4EB0A

Crystal structure of leaf-branch compost bacterial cutinase homolog
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
SNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Leaf-branch compost bacterial cutinase homolog
rcsb
molecule keywords LCC
molecule tags Hydrolase
source organism Uncultured bacterium
total genus 91
structure length 258
sequence length 258
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12695 Abhydrolase_5 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eb0A00
5FDFA 1F0NA 4ZGBA 2GBGA 1MJ5A 3BWXA 4QWMA 4OD0A 2ORYA 3HYSA 4J0KA 2ZSIA 5ALTA 3WK5A 1IUPA 4F21A 5CH3A 4CG3A 2JEYA 1XZLA 1XRNA 2WILA 3R0VA 4U2GA 2AJBA 2XUHA 3RLIA 4X6XA 5AOBA 3SX4A 1Q83A 1YASA 2XMGA 4H0CA 3ZLVA 3JW8A 3OOSA 4X91A 2Y2UA 3B5EA 3WMRA 4MEBA 3WL5A 3ZLUA 1MPXA 2BKLA 1H2ZA 1JU4A 2XB6A 4W1QA 2OG1A 1L7QA 3H2KA 5H3HA 3CXUA 1ZI8A 1H22A 2ZVDA 1ZI6A 1UFOA 2WJ6A 3EF3A 2FJPA 2Z3WA 4GI1A 5LZ2A 5JADA 2V98A 1ACJA 3H2HA 3R3UA 1QO7A 4MQMA 1VXOA 3WJ1A 2B61A 4UPDA 4W9RA 4M0FA 5ALPA 2XQFA 3IUQA 1DX4A 5E4YA 1LPBB 5DTIA 1VZ3A 4TVKA 4B82A 4D9JA 1D07A 4UBLA 2OCGA 3ESCA 3AUKA 5ISMA 1GXSA 4GXNA 2HA7A 3OPMA 2PBLA 4S0XA 5IVDA 4QA9A 1QIIA 2OPHA 4MQLA 2WHPB 1BEZA 5JAUA 3C5WP 3OM8A 2XUDA 3Q0TA 5LP1A 4BZWA 2E3JA 1Y7HA 4LHEA 3EBLA 1CUAA 4PV7A 3PF9A 4BP8A 5FRDA 1WM1A 3PFBA 2GZSA 4RPCA 4G5XA 5LZ9A 4BYMA 4G9EA 1QOZA 4Q05A 4A23A 1QZ3A 2XQGA 1NU6A 1CUVA 1E5TA 3DLTA 2VQ6A 2BUBA 2QVBA 3WLAA 5FP0A 2QUAA 3BIXA 4YPVA 3G0GA 4PSCA 3H1AA 5AM1A 1VE7A 5ESRA 5BWBA 5JD4A 4OPMA 1R50A 4AO6A 2ZJ6A 4ROTA 4YX9A 3D7RA 4FKBA 2PKYX 4KAFA 3VXKA 4MWTA 3P2MA 1JMYA 2EDAA 4E15A 3ESAA 2VJDA 5C7YA 3A6ZA 3I2JA 1EH5A 3FLBA 2PSJA 1C7IA 1CQZA 3F97A 5AKLA 3FYUA 5LZ5A 