4EARA

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with dadme-immg and phosphate
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
283
structure length
282
Chain Sequence
GYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Purine nucleoside phosphorylase
total genus 87
structure length 282
sequence length 283
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4earA00
3FWPA 1OUMA 1Y1TA 2AI2A 4DA7A 5B7NA 5IU6A 4TS9A 3IOMA 3UAWA 3BL6A 3GGSA 4NY1A 4NS1A 2BSXA 4WKNA 2AI1A 1Y1SA 4YMLA 1A9OA 3UAVA 2OC9A 4H1TA 1PR6A 3DF9A 3NBQA 5ETJA 1Z33A 3QPBA 5EPUA 1K9SA 1TD1A 4YO8A 4EARA 2QDKA 1VHWA 4TTJA 5F7XA 1N3IA 4GLFA 4D98A 2QTTA 3UAXA 4QFBA 1ULAA 5K1ZA 2GUWA 1VFNA 2A0YA 4JOSA 3TL6A 5F78A 5CYGA 3UAZA 3IEXA 4D8XA 1ECPA 4G89A 4OGLA 2PGAA 4TXHA 4F3CA 3E9ZA 3FB1A 4EB8A 4R2WA 3NM5A 2OXFA 4G8JA 4PNPA 2Q7OE 2QTGA 1JE1A 1VMKA 3BJEA 1RR6A 4P54A 2I8AA 3DJFA 1PK7A 1K3FA 3C74A 4DARA 3KVYA 4LNAA 1YBFA 4TYMA 5CXSA 4NSNA 4BMYA 1JDSA 3EEIA 4DABA 1ODKA 3FNQA 5F77A 3OZBA 4WKPA 1LVUA 4OGKA 4WKBA 4L5YA 1T8WA 3D1VA 4F3KA 4R31A 1U1EA 4JP5A 4MARA 3ONVA 4KN5A 4D8YA 1Y1QA 3O6VA 5B7GA 1XE3A 2RJ3A 4LNHA 2ON6A 1U1DA 1V2HE 1ODIA 4GKAA 1OVGA 1SQ6A 3DDOA 1U1GA 1RXSA 4MCHA 3E0QA 3OOHA 4TS3A 4PR3A 1QE5A 1OTYA 1V3QE 5F7OA 1B8OA 1Y1RA 1SD1A 1PW7A 5CCEA 4OEHA 3DPSA 1Z34A 1NC1A 1G2OA 2B94A 4LZWA 1ZL2A 2A8YA 4TTIA 3PNPA 1ODLA 1JPVA 1JDTA 2AC7A 3FUCA 1PR4A 3LA8A 1SD2A 1Z5NA 1YQUA 1Z35A 4BN0A 2P4SA 1RXCA 5JPCA 4L0MA 3LBAA 1CG6A 4OY3A 4BMXA 3KHSA 4UC0A 2A0WA 3OCCA 1LV8A 5C80A 4L5CA 1T8RA 1PBNA 1A9TA 1PWYE 1A69A 5KB3A 3KVVA 4QATA 4TXJA 4DANA 2HRDA 1Z38A 5F7JA 3T94A 4DA6A 5B7QA 4ECEA 1I80A 5CXQA 1VHJA 1T8SA 3EUEA 2I4TA 4DAEA 4DA0A 1A9SA 4IP0A 1TCVA 1C3XA 3NM4A 4K6OA 1B8NA 4QAQA 1K27A 1RT9A 2HN9A 3OZEA 3OZCA 3P0FA 3INYA 3U40A 1U1FA 3UAYA 1CB0A 3NM6B 4F2PA 3OOEA 2OC4A 3F8WA 2HWUA 4FFSA 5EFOA 5CCDA 4DA8A 1ZOSA 1A9QA 1RXUA 1ULBA 4MCIA 1YR3A 1JP7A 3KUKA 3FOWA 3MMSA 3MB8A 1TGVA 4GMHA 1NW4A 1FXUA 4RJ2A 1A9RA 3BSFA 1Y6RA 2QPLA 4LKRA 4F1WA 1V4NA 2HSWA 4G41A 1TCUA 3PHBE 4M3NA 4TXLA 1PKEA 4U2KA 1T8YA 3OF3A 5DK6A 3PHCA 3P0EA 4OF4A 3PNSA 4YNBA 1PK9A 3EUFA 5I3CA 4WKOA 1YQQA 4L5AA 1Z37A 3DP9A 1JDZA 1RSZA 1JYSA 3O4VA 3OZDA 2OECA 4YJKA 4OJTA 4WKCA 1V48A 4BMZA 4QEZA 1A9PA 4TXMA 1U1CA 1Z5PA 4D8VA 3OPVA 3UT6A 5FAKA 1JDVA 1M73E 1V45E 2AI3A 3E9RA 5IFKA 3GB9A 1Z5OA 2QSUA 4X24A 3KU4A 4TXNA 5F76A 4M7WA 3FAZA 1RCTE 1WTAA 4F2WA 4M1EA 4GLJA 3K8QA 1Q1GA 4QARA 4I2VA 4DAOA 4L6IA 1RXYA 1YRYE 2A0XA 5F73A 4JWTA 1PF7E 1JE0A 4TTAA 1ODJA 1LX7A 1Z39A 1JDUA 1PR1A 4R2XA 3K8OE 1Z36A 1OU4A 1TGYA 2XRFA 1PR5A 3EMVA 4E1VA 5B7PA 2ISCA 4QASA 5F7ZA 1SJ9A 3KVRA 1T0UA 3ODGA 1OTXA 5CYFA 3ENZA 1RFGE 1PR0A 4LDNA 1RYZA 2H8GA 1NC3A 5EUBA 1Y6QA 1OV6A 3LGSA 3BGSA 2IQ5A 4D9HA 1PR2A 3SCZA 1V41E
chains in the Genus database with same CATH superfamily
4C5AA 1EVEA 3D8TA 2P5TB 3IP9A 4JJIA 4N7BA 4UQPA 2GLUA 1EGAA 2VKTA 4TQGA 3LCRA 2ZRPA 5EKTA 1EK0A 1Z2DA 4TRNA 4A8PA 2Z5VA 1YQ9A 2XGSA 1XCMA 3UPTA 3Q5GA 4W7HA 5IU6A 4CL2A 3LWNA 3LTNC 5ES4B 5CCBA 1VJ1A 2JIPA 4D9JA 2HRZA 1MDFA 3G3EA 3OCVA 4DREA 2XJ9A 4J4TA 4B7CA 1TW2A 3B7GA 4PICA 4WZAA 4EUEA 3R5FA 5JD4A 3DEAA 1KI9A 2RGNA 2JK0A 3HFJA 1XAJA 3BGDA 2GWRA 5GONA 4KUGA 2AI1A 3ANTA 1R74A 4TMFA 1EUYA 2A59A 1RRFA 5CT8A 2BT4A 2I1WA 3AB3A 3EXIA 4M1OA 4EGSA 4E4TA 1GPBA 5LQAA 2PJUA 3GZNA 3MINA 3JWEA 1K3TA 3ORHA 4ZAGA 1K6XA 4BO5A 1J0AA 5E8JA 5D8DA 5TE9A 1IEQA 3AY7A 3A1VA 1DKNA 4ZVQA 4YO8A 3T15A 4DC9A 1DQYA 2BC9A 1UDRA 3GRUA 4R71A 4X6XA 1BROA 1F0NA 1B8UA 1RCFA 1M6YA 5ITZA 1TZ2A 1RE1A 2G0TA 3M8KA 1PZEA 3SHVA 1BE1A 2I03A 4XSVA 2FMIA 4I08A 5K0TA 2C07A 3I9MA 1EJ6A 4OHRA 2XWSA 4C4OA 3NHKA 1OAOC 4JEMA 1JIUA 1JDBC 1JEJA 5KNDD 2MOKA 4S12A 3U7IA 2WIDA 2ZLBA 3V1UA 2JBHA 4KI7A 1H1LA 1XQ1A 2EIXA 1T5LA 2AG1A 1B6TA 4LVNA 3QPWA 1R9JA 3M0EA 1R7RA 3NCTA 4ESHA 4W5TA 3OPQA 3QLJA 3S2SA 2K6GA 1FVHA 3N2KB 3SZMA 4CV1A 2MSLA 4OX9B 5IJ9A 3JYLA 1ECFA 3DL4A 4R0MA 2OXFA 1NM5C 2PXXA 1GNVA 4DWVA 2QUZA 3I5YA 4KQ1A 2JI4A 4W5JA 4BQSA 2V7PA 3CVYA 4DCUA 4D4HA 2EYUA 4CDMA 2XQJA 2OZEA 1IMOA 3VNBA 3I2KA 1V2GA 3H5IA 4H3KB 4PFKA 5GMOA 5BW8A 1V1MA 4REMA 1KAMA 4KRYA 4Y9TA 3Q1LA 4KQWA 2G08A 3FH0A 1KS9A 3LT4A 2A14A 4TYYA 3CPEA 3B2QA 4K26A 3GW8A 4KLRA 4C43A 5CCXA 1U6IA 4H77A 4MQMA 3ZDZB 4P58A 1Y8AA 4ZV9A 3DWGA 3EZ2A 3ZVRA 3PZRA 3OD5A 2JHAA 5H80A 1DBPA 1SB8A 2KWIA 2NZWA 2W6PA 2B5WA 2IITA 1HOTA 3PQDA 4IIBA 3PUWA 5ARCA 5A5VA 1VCHA 4JV5B 1RLTA 4M0UA 2A5FA 2NNLD 4OHVA 1GUFA 2L69A 3D8BA 4N5MA 4ZVOA 5B53A 4DABA 5AUQA 1EYZA 1BGXT 1AHIA 5F77A 1VMAA 5WRFA 2CVPA 1KDYA 1F2UB 2BGKA 4KWCA 1KI6A 3REQA 4NJEA 4G0NA 5AVVA 3V55A 2B6NA 2P8JA 2B7BA 1D0IA 5C1IA 3VPDA 5CLJA 3CJRA 4BNXA 1BA3A 3FCCA 3KEFA 4ETIA 2IYQA 4KO4S 5JFOA 4L8LA 1BDBA 2JAOA 1AZWA 1O4WA 1HLFA 3NC4A 2HT6A 2GILA 3JTEA 4E7PA 4WJLA 1G16A 4RJIA 1HMPA 1TYCA 1W49A 4TMWA 3CLHA 4WXYB 3W90A 2ORED 4DIBA 2ZYTX 4ZO8A 1TMYA 4B45A 4BPRA 2J6HA 1A9XB 2NVUA 5ER6A 5EHGA 1CZKA 1YRAA 1AKEA 1VHTA 2VJQA 5DOVA 3WGZA 3DL7A 1YVDA 3E4CA 1GKUB 3M1YA 1PJ3A 1BQ4A 2QL9A 2TS1A 4P31A 8ADHA 5ALUA 1GRQA 1MPTA 