4EARA

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with dadme-immg and phosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
282
Chain Sequence
GYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 87
structure length 282
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4earA00
4D98A 4NS1A 1A9SA 4QARA 2IQ5A 3U40A 1V2HE 4QASA 1T8YA 4BMYA 1PR4A 1U1FA 1JDTA 1YRYE 3MMSA 1OTXA 2OECA 5KB3A 1JDVA 1NW4A 4TXJA 4YO8A 4GLJA 4JWTA 4QEZA 4WKOA 4M3NA 2OC4A 2H8GA 3KVYA 3FOWA 1VHWA 1U1EA 5ETJA 4F3CA 4L6IA 3INYA 3OZCA 1Q1GA 1Y1SA 2BSXA 3ENZA 4EB8A 1U1CA 3IOMA 5JPCA 5B7GA 4OJTA 3EEIA 4WKBA 1ODJA 1ZOSA 4TXLA 5CXQA 4L0MA 4I2VA 1K9SA 1B8OA 5F7ZA 3UAXA 3E9RA 1OTYA 3OOHA 1VHJA 4UC0A 1RXUA 5DK6A 1JP7A 1V4NA 5CCEA 3DPSA 1Z33A 2HSWA 1Y1TA 1VFNA 4TS9A 1TCUA 1SD1A 3DP9A 2AC7A 1U1GA 1ULBA 4TS3A 1Z5NA 4NSNA 5CXSA 5B7QA 5CCDA 4BMXA 1Z5OA 2P4SA 5EFOA 1QE5A 5EPUA 2I8AA 3EUEA 4WKPA 5B7PA 1JPVA 3OZBA 1CG6A 1YQQA 3BL6A 1PR6A 3TL6A 3UAYA 4LZWA 1G2OA 2QTTA 4DAEA 2QDKA 1FXUA 3OZDA 1V48A 3QPBA 2GUWA 3OPVA 3DJFA 3D1VA 1JE1A 1PF7E 1PR5A 1RR6A 3C74A 2A0WA 4YJKA 4R31A 4BMZA 1LV8A 4OF4A 5I3CA 4LKRA 3KU4A 1SQ6A 3OCCA 4GMHA 1V45E 3P0EA 1ODLA 5IU6A 3ONVA 3PNPA 4H1TA 4M1EA 2AI2A 4TTJA 3NM6B 1ZL2A 4OEHA 2A8YA 1JDUA 3OF3A 1OU4A 1RCTE 3FAZA 4NY1A 5F78A 1Z35A 4TXHA 1A9TA 1A9RA 3EUFA 1T8RA 4R2WA 1V3QE 2ISCA 1A9OA 1RT9A 1ODIA 1A9PA 5F77A 1PR1A 4D8YA 1YBFA 4D8VA 4TTAA 1NC3A 2QTGA 3KVVA 2HRDA 1A69A 3E9ZA 1TCVA 1T0UA 4OGLA 4L5AA 4DABA 5EUBA 4PNPA 4FFSA 3BSFA 3GGSA 4D9HA 3PHBE 3IEXA 3P0FA 3EMVA 3K8OE 3NM5A 2Q7OE 3DF9A 3GB9A 3UAVA 5K1ZA 3FWPA 4L5YA 1Z39A 3ODGA 4KN5A 4F3KA 2QPLA 4TXNA 5FAKA 1A9QA 2HWUA 1PK7A 3O4VA 4DA8A 2B94A 4U2KA 4QAQA 1K3FA 4MARA 1PK9A 3BGSA 3MB8A 3OOEA 1NC1A 4M7WA 1Y1RA 1Y6RA 3O6VA 5CYGA 3LA8A 4X24A 4F1WA 1N3IA 4TYMA 2HN9A 1VMKA 1PR0A 1PWYE 3PHCA 1RXSA 1JDZA 1WTAA 2XRFA 1YR3A 1OUMA 1TGVA 4ECEA 5F73A 5B7NA 5IFKA 4E1VA 3BJEA 4WKCA 4R2XA 4QATA 1PW7A 3UT6A 1PR2A 1SJ9A 4YNBA 4G89A 4OY3A 1V41E 1JDSA 1T8WA 4YMLA 3FB1A 4MCHA 1Y1QA 1Z37A 2OC9A 1B8NA 3NBQA 5F7XA 4LDNA 1T8SA 4F2PA 4GKAA 4IP0A 3E0QA 4L5CA 1PKEA 1LX7A 4DARA 4JP5A 3KVRA 4DAOA 3UAZA 1K27A 4TTIA 1LVUA 1PBNA 1RXYA 4TXMA 2OXFA 3OZEA 5C80A 5F7JA 2I4TA 4RJ2A 1ECPA 1Z38A 4EARA 1JYSA 4DA7A 4PR3A 4QFBA 4G41A 1YQUA 4OGKA 3LGSA 4LNHA 1OV6A 4F2WA 1RFGE 4DA0A 4D8XA 1RSZA 1ODKA 3FUCA 1C3XA 2A0YA 1JE0A 1RYZA 1RXCA 1TD1A 3LBAA 3T94A 5CYFA 2RJ3A 1ULAA 3F8WA 1Z34A 5F76A 1U1DA 2AI1A 1Z36A 4GLFA 3K8QA 1SD2A 2ON6A 3PNSA 1I80A 3SCZA 2A0XA 1Z5PA 3KUKA 1XE3A 4WKNA 4JOSA 4BN0A 1Y6QA 1CB0A 2QSUA 1TGYA 1M73E 3DDOA 4K6OA 3UAWA 3KHSA 4G8JA 4MCIA 5F7OA 2AI3A 4P54A 4DA6A 2PGAA 4DANA 4LNAA 1OVGA 3NM4A 3FNQA
chains in the Genus database with same CATH superfamily
1U2RA 1N1EA 2PN1A 4I1OA 4PZLA 3FDXA 1RAEA 1R8QA 5FO1A 4KR6A 3V4FA 2PJUA 1T8YA 4K0KB 4K88A 4RSMA 2PLRA 3M9XA 4H35A 2VXYA 4N01A 2ZREA 5JCJD 2WWVD 1Z6ZA 4I7EA 4BNMA 1LBTA 3R7WA 1Q44A 4FJ1A 3TGWA 2YHSA 2ZJZA 2H48A 4J76A 3RWOA 3UYKA 3WGIA 5LP6B 1NFRA 4OFXA 1CVLA 1Q92A 3LC7O 4UAJA 5TGTA 1TQHA 4CG2A 4GLJA 2IIBA 3I9MA 1JLLB 4RTPA 1H23A 5DGHA 4E5DA 3QNUA 1JUDA 2XZOA 1I4WA 4QEZA 1W5BA 3P2IA 3V3TA 1S0UA 2OC4A 3VO8A 2QRKA 3JSAA 3LZDA 4IQFA 2F90A 3BMQB 2YJ4A 2FW0A 3DHWC 1Q1ZA 3C6MA 3QOWA 1EFUA 5AH0A 3SXJA 3DZDA 4DMLA 2IPLA 4S04A 3J80A 1EK6A 2F64A 2QVGA 4IS2A 3K09A 4I4TB 2I1WA 2JGIA 5BN5B 1H8EA 3ASUA 1U8CB 1JZSA 3DBRA 4TYPA 2NPFA 3ZWKA 1Y8CA 4L28A 3LHSA 4GT1A 1HSZA 1G21E 1GFSA 3BFJA 3GDGA 2WMDA 3BIOA 4WASA 4ZAXA 1AXEA 2CJXA 4RKYA 2ATEA 2WM9B 1JJIA 1XTSA 1SXJC 3HSSA 4BMSA 1V5GA 4XD7A 1GT91 1MB3A 1NWCA 4BTEA 3EEQA 2D13A 4NCXA 4V0NA 4B8YA 1ST3A 2C4TA 3QU4A 4II2A 4ROSA 4RS4A 3RC7A 4BKUA 3ZKWA 1YS1X 4E6PA 2QRZA 1YS7A 1NPTO 4XLLA 4UKDA 4XJVA 4BMPB 1XTIA 5EERA 4RHYA 4C20A 1Z0SA 4UMDA 2HC9A 2NU6A 1Q0LA 4M99A 5KU1A 3OOHA 4ES6A 4E2XA 4QPZA 3DFMA 5TEVA 3QX3A 3AF2A 1Q0ZA 1WR8A 2C8JA 3D3EA 4K87A 2Y4OA 5HDQA 1JWLA 3P26A 2XW6A 5DASA 3R7AA 5LKRA 3GLIA 1RADA 2J9XB 2P0YA 1CQWA 3EZXA 2FSSA 2EGGA 3ZDEA 4LF9B 3O8NA 3LUAA 1M0WA 4BFUA 3I3SR 4G97A 1WDKA 3WYFA 3DLIA 3DUFA 1LNZA 4MQFB 2QQFA 4L15A 4MQ6A 4O4IF 3X0DA 1QX3A 4ZVRA 3PFCA 1GVHA 1Q7TA 4ARCA 2HBZA 3MEQA 1L4BA 3QEKA 4PFQA 3PC3A 1T4MA 2E48A 1IHPA 3AUJB 4NESA 4ALLA 1NXVA 3CTPA 1JA9A 5REQB 4NE7A 4OXXA 1WWKA 2A88A 3E4DA 5MN5A 4KE6A 3AP3A 1HE8B 5EAIA 4W5OA 3GDFA 3IHTA 4AWXA 3SYRA 3JQQA 1YO6A 5K4GA 3L4BC 3MXTA 2ZYVX 1B3RA 1PO7A 3O1IC 4MHTA 1F5SA 4YAIA 5FBZA 4BMXA 4ND8A 2EOAA 4LI3X 3F98A 3K35A 1JPNA 3NPAA 1DWUA 3R1IA 4LHSA 1KI6A 1ZESA 4DDVA 5EE9A 1MFZA 1PFGA 3QVWA 4NL4H 1U7ZA 5T64A 4MI1A 2PSHA 2WWIA 1KRHA 5CDUA 4FMPA 3KPUA 4DRZA 2IYFA 3TKAA 3T1HB 3H2IA 2J5QA 3IPCA 5G3YA 5JCOC 2WD9A 4GMXA 4JI8B 1XNJA 2FZGA 2R60A 3JQGB 2J9YB 3EVNA 4V0SA 3VH2A 4FGWA 3MD0A 3HL4A 1D6MA 2YW2A 1GUDA 2J45A 2K2QB 4LZWA 1N0IA 5I47A 5TVKA 4DAEA 3UFBA 2EP8A 4JI6B 4MDFA 3PFKA 4MICA 2RGEA 4BLUA 1U04A 1M2HA 5AP9A 4PPNA 4LC1A 5HA5A 1E3JA 1UKVY 3V1TC 121PA 1ZHOA 4Y2SA 4QJBA 4ENRA 1IXZA 3C74A 4GC9A 1ISSA 3IB6A 1FRNA 4GSKA 2WRZA 4HZGA 1O2DA 4NMHA 3THXB 3AM1A 