3JYHA 1MN6A 1FFBA 4N8SA 3FYUC 1BCRA 2WHQA 4GLBA 4HZGA 1R88A 3BJRA 3L1HA 3C6XA 1SCQA 2VSQA 1E8DA 3ESBA 1MAHA 4UHCA 5KWJA 1VLQA 1WCYA 2VJCA 1RP1A 5A6VA 3V1NA 4KE6A 3S8YA 2YXPX 5T4FA 5EHQA 3IUMA 2RI6A 3I6MA 4FNMA 2QXTA 2QXUA 4Y7DA 1ZD3A 1ORVA 4AN1A 2VT6A 2Z8XA 4DNQA 2VTVA 2FX5A 1VXRA 1XRMA 5AI8A 4ZRDA 3DJYA 4P08A 3V1LA 1FSSA 5AK4A 1R9MA 2X76A 4YASA 4AX4A 4QNNA 2OQVA 3H2GA 2R11A 3H0CA 1GGVA 1AC5A 1UK8A 1BE0A 1EB9A 3G0IA 4HRXA 4OYYA 5JIBA 4QDTA 2WIDA 1XZFA 1UZAA 1VA5A 1WPRA 5CW2A 2PUHA 4BCDA 1W1IA 3AIMA 3WK7A 2ACEA 3EQ7A 4QDZA 2OAGA 3E0XA 4UHHA 3H17A 4L0CA 2V96A 3HSSA 3TGLA 5LKRA 4WDRA 5JARA 3QPAA 1L7AA 3A70A 4BE4A 3STXA 5CT5A 1WB4A 3O95A 5DYWA 1J06A 1WHSA 3D2CA 1XQVA 4ZREA 2RHWA 2CZQA 4BTLA 4I19A 4BVJA 1CUIA 2CMFA 3PUHA 2JEZA 4BC0A 3E3AA 4X7BA 4H7HA 4X90A 3W9UA 4PF1A 4WFKA 1ZICA 3WK6A 1U65A 5K3BA 2HADA 1YR2A 4Y9SA 4DGQA 5DJ5A 2WSLA 2QKYA 4BAZA 1Y7IA 4BVLA 1N5MA 3D5EA 1QIJA 4ITVA 5ALXA 5HQ3A 3VJKA 5FUMA 3AIOA 1TCBA 2HFJA 3F67A 5HFAA 3QMVA 1OILA 1LZKA 4B84A 3QH4A 3NUZA 4LIPD 3W05A 1YB7A 2O2HA 4ZXFA 1CRLA 5CXUA 2C0PA 5C81A 1MX5A 3I1YA 2WTMA 4CIAA 3PDCA 2BGNA 2ES4A 3QPCA 1MNAA 5CMLA 2CKMA 3UUEA 4X93A 2PUJA 4G8CA 5HF8A 4U2FA 1H23A 4JYMA 1UOPA 2BUCA 1JMKC 3AJAA 4WFIA 1P0PA 4X00A 4Y2XA 1UKAA 4GECA 2HIHA 4DLNA 1A8UA 2JGJA 1E8NA 1X70A 2GBCA 1J2EA 3HJUA 5SYMA 2OGZA 5KBYA 3DL7A 3BDIA 1ZIXA 3M83A 3MVEA 2FUKA 3ANTA 2XI4A 4U2DA 2JBWA 4UHEA 4W63A 4FFVA 5JALA 3G0DA 3K6KA 4KAJA 5EHNA 4QDXA 2WIFA 3TJMA 4P93A 1EDBA 4H18A 1AGYA 1UK9A 4Q3LA 4Y2RA 1EDDA 4HXEB 1VKHA 1FFAA 1ORWA 3R3WA 1QIKA 1U2EA 1TAHA 4OB7A 2GYWA 5HZGA 1YCDA 4B6GA 1BCSA 5D7BA 5CRIA 2B4KA 1EK2A 3H19A 4Y2TA 3NWOA 3GZJA 1IZ8A 5LLSA 1EVEA 2GYVA 3IUNA 4M0EA 5AM4A 1X2BA 