1A2OA 2OHVA 4UEOA 5FNVA 3ZC3A 4DCCA 1BHJA 1QH1B 1GNLA 4D79A 1OZGA 3PCTA 4HAVA 4CMJA 5JCZA 4B74A 3FKQA 5C81A 3KTDA 2F64A 1IG3A 3PXEA 1V5EA 1AA9A 1QV9A 2R65A 3RUPA 2A9QA 3O4GA 4E5KA 2I1QA 1JKFA 3HYRA 3CWCA 4D9GA 4DYVA 4CLRA 2O52A 1FP2A 4QPZA 2UZ3A 5CW2A 3EA5A 1AXEA 5JSYA 1CUGA 2ODPA 3VR6D 3CRMA 1XAGA 2AEJA 4HWSA 4S05A 1UIMA 2PO5A 3AIIA 2ZE8A 1I3OA 3HB4X 1DBVO 2VPPA 4YUVA 3GHHA 1XWIA 3SU8A 3LYLA 3LPNA 4IIJF 5KREA 2OZVA 1N0IA 1UBEA 4HLUC 4TT3A 1E69A 1UWKA 1ZGZA 1WA5A 2QGFA 2HWYA 1QHYA 2ERYA 1ZM2A 2Z04A 5HJ7A 5LXTF 1YZFA 2JGFA 3QU9A 4CQNA 4AY4A 2GF9A 3AVWA 2XNDD 1H8HA 1JAZA 2YCLA 1PI3A 1Q14A 3C1AA 1CC1S 1CR4A 2CCJA 1PE0A 2BKVA 3P7MA 4X6LA 2VP3A 2A6PA 2XWJI 3UJ3X 1RYFA 3CCFA 2W6IA 2A86A 4ZREA 4A73A 2PJZA 4HLNA 5K0BA 4MR9B 2XNCA 3CGWA 1ODSA 3DLIA 2VSNA 2PCJA 4Z9BA 1AO3A 3QVMA 1SA0A 1U7ZA 2BYTA 2AXEA 1NVEA 1RYEA 4Q18A 3KSZO 1N9GA 3WICA 4DM3A 5KUTA 2WP0A 4HQ6A 4UBOA 1FU4A 4XXHA 4XARA 4A6EA 2XMZA 3R5XA 1YQUA 2FUG6 3GOHA 4WLVA 3QWAA 4FVTA 1FSZA 1BXGA 3AC0A 3MMZA 2WWRA 3TCXB 1IZ0A 4HTFA 4TL6A 4BVFA 3ST7A 5HGXA 3U9SA 4FEEA 1ENPA 3FDIA 4F0JA 2Q3HA 2CMDA 3E9YA 3GG2A 3EXEA 1VI6A 3PV0A 4P4TA 1U4NA 1Z8FA 1EP3B 1DXQA 1CRWG 2CZCA 2O2JA 1CG6A 2ODQA 1LTKA 2H5LA 4M6WB 3AF6A 2LD4A 5CXXA 4CM1A 1JQ5A 1O08A 2ASVA 2QYHA 3IXQA 3JD4A 1WPXA 3RKUA 3WQRA 1IEWA 1HTBA 3U60B 1P4RA 4RJKA 3SEAA 4N3GA 1YACA 4B6OA 2X1VA 3ZXXA 3P71T 3LC1O 5I7HA 4D46A 3UFXA 4H7DA 4R16A 1OAAA 1XTQA 1RHQA 3EGOA 1QOQB 3PWTA 3R7AA 5BR4A 1QYDA 2CLSA 3DCJA 4RHCA 3KEGA 4QT0A 3EVFA 3L0YA 3LCVB 4TM8A 2XZPA 4HYTA 1PNQA 4L57A 2XD9A 3O26A 5BN4A 1XZHA 5LA6A 2V4MA 4BNUA 2OCYC 2YWFA 5DLQC 4Z3DA 1ZUNB 3DBIA 1QCYA 4NECA 3WO0A 3PF8A 4GICA 4C4ZA 1UOPA 2W2OA 1AUQA 1Q20A 3ICQB 3LX4A 3OOWA 4GF5A 3LYHA 1K4MA 3I62A 5I9BA 5BPHA 1KO7A 3KSAC 1T4DA 5IMBA 2B4YA 4CM4B 3O1IC 3AHDA 3EVBA 4LDAA 1R00A 2AKYA 1MH9A 2PL9A 2ZM5A 2E7ZA 2ZWAA 5CXQA 1BCRB 4FMDB 1ISRA 1T3GA 2GPJA 4IXWA 4QKQA 4YRKA 2R7NA 3L4BC 3Q7QA 4JBGA 3K94A 5AW3A 1RWWA 1AK9A 3AINA 1RI2A 4M1WA 3DWFA 5D87A 1R0WA 2H08A 2IIPA 3HU2A 4YLEA 1SCDA 1HNNA 3RCBA 4BGDA 2DERA 1XZCA 5A06A 4MUYA 3EQ6A 5IBPA 5LMCA 2WAOA 4PYNA 1KKUA 1OLXB 2HA6A 3ILSA 4B3CA 2ZM6B 1H42A 2NZJA 4WZBA 3OE1A 5LP6C 4XIYA 2XR1A 3B3AA 2PZBA 3BAZA 1IHUA 4LV6A 1NUQA 5LMZA 1ZA2A 4UZFA 3CUSA 4ENSA 4Z86A 2QDXA 2I91A 1S2IA 1KYZA 3PD0A 4WFQA 3GDWA 5CB4B 1U63A 3Q7EA 3Q6NA 1KAHA 2WOJA 1WHSB 5CXUA 3JQ8A 2BW0A 2C77A 1SBCA 4RKQA 1QRUA 4HDRB 3DE4X 3FCUB 3EFHA 3G59A 3Q6IA 1MNAA 3ZHXA 2ZXFA 3EIUA 2PUAA 3DE1X 5EEGA 1NMZA 2EQBA 3UY4A 4AAYA 2PN1A 1T91A 4P2GA 2ZBGA 4OG2A 4ISBA 2VTKA 2YYSA 5BO5A 1KAQA 4EKGA 4P4GA 4A26A 4N40A 1T4CB 1G6OA 3TK1A 1DT3A 5IBQA 4YUAA 4CM9A 3IHWA 4K1LA 2VP0A 2A57A 1ZR4A 4U6QA 1FP4B 3PJGA 1Z7BA 4H0NA 1XX6A 2X2FA 2DAPA 5DTEA 5F12A 1M83A 2TRSB 3F46A 3PFIA 4PIMA 3SZOA 3VU1A 3WYAA 1OIWA 3YASA 5J43A 1AXRA 3D8SA 2HNAA 1RTTA 1TMOA 5E2BA 3TR0A 2OAGA 1AHPA 4R1OA 5ALEA 1JIKA 1UZNA 1QC5B 3T5AA 4IIJB 2IHKA 5AW7A 1OOEA 3PEVA 2R6JA 4CODB 1SUBA 4OHCA 1SKMA 4WNAA 4DC0A 1VE5A 4K0RA 1JU4A 3NAQA 5LB4A 1V8OA 2EW2A 4FGKA 5D1HA 1RYHA 2C04A 2IYUA 1J24A 4XJSA 5IKPA 4RF2A 2H4JA 3GWGA 2OXEA 2Y8EA 1O94D 1QP4A 3LC7O 2V5UA 3PHCA 3BJZA 3GUVA 2BTQA 5DEIA 3UJDA 1KJYA 4PHFA 2Q9UA 4ZTBA 4EYQA 4HGOA 2FSUA 2FPUA 1T3LA 4XR9A 2WABA 2XYVA 4Q9JA 4AULA 2BJWA 2VUUA 3PFHA 2UZ1A 4E13A 4FJ0A 4EBFA 4ZAVA 4Q3EA 3L05A 1H4VB 2GYUA 1GEGA 1SBQA 2NUBA 3D6FA 3RYCB 4HSGA 1VXOA 3GLGE 1V71A 3Q9SA 5J5AA 2XCLA 1U98A 3T7IA 821PA 2ACEA 3C3DA 1L5NA 4N3BA 5I4BA 2D2VA 2XKJE 3FYUA 4ZVUA 2W6ID 2YY5A 3OZDA 5CDFA 3JPWA 3VTZA 5KDDA 2FF7A 3H5VA 1N2EA 4ALIA 4WBNB 4OFWA 1KYYA 1GQFA 3E9CA 4MVJF 2PLWA 2WKRA 4Q6WA 5JPIA 3CT6A 3T95A 3BB1A 3QVJA 4FEAA 4AF6A 1XK7A 2Q4TA 4YJ2F 4GYWA 1H22A 1Q0HA 2QSZA 3OPVA 5JI2E 4HXFB 4BKQA 4G0ZA 2GXSA 3KC2A 5IVDA 4DWWA 4K28A 2OE2A 1DJLA 3TJMA 2YL2A 1F48A 2DHDA 4HD8A 4Z4QA 3OFNA 3P8ZA 3GLRA 4K9MA 4EB6B 1Z07A 2BFFA 4MLZA 3A70A 1BYIA 2FPGA 4RSGA 1T2CA 1L1FA 1O9GA 2H2WA 3K0FB 4JLMA 1NM5A 3SX0A 1G7RA 1R9NA 4BO2A 1N2IA 3T1OA 3IVGA 4NENA 1CDEA 4LFCB 4CDRA 3HQ4O 1EWQA 5F98A 4IS2A 1HA3A 1ECGA 1FNSA 3BXGA 2I6XA 3I12A 4JODA 5L7TA 2IPNA 4EY5A 1YJXA 3OURA 3QW2A 1RLOA 5FR1A 1HQYE 3GP3A 5B1EA 1BYUA 1R88A 5FR2A 1QYIA 5LJLA 3L01A 1PEDA 1NWHA 1J39A 1O9HA 4EG1A 4WERA 1FIUA 5IH7A 1XKLA 2VP4A 4DGSA 1VBNA 4AKHA 3MTAA 3HA3A 4I9GA 1DAHA 2YWHA 4MW1A 1BMQA 1ZMXA 8LDHA 2LW7A 3I0MA 3RUAA 1ZSYA 3GI1A 4I50F 1JQJC 1KI1A 4LAFA 4TQAA 4KSYA 5AOAA 3ORQA 2C5FA 2DHRA 4QVGA 1SIUA 3QWHA 4IJ5A 4K86A 3E82A 4OOFA 5KCZA 4H59A 3U4MA 3TQTA 2PA0A 1W35A 2VRCD 3HJHA 4HZUA 4XVCA 1R6DA 4DNFA 1Q95A 1MGPA 3NEPX 1OXUA 4I19A 1UM8A 4WGGA 4QRIA 1Q6YA 3EZ9A 1WSBA 2HMWA 4URHA 1C14A 1XLTA 2BZSA 4PO8A 4BLSA 1RC0A 2Y93A 3I0NA 5IWAB 5BY2A 3K73O 3OZXA 4FMCB 5FOTA 4P3XA 1XYYA 5HFAA 5BVGB 2NM0A 2Y66A 2BBOA 2NT4A 3A1NA 2L17A 3RC1A 4DSTA 4OK6A 3SHWA 2A0FA 2C7OA 3UKOA 1FYWA 4JBNA 3K16A 1YZYA 3ADPA 5ESRA 1Q84A 3ELWA 8ATCA 3KR2A 1TA9A 2CK3D 4NBUA 1NUUA 1NBAA 4LRWA 2Z9CA 3INTA 4NENB 4OQQA 4QXRA 5DWDA 1H3EA 3QLUA 5DBHX 3WGUA 2JA2A 5FLKA 1XEWY 3RAJA 4AMZA 1HUQA 2RC6A 2WU3A 1TYAE 2XXBA 4E15A 