;  3OH9 A;  2NOB A;  1MPG A;  1NH2 A;  3DPT A;  4EAL A;  1VTL E;  1NVP A;  4ROE B;  1V5S A;  2IV9 A;  2V9J A;  1YQR A;  3OCI A;  5IYC P;  1N3A A;  2NOL A;  1J3M A;  3T4N A;  3CVS A;  1QTS A;  1C4G A;  3N89 A;  3PMG A;  3CWS A;  2YA3 A;  5F9C A;  1KYD A;  2HZM A;  1N39 A;  2NOE A;  1RM1 A;  1C9B B;  1UL7 A;  3TDH A;  1KFI A;  3ULX A;  2NLV A;  1UT7 A;  2FKM X;  1EUV A;  5AN4 A;  3EIK A; 
#chains in the Genus database with same CATH homology
 2Y8L A;  3TE5 A;  3OSE A;  2V92 A;  2QR1 A;  4EAK A;  2QRE A;  2OOX A;  4EAG A;  4CFF A;  2QRD A;  2QRC A;  2QLV A;  2EHB D;  2V8Q A;  4EAL A;  2OOY A;  4EAI A;  1V5S A;  2V9J A;  2ZFD B;  3T4N A;  2YA3 A;  2Y8Q A;  1UL7 A;  3TDH A;  4EAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...