5F4ZA 4UUQA 5JZSA 1R4ZA 3R40A 3C87A 5E2IA 4X92A 4N5HX 1G42A 3L1JA 2WUEA 3OURA 2K2QB 2XUKA 2WM2A 3G9ZA 1UOOA 1BROA 3LIPA 4K5QA 1HLGA 1CPYA 1CV2A 2BCEA 3VDXA 3AZQA 1G5FA 1FFCA 2QUBA 3I2HA 1E8MA 3DDUA 1CUDA 4X85A 1CUFA 3I2KA 2C7BA 4UBKA 4ZI5A 4CG2A 2XLBA 1QIHA 4FBMA 1GQRA 1TQHA 5ALMA 1MTZA 2GBFA 2WFLB 3ZV7A 2XE4A 4FDMA 3STVA 2ZYHA 1UWCA 5D6OA 2PSDA 4N5IX 2HA3A 2OXEA 4BZZA 2BAGA 3STWA 1FJ2A 4DNFA 4I3FA 1P0QA 5K3FB 4UHBA 3DYIA 4GDMA 4DMCA 2H1IA 4Y2JA 3FCXA 2WLSA 3K2IA 4Q3KA 2VAXA 3CCCA 5CT8A 2JGLA 4BAUA 5J3JA 1A8SA 5ALVA 2WG2A 1ZGBA 1H2YA 1BN7A 4LXIA 3WA6A 3F8SA 4E14A 4J0GA 1XROA 1MT3A 3KDAA 5IVIA 2Y1KA 4PNZA 1VZ2A 2I3ZA 4IH4A 2OGTA 2VT7A 5AKGA 5K3EA 5KWIA 1IUNA 4B0PA 1CVLA 5JZBA 2XUPA 4G8DA 1QTIA 4GHWA 2WIKA 3V9AA 1W52X 1KU6A 4MWSA 3BL8A 5IH7A 2V9ZA 5T4BA 1DQYA 5A7FA 2B9VA 4H7DA 5LZ7A 4FNGA 4NZZA 1ZD5A 2W6CX 5HF5A 3T52A 4E11A 1LPOA 2O7RA 3PI6A 1ZGCA 4EBBA 2XQJA 3DNMA 1J1IA 4J0HA 4C88A 2DR0A 3EQ8A 4G4JA 2I78A 4FWBA 4YK7A 4CG1A 4UFNA 4FHZA 1PV1A 2PSEA 4DM7A 4G4IA 3LLCA 5K3AA 5D3KA 4BB0A 4BBZA 1GKKA 5HF9A 4K6HA 4BATA 3G8YA 2XMQA 2VEOA 3C6BA 4UBJA 4KACA 4OB8A 3F96A 3ED1A 2EEPA 3RM3A 3C8DA 1E89A 5DYYA 2HM7A 4DNPA 4AZ3A 1HKHA 2ZJFA 5AI5A 3QMMA 3U0VA 3WIBA 4WY8A 1USWA 1ZIYA 2HU8A 3R41A 3FYTA 2C4HA 3QITA 5AM5A 5ALWA 2WHPA 1EINA 2XUOA 5CT6A 4QWWA 3FAKA 1ZI9A 3DKRA 1R3DA 1YAJA 2Z8ZA 2V97A 3C45A 2C5FA 4C6HA 3FBWA 4PQEA 3WKEA 4MXDA 5FOQA 4X6UA 3KWJA 4QZVA 4BDSA 1THTA 4J0JA 2VA9A 4DTCA 4PO3X 2HA2A 3WWDA 1K4YA 1QJ4A 3OC0A 1AZWA 4F60A 5BOVA 1QO9A 2RAUA 1RWQA 4UHDA 3K9BA 4Y2VA 3D59A 4AMZA 7YASA 1MNQA 5ALYA 5I8PA 1JKMA 1C7JA 3O9MA 2H9YA 2WG1A 3OG9A 1A8QA 1W75A 1BU8A 2OGSA 5FXMA 1JU3A 3WKCA 4H7JA 3N2ZB 1IZ7A 1B6GA 1QIMA 1U8EA 1QFSA 