1XPOA 3A6HA 3RIHA 3V5NA 4D99A 4O4IB 3E9EA 4G07A 5CTJA 3N2GB 3DZKA 3TOVA 4PX2A 4DA4A 3DS8A 4XGKA 3EZNA 4FT4A 4G2NA 3IA7A 3DHVA 2FP4B 4LRXA 4RNCA 1R2QA 4UE3S 1DKQA 3BFXA 1E7RA 5A6SA 5LOVA 3QWBA 2X8AA 3IHLA 3MJTA 1PS8A 4B3FX 4ERNA 3C5EA 5ALPA 2CXQA 1PT8A 1T5HX 3MCTA 3QKRB 4YCJA 4ZP1A 2AV6A 1C4XA 2FP4A 1EFPA 3RI3A 2XGOA 4DA7A 5COAA 1TJ4A 3ZHOA 2F1IA 3N70A 3PVCA 2I76A 3KB6A 4I1VA 4N6GA 1GQYA 5DVZA 4BMOB 4D0GA 4EMUA 1J5PA 3AI7A 1DKRA 3AERB 2H59A 3OX3A 3UYLA 1ZJWA 5EMKA 3TLBA 4NS1A 3CNQS 1H9CA 2I7XA 4AUNA 2BSXA 3L6UA 3KLBA 2NTJA 4AUKA 1QH1A 3CB4A 3GJTA 1MVOA 2G9RA 3PWKA 3P9XA 3IR7A 4N03A 1YC5A 4P7BA 3V80A 3ND9A 4D43A 2V9PA 4U2FA 1FF9A 3HM2A 3KJEA 5BVGA 1FW8A 1XQ9A 2BEVB 1I4DD 1JFFB 3NTQA 1KEZA 1TTTA 3TSYA 2WHPB 4FC6A 2BMVA 4KV7A 2AZXA 3HXPA 1Z2CA 4NNPA 1G8FA 4NH0A 1FVFA 1PSDA 2Q5EA 4ML3A 4WNAB 4CYMA 1F38A 5B2EA 4I4IA 4QXOA 4DCVA 2D13A 7REQB 3TZLA 4ND4A 3L2OB 4OU4A 5F7XA 5J2TA 1Y4AE 4P84A 4DJJA 4FGLA 2VG8A 2GI4A 4FGWA 3IE2A 3Q88A 3PU6A 1WJGA 1DTWB 1UBSB 2Z6VA 1G4UR 4CM8A 4BECA 2GUWA 1OXXK 3G8YA 2PUCA 1Z2PX 4PG4A 1RE0A 4OQFA 4EECA 3ECCA 4OI1A 1D4FA 3C3MA 3ITKA 2FKNA 4MJ3A 4D56A 5C3MA 2EBFX 2HHJA 2AMJA 3HNOA 3TPFA 4YAFA 1PTJC 2QZSA 1GPLA 3IQZA 3ZWOA 3FOFC 3GUCA 4O08A 2D3WA 2B34A 1J9ZA 1P1HA 1RQGA 1ZXLA 1LQTA 3MJCA 4FX5A 3STTA 4A7PA 4NOLA 2R8ZA 4XGRA 4P4LA 1II8A 3F7NA 1DT5A 3TIGA 2W2LD 1NVVQ 5JY1A 2IPXA 2QAIA 2WE8A 3QOXA 4OI4A 4GEGA 3UG6A 3Q3JB 2FZKA 4RA6A 1V0JA 3MTGA 1QANA 4WZBE 2FXIA 1E7YA 5ICMA 5HSGA 4R8MA 1TCBA 4ARVA 5EERA 2WWHA 5FTMA 1IMJA 5SV2A 4HNUA 4LDRA 4CETA 2SCUA 1RM0A 3N5KA 2G1PA 4LQ4A 1RR6A 2JI6A 4M0DA 3L8YA 3M1IA 5FBWB 4MICA 4B3XA 3RSLA 5CVDA 3H9GA 2AMYA 3V2HA 3C5VA 4R1SA 3VHRA 4ZDWA 3CLUC 1YZQA 2P4UA 4NMMA 5G2OA 2XF8A 2X0RA 4PSKA 3QI7A 3N2KA 1MOPA 3RS0A 3S0JA 3KSMA 3ZI7A 2P9HA 2VJKA 1U81A 3MRXA 2GLTA 4I55A 4DKXA 1BQEA 1XVLA 2PZFA 3PEWA 1GKLA 4YJ3B 1TO1E 3RE1A 3JAWB 2Y0BA 5EGNA 3ZGNA 1CJUC 4M8KA 3ZQ4A 5A71A 2QTNA 1ZMOA 1HXHA 4UEKA 4BL5A 5DFAA 2J41A 4CZ2A 4D26A 3QU4A 1ZGAA 1X94A 2E0IA 2J3JA 2HLDD 3D2AA 2PRZA 4XDZA 3P9YA 1LJUA 4XYBA 3RIEA 4FEYA 2E9SA 2UVDA 1KVQA 3X1WA 1S2LA 4PR0A 5EXEA 4F3KA 9LDTA 4C6RA 1GYRA 2B82A 3OUUA 3DYBA 3F3MA 1LVHA 3HN2A 5BMVB 1F4LA 3ORYA 1PQYA 1XI2A 2EL9A 1L8AA 3H5OA 5E3IA 5DGTA 1IQ0A 2YBEA 4WZ6A 1D2MA 4GZMA 4BX2A 4BE7B 2VRCA 1XHFA 5B1YA 1ZM9A 2WVAA 1ACMA 1SZCA 3UKDA 1KI4A 2Q3DA 2IP4A 2BGLA 1THTA 1YBMA 1BH6A 2X7XA 1RZRD 4QO8A 1T2AA 1LPPA 2W0MA 2GZRA 4JKYA 4HDQB 3GUZA 1CNFA 1NPYA 1EVIA 3EBLA 2OGWA 4MP8A 2PUGA 1TCCA 4K6FA 3TO5A 2Q8NA 3HUTA 4JX8A 4EEKA 4RSHA 4OXKA 4LHEA 4QFDA 4R9SA 5TGDA 4GKAA 2CXUA 1P44A 1T3TA 2HRCA 4BVJA 3AR5A 3VSCA 4CLXA 1RCUA 4FJ1A 3LDGA 4HLQB 5GWXA 1AOXA 1XL1A 2MMGA 2YOFA 4WCFC 1FSFA 3VMMA 1JLRA 1Z0AA 1QE5A 2FWBA 2GNPA 3E3AA 4PR3A 3L82B 3PUXA 3A2LA 1SRRA 4UXIA 4F9EA 2HJSA 4P53A 1VRWA 5JYCA 4FGUA 3OLXA 4YJ3A 3L8DA 3TLCA 4LC1A 1U8XX 4NK4A 4K6MA 1F60A 1XAIA 4O3FA 1K9VF 2WKSA 3HABA 2H17A 3SZLA 3TCKA 3AVUA 4UDOA 5JD5A 5KIAA 5CEFA 2DZDA 2NP6A 1Q12A 2IHNA 3RVSA 4B6SA 2B8TA 4B34A 3T3IA 4D9CA 4AY2A 5CM2Z 3CF0A 1XNRB 2RI1A 1FP7A 3I61A 5FJIA 4PCAA 4D42A 5U9CA 1LW7A 2R1VB 4O8CA 5DJ5A 1NDQA 1NVBA 5CH3A 4WT7A 1ZUWA 1JKJA 2I6SA 3DMPA 1DC5A 5FPYA 1XJCA 1U3DA 1YK0A 2D00A 3LA8A 1I7LA 2IX9A 1M1YB 2GCOA 1WHSA 1RXIA 2PLNA 2WB4A 3DAFA 1ONPA 4UTXA 4B6GA 3VH4A 4WASA 3RUFA 2BGGA 1FTWA 2O2SA 5LDHA 4MR9A 1K7CA 4GGPA 1WUTA 1AGYA 4E5NA 2H2AA 1YNOA 3QPVA 3RS7A 3FHCB 3NQ41 1SOUA 4W1RA 1LV7A 3E2MA 4K81B 1O0BA 2O2GA 3V1NA 4HP8A 1EFPB 1EQUA 2ZI7A 4MYUA 2H3HA 2C9OA 4JU9A 2YINC 2JGJA 5JPCA 3ZZ0A 1P7VA 2PA3A 4ES6A 1KH3A 3FCAA 1DX9A 1V4VA 3LBAA 2EHJA 3NDJA 3PZBA 3R6GA 2N47A 4TVBA 5JWHA 3RIYA 1U9IA 3HFSA 4DRZA 5AVSA 2J9FA 4D3XA 3OCCA 3AOEC 3OQJA 3G02A 4EVRA 5JVDF 2CDCA 1AVTA 1SPXA 3QXGA 2XX3A 5PGMA 3VYUB 5F9FA 1PK8A 5JZSA 5HTKA 1YCFA 1PWYE 1QIEA 3B1KA 9ATCA 1IRIA 1HOXA 2D6FA 3OEHA 1DKOA 1T10A 4HWRA 1CUFA 4KIJA 4S1OA 5EZYF 1H2YA 4YI3A 3HMKA 2ZDQA 3BWCA 3CSUA 3IP1A 4HDNB 4I8IA 4DCSA 1SXIA 2G1JA 7REQA 1N5KA 5DM4A 5F7JA 4ZDJA 3T94A 3NETA 1U8ZA 2DKFA 2O3RA 2C97A 3N7AA 2WUEA 4RZXA 1SC1A 3WGQA 1WSDA 3JRXA 5FA6A 2V5VA 3MBOA 1Q77A 2M1ZA 5TDHA 5F4BA 1M8PA 1G7SA 4A2CA 2NO1A 1QJCA 4N9QA 2W2TA 2WSSD 3FE2A 4FYYA 5IS2A 1M1YA 1FBTA 1XTBA 2O1EA 3D6HA 1VGQA 2ZIUB 5ITVA 3HCCA 4KQ9A 4Q47A 4WV3A 4B83A 4Z7QB 2QTFA 4E4YA 4FKBA 3WZ2A 3VPHA 2E4VA 4LVUA 2OHOA 1YU6A 2ZYVX 4LHWA 3JARB 3NUQA 4LISA 1ENZA 5EHIA 2WHYA 4WOJA 3ETDA 4PPFA 3SJAA 1EPUA 1QONA 2IPOA 1SU8A 2MSWA 4Z9AA 3AEUA 2VBGA 3DW1X 3LPCA 1B8NA 1HURA 1PBTA 4FW8A 5DLEA 4DXAA 1ZIOA 1NKTA 2YXBA 1DDGA 2J5RA 3D54D 3FZEA 3KJHA 4XH9B 1YU9A 3UTDA 3QHAA 1E7SA 1XVIA 4FU0A 3MHTA 3E3MA 3FDXA 1PS0A 3K9LA 4RIHA 5CX1A 3T0FA 1MR3F 3BRWA 4E0BA 4IF6A 5EP2A 4PS1A 1NOKA 4X62B 2QG9A 1OI4A 1V8BA 4L2IB 3C24A 4B3HA 1L4GA 4DPKA 2CLLB 5KPJA 5BW5A 2Y0EA 3K1ZA 5EUMA 2DCUA 3AMVA 1GPUA 2GD6A 6AT1A 4C2UA 1EMDA 1N7HA 2IPMA 2Z1MA 3G82C 1QORA 4C4XA 2I4LA 2L0XA 4N47A 4ZO6A 1UXJA 1J4AA 4OQXA 4QREA 1V5WA 1UJMA 4Y0NA 3LZ6A 1GPYA 2FZGA 1O5TA 2VDQB 1I6LA 4Y67A 1X7YB 3VYVA 2I6TA 4YCSA 4CJXA 1NW5A 1IOLA 5JROA 