1ACJA 3LK6A 3H1BA 4BV8A 4CV1A 3WC4A 2CLKB 1SG9A 3OOWA 3CQ9A 4Y2PA 2RDMA 3REQA 1UEIA 2O2CA 3PDUA 4JP8A 5FLKA 4YRSA 5JECA 4Y3UA 4ZIRB 2OPBA 4TQUS 5FHRA 4PXSA 2Z30A 3MT9A 4MJ7A 1MXFA 3V8RA 3QVVA 3N2YA 4UVHA 2VDLB 4J29A 2O50A 1UR5A 2JHFA 3EGXB 4LXXA 3VSDA 4OK5A 3UWMA 3NM6B 1SKUA 3SYKA 4BDTA 2WAOA 1YJ8A 1BN7A 1JDUA 1OWNA 4PC1A 3QUTA 2OV8A 1X7ZB 5FUVA 1C80A 4EI2A 2PR7A 2JLZA 1Z7BA 1PHPA 1PRYA 1GPKA 4M55A 2I4NA 1GR1A 2EJWA 4FXPA 4RMHA 1AY0A 1OASA 3T7AA 1ECGA 3CUWA 3HRKA 3ESYA 2NUTB 2HJGA 2IZ7A 4G4SP 4OLHA 1HGXA 1YQGA 1K2VN 4A6PA 2P27A 1A7JA 2BP7B 4PLYA 3ZE0B 1Y81A 1U7XA 2BI7A 4C2BA 1GU7A 2XB2A 3R77A 1VHTA 1VI2A 2FPRA 1QH8B 4EMBA 3O8OB 1GM5A 2Q45A 1CR2A 2YFQA 4O2RA 5BW8A 5T8KC 3VGPA 4O1IA 3NTUA 4LK3A 4NS4A 4FQ7A 4C4XA 4XX0A 3QEMA 4Y2RA 4EG3A 4WOBA 2YBDA 1SA0B 2I29A 3ZHTA 1G16A 5L45A 1A9XA 1W4CA 4QSMA 4Y18A 3KTAA 3LT5A 1B0AA 4Z9XA 2DWUA 2VWPA 5CTJA 5FV7A 1HDEA 4MUIA 5EUBA 1T3LA 4U9UA 5JEEA 2HXGA 2JLAA 3PKJA 1AK2A 4RD2A 5CX1A 5CNKA 3TEMA 3I1JA 2UZ1B 1SUIA 4U7FA 3ESBA 1LSSA 3LDHA 4JUDX 4YDQA 3LTNC 1E59A 1OVMA 2B0JA 5BQ5A 2GEJA 3PWSA 3KEFA 3OCVA 4XQ9A 4E46A 5AVZA 3FYTA 3WIOA 2A9KA 3WLHA 2GFHA 3MGGA 1E96A 1E79A 2ERYA 2O6HA 3TGPA 4O08A 2IGBA 2HMUA 2J08A 2OGUA 4KQWA 4U9HS 3WLNA 3MOGA 3ODGA 1H69A 1TO6A 3ICWA 2WU3A 3RHSA 3G8BA 1HMPA 3KR1A 3A6EA 2X76A 1QLWA 4TXNA 4EF5A 1VYUA 1QIHA 4ZZ3A 2XDWA 3LVQE 1IUPA 2PA0A 3BTOA 4GM4A 4HPJB 1F5NA 2IUFA 2QRLA 5EOVA 5TE9A 4B33A 4BOYA 5IDQA 4H2DA 2CXRA 3C3YA 4LOKA 4XVQA 5IWCA 3AETA 4AB1A 3PSHA 2GJ9A 4FP9A 4OI1A 1VDZA 2YJ5A 2Z1MA 3IO3A 4MGYR 3WDKA 1T4BA 1Z4LA 3N2NA 4WE3A 4EPYA 4KO2S 5AVXA 4HAUA 2G9RA 2CXPA 4JVOA 5J4KA 1DCKA 4K8OA 4DCGA 1Y3IA 3HWRA 3RKRA 3KYIB 2R8XA 1CBUA 3BZWA 4GM1A 4U2FA 4X1YB 4GICA 3KEMA 1VSQA 3Q12A 4LQDA 4LWZA 1FX0B 1EX7A 2C97A 4FDAA 1V2GA 1N25A 1ZI9A 1RBMA 2FPMA 1XN1A 4ZOBA 4QO7A 3ZV6A 3U19A 1CEYA 5A0VA 3Q9NA 1KFEB 3VC2A 1CX9B 3W5AA 1NVAA 1MQ9A 4PGAA 5K8IA 2JLYA 1EUYA 2IHBA 1UKBA 3OD1A 2J07A 1CSEE 1U1IA 4V2UA 4RZ3A 2DOKA 4WLEA 1C4OA 2Q5JA 3PXBA 5GADl 5F1PA 2HHAA 4BGUA 4RSRA 4RTNA 3OLZA 4BX8A 1C8BA 1JHVA 3AEKA 3V1UA 2DT8A 2CEAA 2WF6A 1M3SA 2DFDA 2OZEA 3MJFA 3TDKA 1QORA 2CBXA 3DL4A 3NTVA 1N5JA 2O7QA 2RIPA 1ZJ6A 2SBTA 5J5VA 3KTFA 4BEJA 1P77A 3PHLA 4AJKA 1ZSYA 1BS1A 1WMAA 4WKCA 4S0ZA 3CISA 3U3MA 5L4LA 2Q3MA 4KHZA 1ZH4A 4F3TA 2WIFA 2DR2A 4PPFA 2C84A 5I7FA 2PKWA 2PUCA 1YAJA 3VAZA 3TCKA 1PDVA 1JYEA 3BORA 4GE3A 3G0IA 3OJEA 4R8KA 4O4JA 3W5JA 1EDEA 3AJRA 4PX2A 4OY3A 3HB9A 2CD7A 3OIWA 1H2WA 4DZTA 2RGNA 3QVGB 5A3SA 2X5NA 1S2DA 1BEUB 4F2HA 4HP8A 1YD7A 4MEAA 5B1EA 4CIYA 1OFVA 4GOJA 4XIJA 1PGNA 1U8UA 4MW4A 1XROA 4Y30A 3RS9A 1F7VA 3C3CA 4IVRA 1QS0A 1XDBA 2M9MA 3A4IA 3CF2A 1XKQA 1NX6A 4MW5A 3OZRA 4JOQA 4L85A 4XQEA 3UATA 2VRNA 2YHUA 2P9ZA 2BH2A 2JGAA 3ROFA 2JD2A 2QD3A 5IK2D 2YN4A 3NHUA 3CURA 2H65A 3NHPA 3KZOA 4PX9A 4YT4A 1MV5A 3RS3A 3E0QA 3C6KA 3EFHA 3X2FA 4TSFA 2AQKA 3QYPA 1S2LA 2H2GA 3Q7RA 1O97C 3QFRA 4MV3A 1X8XA 3FJ1A 3IDZA 3RSFA 4Q03A 1JQAA 1ND5A 1E2GA 2ZSDA 4UUPA 1XHEA 1CY7A 3NV9A 2FW9A 1MO6A 2WMYA 5AVOA 3F4KA 1L6IA 4M0EA 4BJ5A 2WZCA 3Q3JB 1KNQA 1P39A 1E2KA 1QDUA 4NONA 2H9YA 1KYIA 2FK7A 3ORQA 3CX3A 4B7UA 1JN0A 3Q0EA 4ZQHA 5H83A 1XDSA 1BZYA 1B4DA 4TXMA 5JWRA 4J0EA 5DHTA 2R6R1 1DUVG 1WPGA 2Q28A 4J7CA 3WLPA 2P2NA 1P1HA 1TO2E 3QMMA 3VOSA 5J2UF 2ZS8A 4HEQA 3HY3A 1FFBA 2YVQA 2NO4A 4LGVA 2YV2A 3IHKA 4GZLA 2XXAB 1PVOA 2IYXA 3IP5A 2FOIA 5B58T 5CDFE 3KL4A 2WAMA 1IE3A 2X1MA 4UU0A 4LHZA 1C7IA 4HWPA 4CG3A 3IAAA 2AT1A 4HB0A 3BWDD 4RA9B 4PRZA 1QU2A 3JPWA 3TQOA 4GPEA 4GI5A 3T3EA 3NBZC 1UBJS 3WV5A 4YRBA 2I5PO 3EXHB 3CTMA 1OWLA 4UMVA 5DSXA 3MMPA 1MBZA 5GONA 4C4YA 4CQLA 5TIIA 2G8NA 1JHPA 1PNVA 3KALA 1BS9A 2BHTA 4FIZA 4BX0A 1J2UA 5JXHA 3FWHA 3R4VA 3W3AD 1F8GA 3C7AA 3G02A 2OR3A 2X1VA 3M1AA 5FOTA 4F1JA 1K63A 1FFXA 2JIPA 5ALGA 1BE1A 4ZRDA 4JVSB 1Q7GA 1Y1PA 4XZ3A 4ZYLA 2XKKA 1XWIA 1YVPA 1EDZA 3AWDA 3KSDO 1GA4A 4E21A 3EHDA 3ZXUB 3KLBA 3CZQA 1DZIA 1X1DA 3GFBA 3BJZA 4J94A 1WXFA 2WYIA 4S2EA 2R7KA 4J0IA 4MCJA 3M33A 2XA1A 5C5IA 3KM0A 4CUKA 1DNPA 1U1DA 4YJHA 2FPLA 5HJ5A 1T1SA 4JLJA 5EMHA 2X8AA 4PN7A 2GOYA 3QHAA 1P5RA 1GTL1 1QFMA 1TC2A 2IA5A 1SKYB 2QYHA 2WKPA 1SUSA 2XUQA 2DECA 4Q82A 3FPCA 5TQ0B 3SCZA 2E87A 5KNCH 4TWAA 2YZKA 2O5CA 1E9CA 1RKVA 3PQ8A 5JANA 1EM6A 4JZYA 5KVSA 1EFKA 3KJHA 1NMEA 4MW1A 4NJMB 4DMFA 4Y6GB 2W2TA 3A26A 4HNAA 4Z0PA 3D7NA 1WULS 3S68A 1AH2A 1DG1G 3U3RA 2RB5A 1WZEA 1KA9H 2E5WA 4HLCA 3F73A 1BQ4A 1XR3A 3N2GA 4BECA 4HDRB 3DEYX 1QVVA 5BOSB 2DH5A 4FLMA 3TI9A 2ZUDA 3DCNA 1CF9A 5EMJA 1BH2A 3AGQA 1Q11A 1GFWA 5DXAA 4FT2A 4FS3A 3SM3A 2CK3A 1SXGA 1KBZA 2F3UA 4GX0A 4TVSA 5F23A 4CZ2A 3PI6A 3LW7A 1U0RA 3LK7A 3O91A 3HZRA 3TKYA 3BMOA 2R2AA 1PEKE 4MS3B 5JBIA 3FETA 3GFOA 2JLCA 1P2DA 3FLMA 3MT7A 3NJRA 4LY0A 3ADOA 2WU8A 1E1RD 4MVJI 3SU8A 4NYIQ 1VGRA 5L40A 5JCPA 2GVZC 2R7LA 1X80A 2PZLA 2VJMB 1VI5A 5COQA 5I9MA 3WGTA 1BG6A 3KKQA 3DZIA 4X62B 3R6WA 1XELA 3D8NA 4P3PA 2D2FA 2ACVA 1R5JA 1YI0A 4DC9A 3HZHA 1SCUB 2YNMD 1IY0A 1XTJA 2BUCA 2DM6A 3F9RA 3IAEA 4X6XA 5EL0A 3TJZA 3JAKB 2RHMA 4GX1A 5DEOA 1HDYA 1QHHB 4NZNA 5AXBA 