2CJPA 5ALGA 2P8SA 3STYA 2O2GA 1THGA 2QR5A 3D2AA 1FFEA 2QJRA 1YB6A 2D0DA 1XRLA 2HL6A 4TPKA 4JH0A 4L72A 4RGYA 5LKAA 2VAVA 4AZ0A 2HU7A 1QGED 3LP5A 2PX6A 3WYNA 1TK3A 2XQIA 2GBIA 4C87A 1GT6A 5JYCA 1QIGA 4K6GA 1UT6A 3AFIA 1CUEA 4DIUA 4J03A 2CBGA 3G0BA 3TEJA 1XQXA 4NVRA 1CUUA 2IITA 4MYSA 4JEIA 5C8VA 3NGMA 3W04A 3FNBA 2PM8A 2QMQA 4RE6A 1NX9A 5C8ZA 3MUOA 4GBGA 1DX6A 4G4GA 3S2ZA 2VJBA 3B3QA 4H7KA 4BRSA 1EK1A 3GFFA 2BUAA 3FYUB 3AZOA 4MJ3A 2UZ0A 4ZV9A 2DHEA 4U2EA 3VVMA 2XUAA 3SWWA 5JAPA 1K8QA 3G9XA 1LLFA 2Z5GA 1AQLA 1CR6A 3VVLA 3ANSA 5EHZA 3T4UA 5K3CA 1K5PA 2HRRA 2H7YA 3N0TA 1CUZA 5LZ8A 1XRQA 1XZGA 4CCWA 4Y2SA 2QRUA 5ALKA 1EA5A 4HS9A 4OSEA 1A88A 1ZOIA 2O2IA 4MYDA 2RGUA 3GA7A 5LYYA 1LBSA 5A71A 4EZIA 1DINA 1JT2A 4W1SA 2PPLA 3FVRA 3I1IA 4W1PA 4C4YA 3IA2A 5ALSA 2XQKA 2ONCA 1HDEA 3HRHA 4KRYA 1XZHA 2H7CA 4WDQA 4Y2QA 1LZLA 4CIBA 2XMZA 4EY7A 4IH1A 1JI3A 3WL7A 1CUWA 1E66A 2XMDA 5CTAA 4HRYA 3O4GA 4KJXA 2VJAA 4KE9A 5SYNA 4MEAA 2ZYRA 1XLWA 5C8XA 1G4HA 2RIPA 4N8EA 1Q0RA 2DHCA 3YASA 2RONA 1C4XA 1LPPA 5EIEA 1SCIA 4C4XA 3KSRA 1CLEA 2HA6A 2VF2A 4AQDA 5FPPA 4PSDA 2BJHA 3KXPA 3FVTA 2Y2VA 1A7UA 3TRDA 1ETHA 2OLEA 4DMFA 4ETWA 1DQZA 1EI9A 1UK7A 2GYUA 3W9BA 5AKZA 2C0QA 3R3VA 1ZJ5A 5EIHA 1YS1X 2JIDA 3F98A 1OXMA 5CH8A 3WA7A 1DT5A 2JGEA 3GUUA 3H18A 1XKLA 2C5GA 4KYVA 3V48A 5FPQA 5KREA 4L3WA 2YASA 1XRPA 4DSZA 2HRQA 3VJLA 5ALRA 1CUCA 1F8UA 1GPLA 4Y2YA 5EI5A 2ZSHA 3GBSA 5AIAA 3DQZA 3IIIA 4ZWNA 1XFDA 1WB5A 1GQSA 3F9CA 4G1FA 2CEKA 3EQ9A 4EB0A 1XLUA 3FCYA 2BFNA 2LIPA 2ZJ7A 1HBJA 3ZI7A 4WFJA 5JD6A 3CN7A 5HK8A 1CIJA 1ZJ4A 2ZYSA 3H1BA 1DWPA 4OU5A 1MO2A 1VJ5A 4EY4A 2G4LA 4GWLA 2CB9A 3L1IA 2WU4A 5DWDA 2HA0A 3DD5A 5AHXA 5K5EA 3WKBA 2WUDA 4JUIA 4FLFA 3AINA 