2QX4A 3EXAA 2AOVA 4L07A 1KNXA 1Q0PA 5LDGA 1DP4A 1TUIA 4PPGA 4B3BA 1JP7A 3RSHA 4J9UE 1Z4JA 3KUKA 3OJLA 4M0KA 4QUIA 4R9UC 4XR4A 4U6NA 5CK5A 1P1RA 5HQJA 1YR6A 4OM8A 4A5OA 4AT1A 1L4EA 2JBWA 4M9RA 3FWZA 1TL7C 4U2EA 1T5OA 5FV7A 2X23A 3THOA 3URMA 3TECE 1W34A 1O0CA 2VYQA 2QUAA 2V59A 2EDAA 1ZM4A 1RJFA 3A14A 3K9CA 2WPDA 5JS7A 3LWBA 3FTDA 1MV5A 3SS8A 4E46A 3DH0A 5CP8A 1SR8A 2FUG1 4NE9A 2WIBA 2DJIA 3HACA 3E61A 3THXB 4IHJB 5C0OE 5DM60 1VSTA 4HZUB 1B7GO 5JNRA 3C8UA 4D3YA 4FYMA 1G5HA 4HFRA 2C2HA 3DFIA 2NVUB 1YJBA 3U6KA 4KMRA 1P1FA 4RHTA 4UASA 2QK4A 5HMLA 2Y1GA 3JQQA 1XF9A 3NUGA 3ZWAA 4BDTA 3GBSA 1SVOA 3L0PA 1M2JA 4Y9UA 5IARA 3OIGA 4P3NA 4OP1A 2NUPA 1QZ3A 4RXUA 5E0KB 2QTVA 1NONA 2LDXA 2AOUA 3OIWA 4M1ZA 1P77A 3KL4A 1NA5A 5I3CA 3Q8MA 1V11B 2PUHA 2J32A 2HV8A 2BFWA 2OKGA 3MCVA 2YUTA 4EP1A 1KSFX 1BHSA 4DV0B 1TQ2A 1O94A 4MYDA 5AKZA 1FE8A 3LAWA 3QFCA 4G0XA 2P9EA 4P9NA 1E2PA 4KGDA 1NN1A 4PAOA 1FB5A 4LTNA 2O3SA 1IC6A 2YR0A 3STWA 3AB7A 1QO9A 4II3A 4ILEA 4DLVA 4B1FA 3RU3A 5A1TA 5CA1F 5J4LA 3L7MA 4AZ0B 3CX3A 4BMZA 1AGNA 3C8DA 3PR1A 4P5DA 5BRAA 5KSYA 1W1WA 1M2WA 1GNRA 2HB6A 3ROXA 1KJZA 1LQ2A 2EWVA 4WBNA 1EB9A 4L5BA 4EF4A 1T6XA 1MJGM 1TEHA 4GVXA 1V45E 3QPAA 5J4KA 2IPLA 3LUAA 2GKSA 4H35A 2PQ2A 4J29A 3HA2A 3AJAA 3PX3A 4HUJA 4XIJA 1EDDA 4A0SA 1QAMA 4B5KA 1ORWA 1P80A 5F76A 2IU0A 1VG9B 4KAFA 4XVRA 4IDBA 2OXRA 5EQTA 1O87A 4DT1B 5KKAA 1C9YA 3CNEA 2PT5A 1NATA 1PVVA 2QROA 4I9FA 4LXQA 4FFBB 3ZDQA 4DV7B 2AZ4A 2PAFA 3HSSA 1ZS9A 2V7TA 1RYDA 1XHLA 4AYXA 4CBVA 3TRDA 3GEDA 1IN8A 3GP8A 4B3GA 3AP1A 1HV8A 3B7PA 4UOEA 1BGVA 3W9BA 3P97A 1NSTA 1XVUA 2D7CA 2QF7A 3GEPA 1WDLA 5E7QA 2VAWA 2ZR8A 3RTAA 4MYSA 1ZIDA 1J99A 1OROA 1K5GA 1OXVA 2VYVD 4RQAA 4F2HA 4HDSB 5TC4A 4BRWA 2GKOA 4I14A 4R1LA 4XWOA 2I3DA 3FTQA 4EO4A 3IULA 5D7NA 4OFXA 1PJ2A 1VPLA 1PLKA 1COZA 1OH6A 4ZYWA 1WB5A 1TC2A 3AOEA 3CONA 4I3HA 1WW8A 2V98A 1G4AE 3G0GA 4PVDA 5FUMA 1A77A 3IPXA 1MB0A 4W9NC 3HR8A 2XY4A 5HBRA 1ZVQA 4MKZA 5CEJA 2I62A 1YRQA 4PGMA 5FYDA 1R66A 4IOLA 5K0ZA 2R6AA 1K0FA 2WINI 2NVWA 1YFJA 3AQIA 1QDLB 1E1QA 1RAIA 1E6WA 5FDFA 1WF6A 4HQLA 2EIHA 1N5JA 1TECE 5LU9A 3NKVA 2ID4A 4ER7A 3HCDA 2HWWA 1XYGA 1OFTA 1R1DA 1UKAA 1ZHHA 2GLXA 2ISCA 3C6BA 3D7LA 5BN4B 2F43B 1SJ9A 2GPYA 3CN7A 4JR0A 5JEEA 2V0CA 2X0KA 2XYGA 1IY1A 3EEFA 4UAVA 2WP8J 3NRJA 1FNDA 2ZCUA 4DIFA 2A2ZA 4EJMA 4IG4A 3HLYA 5ALFA 1EXMA 1FVXA 1L6RA 1T9ZA 2HIHA 2O8FA 1GPKA 1CQJB 3LUPA 4PSCA 3VDMA 3IP3A 4P3YA 1EWVA 3BD8A 4JUAA 4KQ2A 1YGYA 1X1AA 2W9XA 3AWDA 3CF4A 3LOPA 4OMDA 3P2YA 2JCSA 1QGUA 4PYIA 3WNDA 1TIBA 2CVHA 1TW3A 2JW5A 4FKZA 1RHRA 5MFZA 3Q7PA 3R7LA 1JT9A 1UJBA 1YRWA 4FSDA 1K88A 2Y4OA 2QUHA 5HKKA 2AG6A 3GARA 5JIBA 2R66A 3D4NA 4JBIA 1UMCB 5DCLA 1NAIA 2G1UA 4KVZA 4HWKA 2YZ2A 3PFFA 3M4XA 2G76A 1OBHA 4FBLA 4OOEA 1QZTA 1EVKA 2JZNA 4QUAA 4YBRA 4YRQA 4N5DA 2LCQA 1QLHA 1XCLA 2WQZA 3BM5A 4PINA 1DELA 3AEYA 2B0CA 1ORTA 1MORA 2WKWA 2VCEA 4PSDA 3RKRA 3TKAA 4BGIA 4WCVA 4E5SA 2Z8YM 3Q8WA 5FB3A 1Y1PA 1Y8QB 2NW6A 3FW1A 4NPCA 721PA 2DQ4A 3AVXA 4L50A 2FSIA 1C5KA 2YW2A 1NY6A 1F6WA 2EZ9A 2ENWA 2OP1A 3G5TA 1PWEA 4Q37A 4DILA 4U7DA 2WMOB 2BOVA 2G72A 4DMGA 1VIMA 4M0MA 3MILA 4WKNA 2RH5A 1HQCA 2R00C 4W5OA 5ALLA 2JHGA 2F43A 1M0WA 3QENA 1ISHA 2G77B 3PFWO 1PR6A 3DF9A 1U7UA 4QODA 3OEWA 5KMGB 3S40A 1YJAA 4ZT4A 3CTMA 4EHIA 1YZKA 2PGIA 1U0JA 3AW9A 4YUZA 2PGLA 3PPYA 3A6EA 3NDPA 5HFJA 1AKYA 2V9CA 1SG9A 1Y4DE 2AEMA 2FQYA 2J4CA 3FWYA 2SHKA 4TTJA 3VM6A 5THQA 1JL3A 4YUWA 2D5CA 1T1IA 2PVSA 4BNFA 4G5SA 3M3DA 2QTTA 3KO8A 5JNUA 3B7WA 1Q7TA 4AIIA 3UMRA 3M34A 5I7WA 2XCOA 5AXDA 2G7MC 5K1ZA 5K3EA 1KH2A 5KNDA 2HCTA 3BE6A 3NIFB 3QUTA 1EHYA 2RD2A 1VPWA 2OMEA 1FFBA 1EFVA 3K0CA 1Z47A 3NNSA 4IFIA 4L16A 1CS0B 1WF3A 5CTAA 5BQPA 5DNWA 3IB6A 1U02A 2ZYUX 1W5BA 1YA8A 4EYGA 5EGSA 4AUEA 2P62A 3VR6H 3LHDA 5JC8A 1V95A 3A9WA 3EGVA 1CIVA 1EQAA 3LNCA 1LEHA 1NVWQ 1QDUA 2R9VA 4JBWA 1C8BA 1CUDA 3ER9A 1PJTA 2LPMA 2XB9A 4CIDA 1I4EB 5E1MA 4R2WA 4GQIA 2DKOA 3M6VA 3FTCA 4LI0A 1TKRA 3DMFA 3IX7A 2QN7A 1WUYA 5TEWA 3TE6A 2YRXA 4E5MA 4G8JA 1K5PA 2FWIA 2DWQA 1X39A 1AE1A 4WVLA 2WWYA 5K3OA 3N39C 3X43A 2FDXA 1Z6AA 3TD6A 4RM2A 1DQNA 1EH5A 5E4YA 4YDSA 2N42A 3PUKA 4C0WA 1SXGA 4JAVC 4NJEB 3E9MA 3RYCA 3U2QA 3K9FC 3E9DA 3AEXA 4BQNA 5K0SA 1X8JA 2ZFUA 1UBMS 4BJ3A 3G9ZA 2JVJA 1ADJA 3EG9A 1Y5MA 4HX5A 4RYLA 1AZSC 1ST2A 3WXBA 3DOEA 1ETUA 2OAQ1 4DUYB 3TPZA 5CAEA 3OZSA 3LCCA 2ZYAA 5KX5B 2CT8A 4BFZA 1GGJA 4YYZA 3FNQA 1AK1A 3TTWA 2BGMA 3OZBA 4M8NE 4TYPA 4RIFA 1KEPA 4D8TA 3WDSA 3SXJA 4ZT5A 3SFVA 3CKKA 3Q3GE 5CNJA 5DSTA 3BN3A 4LZNA 4WMLA 3I01M 1TFUA 1J8MF 2ZUVA 3FMOB 4YCLA 1APBA 2AQKA 1SB9A 5BSUA 4PBTA 3N2IA 4E2XA 1JDPA 4IJVA 3ROFA 1BS1A 4MDYA 1OWOA 1MIOA 4ZVKA 3DQQA 5DNEA 1M7HA 4DLPA 1HT3A 1MO3A 1CW2B 2I2AA 2JEOA 3QKTA 4JVMA 4XWGA 1E4YA 1PL6A 4HVAA 1JKXA 1JEEA 2DR0A 4U7PB 1FOEB 2NSYA 3IAAA 2GCGA 4OKIA 2J31A 3L6EA 4ARZB 1ZU4A 1JG2A 2J0VA 2XLCA 3O9MA 3WGKA 4OSPA 3V4FA 1XPUA 5CU7A 2X4LA 1UIRA 1C50A 5FORA 4Y2XA 4MQUA 2ZUWA 4IVPA 4BLVA 3C14C 3GRYA 5JZBA 2I54A 3KAKA 4GIBA 4MCAA 1AUPA 10MHA 2V8OA 3SLRA 2FEPA 3KHUA 1YHZA 2FOLA 1CJTC 2C7RA 4D4LA 