4ZU6X 1RM5A 4LFAB 2WPNA 2ZTSA 3CPHA 4WJLA 1UPBA 4N0QA 2H51A 2O2IA 2VYVD 1EBBA 3I52A 1T5BA 3JQAA 1JDTA 4AS3A 1SCAA 1RWWA 1E58A 2J6HA 2BBOA 4DSUA 3K5WA 1QE0A 1V4BA 4J3JA 1SH7A 4NJOA 3M82A 3JWGA 5JATA 3W9UA 4HBGA 1U6KA 1EIWA 1RJFA 4C0AC 1X1CA 3K0HA 4W9RA 1NW4A 3HVJA 1KO5A 3LKVA 5AVVA 4DQLA 5FEUA 4HZUB 4GL2A 3W90A 3H9BA 4U4AA 1B43A 1CS4C 1XDZA 4F11A 1NDQA 3V1YA 2OKCA 3BFPA 1CLEA 4KYUA 2B4RO 4MVJM 1GXSA 5HCNA 5LP6F 1ILEA 3EBOA 4BO6A 4F7DA 4MQLA 1SXQA 1YQWA 2SKDA 3M1LA 4P0PB 1U2EA 3FOWA 3EW7A 3I0NA 1U0EA 3BJIC 2Y6UA 3LUJA 3Q3GE 1QFJA 3OCJA 4P31A 4WY5A 5FBHA 3WIDA 3CWCA 2SECE 3HH8A 3PICA 4WT7A 3Q5EA 1EX6A 2WTXA 2ZJ3A 1Y1SA 2FI1A 2YY6A 2P2YA 2VP2A 4ZO4A 3L9XA 4ALJA 1E5XA 3AI1A 3Q11A 2C57A 5DI9A 1LRJA 3H04A 3PVZA 2BEJA 3WO0A 2Y71A 2GHQA 3BQ9A 4PQGA 4AMVA 4ZZIA 2C9OA 2EKPA 5LBUA 5CITA 3THRA 2QIOA 2WVAA 1GDTA 2ABWA 3GAZA 3O4IA 4BJ6A 3QRWA 2ADOA 3OX4A 1CP2A 2TRSB 1NBME 2CLMB 3F90A 1BVUA 5CB0A 4I14A 3QUCA 3TSAA 4B81A 1OMOA 3C6XA 5GIOE 1CIPA 1M2NA 2EW1A 3HSKA 2EFJA 4EVRA 1N2CE 1FEZA 3LX4A 3C39A 4N12A 3TG8A 3MJRA 2O48X 3OBIA 2FKNA 1RQGA 3TLYA 2MWMA 2JJ1D 2VYCA 4LBYA 1FBTA 1JAIA 2H92A 4URYR 5E2BA 2CCKA 2BFBB 1A7UA 1ENPA 2O2DA 2WSSA 3HI6A 1OYVA 3LHKA 2GLUA 3T7CA 3DKPA 3KOYA 1G8PA 1VA5A 5TX7A 4GOND 4KQ1A 2DH6A 2FWIA 1ULZA 4RDXA 2Z9CA 3OX3A 2A0FA 3STHA 3ITKA 3W2TA 2CT8A 1G7CA 2PUWA 3HV0A 1NQUA 2C5EA 2ODPA 2YRXA 3JARB 1E6MA 1TCUA 1R8XA 2N1MA 1DPGA 2PKQO 3NOVA 3ZV3A 1OLSB 3DB1A 3QA9A 4KFRA 3N7TA 4CGYA 1W59A 4XPZA 4DCNA 2VDVE 1G8MA 1L8AA 5JAUA 2I78A 3M4ZA 3PR3A 1BN6A 3R75A 1CIJA 4YFVA 1M5TA 5C52B 2QN9A 1ZCAA 5AKIA 3DO8A 1L8XA 2IELA 3HDQA 2FXVA 2WT9A 2XITA 2HGSA 1QZ3A 3BREA 3GCDA 4OOFA 4BFSA 4CHTA 1VGVA 1TW2A 4NBLA 4P36A 4QREA 1ZU5A 1CFZA 4ND5A 2W6OA 2NZJA 5DYWA 1KYWA 2QV7A 4QNRA 1IB6A 3F97A 3C98A 3D0RA 1EFPB 4X8OA 1QC5A 1KSHA 5EPUA 5CA0F 1JPVA 3GLHE 1DKMA 2NG1A 2OL4A 3KDAA 4KXUA 1PQUA 5B12A 4OSPA 3O47A 1L7VC 4C4TA 3E1GA 3ZDFA 2AMLA 8ADHA 3MB5A 3KETA 5JNWA 3KHKA 3ABZA 4H7HA 4WQMA 4JHLA 5DTMA 3WYNA 1S1MA 4AULA 1D2MA 1FBNA 3DOIA 3H8JA 5G0SA 2F1IA 4HNUA 4CKBA 2PGLA 4QG3A 2BF4A 4BZZA 4Z86A 1QR6A 1T9BA 1OKKA 2VATA 1PWHA 3CJTA 1NP3A 4HTFB 5KX5F 5TDHA 2ZIXB 3T0IA 2J3JA 1GYQA 2JB9A 2RAVA 2ZM5A 4Q5IA 4G67A 2Z6QA 4YRFA 4JBNA 2OK7A 2BMJA 1RR6A 1K7XB 2VYND 3AIKA 3IVRA 2I34A 1JWAB 1Y37A 1KYTA 4I99A 1G5IA 1MX5A 3NGXA 4HKTA 1XZMA 2AEEA 5H0IA 4EY7A 1JFTA 4L51A 4BJ1A 1ZM4A 4A03A 1DJQA 3IP3A 1N6OA 4QM6A 4JI1B 3LUBA 3G0BA 2IOHA 3HCDA 3QFCA 4FMCB 1PJAA 1RQXA 3FTQA 3QU9A 2QBYB 2UXDB 2C00A 4CQMA 3WYEA 2XEXA 2PV0A 5FA5A 1BC5A 2HSDA 1PEYA 3GMSA 3VU0A 4EYGA 1I8TA 1IBRA 3AR6A 5LA6A 4BMVA 3HPQA 1TC1A 5KYWB 3EZ7A 4B6EA 3A1CA 3L8MA 2X22A 4ZO7A 4DA9A 2BMDA 3KOZA 3E2IA 1X9IA 1NQVA 3EG9B 2C54A 3QI7A 2O8CB 4M54A 2GZHA 1P1RA 1UPTA 4N0MA 5CAEA 2P9JA 2NUPA 1JB9A 5C1BA 2HXYA 3DTYA 4IZOA 1VL5A 1RCTE 3FNRA 3PHIA 3ZWNA 3MWEA 1WXDA 4NY1A 1Z0DA 5LL6P 5JARA 3V80A 1QRDA 3HP1A 3JZIA 4CLXA 2WKRA 5K0BA 3GUCA 3HUTA 3L4SO 3SJ7A 4QBHA 1PD1A 1LBSA 721PA 2YWXA 1YZYA 2Z2ZA 2QTHA 3DBIA 3T4PA 2XTZA 1D3AA 1V37A 3L06A 2HQ1A 1E3DA 4R84A 3TTSA 5TEWA 3GLFA 2IS2A 4GE0A 3SHFA 1QQ6A 3T9FA 4HFNA 2ID7A 3NNSA 4QOHA 3AMVA 4EG6A 1W9MA 2BRUA 4JYMA 5U9CA 4U02A 1TZCA 4LXQA 2GT1A 4P93A 2VNHA 5JNTA 1SURA 1NNI1 2R62A 5I5EA 4CM8A 2RGAA 3DWGA 3TCNA 1IJBA 1DC4A 2NU7B 2ZRBA 4LGMA 1E5DA 2I3BA 4L5AA 4XJXA 2A35A 2J6IA 1R5NA 1NBIA 1UQTA 3LKBA 4YCJA 1IY9A 2I4OA 4YI5A 3WNVA 1R6TA 2EFDB 2VKTA 1IHUA 3K09C 4AIRA 3QV1A 1G18A 3TQFA 4JI7B 2XH8A 3L7IA 2JFGA 3ECCA 3JQ7A 3OQIB 3QPAA 2WKWA 4XFDA 4YACA 4YCBA 3P0FA 1D2CA 2HYDA 3WNCA 4F38A 4ZDWA 3PQCA 2PZMA 2QN6A 2HT6A 4HDOB 3RI3A 2XRYA 4Y2VA 2ONKA 5KQGA 4NZMA 3ABQB 3FWPA 3KXKA 3ZYCA 1GGKA 1UXIA 1P5JA 4IIUA 3VZBA 4TX1A 1FNDA 3T7IA 5BORA 1RI5A 4B85A 1FDUA 3HXOA 4KN5A 1MB0A 1GN9A 1ZIXA 4F56A 2GZAA 1TK9A 2XNDA 4IHJB 4JB8A 1MC1A 2IDMA 1AHHA 3K5PA 4GLBA 2VP5A 3SX4A 1Y1KE 4DG8A 3UH0A 3IELA 5CLJA 3HO1A 4JLOA 1G21B 2HF8A 3AEXA 1ZR2A 1QK4A 3HKDB 3WLJA 1LF5A 1CS0B 3KT3A 1M2VB 4LVCA 2W8BA 1M1YE 3E0XA 3RJZA 1JHUA 3I1FA 4XM2A 1REQA 1SM4A 2FSIA 2OSVA 4C3VA 2C2ZA 1U2GA 5DGTA 1EG7A 2ZBPA 4PGGA 1RLIA 2GYUA 3V8EA 4MA0A 2WJ4A 2ZI3A 3EIHA 3I42A 4FW9A 4RMIA 1P6XA 4BKRA 1N6IA 3I83A 4X20B 4BVBA 3GPLA 4FHCA 4HQFA 1UP6A 2PRSA 3RBAA 3IP6A 5FPYA 1Z5GA 5FCDA 4WDQA 3E27A 4D79A 2ZJYA 2D1SA 3NONA 1XMPA 4YDSA 3ELDA 2Z5GA 4TL6A 5EYPB 4DSAA 1XB2A 3UWOA 5CVEA 1JDPA 3R4CA 4QOIA 1EI9A 1BDMA 1CDZA 3MOSA 5K8VA 3VAAA 2GBFA 2IS6A 3KPYA 3BA1A 4OHRA 1KY5A 1AKRA 4ZMRA 1XUOA 2OYSA 4PFSA 3I73A 4MW6A 3PA6A 5ILGA 3ND7A 4L95C 1ZW6A 3PHCA 4H18A 4KR0A 3DYBA 1WTAA 3ISTA 4UEOA 4E4RA 3EIWA 5C8YB 3QTLA 2ZR7A 5ENDA 2ZBDA 4TLDA 3GAFA 4HGRA 1C50A 1JG3A 2QU8A 3C3XA 5BPHA 2D2IA 4JEIA 4Q4JB 2UUAB 4EWLA 2UVPB 3IUBA 3HS3A 2KSQA 2HCFA 3NHJA 2QRVB 3GEIA 4BQFA 4DB2A 1WF6A 1XZKA 2NMVA 1H2ZA 5JSUA 4WKGA 4DCCA 2PUEA 3I2YX 2LZ0A 1RVDA 1XQYA 1I2MA 1YBMA 2OO7A 3EXIA 3GGDA 4MVWA 4OLFA 1JX6A 4D82A 6ABPA 2GLXA 3CZAA 3PNVA 4KIFA 4TL8A 3TZKA 1ZM2A 1ZX1A 5CPBA 5IANA 3EIOA 4WBNA 4WV3A 1IBKB 1CUIA 3DO6A 5H9VA 1U5BB 5BYKA 1ZI8A 4R1OA 3QYJA 