1VOTA 2G5TA 3PF8A 4CCYB 3ZPXA 4B81A 5FKJA 3IUJA 3OTQA 5AJHA 3WQHA 3I6ZA 2DQYA 2G5PA 5HKBA 5JZ9A 1VE6A 5CURA 3WYDA 4AMYA 4O08A 5LZ4A 1E3QA 3QYJA 4BAGA 4KEAA 3IVMA 3WL8A 3PFCA 4B9AA 2OCIA 3JWEA 4OCZA 3C5VA 1LPMA 4ARAA 3BDVA 4X94A 2I03A 4NMWA 2XUQA 3NOXA 4CFSA 2PU5A 3WIOA 3DS8A 1N1MA 2NW6A 1WPXA 4X71A 3A2LA 2IIVA 1EHYA 4M0MA 2DHDA 2X8BA 4BRZA 1TRHA 2ZYIA 1YS2X 3G0CA 5AKEA 3IURA 1XLVA 4Q3OA 1XQWA 2ECFA 1EB8A 2ACKA 1PJAA 5DLPA 2B20A 3DOIA 1O6GA 1QONA 3AILA 2OCLA 2Y6UA 2HFKA 3DKKA 5ALZA 4XIIA 1MU0A 4KRXA 2XUIA 1B41A 5AKXA 3GELA 1R1DA 3EIOA 3C8HA 1J07A 1XZEA 2J3QA 5AI0A 4EY8A 3C70A 4QEKA 3ICWA 3STUA 5JATA 5JAHA 5E4JA 4W1RA 4B83A 2WJ4A 3R3YA 3DYVA 3BE8A 4JNCA 4U2BA 4BE9A 4UFOA 4E46A 3WI7A 3H04A 4IO0A 4OB6A 2PL5A 1H2WA 3RK4A 3I2IA 4GW3A 5AH0A 3FLEA 5JANA 2X5XA 4IHAA 3RARA 2WIJA 4H7IA 5E4TA 5AOCA 1JJBA 3IDAA 4OU4A 4HVTA 3O4IA 3HXKA 2HU5A 3I2FA 1CUGA 3WWOA 4X97A 3UUFA 1N5RA 4LXHA 3QBJA 4DSAA 3IULA 1EDEA 1XZMA 5AM3A 2DQZA 3QM1A 3G9UA 4UBNA 2JGKA 1PFQA 3G7NA 3VKFA 3KOOA 4H35A 4X6YA 4QE3A 4B85A 1QTRA 2AJDA 4QLAA 2D5LA 4UFPA 5CBKA 5CT4A 4K6KA 4FBLA 1EXWA 4BC1A 3HACA 1XZCA 5AK3A 5A2GA 3H2IA 4EHBA 3Q8WA 1QLWA 4XWGA 4J7AA 1ZD2P 3HEAA 5AK6A 4A16A 4FTWA 1ODSA 1SFRA 2IX9A 3WZMA 2QOEA 1HL7A 3AZPA 5HF6A 4LKOA 2XMBA 2WFMA 1BN6A 3KWFA 3MUNA 2XUJA 2J4CA 1TCCA 1XZBA 2R8BA 3M3DA 1CUSA 1EVQA 2YYSA 4J0DA 4OYLA 4UHFA 1M33A 2XLCA 2EDCA 4INZA 5DNUA 5ALQA 1KEZA 3BF8A 2XMRA 2AJLI 2FJ0A 4C89A 5IKXA 5FLKA 1YA8A 1YSCA 3D0KA 3O0DA 6YASA 3AIKA 3FWHA 3GROA 2XUFA 4FOLA 3STTA 1LPNA 2DSNA 4PSUA 3O4JA 5IVKA 1Q0ZA 4J0IA 4Q82A 3O4HA 5K3DA 4BDTA 2G63A 4RNCA 4LYDA 3ILSA 1ODTC 1XZAA 1AURA 1WOMA 4PW0A 3G9TA 3ICVA 1P0MA 1HQDA 4U2CA 1MX9A 3WZLA 3SK0A 5A62A 2Y6VA 