1I3KA 5LFAA 3RRJA 3JALB 1NFRA 3B52X 1LRJA 1PQUA 1U3CA 1OXKB 1A04A 3NHSA 1OVGA 4WLEA 4XE5A 5G53C 3GCGA 1PSWA 3BB4A 1GFIA 1LWOA 2N0SA 3PX7A 3LZDA 2RH9B 2ES4A 2RAVA 4JI4B 3PGXA 1GSAA 2FZWA 2QN8A 3KVOA 1UKCA 2P3SA 2MMCA 2BI7A 2W2KB 2WVJA 2OV1A 4OGGA 4YJGA 3R7FA 4ALLA 5JYDA 1P45A 4CMIA 3F6PA 5F7OA 1WAMA 1B8OA 1LB1B 4TRRA 1G8AA 1Y1RA 2VJYA 2Z1NA 3A9TA 3ZCQA 1SD1A 4YCMA 2EEZA 4EHNA 3QVGA 5B6PA 4ANFA 3N6RA 3WDLA 4EJSB 3ZVNA 4K9OA 4M8SA 3BXEA 4WUVA 1OYWA 4F5ZA 3RWMB 1D5WA 2ZI4A 4J2HA 3OM9A 1S3IA 3VVCA 4H4DA 3I5AA 1XA0A 2PKCA 1O58A 4BQFA 1UZLA 1TRKA 1M72A 3PNQA 2FWNA 2BRUA 1ZH8A 3PEEA 3RHSA 2PSFA 3KK0A 4ZAYA 1YQEA 2QGNA 1Y7TA 3V4OA 4CQMA 1Y8CA 5HKBA 3KQUA 3JWHA 1G59A 3UYKA 1H93A 3EWNA 3CW9A 1PGJA 1UEXC 2JCBA 2PHZA 2V7BA 3SQLA 2YMMA 1D7OA 5CITA 1PJ8A 2X8BA 4JB0A 2IYEA 3CZMA 1DBQA 1GLGA 1XTKA 3EC2A 3QBJA 2FK8A 4EYOA 4OLAA 3JQ9A 4EI9A 3U0BA 3NHRA 4WBNF 1PJQA 3COVA 3Q1KA 1CY0A 4TLEA 5A3JA 3BD9A 4XI9A 1L7RA 2DTEA 1PZXA 3H1TA 3LLSA 1FQJA 3OU7A 4JQOA 5LA6B 1BDIA 1JTEA 2PLAA 1QXSA 4Y2RA 1I01A 4YUYA 1FNBA 2X3FA 3IIMA 2VDKB 2GZ2A 3AUSA 4N3AA 5AO9A 3SC2B 4DG9A 2J3DA 2AWNA 1NFFA 2IZZA 3DE7X 4G4GA 1TK9A 4IRUB 5C8VA 3ICPA 4EGAA 4ZI7F 3NNDA 3ZGYA 4CFSA 5KNBH 2D2XA 3COZA 1S2OA 3W79A 4RV5A 2PUJA 1BXGB 1R5JA 1A69A 2Q1XA 1NZJA 4FC7A 5KJ1A 3OY7A 5L3VA 4PG6A 2N46A 2OB1A 4TXJA 5LP6B 1LBIA 1RD4A 4J16C 2XI4A 5JH7B 1KBZA 3QX8A 2C8LA 2C8KA 1X87A 3O73A 2D54A 2YX1A 4L5IA 3M6WA 4ZI2A 4ZC8A 2V6IA 5IF9A 4BHTA 4FX2A 5JADA 4OBEA 3WL6A 3WK9A 1VMEA 4V0SA 1TQDA 4U00A 3GFRA 3IEKA 5EQDA 5TS3A 2ZROA 1W25A 1QQ6A 2QGZA 3BERA 4A6PA 4ZHQA 2QBYB 4QGBA 5JS2A 3RV3A 1MG5A 2CHVA 5CVTA 5AJXA 1AQYA 5LKRA 3PC2A 3W2EA 2AOTB 2AJLI 2BHSA 2J0UB 2RIPA 2ZJFA 3AFOA 3Q11A 4AS2A 4DBVO 3E8SA 4ID9A 4MVXA 3TQFA 3U6BA 4CCYA 2JK1A 2AC4A 1EB8A 4L72A 1UBLS 2C2MA 4NLLA 3MWKA 3TSZA 3H2SA 3R3UA 4KFRA 1V47A 1DOHA 1P4SA 1TCVA 3NRCA 3KTAB 3WWDA 2D0PB 1FU8A 4P7FA 2GZMA 3T9DA 1Q0LA 3TTSA 3VZQA 5JCOC 3WIBA 1E1QD 4L28A 1TM1E 3PDJA 1E1MA 2NXEA 4QAQA 5DWVA 5JY6A 4B3SB 2GFHA 4KHPB 1RT9A 1RADA 1YBVA 2ZBPA 2QMUA 3VGPA 1K6JA 2NUTA 5KWEA 4OYLA 3UK2A 3TZBA 1OKKD 3SQWA 3P5SA 2JKYA 2DPMA 4QUHA 3TW8A 4XIFA 1TAGA 3RFCA 3B9BA 4RE5A 2HWUA 3VR1A 3SKXA 3EW9A 2O8BB 3VNSA 1MC1A 1XXHA 3E5HA 3Q40A 1E6MA 4PZPA 3R3HA 3ZWPA 2DM6A 4FCCA 4LBWA 3F7MA 2Q6OA 4D3DA 1RAFA 5KOYA 1QP7A 2VNKA 1DJPA 1B43A 1ULBA 2YHIB 4M0LA 2QVBA 4TRMA 1EWYA 3WDMA 5EZYB 1ESCA 1V25A 4I5GA 3USES 3C7KA 3U26A 3GGCA 2CHGA 3ACCA 2FMXA 3F0TA 4F04A 1TT5B 3V2GA 2EYQA 4YJ2A 2FJPA 3FOWA 3QW4B 1EUDA 1KYWA 2QY9A 3HZHA 4UHFA 4AMUA 2C1ZA 4J1TA 2HSDA 2I4NA 3R75A 3D6UA 1C1DA 2YJTD 1DXHA 2H4XA 2OEPA 2YV4A 4FDAA 4HO1X 1OHHD 2C03A 1GN8A 3HO8A 3MTQA 4IFBA 1PGOA 2FPIA 3Q8XB 1IN1A 1XJ5A 4KQMA 1YULA 3LDHA 3CLSC 1UDCA 3OECA 3SIPA 5CBKA 4RK6A 1EA5A 4IQ4A 4V0KA 1V8FA 1P7PA 3N74A 4HLCA 5L3QB 4HAOA 2BUAA 3JVUA 1SKQA 4PZZA 1O6GA 4FGJA 2HWKA 5TQ2A 2FN9A 2FZ5A 3L04A 5A0VA 1QH8A 2B20A 3IILA 3L1HA 3X1XA 4YV1A 1YVUA 5HJEA 4ABYA 1H8EA 2PX5A 3P26A 5AH0A 3QLUC 3IEUA 1XQ6A 2RJNA 2V1UA 4RHYA 1RNLA 2QVYX 3O47A 5EVCA 2VAPA 3CUEF 4YAWA 4F6LA 1Z9BA 3IT2A 3ZJUA 2EFDB 3LLMA 2GK3A 2Q3MA 3E15A 3N53A 1KXJA 1MQ8B 3G2NA 1TEZA 2X8WA 3DNMA 4R01A 2CLFB 5FL7A 1DI0A 1E7WA 2Q2NA 4ND6A 1A7UA 4WQMA 2NGRA 4RETA 1CUXA 4IOJA 4NZPA 3LPLA 5A9SB 3ELUA 1WHTB 2GYYA 3V3KA 3V97A 3KU1A 5EZSA 1UMCA 4M86A 2BM1A 3I92A 2Q45A 2FZVA 4KEAA 5MHTA 2FZCA 4FZ5A 4E07A 1G3MA 2REBA 3P2JA 4D81A 3ASZA 1VA5A 2BFEA 1Z13A 3JQ7A 3LQYA 3AH8A 2IOQA 1ABEA 5A9SA 4KR9A 4PO9A 3TB4A 3TOZA 3M2TA 2VQSA 1L9XA 3MGGA 3PYXA 4YX9A 3HSYA 3RVPA 1FXWA 3BUSA 3TTYA 1AK2A 1X7XB 1U7XA 1Z2EA 3REGA 1AZLA 1QLWA 3L6OO 1C0IA 3OMXA 1KDVA 2OPHA 5FQOA 4GX5A 2YXPX 4WJZA 3ZGXA 3ESCA 4HFNA 4F3RA 4R1TA 2JIOA 3UT5B 2HFJA 2YFHA 4UBLA 3VZRA 2BMJA 1KKLA 3MS7A 3HK2A 1HLDA 1Z5OA 6GPBA 2C7QA 5KTNA 3JU3A 1T26A 5D3QA 2HTFA 4BASA 2K7FA 3WE7A 1DBIA 2MYPA 4M7WA 3NH6A 1JYFA 5DCYA 4CTMA 2I4RA 3KAPA 1NT4A 1G5TA 4W63A 3HGMA 3T3HA 5BNWA 4AY6A 1F9AA 4NBLA 2NZXA 3UIEA 4NULA 2ATCA 2PL5A 3HADA 4KR6A 2HCRA 2F1OA 1RKUA 1PL8A 2PPLA 3EA4A 3H75A 3ZIUA 2F67A 3M82A 3MUOA 1DX4A 3TAHA 5EJEA 4F93B 1EXWA 4GOKA 4L6IA 3QTBA 3O2SB 3X2SA 4DSNA 1YE8A 1KOLA 2XQFA 4JWTA 2OK8A 4NBTA 4Q4CA 4WBSA 5JASA 3CKLA 1QZXA 5T8KA 3ZQJA 5C9ZA 2F59A 2IHUA 1DUVG 2IDZA 3IV6A 1BW9B 3ZKWA 5B2FA 3T4XA 4J76A 3VYRB 1ND5A 5HF8A 2WU4A 4HFMA 3ZJ4A 5C1PA 4I1IA 2Q0QA 4MV3A 2UYGA 5KSPA 4PBRA 1ZQ1A 4B3IA 3TG8A 2I6FA 4MXDA 3T61A 2X1MA 1KIFA 1K7YA 1Z17A 3FCXA 3GMIA 3B5JA 3N2YA 4NG5A 3TS1A 2Y1WA 3D3WB 1Q11A 3C2QA 3WLHA 1VPVA 4EVSA 3GRVA 3I6BA 5T3UA 2XAAA 3ZBUA 2A3RA 5BURA 4URFA 1YWGO 4ZEXA 3HCWA 1RKQA 2WNIA 3FUWA 3L46A 1U3GA 3BZBA 4I8DA 4RZHA 3AL2A 3G5UA 4Q4HB 1RQ2A 3K72B 3ZDXB 1T0UA 3ODGA 2DFPA 3PQ3A 5KDLA 2JIZD 1XJ0A 4O4JB 3WLEA 3PRHA 1N6RA 2OL4A 4BO7A 3O31A 3EIXA 3GGGA 1E4EB 3AG6A 3E3NA 4X45A 2FPPB 3OJFA 2R6DA 2R48A 4LYHA 1AUXA 4A91A 1H6BA 2FPLA 1WCV1 3GJ5A 3I5XA 3H9UA 3HUDA 2ZI9A 3GA5A 4LQCA 1MPXA 2B4TO 4QU0A 4PAMA 5CJPA 2A1UB 2X9GA 5J5VA 4D02A 3AGPA 1KZ1A 1VA4A 4MW6A 1QHEA 2J33A 4ZCRA 1D6JA 1HT2E 4ZZ1A 1ZCFA 2R85A 5CBPA 4RGQA 1WABA 