4CV0A 5B1DA 3CCBA 1Y6JA 4UM5A 4AWAA 5LLTA 4OQLA 2VHCA 2BFOA 1E1LA 2H5EA 5BY2A 1J5XA 1YE3A 5E6RA 1J2YA 1U90A 1OX4B 2ZKIA 4EYOA 3TF5A 2CV1A 2PTGA 4PZEA 2AXQA 2RGWA 1C7ZA 3DLAA 3VDRA 3FHJA 2E49A 5I8WA 2KE5A 1AGRA 2EJBA 5KYVA 1JAYA 3FB1A 1R6UA 3A6DA 2ECKA 3IQEA 5A2GA 1XDWA 1NUAA 1Y8RB 2FDRA 2PJZA 4XD2A 3KJGA 2RAFA 3VYRB 3FRJA 1MLDA 4AZ3A 3DMNA 3F5MA 4X5OA 5K0NA 4BZWA 2FUKA 4S2UA 4PQRA 5JDCA 3I5XA 3JWHA 4Z0TA 1GPDG 3GVCA 1EP9A 4GKAA 4JDUA 1UK6A 1YASA 4QBGB 3O38A 2ODAA 2CHUA 3D4BA 1T13A 3KYDB 1D0VA 2HIHA 2PSDA 3OMXA 1YZTA 3L8CA 5E0KB 4CI0B 4YFYA 4DCSA 1PKEA 2X4DA 4KQJA 4DWVA 3NI2A 3UJ8A 4DYHA 2F3RA 5E4YA 5AUQA 3H1TA 2NU8A 4W9NA 1M1UA 4NBKA 3X1YA 2AFIE 3IOBA 4V0LA 3M5DA 4AMGA 2O19A 3ORYA 5FNVF 2Q4BA 3UAZA 5DX1A 3QE0A 4TTIA 5FHQA 1MDFA 3CY6A 1TK3A 4R2LA 2XB6A 1IAVA 2V6GA 1D04A 1RRKA 1WB5A 1EK5A 3M9LA 2Q9AA 4NYMR 1KMHB 3VR4D 4RVUA 2PRJA 1WRBA 3SHQA 4MWZA 1AU9A 1VP3A 4XYGA 2PKYX 3KV3O 4REOA 5MF6A 5CEEA 2HWKA 2LWIA 3CLSD 3FR7A 4P34A 3W2GA 1GNPA 1SFRA 3PCRB 4NFHA 1FJHA 3Q3IA 3TRDA 1L7PA 4KITB 1GGNA 4KLAA 1CUYA 1WE2A 5HF9A 3TW6A 4AD8A 1W9HA 4AO8A 2R1VA 2BSAA 2YXBA 4BNKA 4CEJA 1RWKA 3O3NB 3DOFA 4FE3A 4JASB 2IS1A 2BMAA 5T4BA 1YQUA 2WU4A 1KVUA 4OGKA 3UKDA 5DNVA 2QPAA 4FOOA 3RRFA 3I62A 2J30A 3G2QA 1KC1A 3I72A 2Q6IA 3RVDA 1OGJA 1ICIA 2GPTA 2ZRNA 3D5QA 1WEHA 2AGVA 2AG0A 1C9NA 3AIOA 2AN3A 2BFEB 3RS5A 4Q7QA 2IUUA 1QCCA 3P96A 4CTJA 2A0YA 3KSMA 2P35A 2IH2A 4E4YA 1IBLB 1RIIA 3G2HA 5PGMA 3G2PA 2LCQA 3UCEA 3EMKA 4JI4B 3MWLA 3V4PB 1NJ1A 3GJYA 4YJ2B 6ADHA 1XD2B 3RU7A 2VHQA 3CLUC 3OQ1A 4JU8A 5DHRA 1XN4A 4HDMA 3JD2A 4Y2GA 3VXKA 4BO8A 1DMSA 5JJBA 2O5EA 1VMEA 4BGIA 1NOJA 4B46A 1NW5A 2ZI9A 1EFVB 1ZDMA 2JCYA 4F12A 2LW7A 4FQ5A 1E1QA 1XV5A 2FWPA 3VTFA 5HTKA 5HOQA 3K0AA 2AJBA 4RS3A 1WZNA 2PMCA 5E2IA 2PVPA 5BWOA 2CNOA 2QZ9A 2BFDA 3VPAA 2VUTA 3DFKA 2NV0A 4JB3A 2HQOA 1K5HA 1DHTA 3QVUA 4X3PA 4DPLA 2OZLB 1BE8A 3GEGA 3OTOB 1WHSA 3AESA 3G9XA 5BUZA 2JBAB 3DCIA 4JC8A 2VHTA 4MKRA 1J09A 2ALJA 3ED5A 3ZW8A 5AJTA 5HRAA 4U00A 4MGZR 3DCJA 1QKIA 3KHSA 3IOCA 4KUHA 1G6KA 3ZN2A 4ZKDA 3AUSA 1U11A 1GPJA 2FSVA 1D2NA 2XMGA 3ZGVA 1VLQA 2QOEA 4RJTA 4EATA 1Q22A 2XEDA 1TM4E 1I7SB 2JFWA 3REFA 4AF8A 2CMDA 2OMEA 2VCEA 4XVCA 4RKQA 2Z95A 1ZMOA 4AYTA 2PNFA 4P86A 3OC6A 3UWKA 2AKEA 4DA6A 1NF9A 2HFKA 1HX7A 2VHXA 3LIIA 5TGZA 2FSUA 3P2EA 3VMFA 1PJSA 2O1EA 5DTQA 1IQRA 1NIPA 3EN0A 3EGWA 5FBKA 4KXLA 2XMCA 1LTHR 3A4TA 3LPDA 2XMBA 1Y48E 4X7RA 3QPUA 4I50A 4X7PA 4LPSA 3LTEA 2HDHA 4EA9A 1FDVA 3R24A 2YQ4A 5IRCD 3LVRE 3GJ7A 1TKCA 1H4QA 4IJVA 3IR7A 1G3RA 1JH8A 4AJPA 3HEBA 4CL3A 1Y34E 1WBJB 2UV8A 3DHYA 1WF3A 4F45A 1JJAA 1SZCA 4EHAA 1JPJA 2LCFA 2KHZA 4Z3DA 1M2WA 3AFMA 3LC2O 4K46A 3LUDA 4Z9YA 3R3VA 5E6SA 1JDVA 1Y98A 1X6VA 4KI7A 3T1VA 1NSTA 3WL3A 3QMVA 4J1SA 3ZLTA 2C5LA 1I4OA 2XCTB 4ZJPA 4ENSA 1QFZA 4LUCA 4NBSA 3IT1A 4QUAA 3I5MA 2PR2A 1U3CA 4HC4A 4MMXB 4PYOA 3A3KA 5BO5A 3D7KA 2PX2A 4IR7A 1A7KA 1DC3A 1H1TA 2AR7A 4IGIA 3SYTA 2FW6A 1GARA 3NTXA 4FFRA 4RE5A 1U9IA 1KIFA 3KQSA 5AVTA 1D2EA 3MGBA 1JT9A 1IK6A 4IGEA 1O4WA 4JITA 2D62A 1R6XA 4J0CA 2AB0A 4KWIA 4L6IA 3ZWPA 2QR5A 4X1IA 1E3WA 3CH7A 3HJUA 2RGNC 1YA6A 1D09A 2J41A 4GZ6A 4H7KA 3IV7A 4QEDA 2HMSA 4DLXA 5K0TA 3JQ8B 1F3OA 4C3OB 2G83A 4Q9LA 2VO1A 2I2DA 4PSUA 4HDSA 1XZQA 3NXSA 3V46A 4OI0A 3RC1A 2OHFA 5JAOA 1OT5A 3DHVA 1EWRA 3J81A 3NS7A 2BJWA 2QTCA 1CEEA 1K7SN 1YTLA 3AF0A 3ZCRA 4M0PA 3N0XA 1ICEA 4XEHA 1YU9A 5CD9A 1A88A 5LSAA 1GGMA 1ZOOA 1LNQA 3OICA 2NVWA 4XTRA 2FH5B 2JIZD 3R7SA 3BT7A 4D0SA 4M6WA 1QGDA 2ZWAA 3EGIA 5JNRA 2ZIEA 1FYXA 1HQYE 2HF7A 2YMPA 1P4AA 2GPNA 2Z4SA 5EE1A 2A4MA 1RDFA 1RM0A 3L7NA 5EXXA 4UU7A 3R41A 1NZFA 2ODEA 2ZRPA 3ENKA 3KZVA 4OUDB 2F8MA 4MHSA 5ALYA 4R9UC 5LQSA 5ICCA 3EPLA 3ZLBA 4B73A 1P0CA 2HK7A 2XI4A 3W2EA 2E9SA 1S3GA 4DBLE 3HKEB 4Z7JA 3MJDA 2M1XA 5JYBA 4HAWA 4Y2UA 1Y1TA 3KD3A 4A8HA 2WFZA 3SSAA 4YR7A 1Y9EA 2VPQA 4IEIA 2VK4A 4BC0A 1L5QA 4KPYA 3LMKA 1W2WB 2QPTA 4W6QA 3I2KA 3QWBA 4EUHA 1K2WA 3LDAA 4NLLA 1SD1A 3PUYA 5K6TA 1ESMA 1AHIA 3B70A 3KKKA 1CETA 1Z0UA 2K6GA 1NJ5A 4CCYA 1I14A 4PC7A 4QHTA 3TLEA 3ZNPA 3LL4A 1OY1A 4A1FA 3I8XA 4Q39A 5DLEA 3SSNA 3DPUA 3IPXA 1X1RA 3EBPA 4K40A 5CCDA 3VZQA 2WA1A 2RI0A 3CEAA 1MD9A 3IIIA 1BD3A 2ORIA 3OZGA 3THWB 1QIEA 2VI5A 3ACBA 3RWBA 2O2XA 4Z49A 2OEPA 1QE5A 1AKMA 1ECFA 2P5YA 3BILA 3EEFA 1QO0A 2P2LA 3PL1A 5AO9A 1O6ZA 2FZVA 5GZ6A 2O2SA 2XBLA 3OOJA 3WYBA 4ASUD 3A32A 4CMKA 3NDJA 5C3UA 2VZ9A 1K5PA 1CG6A 3UMBA 5EKUA 4QOSA 4W7HA 3WKBA 1XCJA 1A1SA 4B40A 3IT0A 4RVOA 2VQDA 4GVLA 2CV2A 3W7BA 1QJ4A 1QIIA 4J0GA 1OI3A 2JKYA 4M4SA 4LZPA 2OK8A 1PR6A 2W5UA 1EJ6A 3E1SA 3E5NA 4MUYA 1ZD9A 5L3SB 5LFAA 4DJDC 3P8ZA 2ZJ5A 4OHYA 2NO1A 4FX5A 2YVLA 4DCUA 4YMGA 1PYDA 1FSSA 3PPXA 4ECAA 3UBTA 1VIAA 3KAJA 3Q85A 4I55A 3DSRA 4C04A 1KI7A 5HX7A 1NNUA 1G59A 3UKJA 1QVWA 2GERA 4JU9A 5LDDC 2GZDA 3GDHA 3H5OA 2AJTA 3LLUA 1S7GA 1WNTA 3NNDA 3OFND 4OQZA 1O58A 2IPMA 2C2WA 4Y0NA 3RUCA 2BAGA 3PIIA 2Q7DA 1AA6A 2H7VA 5K9ZA 4TV9B 4RV4A 1NZJA 4RZUA 4MR9A 2B5WA 1KS9A 1YK0A 4QYMA 1QGAA 2A0WA 1BDBA 1QV6A 3SZMA 1G4HA 4MUBA 3MN1A 1YJQA 4BMZA 5CFMA 4CJXA 1A3CA 