3V1KA 4NS4A 4KAAA 5AP9A 3QMWA 5EIAA 3VISA 1QE3A 4EY5A 4FMPA 1AKNA 4HXFB 1BEEA 1CUJA 3SC2A 4DMKA 5AI6A 4B7ZA 2BGRA 5FV4A 4X95A 4I4CA 1TIBA 5ALOA 3RKSA 4K2AA 1CUHA 1GPNA 1L7RA 3C6ZA 2HA4A 4N8DA 4BCBA 4BP9A 2WUGA 4AB1A 2QJWA 4JYPA 5JAOA 4Z49A 1TCAA 4G8BA 2XMCA 1R9NA 3M82A 3I6YA 1DT3A 1ACLA 2C58A 3BJMA 2WHRA 2WTNA 4UBMA 1Z68A 5I9IA 3UMJA 2WU3A 1JJIA 2J4FA 4XJVA 2WKWA 4H7EA 4XVCA 3WWCA 4WCVA 3IB3A 5JD5A 5CT9A 1QIFA 5CXXA 1LPSA 1UKBA 3QVMA 1UOQA 2J3DA 2WFZA 2XT0A 4L9AA 3KD2A 3WK4A 2QM0A 1FFDA 4H7FA 3DL4A 1WB6A 5AI4A 4XX1A 5ALJA 2PSFA 3DCNA 1VA4A 4G9GA 1NU8A 5ALEA 1ISPA 1K63A 3FOBA 4ARBA 3LIIA 2O7VA 3ZWQA 4EY6A 3W06A 4QLOA 3WWEA 5DYTA 1BRTA 5JASA 4DMHA 2Z3ZA 1U4NA 5AM2A 1UK6A 4IH9A 5HK9A 5EGNA 5AKKA 4GEGA 3FSGA 4Q34A 5AKJA 3HLKA 2XMSA 1LPAB 3ESDA 5ALHA 1GZ7A 4P92A 4V2IA 5BV7A 4EUSA 3I28A 2DFPA 1K6EA 4H77A 1W76A 3MGAA 1CUXA 3C6YA 2VATA 3WKDA 4A5SA 3E4DA 5T4HA 4KE7A 2PVSA 3WWPA 4AO7A 4ZV7A 4J0CA 2XDWA 2JGFA 5T4EA 3M81A 3W2TA 1LNSA 3HC7A 5ALDA 1BS9A 4DNOA 2HA5A 1T2NA 2JGMA 4KR0A 3DOHA 1YA4A 4KE8A 5DTJA 5AO9A 5D3ZA 3WK9A 4B9EA 2DCMA 2YH2A 1XZKA 1XQYA 2WIGA 3E1GA 3BF7A 4AXBA 5IVHA 2QTBA 5HCUA 4LXGA 5AKYA 1HPLA 3IBTA 4HAIA 3X3HA 2I3DA 4FLMA 1DU4A 4UBIA 3U1TA 5AOAA 5HQ3B 2GZRA 3A2NA 2XUGA 4WJLA 2OQIA 1TKRA 3FLAA 2WQZA 1F6WA 1RYYA 2WUFA 4HXGA 3WKAA 1QIDA 3WL6A 5AK5A 2QS9A 3R3XA 4P9NA 4Q1VA 5AM0A 3V1MA 4AN0A 4Y2PA 1XZJA 1DTEA 4IQ4A 4TGLA 1AUOA 3VJMA 5DNWA 3C43A 4WY5A 1XRRA 3PICA 5AICA 4LYEA 1MX1A 4AO8A 1W4LA 3BXPA 3HI4A 3D4LA 3CN9A 4BTVA 5ALFA 1G66A 2Q0XA 3D3NA 1Y37A 4HTAA 1H2XA 5AI9A 3ZLTA 3FSGD 5YASA 1XZIA 4CCYA 1DWOA 4BVKA 4QDUA 4B0OA 1CQWA 1JFRA 1XKTA 3HZOA 4RE5A 3R3ZA 3I2GA 5HKAA 1OCEA 3H2JA 1SC9A 2HHAA 5AIBA 5LIPA 