4WEOA 4FKMA 4K9KA 1LF0A 4QUJA 3NTRA 5FBKA 1DWPA 4I66A 3FCYA 3QLVA 2C4HA 1JJFA 1ECJA 3A36A 1OUMA 3GWZA 4C4TA 3WQHA 5LP1A 3NAMA 1U2PA 5FPQA 4ZQIA 3CINA 3JQDA 3ZV5A 1BRMA 4HB2A 5HDBB 2FI1A 2LDBA 2WG2A 3IYLW 4YIKA 1DOAA 1FYDA 1G2PA 3N6VA 3DOJA 1YS2X 3AUXA 2DB3A 1LBEA 2HF8A 2Z08A 1AKWA 1HKHA 2OKCA 4LRTB 4V0LA 3UWPA 4BVKA 5F9HA 3M6MD 1NZFA 1ORIA 4WDQA 5AIBA 1JIIA 3LXUX 4J07A 1P73A 3AL0C 1U8EA 1DARA 3JQ8B 4KN6A 4NY1A 1L4UA 1UJ5A 4OU5A 3OO0A 1MLDA 5FPPA 2LKDA 3RFVA 4C08A 3S5UA 2UUCB 3ZY6A 4Q21A 3OLZA 4EVIA 2PDAA 3K9HA 2CLMB 3QV1A 2WT9A 4H1TA 1FPMA 1KGSA 2Q9AA 3E35A 4MNTA 1W9HA 2HIGA 2Z3ZA 3N0VA 4YJFB 5LU8A 1JG7A 3GLFB 3RK0A 2LWIA 5EIHA 1Y8RB 1UWVA 1NHWA 3OM0A 4PU0A 4HS9A 1BVYF 1ZOPA 4FCWA 2QE7A 4KXFB 5EPUA 3RDPA 1JI0A 3FYHA 2Y67A 3EGXA 3LQFA 3VQTA 1RMTA 4W5RA 1IBKB 2CWDA 2QDKA 4KQKA 4JJZA 1AGPA 1P61B 2R97A 4NFSA 3LI2A 4UOQA 1FYEA 4KDFA 4EFNA 2Y2VA 2YN2A 4TZ0A 4ZCIA 3BRSA 2YIJA 1UK6A 4GOLD 1VLJA 3DA8A 4DYDA 4INOA 3ZWKA 4EZBA 1SQ0A 2YQ4A 3HXOA 5JARA 5H02A 2PH3A 4Z99A 3WQSB 3OG9A 5E4FA 4W9RA 1WVGA 4LYJA 4R2LA 1E2UA 3G1TA 2BEUA 3KFLA 3VNRA 4TTPA 2O1WA 4GW3A 4B35A 4EG4A 4FUQA 4NAVA 1GYQA 1ECPA 4F71A 4G89A 5C4GB 5I4CA 4OGLA 1U8CB 3A4IA 1S2NA 1F2TA 3UTCA 2OUKA 4P32A 3OZ7A 3RASA 1OC4A 3AT1A 2RGCA 4L4ZA 1Z15A 3HKDB 3GJ7A 2B3DA 3I4LA 4XD2A 1N6IA 1A8SA 3AR3A 3MJFA 4X1OA 4ACAA 5K8JB 2BL4A 5KU1A 3WSWA 4FP9A 4GZLA 2PD3A 3D3NA 4OLFA 1JHUA 2OENG 2QM0A 3ABIA 3THWB 1DOZA 4JBYA 1L1EA 3SWWA 1Y89A 3QEMA 4QULA 3GT0A 2FX3A 3LXRA 2ST1A 1EWTA 3CW8X 4AZSA 4M1SA 1CQXA 1UKYA 3C15C 1Z0DA 1SXJA 1K3FA 2IHVA 3W3AA 4DARA 2QI9F 4HQ0A 2YWXA 3GEMA 2VI5A 3OU2A 4CHGA 5G4LA 3V8NA 3BXPA 1Y33E 2YIDA 3E81A 2QN3A 5B4UA 2OORC 3EXG2 3I2YX 5FOVA 4ZEWA 5MGNA 2QVCA 4KUHA 1JGTA 1G7TA 4KKVA 1YDEA 3U3OA 1QQAA 2AOWA 2MU1A 3FOCA 1N2CE 4MRMB 5FOWA 5H82A 1QIKA 2A9FA 3L79A 1MJFA 3QF4A 3FHTA 2ZAGA 4V2IA 4GU5A 1QVRA 2ZBVA 1ZXXA 3LDUA 1W88A 4YWHA 5GVRA 5ICGA 1PUXA 3IV9A 3N6XA 4DIOA 3ZZNA 2COKA 2F3TA 3H8WA 1T8WA 1IXZA 2IOYA 5KQPA 3HWSA 2AH5A 1Q1EA 3IEIA 1KMMA 2Y9MB 4LS3A 4OA5A 3SN6A 5HIAA 4O1MA 5D5HA 3EDQA 2V6BA 3FPGA 3V8VA 2QG6A 2DLDA 1J0BA 5G4KA 1U8FO 1KWKA 1N2XA 3HKBA 3MIIA 4Z5XA 2VUSA 3L7OA 5JZVA 3EVGA 1E3MA 2AN3A 5JQGB 5PNTA 3KEOA 3G0OA 4ODIA 5JNWA 4AWAA 3GEHA 4YYEA 3M9LA 4BGVA 3JRNA 4GS5A 3I32A 4MV9A 2FYTA 2GJ9A 3GPCA 3SBDA 2FPWA 4L0DA 1JAXA 2HQ1A 3GEEA 1NR1A 3C8MA 2P6MA 1ZGGA 2RJ3A 3O1JC 3CH4B 3L0DA 2WJGA 1NE7A 1JSRA 5I9MA 4P7JA 3ZGVA 3DAPA 4BMPB 4F8EA 3PXCX 1NXSA 1Q22A 2PGDA 2WA1A 5K0JA 4MITA 1LLUA 2R84A 1C29B 5F1PA 3TEFA 4DJEC 3I5UA 4J0QA 1JFSA 3FBGA 4PAQA 1RKXA 1WBJB 1Z4NA 4AI6A 4CR7A 1TIKA 1CERA 4E21A 1XTIA 3GJSA 1W1IA 3EXFB 1ZJYA 3C3AA 3KQOA 5JXGA 3EMBA 1H1LB 1QJ4A 5LOVF 4OYHA 2B1JA 5CEEA 4R8RA 3OCZA 3UANA 4GNKA 3K6RA 5IJ9B 4BVHA 4KDEA 1SUFA 2XMRA 5AVTA 2GXUA 3R44A 4EY4A 4YRRA 2DBQA 1XZDA 3IURA 1YBAA 2BGJA 2GK7A 3M3PA 4WESB 5H1YA 4BVLA 5HFNA 4QJ4A 4FD2A 4G0WA 4ARSA 1P60A 2R6ZA 4I99A 2LCIA 1RPJA 1UKVY 4QDJA 4QXQA 3UXYA 3PNPA 3I8SA 5ERYA 4DOMA 3G0HA 4YAKA 3NKLA 4OPMA 4DY6A 2O5VA 4EL5A 1GFSA 2AC7A 2JAPA 3BWDD 3VBCA 4Z4FA 1SHLA 5T57A 4I3FA 3OLQA 2D8MA 2VSOA 2V3WA 1FJGB 2JBAB 1R0YA 1NBHA 1XK6A 2D1YA 2RHCA 2CVFA 1L4LA 3LW8A 4IIUA 5CW1A 3U9LA 4DIEA 1DX6A 1R8SA 4O4IA 5B12A 1WZCA 1H2AS 1EZ1A 3D4BA 5CA0B 1PS9A 2DLCX 2C9DA 1N2HA 2EHDA 5KYVA 4KN9S 4FINA 4BATA 5JU6A 3EWAA 3W0LB 5K03A 4DBLE 2F9LA 2QL6A 2HA0A 2I9PA 3OIVA 2W43A 1CZOA 1FTQA 1YMVA 3JXEA 4KZPA 2RGEA 4G1FA 2NO7A 1GLVA 2FW0A 2XVZA 5DHQA 1RXCA 1I6MA 2H1LA 3G9XA 4XLZA 2FRXA 3RB8A 3L02A 1WX1A 5DX1A 4CIWA 5IVKA 4U3JA 4BMXA 5LKAA 1N0HA 1F20A 3MOIA 2PJRA 3PNMA 4R9RA 3A1SA 3ZXIA 5JSHA 5LLTA 4F38A 1JBEA 1S3SA 2C84A 3PC4A 1EBBA 3DWEX 3H5NA 2BP7B 5ELLA 1R18A 4K3UA 1XFDA 3EOAI 2J3EA 1JXOA 2KMLA 1XTSA 4B2IA 3VYSB 2I80A 1VP9A 2XEXA 3EIOA 4DJAA 4BEVA 2F6RA 1WW3A 1OH8A 2YFYA 3L7KA 1RPNA 1B6GA 2OCGA 2QWXA 5D85A 1JBKA 4ZOLB 5DX8A 3IS3A 4MLCA 5F5XA 5IW8A 2R86A 1TAHA 1HWYA 1SHKA 3QBVA 4DA6A 1UWLA 2XUFA 5AK5A 2HWXA 3QEJA 3NHWA 2A92A 5EPEA 3ZIAD 1LDYA 1SIBE 2HREA 3L8FA 4LZOA 3K15A 4EG0A 4AMVA 5B7QA 5JWOA 2O4CA 2PZGA 1A9ZA 2RHLA 2HLPA 2WAAA 4LX8A 4PZDA 1YHYA 1IAQA 4ECEA 4JS0A 2E1RA 4MW0A 5K4GA 1YUBA 2WEKA 3BICA 4J7XA 4XUCA 3N0TA 3PC3A 2Y1OA 4X9XA 4G63A 2ORIA 4R7TA 4U2GA 1L8XA 4X7MA 5AYVA 4DIUA 5J2UA 1W4CA 4TL7A 4BAUA 4GX1A 2Y2UA 3KR9A 1KZ7B 2QPOA 2WUGA 1C41A 3NEAA 5FP0A 3ETHA 1LWNA 3D7SA 1RZRA 2DG2A 7MDHA 1S01A 2ORYA 2TECE 4YBZA 4KOEC 2X14A 3I52A 2ARKA 2VXBA 3AIOA 5JRZA 3JATA 2J5BA 4UARA 1CS4C 4AKEA 5KKCA 3HMQA 3HB1A 4AY3A 4QC2A 1V96A 2OV3A 1YMUA 2YYZA 1L7VC 3EIHA 4IUYA 4YJHB 1QO0D 4I1OA 1G6HA 1UAYA 4YP6A 4U3JB 5I01A 3ZNQA 5HOEA 2ZYDA 1M67A 3PPWA 2I8LA 2R2AA 3DT8A 3IERA 5K8CA 5IXYA 3U40A 2QN2A 3TQCA 5J23A 1RAAA 1A97A 1SK8A 2OO5C 1IY8A 1JQKA 1OILA 3D9QX 4RA6B 1RKBA 5U4QA 2NO4A 1PD1A 2GCNA 1GDTA 4YS6A 1KQOA 3AHEA 4GBGA 2JJMA 3L06A 1RAHA 3DMRA 5A5GA 3WGNA 4D9EA 2G36A 5K01A 2DFKB 3OX4A 3EG9B 4D5GA 3KDSE 5D86A 2O19A 1G2QA 2C4KA 4NHEA 2VRNA 1VZ3A 3FJOA 3V8MA 1BFUA 1WXDA 2IIBA 4MMZB 3B6ZA 2ECOA 3CLKA 3IIIA 4PXAA 1GLNA 1FS5A 2W5UA 2DQSA 3IBSA 