3MINB 1N4AA 3B1ZA 1C2YA 1Z0IA 3RFXA 2GCOA 2Q0HA 4KPUA 4PTZA 2PX3A 1RS0A 3FW1A 1HQCA 4MI3A 5JCJA 1C3OA 2JHPA 1SQSA 1FNMA 1XZAA 5ITSA 1EJBA 3M1YA 1L5RA 2WWTA 3BYZA 3MYYA 3IVXA 4TT3D 4FMCF 1UQRA 5BT8A 2WQ6A 2J0VA 5EEHA 4EZBA 1L4UA 4CNQA 4ZHQA 2R6AA 4MRAA 4PVDA 2ZJ0A 4OA8A 5DW3A 4AMYA 4ZOAA 2R751 1YNSA 1ZRNA 2BGMA 3WGMA 2PH7A 1O96A 3IQZA 3OESA 621PA 3DBOB 5IXYA 1QX4A 4D46A 3CONA 1SHKA 1Z12A 4EPWA 1TEZA 4GPZA 2PBLA 1FFWA 2DWCA 2FGJA 3OEYA 4DLNA 3TFQA 1MVNA 3BIWA 1A9RA 2J46A 1DGQA 2DB3A 4R2WA 5LIRA 3CVVA 3M0EA 3O9MA 2IP2A 5G3ZA 5DYGA 4I4IA 2RJOA 1V1RB 1XZNA 3CX4A 3OP4A 1UZNA 1WXEA 2PLFA 3TVTA 1UM9B 3AVYA 2QTAA 4YAWA 1H6CA 2QS9A 3I37X 1DJPA 3TW4A 3I01A 3BD7A 4GI1A 4ZVQA 5FXMA 3FCUB 2JAWA 4AO7A 2X8JA 1ZIPA 2Y0DA 5ALRA 3TG2A 3GRZA 3HGMA 5CP8A 5AKZA 3EAFA 5F77A 2YVAA 4RIEA 1S3SA 5GP1A 1H2RS 5C8ZA 5D00A 1L7RA 4ZTZB 4Y6RA 4P83A 3DE6X 5CBPA 1MKYA 4LYAA 1VCMA 3NIFB 3E9ZA 3WMRA 1T2NA 2VT2A 1ZNXA 5HKAA 1HFWA 5BR1A 1ZHFA 1GL9B 2BGIA 3AEQB 2R1UA 3ODPA 4PNHA 5JTTA 3N0TA 4OMDA 5F9MA 1K7EB 5KSZA 1YDMA 3ZU4A 3AF6A 4TRNA 3BSFA 1D6NA 3D7RA 5DFAA 1TJYA 1ZVJA 5KNDD 1N32B 3EMVA 1AMUA 4YIHA 3EISA 4N03A 3NM5A 1YJXA 5JLAA 5CDSA 4WPGA 1UBCA 1KVRA 1QHIA 4N9WA 3LSYA 1H6BA 2YFYA 4C01A 3K73O 5LNK1 2V6BA 4ZAYA 1NMYA 1SQ0A 4LOLA 4C1BA 2ZCUA 1P72A 4NYJR 4QHYA 4DSTA 5AOCA 4UAVA 3WA7A 2OG1A 1UBGA 1YOVA 4PIPA 1A9QA 4GRIA 6REQB 4PPYA 1K86A 2FWNA 2WINI 1SKBA 2F43A 2R5FA 1ULSA 4JLWA 4JR2A 2VJPA 4IDCA 1M2KA 2PBZA 2ZYDA 5JXIA 3BRQA 2PZ8A 1ADGA 1ONNA 4IHJF 4DDKA 4MARA 4V1CB 2GCPA 2V7UA 3BHMA 3FPHA 1I2BA 3H7AA 3MUNA 4FEGA 4AS2A 3OOEA 2QUAA 2G17A 3MMNA 1E4EB 1WBBA 4P7GA 2ZBQA 3PEYA 1WCXA 4KQ9A 4C3ZA 4F6CA 1Z0KA 4CR6A 1Y6RA 2BV3A 2QD5A 2HRBA 3NOXA 5GGXA 3L6EA 3O6VA 3A6PC 5DWDA 1N2CB 3LWNA 4I9NA 3TSCA 2PWZA 2WJZB 3U26A 2PO7A 3FBGA 4WUVA 1M66A 1ZINA 2J3IA 3I32A 1HR0B 4OQYA 1T6XA 3S7TA 4XUEA 1IVYA 2QHXA 2AYXA 2VQ6A 2WVJA 3C3EA 4MPJA 4ZDJA 1BDHA 1SXJE 2ZQYA 1I1QB 2P62A 2PQ2A 3QOYA 1OC4A 4A92A 8ATCA 3HU5A 3OWHA 4G65A 3DCYA 4FFDA 4H17A 3LOUA 4RC9A 3ROTA 2BCGY 3JSXA 3QUAA 4YQEA 1JQDA 1Q20A 1X3LA 4MVJH 1DXHA 2B25A 4DUPA 3Q7SA 3TMAA 3EVBA 2QM8A 3ZTYA 4FCWA 5C8YF 1GT6A 4UBKA 1MHTA 2FCAA 4HG2A 2WUGA 4XCQA 5KOHB 2CW5A 4LNUA 1ZCBA 1IHOA 3FR8A 3TXAA 3UC5A 1MH1A 5J5CA 4A5SA 2MMCA 3G5LA 4GNRA 2OB2A 4PINA 1MAVA 3R7BA 3NHKA 4ZC1A 2CHQA 4YREA 4MW9A 1QR2A 1SCNE 3NUGA 2CFIA 5FTJA 4UPDA 1EWKA 1RQNA 1LXCA 3DMDA 1MOQA 2DEUA 1Y42X 3N07A 3NRBA 3DC2A 4B6OA 4IIJB 1TRKA 1GG9A 3D8UA 3NAZA 4FHZA 5F12A 3OLWA 1QQBA 2W4MA 4JJAA 1P91A 1BXKA 1G8KA 5H02A 4HFJA 4ETIA 4U2BA 1P9NA 2EJCA 4QYIA 5J3JA 4DJFC 4A36A 2TMDA 5C1IA 4E2YA 2Z08A 4GMFA 5CA1B 1VZ3A 1DEAA 3KKZA 1NFQA 2ATIA 3UT0A 3ISVA 1DEOA 1M1XB 2LNDA 4AX8A 1BXRA 2WKSA 2P7HA 2HRQA 3GGGA 1KAEA 2YC2C 3BWEA 2VOEA 5D7BA 1HY3A 1R66A 3FLAA 4HAVA 2PZEA 2VFAA 5G4KB 3NHSA 3S2YA 4ZMSA 5A06A 5KHOC 3CVOA 1GCGA 1M34A 4HJXA 3OD5A 1S1CA 4O2AA 3OY2A 3MS7A 5ALKA 1ZK2A 4C22A 3WP0A 4FEYA 4ARUA 4DIBA 4EG5A 2VNKA 2YWCA 4XIIA 4FFVA 2B8EA 2OUIA 4O2BA 3WICA 4JP5A 4RVFA 3SQXA 3CVXA 1SC3A 2B1JA 3R40A 4OJKA 4ZPXA 1ESEA 2WD7B 1IEWA 4I19A 1TJ5A 1OSNA 5JD3A 1KEUA 2PRIA 1YBHA 4P82A 5DHFA 2PH1A 4EPRA 1KQOA 3GX1A 4TUYA 1HYBA 3EGEA 4BWFB 1L7EA 2AQHA 1K6XA 3TI7A 3DDHA 3TAHA 3DZJA 1E9DA 3MWFA 3C3PA 4Q21A 1EUCB 5HMMA 1Z18A 3ZD9A 1NDHA 2GAIA 4LHXA 4MRVA 2UKDA 2XUFA 5K51A 2H11A 2A84A 3DHEA 4LV6A 4TMVA 5GPBA 3RK4A 1BFUA 2E18A 1CNMA 3QELB 2VEDA 1A4UA 4K9DA 1SHUX 3I2HA 1RWBA 3FTFA 5K0JA 1UBOS 4XTCS 4EZEA 5CDYA 2OB1A 1RAIA 4F3NA 4RHFA 1JEAA 4HQ6A 4WXYB 3T3HA 3MT8A 1L7XA 2VP0A 3NVDA 3REOA 1ELOA 3HDTA 3MAGA 1HPLA 1JIJA 3K1TA 5FBVB 2ZB2A 4AP6A 1MT0A 1IM8A 1JEDA 1HXHA 2PMDA 1Y8QB 3PC2A 4LQCA 3WXMA 1UPFA 4V3BA 4CT0A 2P9BA 4DA0A 3TBHA 5LDHA 4H7EA 3TX2A 4BBAA 5AVKA 5BR8B 5FR1A 1X7DA 2YXLA 2WM8A 1C1DA 2BRUC 2JIBA 3KSRA 4L72A 3TNYA 4M9XA 1AQUA 3TL3A 2IEDA 4NOMA 2I33A 1TD1A 4Q16A 4QLBA 3T6KA 1J21A 3B9PA 1S96A 3PBKA 3QKIA 1HFEL 1GNRA 5DJ5A 1V47A 1T35A 1EFRD 3MRVA 4RH1A 3P2KA 4KL8S 1BU8A 2ZTUA 4E33A 3UMFA 3MUEA 3CIOA 4Q9JA 5CT5A 4B31A 5ALTA 2YJZA 4JT8A 4TV8A 2ROQA 3BEOA 2JZCA 2GF9A 3AM3A 4ITVA 3W5SA 2BTQA 3RSCA 4X91A 3VPGA 4DR3B 3OTIA 3S8MA 3O3MB 4H7DA 2M6LA 5AHRA 1ZD1A 4RGBA 5C18A 1E2HA 1U99A 3BXFA 3WGUA 1WV0A 5B58C 4CLDA 2NP6A 2GJ4A 2W11A 4KUGA 1PWEA 4G37A 4C7VA 2HRRA 1O87A 5FUBA 4DUYB 4XKJA 5JLJA 3RU2A 4TKUB 2PMKA 1XWWA 1I9CA 3ZX4A 2AH5A 3C4VA 4QJ5A 1H9BA 3KNZA 1P1CA 3MT0A 1WDMA 3E18A 4OHFA 5FBRB 3ED1A 3RQIA 3QNWA 3CVWA 4XX1A 4CU2A 5L51A 2R8YA 1AUXA 2DUNA 2FEPA 1U2GC 3B8HA 5LB2A 4WCFA 3P9IA 2IUSA 4NJEA 4QOEA 5THXA 2R11A 4G26A 5DP1A 2VAPA 1BMTA 3T99A 4QZVA 1MW8X 3KKLA 4OB6A 2X9NA 1HTWA 3PGLA 3H9JA 2E3JA 5C4GB 1EINA 1M1YB 3TD6A 1WCIB 2ZTHA 3QKSB 3ZDCA 2AJLI 2E4YA 3HJRA 3ICOA 3CZ5A 2VAWA 2ZRCA 5DH9A 5IKPA 4FUQA 2BKEA 3P9PA 1N9GB 3N8DA 2NADA 2G4VA 2CJPA 2GBCA 3H42B 3DAGA 5LKAA 2IY9A 2CLCX 3Q9LA 1SK8A 4Q24A 3WXBA 2PGDA 4I1UA 4FJ2A 3D2LA 4XGQA 3RVNA 3QFSA 1ZD4A 4FC7A 4RK0A 1JR3A 1QRRA 4MVJE 1GP2A 1XAHA 3ZI4A 3L7BA 1FA9A 4UFOA 5TVGA 2JJMA 2V7VA 2ZS9A 1OU0A 4LCBA 4GDFA 1WVIA 3DEAA 4P2BA 