4C01A 1IUOA 1ODCA 1W6RA 3HABA 4OUKX 1LGYA 5A7GA 1SOMA 1X2EA 2WFLA 1N8SA 5BWCA 1P0IA 5ALNA 3LCRA 1F0PA 1AX9A 2WG0A 1LBTA 1ZD4A 3B12A 2QZPA 2RHTA 1S8OA 1CFJA 1QIEA 1Q84A 3QPDA 1UXOA 5ALUA 5K3FA 3PE6A 4DYHA 1UKCA 4J3JA 4EA6A 3A2MA 5DNVA 5I7UA 3WJ2A 1O6FA 2QT9A 1GPKA 2ROQA 4FFWA 3WK8A 1CEXA 1SCKA 1MAAA 2HDWA 1KU0A 4C4ZA 4F0JA 1GKLA 2JF0A 4QDOA 4FLEA 4Y2UA 1QFMA 4X3CA 5ALIA 1WHTA 5EHXA 3CCBA 1YAHA 4B80A 2PSHA 3PUIA 3LS2A 1CUYA 1XZDA 2AJCA 2W22A 3QZUA 2WJ3A 2PU7A 4BCCA 3G02A 1JJFA 1AMNA 1T4MA 3D2BA 1IVYA 5CH5A 5ALLA 3BIWA 5EFZA 5AKHA 2AJ8A 4CI9A 1EX9A 5AKIA 3O9VA 3DEAA 4F5ZA 5A7HA 1IMJA 1DWQA 1I6WA 2CUTA 2OCKA 2OAEA 2H7XA 2AXEA 4UBOA 2JGIA 1CUBA 5HFNA
chains in the Genus database with same CATH superfamily
2OV8A 1F0NA 5FORA 3LC0A 3IPAA 2BPOA 2GBGA 4QWMA 2G67A 4OD0A 2BYTA 1GZ4A 3HJTA 2QZ9A 3E7WA 4Y6QA 5KC9A 2Z4TA 1PRYA 2GAFA 3MWJA 2EG5A 2ZSIA 4FX5A 4NQZA 4TYQA 2G8NA 4TSKA 3H6HA 4F21A 3L0BA 1W5TA 1C9NA 2IK8A 2VVTA 5BMVA 4LVOA 1ONBA 1U2SA 1CQJB 5F2OA 1MV8A 2I2WA 3QG1A 2NO0A 1M10A 1XRNA 2VZEA 3H9QA 5BW6B 4MP6A 4KBGA 1FSGA 3Q41A 3R0VA 4KTVE 1GWNA 1D4FA 2HO5A 4LXTA 4J91A 5K6TA 3OZGA 4IS3A 4ZKDA 5ECDA 2XMGA 4UD2A 3ZLVA 1WXFA 1YJXA 1JTVA 2PLFA 5IT4A 2ERXA 1BGWA 3W79A 3JW8A 2J30A 3DE6X 3OOSA 4HGOA 2N46A 4I08A 1P74A 2DP4E 2ILVA 3OP4A 3HMQA 1IN1A 4H7PA 4UC0A 1E2UA 2R1UA 4TKZA 5IANA 3GJRA 1KQPA 1XA4A 3KOUA 3WL5A 3CZAA 3ZLUA 2BEKA 121PA 3CQ9A 3NEPX 3SJZA 3TAUA 3I8OA 3O8QB 2ONZA 1SZJG 3DAHA 1WDWB 3OF2A 2WOJA 4BNMA 1AG9A 3CFYA 3OPVA 1X1CA 4CT0A 2OLJA 4C0AC 1P7VA 3MFQA 1OFGA 2XB6A 1ZJZA 2UU9B 1L1EA 4J0QA 2YWFA 1V71A 1JI0A 2OG1A 1SB9A 5EKDA 3BQ9A 4Y2GA 2C2HA 3GLIA 2X9NA 5BYJA 1FDOA 1XN1A 2NWQA 3COSA 3CXUA 3ONDA 2P9QA 1ZI8A 4JEMA 