5HG0A 2DJ5A 1U0SY 1X1DA 5FUYA 1IWPB 3IAHA 2SNIE 4M0EA 3KNZA 4WFKA 1YR3A 5E9WA 3U4DA 4A82A 5ILOA 2HBZA 2WF9A 1JFFA 3WSVA 2DXIA 5EOVA 3H04A 3LNTA 3ZD6A 3A1FA 2ZJ8A 3FCSB 3CVOA 3I05A 1PV4A 5F2NA 2G4LA 3I58A 1C9KA 4RD3A 1A9RA 1AU9A 1NL3A 2JJQA 3QJ5A 4H7PA 4UM7A 1EDEA 1QRSA 3FB4A 1YKGA 3DWIA 3G0CA 1U7HA 4KACA 1NHGA 2A30A 2R8YA 3ISVA 4LGCA 4LX0A 4TV8F 4PTYA 3FOZA 1E7QA 2VSXA 3PXUA 3NGLA 4RAOA 5F33A 1QX4A 1GKKA 2HSWA 2IY7A 3ONDA 2RK3A 5HBGA 5F1YA 5KQSA 4QRDA 4JGBA 4M4SA 3H87A 3MSXA 2RBGA 3HZZA 3QTLA 4M3NA 4RD1A 3DE5X 2RI0A 2WKQA 5AJZA 3IFSA 4K87A 3F4KA 1D2EA 4TVKA 3OM1A 1M2NA 2VZLA 4MK4A 3FCEA 3OF3A 2REOA 1NP3A 3DFFA 3ZK8A 2I33A 4TROA 4GKKB 4G8BA 3DOIA 4WNIA 3H2ZA 4X7BA 4ZT3A 4YNBA 5B1DA 4CGZA 4NH4A 2PKRA 1P5ZB 2YJZA 3SZUA 3GJ8A 3CO0S 5BNFA 4RTPA 1PK9A 4ZJYA 5HIKA 1EK2A 1OVMA 3UGKA 2OB2A 2GVNA 2D1FA 1NV8A 1JHYA 4LPSA 3KAJA 3OI7A 2IV3A 4RABA 3I6IA 3WYDA 4BNLA 1ZGHA 1JVSA 1IBLB 1UPAA 3PLNA 3K6SA 3T7TA 3HKEA 1OFUA 4IGKA 5DE3A 3TXYA 5F2KA 4F7DA 1F2DA 1TAQA 4GOXA 2Z5FA 1G8MA 4K40A 3G5LA 1I10A 3ILYA 3PF9A 4ZU6X 5FADA 3NWBA 5HZMA 2P9JA 3ZLJA 2QENA 4OJTA 3NOVA 4LJYA 4NJOA 5IJXA 3SSOA 1W581 1M8KA 1P9RA 4FI3F 1ODCA 2BFBB 3JASA 2QRQA 1YB4A 4LF7B 4COKA 4BQRA 2R6HA 2BGIA 3WWYA 2GEDA 2VK4A 4HNSA 4C3UA 4JOCA 5KYUB 1YMQA 1N7JA 1Z5PA 5CDHA 2DY0A 1WR8A 4W82A 3LSYA 5EE5B 3W9UA 4E12A 1XNGA 1DJQA 2W6CX 2ZSJA 2YQZA 2XEDA 5KQRA 1ADBA 2ILTA 1MZVA 4OM7A 3QE9Y 1E2KA 4A10A 1CDDA 3BB3A 3IESA 5JPDA 1CUYA 1H1DA 1ISSA 4F06A 1KO8A 1LQUA 3ACBA 3D6TB 1NQUA 4HN9A 1E0AA 2WAXA 1I36A 2WTEA 4O2RA 1ID8A 1GL3A 2BAGA 5B3JC 3AF1A 4XX0A 1OX4B 1I9GA 4PZYA 1SY7A 1XN4A 2H9IA 2FY8A 4C88A 2HJWA 5IKEA 1WTAA 5JDCA 1TF7A 2C83A 2PXCA 3V1MA 3P0IA 4TN1A 4FFWA 4JUDX 4MUIA 4XD7D 4MJ7A 3PS9A 2HD4A 1N7IA 1KMNA 1LJLA 3FPHA 4JR1A 4MKFA 2O2HA 1Q1NA 4WOBA 4Z9FA 4MGZR 3ZE1B 5LA6F 1MGOA 4NCAA 5EIXA 3U16A 1P0CA 1XTPA 1X19A 2GN2A 3N2LA 4U9HS 4B2PA 2IUTA 5BPFA 2P9GA 1ZZEA 2C88A 2HF7A 2QZJA 2Y6UA 4JH0A 3ZY5A 1GUBA 4BMNA 1KHHA 1U0TA 2IXTA 3KOUA 2X5NA 4LSWA 4L3WA 1ZWLA 5BSKA 3LX8A 2VXCA 2QR2A 2XVAA 2UYCA 2PH5A 5CVJA 2J87A 1S02A 2C7VA 1JWBB 1T2VA 3S68A 2UYQA 2Q3CA 1HRKA 1P2FA 1PL0A 4URZR 3VPSA 1PR1A 1JYEA 2VJCA 4UPVA 1DVRA 2A4KA 4UULA 3QLTA 1JN0A 4RD0A 4XTRA 5DASA 3NBUA 3BH0A 1C3OA 1YR2A 1TM4E 4N5IX 2PGOA 2VK1A 3CM0A 3O3OB 5I9LA 2XTZA 2NPIA 4EX7A 2YV3A 4JI1B 2C2GA 3T8YA 1E59A 3F71A 4PLFA 4ZA2A 4E1VA 4DDKA 2IOFA 3ZGZA 4H6VA 3BE4A 1H0KA 1F14A 1FLVA 4M53A 3PE3A 4TQ9A 2RGWA 4HBZA 4BO4A 4P92A 3WIVA 1NXTA 2C5GA 4MQLA 2XBLA 4X8LA 3W77A 4ASUA 1MA3A 2K4MA 3BTOA 4RVNA 1D6SA 5JRJA 2A5DA 2NYAA 4PPQA 4B0OA 2WJ6A 2QMHA 3O92A 2MSDB 1X0VA 4M0FA 4X6UA 3SBOA 3WLJA 4EW6A 3SYTA 4US0R 4ZCLA 2ZRBA 2ZSKA 1EFDN 3I2FA 4IHJF 5ES3A 2DEUA 3RBZA 1XTTA 2J3IA 4MSUA 1MHPA 5B3JA 4AKSA 2HMYB 3CZ9A 4D3ZA 3CEJA 1XU4A 3H9JA 5K0LA 4JJ7A 4DQLA 4J4BA 1HTWA 2UV8A 3AKYA 2Q50A 3JATB 5IZ4A 4NAHA 2DGDA 1O95D 1R6BX 4NC9A 2PT7A 1UMDA 1OB5A 5A3SA 3NYIA 3L6DA 3DJYA 1IIRA 4XCVA 3G8BA 1P7CA 3HBAA 3EQ2A 5B55A 4M7PA 4RELA 2NUTB 2PCLA 4Q15A 3TMYA 4LV5B 5TQ0B 1A4IA 2NSJA 1I3CA 4KAJA 2GRJA 4Q7EA 3D2LA 1IOZA 5J9FA 3H1PA 4FR5A 1P17A 4E5DA 4ZYXA 3DOUA 1QBGA 4MUAA 4M9ZA 1PT7A 3UOWA 2MIIA 5IUJC 4W99A 4DCMA 3UCXA 4R6WA 4BX3A 3QPDA 4HX9A 2Q7XA 1GRVA 4Z3OA 4NQZA 1J6UA 4GPIB 3AU9A 4F5DA 3E05A 4Z9XA 3W5IA 1KKMA 4DW8A 1EUDB 2KPOA 3FDZA 4C07A 2RCYA 4HY3A 1AKNA 2WNSA 4K88A 2CHQA 2HPZA 2VJLA 1A1VA 1W44A 1SK9A 5ETJA 4TN5A 1Z33A 3KOWA 2G9NA 5KWVA 2WTNA 1W0KA 3S99A 5E6UB 1Q1AA 2Q1UA 1UKBA 2HYDA 4NIMA 4X97A 1U8YA 1E9AA 3PC8A 3GPIA 1CQIB 3PNBA 4RESA 2ZR9A 4I9UA 3KZ1E 5EPOA 4M60A 2ODWA 2NN3C 4I1UA 1ZXBA 3KFVA 4IYRA 4B46A 4BMSA 5JEDA 4QUBA 4IKPA 1VLVA 2A1UA 5C1DA 3S3TA 4D0LB 4KLZA 1DO8A 3KQKA 2ZJYA 5AJHA 5I7OA 3ENKA 1L5ZA 1DMRA 5M7EA 1BCSA 1ZD5A 1QHNA 4RCZA 3UNXA 3I45A 4AURA 5L40A 3U0VA 2BH9A 1PT5A 4JLAA 3SR0A 3I2JA 2SKEA 4GPAA 4RIIA 3RSZA 4H60A 5IASA 4YHHB 3A2KA 3M6XA 3OOJA 4IUBS 1ICEA 1VG0B 2ZVJA 2BFAA 3LFTA 3VC2A 2GAIA 1WUJS 1OQAA 3PGVA 5KCMA 2NUAB 3VV2A 3ZJYA 4D8XA 4Q3LA 5DB4A 2HK6A 3K9GA 2WZQA 2AW3A 3M83A 4IKEA 5TARA 1VDZA 1Z6PA 4J75A 3WV5A 1KEEA 5JS1A 1G3QA 1EZ4A 4D9KA 1R3DA 1UINA 4C20A 2I7DA 3WC4A 4WESA 4JC8A 4DLUA 5I7VA 1GUZA 2OBYA 1TVCA 1KEUA 3D5QA 4YV2A 1R0SA 2QZ4A 1K89A 2WT8A 3L4EA 4EHLA 3TLXA 2H00A 4C7OB 4ZOLF 1ILWA 1JE1A 4YASA 3O1HB 2ONJA 2O8EB 4BX9A 2G83A 3IR6A 1U9IC 1QB8A 1BOFA 1R6XA 3WRWA 3ROQA 1H0HA 5CX1B 4PRZA 5T7BA 5AM4A 2XMGA 2IRWA 4IDAA 3GK3A 2R1TB 1G21B 3H2YA 1EK5A 2QYSA 2A58A 1E9RA 1FRNA 3VH2A 1Q7GA 4IRXA 4B7ZA 2CFOA 2GXQA 4JIGA 1F0PA 1E5TA 1N9ZA 3TYXA 3VAYA 1NNEA 1W76A 1LFDB 4LOJA 2JLRA 5C8YF 3S7ZA 3QKRA 2RGYA 1FDRA 5JCOA 3C6MA 3RFUA 1JZSA 1EESA 2JLSA 4QNMA 4JEHA 2ZRMA 4JA2A 1Y5RA 3EXHA 1JZTA 1XJWA 4ASUD 1IK6A 1NKSA 1SM4A 3SEFA 2VUTA 1RHJA 4WKBA 2V7QA 4J7AA 4ZVNA 4OQYA 3KLMX 4B7UA 3DTVB 2P5UA 1U7WA 2YQ5A 4GOND 4NMHA 3CC8A 2V7EA 3D1VA 3L5KA 4EO7A 2XT0A 4JLOA 4C0QC 2FQXA 3QVSA 1W36B 3K9WA 2UVPB 3H65A 3ZDCA 2IC5A 2PAAA 1WKVA 1YZVA 1NGSA 1S9DA 1RYBA 4IJQA 1CZLA 1N6PA 4Q24A 7YASA 4ND7A 3SM9A 2R68A 2AN4A 2NTVA 2G04A 4MWTA 1IE3A 4FFMA 5T5QA 