1NUHA 3H2JA 4EYQA 5I8ZA 3UK0A 3DXFA 3EZ6A 2FZWA 1FQKA 1FNSA 2PEZA 5A4MS 2XUJA 3GVXA 1RI4A 4G2TA 5IK2A 2ZSIA 5AVJA 1GKKA 2BZ0A 2FN8A 4R2MA 4FDVA 5AI9A 3KQHA 4WN3A 1B23P 3OUZA 1VKOA 5SYMA 1XMJA 5DCWA 3CT4A 2E85A 3EC2A 4IDOA 1XALA 4CYMA 4XWKA 1ZWKA 3JD3A 2OILA 4D02A 1G1AA 4I36A 2ATCA 4N0DA 1TCBA 1HDXA 1HNZB 2VHVA 3O92A 3BWVA 3V55A 3KYCB 1RHQA 4QXPA 4LJ6A 4REQB 4DDUA 5LXTB 3ER9A 2GK7A 4D0LB 1M8PA 2RHCA 2MINA 1VGQA 1XU4A 4MH0R 5C0OE 5HP4A 5TS2A 2PBFA 1PDWA 1DKPA 2MSWA 2P3SA 4S0XA 3ZE6A 3Q6NA 3BWYA 3ZCTA 4JQZA 1ZAKA 1SBQA 3BZUA 3VMMA 4D0NA 4YAGA 2ENUA 3T7SA 3T3MB 5I7UA 2CUNA 3T3PB 2Q4OA 5C8VA 1H05A 3U7RA 3FLEA 3JV7A 2C9DA 2HSZA 2FWRA 3G2IA 3L7MA 5DMXA 3LWDA 4BIMA 4ER0A 4J9UE 2NO9A 1ODJA 4Q34A 5JDCC 2YDXA 3GNQA 1I2AA 2ENWA 1SVWA 2EWWA 2VDWA 4DEVA 4MI6A 4BFCA 1NR7A 4CM6A 4LOIA 1S3FA 4PPGA 1UZAA 2A86A 4KVAA 5TB5A 5I7VA 2Y76A 2J33A 1JG4A 1OHHD 5JWHA 9ATCA 4DIKA 3H9UA 1Y5RA 4MYSA 4WLNA 3RIEA 2DPLA 2C7RA 1I4DD 1XMSA 4QDKA 4HYQA 4R1SA 3PFWO 1WUYA 4W9NC 5DNWA 5FUYA 2FQWA 1HEIA 1NURA 3HBJA 5IM5A 1MR3F 1N0UA 2X23A 2Q3FA 4R16A 3W3AA 5JNVA 2PUAA 5T41A 2C2OA 5DK6A 4AROA 5JALA 1EUDA 5HKBA 2ZZKA 3C3DA 3USCS 1FRZA 2YXEA 3BQNB 4RH3A 4U63A 5H3CA 2H4XA 3I45A 1V3UA 4M88A 1SOAA 4Q6BA 4R6WA 4RF3A 1VIDA 5DCYA 4CKWB 3ZK7A 1VC2A 4BFTA 2AFIB 4U0JA 1G9SA 3TL2A 4Z8XA 5FA6A 5ECYA 4UFNA 3FNGA 2WLTA 2AOTB 1H66A 3WIUA 1TNDA 1Z9BA 1SOUA 4B4WA 1IDN1 1NTRA 2B99A 2KI5A 3DTVA 3LYAA 5F1OA 3ZGOA 1E1KA 3IKVA 1GZSA 1UEXC 1Z06A 2FFRA 3I34X 3R3SA 3BE6A 2OZPA 3A36A 4LDJA 3IH5A 3W5VA 4ALMA 1BWRA 1U9JA 1W34A 1C0IA 4E5NA 4DYDA 2YXNA 3LQ1A 4BQRA 4L4SA 4YRPA 4CMHA 3QE9Y 4MR7B 3F96A 1CZKA 3OCUA 1LDEA 1JXMA 1K7CA 2PXAA 2Z43A 2OCAA 1G64A 2IDZA 3QIVA 1ISFA 1VIYA 3LRPA 1U3WA 1QWSA 2ECOA 3WIBA 5JAPA 1Y3AA 1EE2A 1JKJA 2JI6A 2OO5A 4KBFA 4OQFA 5A9SA 2W2OA 1WOMA 3EVTA 1SIUA 3HBAA 5ALHA 3PUJA 2PUTA 3SQLA 3M3PA 1KJYA 3TD2A 1O8CA 3TSOA 1N0WA 1PU2A 2YV3A 3T06B 5BSRA 1U2SA 3FAKA 3KS9A 4NPAA 4NZZA 4R1NA 3A7DA 4MB6A 1CY8A 3P52A 2Q8QA 3NBFA 4RHTA 4YS6A 1G2OA 4B43A 5D85A 4YH1A 1TVEA 3R74A 3VPFA 4DRXB 2ZAYA 3CO0S 1E6CA 2Q50A 3BD9A 2CLFB 4E30A 1DUIA 1W36C 3CZPA 3RADC 1XMQB 2GDJA 1N2BA 1W73A 3RF6A 4EW2A 1EVLA 3MC1A 5TC4A 5IYZB 4D3SA 1DRJA 2YNMA 1X14A 2V97A 3ENWA 4MUAA 1WNFA 1XEFA 3VR6D 1KFBB 3WRVA 2PYZA 5A4IS 2ASVA 3KR9A 5I3CA 5JOQA 3DOUA 1BWQA 2IEZA 2WYVA 2VYVA 4WCVA 2F55A 4YT2A 3KR2A 4AUEA 4ZYXA 2FSVC 1PT6A 2JFOA 1XXLA 3AY3A 1EWVA 1I9GA 4N7JA 1PFKA 1N2ZA 5L7YA 1JQ3A 1HDCA 3CIFA 4QM7A 4GMHA 3T95A 1KEEB 5HCUA 4B48A 1KP2A 2OD7A 5TPWA 5D6NA 3EOZA 3PLAE 1KBQA 3LLSA 1M6HA 2X0KA 4JXKA 5E9WA 3DMHA 2EHDA 5BQXA 2Z8XA 3FNIA 2CUKA 4FI3C 1SBYA 3IRUA 4D4KA 5DM70 3G17A 4ZCTA 1ZC3A 2A8YA 3LS2A 3P7MA 3K32A 1PQPA 2X4LA 4MRMA 2ONJA 2HO5A 1SC9A 1SU7A 1XYGA 1KH2A 4PHGA 1KJNA 5C35A 5GZ3A 2UZIR 2XUIA 2Q5HA 3ANYB 4CIDA 1AUQA 4J3FA 4TWJA 3ROPA 4GVPA 4JSYA 5AVWA 1ESDA 1GKUB 2Y4NA 5KTRA 5D51S 1RWQA 2WBLC 5I9SA 3EZLA 3LWZA 3T5GA 4E7OA 4XPIB 3DTTA 4PR0A 5BPFA 3VDMA 1XG5A 1W2HA 3QX9A 1FP6A 2DHEA 4PWZA 1XHLA 3VI4B 3GJSA 2BFCA 3M49A 3ZBPA 1A76A 5HF8A 1RQRA 1ZZGA 4FFPA 4LXTA 2Z56A 1K0UA 2PEYA 1KQ3A 2ID8A 2ZYRA 2XOXA 3HFJA 3RTGA 2G28A 2NZWA 3Q9UA 4IIHA 5L3QA 3WAJA 1D1PA 4UUAA 2BBWA 2FRVA 3BSWA 2UUBB 4NXNB 4B75A 1JL3A 4CL2A 3R8FA 3VNUA 2DGDA 2FPIA 4K9PA 3H8WA 4REMA 4G0ZA 4B6QA 3KQYA 4NQZA 4ZPJA 4KQIA 4FYJA 1HDRA 1T0BA 1P0IA 1QAOA 2QTGA 3KVVA 4L9WA 2EWVA 3OQMA 3EVEA 2DKOA 1AZWA 3KUUA 5BQOA 1MEEA 3CPSA 1T25A 3D8RA 2J9RA 3EIUA 3L8DA 1O9GA 4L5IA 3LPNA 4G3XA 3WKDA 1U9IC 3AR8A 1K6JA 2JJ1A 2D7CA 3EXFA 4J6EA 4NZ9A 2A92A 4JP1A 4WX2B 1TM7E 4KTTE 4B6JA 4Y9SA 4E5VA 3HC7A 3GGSA 3OT4A 4ISBA 5I9TA 2PL5A 3UGQA 5LMUB 2BHSA 3X1DA 3E9YA 4Q7MB 2TS1A 1ZM3A 3VU9A 4YAUA 4KO4S 4TTRA 4YCMA 2JVKA 4X95A 3IV9A 3FUTA 5FUXA 4YDRA 1R1DA 3E8XA 1S89A 5DPMA 4UBJA 3GFFA 1BRTA 4QOJA 2J4FA 3MOIA 1J0AA 4X97A 1I3MA 3ELUA 1E92A 3OEED 1RTKA 5FPQA 4TZKA 1HZZA 3WGNA 1NKSA 3LSTA 2HRZA 1J0XO 3D43A 5ESWA 3ZDXB 3HU3A 5HQ3B 1MGPA 1STOA 3QQPA 4XDZA 3L8FA 3R5HA 4TLAA 4NCNA 1V11A 1L3IA 2GN2A 3PQEA 3UVEA 1QHGA 1Z2EA 4Y2TA 4TL9A 3TFWA 1TZJA 2AN4A 2WJHA 1DEHA 3FYUB 3T5CA 2WJGA 4E0BA 3LF1A 3AKDA 5IABA 3O1JC 3TXYA 1RYYA 4EI8A 3VV2A 2HPHA 4QU0A 1KJ8A 5E38A 5KVAA 1ZBDA 3CB2A 3PGA1 3SK0A 1RU3A 3R3XA 1FTNA 3NVKI 2XCOA 3ILXA 4UW9A 2WJPA 3AK4A 2BYTA 3NEPX 4KRGA 1SB8A 3WYGA 2ZUWA 5ICMA 5JQGB 3JRWA 3EQ6A 3EVDA 3NQ41 2JA2A 2JVJA 2AYZA 3FLBA 2H1FA 3B20A 3OJLA 4UUBA 3WB2A 1E2BA 4A16A 3MLBA 1PTJA 1PFWA 2C4NA 3F4LA 1GL7A 1KK3A 4FDUA 4ECEA 1NZDA 3Q6MA 3PWZA 3LHDA 4GSLA 1COWD 3B5IA 1RHUA 2O7SA 3CCCA 5FAXA 1SCJA 1IHXA 1W4ZA 5HWSA 2J3EA 3SN6A 2VYNA 1YHYA 3REGA 1O0BA 1PJCA 1Y3FE 3Q3VA 2Y1WA 5BMOA 4KNYA 1ZD2P 4IFEA 4WBXC 1GKYA 1M2OB 2ZYSA 1AMOA 2JA1A 2MR6A 2UYOA 5F51A 4BB9A 4QTZA 1E7YA 2I7VA 4PG5A 3T5TA 1Z8NA 2BR5A 3GOQA 3AFOA 3GZNA 4A6EA 1ZGAA 2UVDA 4QBKA 4XEUA 1JZTA 3FBWA 4RPCA 3V1KA 1RAGA 4AW9A 5IC4A 1A5BB 1I6KA 1MVLA 1IXRC 1DKOA 2HV9A 4G89A 4ACAA 3ZUGA 1BGXT 3X1MA 2GEVA 5D1HA 1A98A 3QH4A 1LSUA 4YCCA 2FMXA 4N41A 1W93A 4KSCA 1JDSA 4NMXB 2WF7A 5IBCA 5EKTA 1MJGA 4XLTA 4Z99A 1IEVA 1FU8A 1II9A 3EA5A 3DZFA 3EWSA 3EYAA 1YIDA 2H5LA 2VUUA 4L07A 2J59A 3NJ4A 3P2OA 4M36A 3VU3A 2L82A 3DV0B 2LIPA 4UEJA 2COKA 4P7BA 5KAMA 3U5TA 2XOKD 4DMMA 4RMJA 1FFYA 5CA1F 1TT7A 3DO5A 3PD1A 1WCYA 3RRNA 2IYAA 4MYHA 3T9EA 1Y8ZA 3FYHA 3WRWA 4ESOA 4G0OA 1T2FA 3DAPA 3IP9A 4Q9HA 3O9ZA 1OW3B 3KT0A 4AKIA 2ODQA 1HMYA 2ZTLA 3HRIA 4L27A 3DVLA 2YXDA 4YYZA 4XVUA 1QDLB 1M75A 1W96A 3D6TB 3HO8A 5FD8A 5HCIA 5ALWA 3N2EA 1LJUA 4RTLA 4YRGA 3FNFA 5GM1A 4FZRA 4BX9A 2OCXA 2I9KA 5J2UA 3T7EA 4JLBA 1YZVA 4W5RA 2VSNA 2M98A 2AE2A 4PC3A 3D6MA 1QTQA 1Z0AA 2PS3A 1P4HA 3A7EA 1YS6A 3RU9A 4CCSA 3ZQJA 1KZ7B 1PBNA 2O8EA 1E0SA 4KGZA 1R12A 3M5CA 4EMSA 1KIMA 4EY3A 2H2HA 5DN6A 4HXEB 4PW0A 3V7WA 1KVSA 5BN1A 3NTLA 1ZISA 2FPWA 2ZJ1A 4QDUA 4BLTA 2H1RA 3PX7A 3TLKA 4WUTA 5DSZA 4QE3A 1WUHS 2FFJA 1HV8A 3CLRC 4BQPA 2FGKA 5JAIA 4FYVA 2EP5A 1KSGA 4WTOA 5TMDA 1U8FO 3PS9A 2QTLA 1C3LA 3MW8A 4XQCA 4ZVPA 3IA7A 4KVGA 4HVCA 5KWIA 5JAHA 3JYNA 3KPVA 3FTDA 1IXYA 3UV3A 1C0PA 2R0QC 4AP9A 1YGYA 2PJRA 1ZYUA 5ESDA 4CLOB 3NC1C 4F2WA 3HB5X 1KKUA 1QZZA 4F0JA 3OO1A 4BVHA 4ENQA 2ZJOA 3MLAA 3L7AA 2EBWA 4RQAA 1XCOA 2YV5A 4K26A 4KIJA 2AD5A 5I3ZA 2FW7A 2QNIA 4C88A 2QT1A 2WG1A 4TKUA 2GBLA 5CJPA 1SWVA 4E94A 1NL3A 3CZRA 3MA0A 2FV8A 2NVUA 2AE1A 4TLEA 3OCXA 3LBAA 3KB2A 2Q5OA 1RRPA 1Z2OX 1YS4A 2AEFA 4G1FA 2ZSBA 2G9NA 1TU0A 3LQYA 4J2HA 3A4LA 3U31A 4AY4A 4BASA 4CV3A 4UM9B 3QXXA 4CBVA 4BLQA 4KH1A 4D56A 1NVFA 1E3SA 4AN4A 2AA3A 1N0HA 3RUAA 4YGXB 4WNIA 4EHDA 3OQNA 2X5JO 2W6JD 1UMDB 3KZKA 1AKTA 1XO1A 1PP4A 1O5TA 1X7YB 2O0LA 2V6FA 3AFHA 3HWX1 2BFFA 2XT6A 3C8DA 3PNSA 1RYHA 1BYUA 1PDOA 1NVEA 2BUBA 2GMWA 4X7MA 1IVNA 5A7HA 5C81A 1GIAA 2P40A 4M0FA 5NLLA 3H97A 1E7RA 1BX1A 1XAIA 2RHWA 1HDOA 3KLNA 1RJEA 4BN0A 4DCPA 2OBBA 5D01A 2LDBA 2ZZMA 4DY4A 3QTBA 3S2EA 4HFMA 1GITA 4YBRA 4EA7A 5LBTA 3NHMA 1PJ4A 4BVJA 2FMFA 2NSDA 5HFAA 3LY5A 1CUWA 5IJ0B 4Q9AA 4MCIA 4OQ4A 2R5NA 5FOUA 3WLAA 3A1DA 2Y1EA 4U2EA 2JW5A 3P20A 2WOOA 3TLXA 2CVZA 4CHGA 2PS1A 3DEKA 3D4LA 1EGQA 5JZ9A 2CHGA 3SZRA 1G3UA 3RRZA 3PHJA 3ZIUA 2DWOA 2QYOA 2IXDA 2WB4A 4URFA 2BVNA 3I1YA 1P1IA 1M6WA 2CEKA 1VXRA 3W5BA 5K09A 4OHPA 1ZS9A 1IN4A 2WJIA 2YOGA 1HQDA 2YY5A 4YAFA 5P21A 3SJBA 4B82A 3SE0A 2QSZA 4AZTA 5JC1A 1VCIA 1PT7A 3LUGA 4Z0HO 1CY4A 2NUAA 2C1ZA 3PKIA 4ACBA 4TGLA 4F84A 3SSOA 5IG2A 4CT5A 4L7VA 1A9SA 1C9MA 4J7XA 4P84A 3USZA 2YYAA 3IQIX 3JAMA 4GHWA 1GVNB 1TZKA 1U5AA 3EIQA 4FMDB 4JR1A 1JFLA 2VWGA 4MQ5A 1XQVA 1M6VA 3HB4X 4XYLA 1S6YA 4LJKA 4R3NA 2WMOB 5ALOA 2CNBA 1BVHA 1OTXA 2B34A 2PBRA 3GXBA 5ALSA 3RIGA 1H0RA 3SIWA 4AYXA 1GNVA 4G84A 2QT9A 1SZJG 4ZCPA 5CVTA 2BF7A 1JLLA 4PAGA 1SXJB 5KYTA 1EPUA 4LZNA 4DQUA 3T7KA 4UTVA 1TCAA 2BLNA 5BNWA 2DETA 4OAPA 2A9OA 2C4MA 4WKOA 1EQ2A 4X64B 1TM1E 3GLIE 5CH8A 4YQYA 3QXCA 4KQ2A 3K53A 3AM4A 5DT2A 1AE1A 2QG6A 1IG0A 2QUBA 1Z6AA 2D6FA 1MVOA 5C7YA 5BN5A 1ZGZA 5JSZB 3FHCB 1W0KD 3IDAA 3JWEA 1NR1A 3NPMA 4RTKA 1RYMA 1D7AA 3EW9A 5F5LA 1X1EA 1NG9A 2WWWA 1PGOA 3ADBA 2WZQA 2NQ8A 3CNOA 2O3TA 4G6ZA 4WOKA 1YKGA 2X5KO 2BSXA 3M89A 1GZ4A 5LXTF 4EB8A 5EZYA 4YMUA 1SUPA 1KZHA 3RS8A 1HE5A 2ZJ4A 4M1TA 4UULA 1TJ4A 1EM8B 2XCRB 2ZRIA 1FS6A 3HN6A 4PZDA 1O94A 1G5RA 3OM9A 1YMVA 3OZIA 4NOJA 2ILVA 3E53A 3CN9A 4HFRA 1XTUA 3BMCB 3EY4A 4LMBA 4TVKA 2Q62A 1BRMA 1KO8A 1OLUB 4C0XA 1CDEA 2E4UA 3N5CA 2E4XA 5EPEA 4B3XA 3H13A 3GD7A 2AQ8A 5F2KA 3BMNB 2RHLA 1KK2A 4DCMA 4JGBA 1NV9A 4ZOLB 3LOQA 3V1MA 4ZEWA 3ZX5A 1N6KA 1TQ2A 1VKZA 3NVAA 1I4TD 2LD4A 3LE8A 4HLUA 5AK5A 1OBOA 1JG1A 4Q4LA 1L7BA 3DFFA 5HILA 3FZEA 4M1YA 5BRAA 2A3NA 3TZCA 3ZVMA 3G3EA 4IO0A 1UK9A 1WJGA 2ZPTX 1YI1A 4QBIA 3V1NA 4UZEA 1MTZA 3WQHA 1XPJA 2O6LA 4HPXB 1E5TA 4C89A 4J0QA 3HYRA 4Q4HB 3NYQA 3B1YA 5SY6A 5HUJA 1E9VA 5JE8A 3AB3A 1YB4A 4I2NA 1W1UA 3CVJA 3ICPA 4AMZA 3GYGA 1X19A 3PJFA 1B8UA 1VKRA 3AXTA 3WGZA 3C3KA 3EC7A 2G25A 3L0IB 3PV0A 4PBRA 4HY3A 3KE9A 4UM8B 2G5PA 5JS2A 4LHWA 2I2BA 4PLTA 4XJTA 4MIOA 3ZJTA 2WYUA 4IF4A 5HPYB 3CE9A 3ZGNA 1T8PA 4QBFA 3DP9A 3CLHA 5DX8A 4MKHA 5DF1A 5CA0A 1JBKA 3MUFA 1MRSA 2WK1A 1GTSA 1UM8A 2C42A 2PUHA 1WXQA 2B7CA 3CB4A 4JLKA 2C7VA 1G6HA 3RROA 4IKPA 1NBMD 2GF0A 3CH6A 2YWGA 1AXRA 2FX3A 2WDPA 4G24A 3H5LA 4QGHA 3WADA 3UOGA 5F9FA 1IOZA 1IG3A 1M6YA 1RXEA 2Z04A 1UEJA 3FVTA 3U1VA 1HT0A 4BE9A 5A4FS 2BDEA 2YVKA 1G19A 4KEAA 1DLIA 5JUWA 2RFLA 2VK8A 5EA2A 3VR0A 4AO6A 4F2DA 3D6AA 4HVLA 2XUDA 5IBRA 1MJNA 2P3QA 2JGFA 1UDAA 1ZP6A 2R7AA 4FYPA 4BNIA 5BXYA 5KX5A 4GOXA 3A6FA 4KXWA 4ZVUA 1RHJA 3JQGA 1AQ6A 2VDRB 3HKCA 3M2PA 3OHMA 1VJGA 3FMVA 4BVFA 1FMTA 3OI7A 4GLLA 5LCXA 5LMZA 3C97A 3EVCA 4MIYA 4UNIA 3FMGA 4K28A 4QUDA 3G2NA 4CM5A 3ZHYA 1NMZA 2IEYA 1B1AA 5FX2A 4RTRA 5E9AA 1U0OC 4JI2B 2CDNA 3GH3A 2QTTA 1MV8A 1ONBA 2W83A 1L3CA 3DE7X 3Q3EA 4MWSA 2DFTA 4BLWA 4EELA 4LDPA 4ZCMA 5EJ8A 3ITEA 4HBZA 5IKOA 5FWYB 1FXWA 3OPVA 5TV2A 2N46A 1GOTA 2X8BA 3JVUA 4DV3B 4NK5A 1ZJZA 3TLCA 2CFRA 3QSYA 4M9ZA 3GRAA 2V54A 1UOQA 2AJDA 5IAAA 1UKAA 3F8TA 5AI5A 1J25A 1JLHA 4ZIRA 4Y2XA 2C0CA 5FULA 4EL5A 1NATA 1CV2A 1VSBA 1Y7IA 4HDCA 5IYZF 3I5YA 3OPYB 3K15A 4GYJA 2IH5A 1DQZA 1TB4A 3W6UA 4BLVA 4BRWA 5ABPA 5BW5A 2O8NA 2QTZA 3MM4A 