3AUAA 4MS4B 3U3ZA 5FWXB 4AJNA 3W2FA 1DMSA 4I1RA 1H2WA 2FUCA 3H99A 2ERCA 2GTHA 3E9QA 5GJWC 4AO8A 3ZVMA 3S55A 1T25A 1X38A 2QX6A 1FUUA 3TF5A 1UUFA 4WA8A 3UHJA 5FWXA 2NXCA 5DW3A 1K7XB 2XF2A 3K1AB 3WVNA 5JHHB 1S2GA 1WD7A 3KQYA 3FTEA 3FZNA 2NXJA 3RUCA 2D1RA 1U1GA 4ISCA 1WCYA 1I2AA 4PN3A 2QNBA 3NFYA 1XRPA 2BEWB 1IVSA 2W2VA 3TN7A 1NF8A 1Q0TA 3KQPA 4NZOA 4BVGA 3P0HA 4LYGA 4BV8A 1ZLYA 2GBLC 2IFTA 4GUAA 3STUA 1Z5ZA 2BFNA 1Q19A 3EFOB 4HWTA 5EWMB 1PW7A 3I8XA 3NO4A 4A15A 1TUGA 2AMLA 3KWMA 4I9NA 3AVYA 4C87A 4JI6B 4A5SA 5CCEA 3QVKA 5AMXA 1EFRD 1LLFA 1QGDA 1V4BA 4ARUA 4CF6A 1Z34A 1M5RA 1FP6A 1NT2A 1V26A 2NO6A 2YRFA 3IDAA 1RRKA 3DE6X 3VJRA 4PBSA 5ESDA 5BT9A 1LNZA 4PAGA 4KNWA 2R87A 1TJ3A 5HIMA 3FBTA 1TO6A 4OTZA 1DSSG 1Z56C 2R96A 4RPJA 4ZO4A 2FX2A 4OMCA 3WWOA 4X6YA 2AXQA 2I1LA 2R11A 4OGFA 4DTCA 5TQJA 1U80A 2C3MA 3FPBA 2DWCA 3FR7A 4X8HA 3IOCA 5TIIA 3H2HA 1FVOA 1WXXA 2QXYA 4YWJA 3KUUA 2QIPA 1T3SA 1UZUA 4DCTA 4DMHA 4L1KA 1DC8A 2F9FA 1F3LA 1UBUS 5MF6A 1VOTA 2IYOA 4G0MA 3O4IA 2WAMA 3ZG6A 4FFBA 4QXMA 3LL7A 2J7PA 2IYFA 2FFAA 1VIYA 3ESYA 5EZYA 5TV2A 4DT1A 2ZYSA 2B4RO 4GZ3A 4MUFA 4NZ9A 2ZJ7A 3MPOA 3OJ0A 2XRZA 4GEKA 2A7QA 1G8PA 3B1XA 3AILA 4UCQA 3X1KA 1YDMA 3ZD9A 5DBIA 5AVXA 4OY3A 5K0NA 3CO5A 3S2ZA 1WOMA 4LMAA 3D1JA 5ECGC 1HNZB 2BBSA 4KR7A 1H4QA 3KETA 4WIAA 3SJCA 3D2CA 4DSZA 2QVGA 2O5RA 2PXAA 3HU5A 3KM0A 4MZXA 4RMJA 4XWTA 2JLAA 2R2GA 2ZWIA 3BJRA 3C98A 1I1HA 4J0DA 4ENUA 2XCIA 5A4IS 3VV3A 2DBYA 4S1TA 4M9QA 4HQFA 4TL8A 1T0BA 1V16A 2MT9A 3F4BA 1NLZA 4QVIA 3LQ1A 4CCYB 1RLMA 4IFEA 5CDGA 4UOZA 4D96A 4FNGA 1PWZA 2P9CA 2POQX 1BWPA 1VLLA 2JIQA 3LUFA 3KTAA 4U2CA 3SYMA 5H5JA 1OIVA 1Q0SA 1WY5A 3PYLA 3T52A 3E6AA 1JLSA 3OTIA 1ZH2A 1E1LA 4G5XA 4H4EA 3LKVA 2V7WA 3DSRA 4KPYA 4TKVB 1J0CA 3DOHA 2WFLB 2X5JO 3DLHA 5HIJA 4RK0A 2H18A 3P19A 4OV6B 4PPYA 3IP5A 2IX3A 2CF5A 3TI9A 2ZRLA 4L6CA 3P2MA 4ZEOA 1T8SA 3HCBA 4P34A 2AN9A 1N8NA 2QD5A 1UBHS 4Y7CA 2AC2A 4RTJA 1BXZA 3RBXA 1EX1A 2OAP1 1CR6A 1FEZA 3DB1A 3KKMA 5FWNA 3B1WA 2F8SA 5M04A 3AP2A 4EHFA 3KPVA 3RS4A 4YUXA 3O8NA 3WXMA 1GZ7A 3HVUA 3L0SA 1RM3A 3B20A 5I9NA 5LL6P 1Y3CE 4P4NA 2ZJ4A 3KB2A 1P1JA 3KPJA 1XQXA 4TTRA 5BWCA 1CHDA 1UANA 4LEIA 5EE9A 4EJ6A 1QG0A 1PEKE 1RC8A 1T1EA 1NJ8A 4NOMA 3B89A 3ZCPA 5K2OA 3E2IA 2C2XA 2F2TA 2H1WA 3MJVA 1BMFD 1XLVA 1AN9A 3WIOA 2IELA 3P45A 4I6EA 1ESZA 1XNQB 3MBIA 1RRVA 5EFOA 3CVUA 1TKBA 2PMCA 2ILVA 5CCDA 3DEFA 1XCGB 1GFWA 4JVOA 4A8TA 5J1SB 4LNUA 4NZNA 1UBOS 1B3BA 3PHIA 4IM7A 5EYPA 4Q34A 3I0ZA 4IMIB 3NZEA 3AYZB 4DADA 1DHRA 3MUEA 3BDIA 1SXJE 4PLYA 1LS1A 1Y6JA 3M81A 3ANMA 1ZK3A 4R9VA 1ZMBA 3ZNNA 3EWSA 4K1XA 4BS9A 2OQIA 2Y99A 1YI8A 4JP2A 5EHQA 3UMJA 1E3QA 3KQLA 3QVOA 1XSEA 6Q21A 3UJ8A 3MWEB 5K05A 5CYPA 3ZX5A 5B36A 2K2WA 4MB2A 3FNGA 4RGVA 4ZVTA 4DLRA 1C3OB 2LGJA 3R77A 4UUQA 4X84A 3RU9A 1E3IA 5JQWA 1YJ5A 1X8KA 1ZGJA 3MWDB 3UK6A 3WKDA 3ZKWB 1Y6RA 4TRJA 5KMGA 1USIA 3FI9A 4NONA 4ZMRA 2NUPB 3N59A 3IBFA 4JGIA 5IANA 4TL9A 3PE4A 1T2FA 3ZJ5A 1Y3IA 2HGSA 3S2GA 1LW6E 4G1CA 4KN8A 4HGPA 4F1WA 3R0IA 3T3OA 1TVEA 1KE1A 2Y1XA 3CU5A 5ADUS 4F3TA 4HNAA 4E09A 3F78A 2P69A 3AIMA 3CNNA 1Y82A 3PHBE 1L8LA 4L9WA 4MWZA 5TT0A 3RYIA 5GTDA 5MFPA 3EF3A 3A4VA 1WO8A 3HRKA 4QTTB 3PGKA 2CVQA 4HZIA 4LIPD 1HGXA 1U94A 5TJ9A 1T1RA 3M7IA 2G8LA 3ZGOA 2ZYGA 4D4MA 1OA0A 4DRXB 5B64A 4L9RA 4U7JA 4BAZA 3BTVA 4IINA 3CUYA 4R2JA 2FSVC 1QQ7A 2ZSDA 2WBLC 3T9AA 1X7WB 1EX6A 5IT9A 2N9UA 2JGRA 3MVEA 2O05A 1IL0A 1XCPA 1EDOA 3EZ7A 2Q49A 3DR5A 3N0WA 1ZRHA 3Q3CA 3J7AC 4UVGA 5JBNA 1YRBA 2GBFA 1ES9A 2FPMA 4D74A 3CKYA 1TCAA 1OGIA 1HQDA 2OFOA 3F67A 1NXXA 1SHZA 3OM8A 4IIGA 4OQDA 1JDZA 1HORA 3I42A 1KSGA 2ZVDA 3WYCA 4ESEA 1SCQA 2IXBA 4Y9DA 5KS2A 4HAZA 1Z6ZA 2BM9A 4XEHA 3AV3A 3VHQA 4ZQEA 1KJWA 5DRYA 2BR4A 3QKUA 1RRPA 3X2EA 4MWOA 3NDBB 2VXOA 5G0TA 1JAIA 3KLNA 4DMMA 1SXHA 4R5MA 1H0SA 4TXMA 3TJRA 5CB0A 2WYUA 2ZIXA 1TQ6A 2JGMA 3KYDB 4GD3Q 4GI2A 4MVJD 1OWMA 3KT0A 1IQPA 4ZZ2A 3UT6A 4BV3A 3R20A 2F3PA 3D6AA 4X61A 1JHZA 1NVDA 2DT5A 2H2DA 1WV0A 1EUCB 5CH8A 3SKVA 4DPMA 1U0BB 2Z3VA 1E2DA 2PZAA 4J2OA 2V55B 3D3JA 5LVAA 5EAIA 3UBTA 2P1ZA 1JA9A 3T7SA 1YCGA 1P0FA 3PIIA 3ADOA 3QQ5A 1RJWA 2QLJA 2EEPA 2X2EA 3F6SA 1EVYA 5L4NA 4IIHA 3LKDA 4CQLB 3GNLA 5JCJA 2FU5C 2C57A 1DS6A 1EJ0A 1NVXQ 2ZB7A 2GZSA 3K5PA 2JZCA 2HHHB 4GXRA 5JFGA 1TRHA 4H2DA 1H2FA 1P74A 2X77A 2XYQA 4XUDA 2GK4A 2FFHA 2P9YA 2CLDX 2XWPA 2XQIA 3W1WA 5L51A 4YJ2B 2RHMA 3LT0A 4P22A 2DMRA 3NT5A 1EVJA 1SFRA 2GSWA 4MVJG 3ZCRA 3H4VA 3RLFA 1DG1G 1J8FA 1K8XB 1KO5A 2XA1A 4HSEA 4QL3A 2PX3A 3FSRA 1SRQA 4UBIA 2EX4A 1LX7A 2RHWA 3OVMA 2EJVA 4FR0A 4QU8A 2FPPA 3LT2A 1E3WB 3AJRA 5E6RA 5GOTA 3TLKA 2ZP1A 1RI5A 2FN3A 5EA2A 3U3XA 1YGPA 4UZEA 3AHHA 3FPJA 2B7LA 2IKSA 1HE2A 1Z36A 3B9QA 1FFAA 5DTIA 4BDSA 1M0SA 1BVHA 1OU4A 2WTAA 3L6CA 4K2AA 4AECA 4FHCA 4AROA 4OXYA 1EJ2A 4HEA1 1XZNA 3RAPR 4CKCA 4INJA 2OUIA 2C3OA 3ORSA 2GCPA 2HDWA 1NUAA 2ZZKA 3U1VA 4COOA 1GADO 5LQRA 1JLLB 1RC1A 2WWIA 2GPAA 3CXRA 3U7GA 2GM5A 4XB1A 4MB6A 1OTXA 2V3VA 3HV2A 5CHYA 5AVRA 1KK2A 4N5HX 4C03A 3FSEA 4CEJA 2YNMD 1Z7GA 1RPZA 3KXPA 4QOGA 1EWKA 4TV9A 2JAUA 4Q03A 4CFYA 3I04M 1GSHA 2VEDA