2IXAA 2XIQA 3QA3E 5KHAA 3WS7A 4DWOA 2BI4A 4HGPA 1WD5A 1SZDA 3F6BX 4PZPA 4WCFC 2F3QA 3RS7A 4TMKA 4IGKA 3PNQA 5CHYA 3W8FA 2YWBA 4IRUB 4U6NA 1DSSG 2QL9A 4OEHA 4JVLA 1T1RA 1ISIA 1ZUNA 2G71A 4U0KA 1V3VA 1FFHA 3JX9A 3BUSA 3MTEA 1MP0A 3I6ZA 4S1WA 5IJZA 2ORYA 1DARA 1LNSA 4KIUA 3LT4A 3T1OA 2MMGA 3DDWA 3RVBA 2VTKA 2YZGA 4MK4A 3HNOA 2BP7A 5F78A 1UDRA 2OXIA 3WFJA 3ENVA 5CNJA 4P38A 3RR2A 1RW4A 1D4OA 1M6EX 3GV0A 2VPYA 1MNQA 1LZLA 2BEWB 1JLKA 1QH8A 2YR0A 1GSAA 1NJ2A 2QJRA 3O7WA 4JLMA 3UXHA 4EY8A 2AKAB 4NV1A 1GV0A 1X1QA 1X39A 2W2KA 4B4UA 3I3OA 2BZ1A 4GEKA 3KJZA 5EVCA 4CF5A 4K9SA 1TQ6A 3KCNA 1BCSB 1JMKC 3QOFA 4XDGA 3CUSA 4QTYA 2IF0A 2XRZA 2HJWA 2J0EA 2QR2A 3IIKA 4F6RB 1JSXA 2ZRFA 1PR1A 1H8ED 3ZJVA 3IYLW 3IEKA 3ZWWA 1XRLA 1U2QA 2DFVA 3QY0A 3QEJA 1ZD3A 1V1JA 4ID9A 4IDHA 3ZC3A 4MUJA 4URUR 3MNFA 4PAMA 4A0HA 1AUPA 1MCZA 1BWPA 1KZ6A 2C92A 3H83A 3PDIB 1N1GA 5SICE 4DXDA 5HR5A 2QVZX 1XRQA 3DEJA 3C8ZA 2PG3A 1ZMRA 1SEPA 2C3YA 3DOOA 2QRMA 4XD7D 4MKXA 3NWOA 1FUUA 1N4DA 1ZH0A 1L4NA 2I65A 2MYPA 1Z0JA 3PF8A 5DULA 2Q99A 5B1HA 3VSEA 2B37A 1NKTA 1Q2XA 3A6HA 4GVXA 1TUEA 1M7GA 2GXQA 4FCVA 3ZK9A 1VL0A 5A7FA 2HBYA 2IE0A 4X8MA 1Q19A 3WWPA 4FR0A 4JB2A 3NZEA 3IS3A 4BQNA 1LDMA 3T15A 2PXCA 3AG6A 2EYQA 1KBOA 3RJ9A 3NORA 2FQQA 3V8BA 4R1UA 1XKLA 3WGQA 3K96A 4Y6SA 1JKIA 5CX4A 4GRDA 4PGMA 5EE5B 5KTSA 3FNHA 4FHGA 5GQSA 1SB9A 3IKJA 4JMLA 2AZMA 4OK3A 5C4MA 4BNHA 3Q4GA 4FOSA 1YB6A 4L0QA 4D9IA 5JXWA 5DIFA 3DNPA 4OH1A 3TCXB 3B2QA 2E37A 5T4EA 3RK1A 1F51E 4ZO8A 3SJAA 2QENA 2Y9MB 2ZAMA 2K2WA 3LO8A 4BB5A 2QXUA 2R84A 3MB8A 4QPNA 3U4DA 3UY4A 5AD1A 4RD6A 3FH0A 4KFSA 3JQ6A 5IUNC 4R2IA 5LZ5A 2PL1A 4WN9A 1J2JA 4M7WA 1YJAA 2JC3A 2ZKLA 3JU3A 3WNQA 1QIFA 3OZXA 4OBEA 3MMZA 4ASUA 2ZYTX 1YRLA 1O1YA 2BDUA 1WDLA 3DULA 3OE4A 4RKEA 1KJIA 2PX0A 1FCJA 3TR5A 1P44A 4U7WA 4V0MA 3VISA 7ADHA 1NXQA 4KRYA 3W8DA 5KSOA 5IM4F 4Z4HA 2IY8A 1FP1D 2SHKA 1QVAA 2Y27A 3I53A 4JKOA 4Y0AA 4XIFA 2NSJA 5BSFA 1S2IA 1UXOA 3D4PA 4XOIA 3D6NB 2Q6VA 3MTBA 1PWYE 3I4FA 4A2QA 1JVSA 1FRFS 1Z16A 4Q02A 1JGTA 2JS7A 2MYNA 4HYYA 2P3LA 3GVPA 1WXHA 3WB0A 1FFCA 1NULA 1P61B 1YC2A 1ZRHA 1ULHA 2HJRA 2TYSB 2GEFA 2XRFA 3L6CA 2XYQA 4HDAA 4L57A 3HKBB 1QIGA 5IJAA 1OQAA 3WTCA 5ES3A 1O89A 2QVXX 5K0ZA 1JQBA 3OFNA 4GMGA 5DYNA 4HWSA 1EBFA 1T2DA 2C8VA 2DE0X 5LPNA 1TM2A 3LUKA 3ROEA 1GYRA 1C1YA 2F48A 2QMHA 4I9GA 4HDNA 4IDDA 5LOVB 2YUTA 4NFSA 4AJHA 1PJ8A 1UH5A 2QZ4A 1FF9A 1SG0A 4C7XA 2XSZD 4Q3NA 3ZPXA 2YQZA 4PLVA 2OO5C 4G5QA 3OM0A 3B5JA 1RHKA 3L1HA 3PUXA 1PR2A 1S2NA 1SJ9A 4D9MA 3N1UA 1Y3HA 1T9HA 3GJXC 3QVGA 1OXKB 2WTEA 4E11A 4NAUA 3RBZA 2GBGA 3VTAA 3MBOA 2ZSKA 4JROA 3VM6A 2FQXA 2V0CA 1T9ZA 4X1OA 1RZUA 2OKGA 3NC0C 3WYDA 4P3YA 4IM7A 1Y1QA 1Z37A 3DFZA 1JTEA 3AOEA 3FUWA 3QWIA 3TZHA 1C7QA 2RGXA 4FDTA 1BEZA 4F4DA 4L3WA 1VSUA 4IIGA 1R00A 2AFRA 4LE0A 1UJCA 4G09A 2LDXA 4P8RA 5JS6A 1YB5A 1ESCA 4I6GA 4MB0A 5K2MA 1OD6A 4JCCA 4XWOA 1EFAA 3EFBA 2Z6UA 4C4AA 1CJMA 2YNMC 2A5DA 2COEA 3IMGA 5FNVA 4E6EA 3K70B 4FFBA 4YIKA 4JYAB 1EGMB 2GD1O 2IUEA 1P8JA 4FE4A 5BNIA 1F6WA 1H94A 4C4PA 1PZHA 1LX7A 4QIHA 4RVNA 4E1AA 1W29A 3EAQA 2C1XA 4N3AA 5DM1A 1Z5UA 3KL2A 4JB0A 3T4EA 7GPBA 3KQPA 1GRRA 3Q10A 5CB4F 4UQLA 3QW4B 2O8FB 3UC9A 4ZZ2A 1KVQA 1T6YA 2HB6A 3E3AA 4Q9DA 2PS0A 2PUFA 3CNEA 3IJRA 1R4MB 2C3UA 3D6VA 4IJQA 1YRBA 2ZBGA 4H08A 5IVDA 2IT1A 3ORFA 4Q1EA 3HY4A 4AWBA 4TRRA 2DBYA 4O1HA 4M8SA 5JMWA 5K7SA 1WW2A 2E82A 4HYEA 3ILVA 3LBHA 4NU6A 4DB4A 2I4TA 4RJ2A 3MGKA 3WWCA 2XXAA 2IYPA 2X0IA 1WUTA 4EF4A 1GPLA 3I6YA 3QXJA 5FEMA 4DR6B 4HN4B 3ETJA 4NCAA 3GD5A 3ZIAD 5SZHB 1W5TA 3LCRA 4IOJA 5F3WB 5DBOA 2VZ0A 2ZI6A 1E5QA 2A33A 4GPAA 3TE6A 5KYXB 4QQKA 3EXHA 3H2ZA 4K9NA 5KVVA 5FUQA 2W6PA 2REQB 1FLDA 2EKDA 3AL2A 3UMRA 4BNXA 1MJFA 1Y6FA 3D8BA 3HSYA 2FEXA 3KTDA 1Y1LA 3L6DA 1WAMA 3KZ1E 1TYCA 3JZAA 4KGVA 3FIJA 4TTVA 1I7LA 1I6WA 1KAGA 3TQSA 4OFBA 4YCDA 1IDOA 3WLLA 1Z4IA 1A82A 4P4TA 2J3DA 3FDFA 2GEUA 2OPHA 1ODTC 1DFIA 1DQPA 5D3MB 1MRNA 2HJ9A 3KHTA 2QG4A 1E66A 4DCTA 4WOCA 5AJYA 3CNBA 2P5UA 4RX1A 4O0MA 1EEXB 3B9BA 2RGBA 4WVLA 4F4CA 3DVQX 5DBGA 1E79D 3VPCA 3H84A 1UBEA 3S8YA 3J81k 2O5RA 5JASA 5FADA 1R4ZA 1Z34A 4M9CA 3DXXA 1EP3B 1LDGA 3O0TA 1DBIA 2CYBA 3PUZA 4PZCA 1SD2A 2QZSA 5D3QA 4YLGA 4KXMA 1CQJA 2VSYA 2XCQA 2RSLA 2JPDA 2RK3A 2Q2OA 4M8LA 4UTZA 2C95A 2V59A 1XTZA 5B55A 3L0ZA 4J07A 1BHQ1 3CHYA 4WKNA 4EECA 1TXGA 2E0IA 4JOSA 3L1JA 4QC2A 1TIKA 1Z5WA 4ZZ0A 3DT6A 1XLVA 2V03A 2F3PA 2DUUA 3KJQA 2P7IA 3PK0A 5GINE 4ZQGA 3AJDA 4TWBA 4ZRNA 5EP1A 3S40A 1QFXA 3OEWA 2HA0A 3ZCUA 3KEQA 2X77A 2RG1A 4HDRA 4BV9A 2DPXA 3M6UA 4F60A 2GEBA 1YJBA 1XQWA 1F0YA 4K6OA 4P3OA 4MYDA 1AF7A 2G1UA 2RJNA 6CHYA 1G7TA 4JODA 4MQEB 1YK1A 4TWZA 5BT9A 3BX1A 4M53A 4OHMA 1U6IA 2R5WA 4P32A 2ZK7A 3A4MA 2E5FA 3UJHA 4G86A 4CI9A 5HM6A 5LQAA 2FFBA 5JY1A 5FFFA 3VH4A 3JQRA 4ND1A 4IV5A 4RPJA 3RVMA 2AI3A 3ZHBA 4NMWA 2JG3A 2HU8A 3FXAA 1YQXA 4W7SA 5BRNA 2FLKA 2MYUA 2HA4A 2P8SA 2Z2JA 3E7WA 3HBFA 1G9TA 1B73A 5L7TA 2CFOA 3SLKA 4GYWA 8MHTA 4DJJA 1R10A 2FDCA 3BL8A 4KBYA 1J7KA 2IL1A 4EABA 3PXUA 5F2EA 3ZQUA 5JC8A 3AHCA 4RMGA 2A0KA 1HDGO 2OORA 3M6AA 3UA4A