3W6PA 1ZI6A 4A3SA 4OSOA 1HQYE 2BJVA 4R0NA 3GLGA 1DCMA 4FJ2A 1ISHA 3VZQA 3BMQB 1VC2A 3AHDA 1ZX1A 3EGVA 4JP5A 4HNGA 2ZTLA 1GAXA 2FB9A 3A11A 3LUCA 4YHBA 4BMPB 1G20E 1T10A 3K15A 5U4XA 3K20A 4MS3A 2K6GA 3JQ7A 1J00A 2V98A 5KKAA 1N9GA 2VK1A 2PCJA 3ZJUA 1HTWA 5AWFC 4R0MA 4RK6A 3UOGA 3NKFA 4RTQA 1LQ2A 1YUNA 3CEAA 2FNAA 3IP3A 3WJ1A 2H1RA 1N7JA 1DEKA 4E08A 3DMYA 1C1DA 3TPCA 4RA9B 4ER6A 2QL9A 3DZFA 1Y3BE 1PWXA 4GQAA 5HFJA 2FEOA 4OO3A 2GPBA 1KZ6A 4TSFD 1E32A 3DJFA 2H2WA 2ZTUA 3HVKA 2G5CA 4JBGA 3U3MA 2F3PA 3OUTA 4R8MA 4NX2A 5MN6A 4NE7A 2DECA 3FTCA 3O8CA 4MV8A 1VMKA 3ADOA 1RHRA 3F4BA 4TVKA 4WADA 4K6FA 3T5BA 2FEKA 1LRJA 4L4YA 4B82A 1RRCA 2Q5JA 4EECA 4DLVA 2AOTA 2H7VA 4OUDB 2Q1YA 4A82A 2GZDA 5DASA 5L4NA 1PK9A 3R2JA 1G16A 1D2CA 1GEEA 2WPDD 1BDMA 4KXQA 4ZOLA 5JH7A 2DPMA 2P7IA 3DE2X 2OCGA 1W0KA 5BW8A 3AEXA 4L4XA 2PRKA 1BQEA 2WPNA 4HN4B 2I8CA 2P3QA 3AUKA 3O90A 1LSOA 2AXNA 1W59A 3AQ4A 3SM3A 2JLWA 1QB8A 1XE3A 4PC2A 5DEOA 4CM9D 3ECSA 4JWKA 4QA9A 3EZXA 3GPLA 4QQFA 3GFGA 3W9YA 5H16A 4E7PA 4C05A 2DX7A 3M49A 2W70A 1HYQA 1GA1A 3GRYA 3NANA 4G09A 2B1GA 4KO3S 5BR7A 4DA4A 3GF4A 2W6ID 2OVBA 1O54A 1PGOA 1Q3KA 2XUDA 1NWCA 3NGLA 1XJCA 2OEPA 4WVLA 5BOSB 1G21E 1SOVA 4CIXA 1UDCA 2BFEA 4L7VA 2E3JA 2FPGA 4LHEA 5U4QA 1YCGA 3JQRA 4TV8F 1T8WA 2DM6A 2YWGA 1NQAO 3HBMA 1QCCA 2B34A 3DOUA 4NYJQ 3TINA 4WCFA 3Q2KA 2WV9A 4BYMA 4G9EA 2FPXA 1E7WA 2VCHA 2E89A 4LWOA 4Q05A 1OB2A 5IXSA 4EGSA 3R9XA 1P75A 1VE3A 2OY0A 2PO5A 1U8UA 4N54A 4X8HA 4ZHQA 3MTAA 4WCFC 1K3UB 2ETVA 2ILTA 4DQUA 1LA2A 5EWJB 2BUBA 5JLJA 2QLBA 5JW6A 3LC7O 1U5BA 4LJ6A 5FP0A 4MW4A 3NIFB 4Q1EA 4X61A 1BWPA 1QVZA 3D1LA 2NNWB 2CYAA 1SUFA 3G0GA 4YPVA 1E58A 2IL1A 4R2MA 5ESRA 1BVHA 1AGXA 3O92A 5JD4A 2P0YA 2JFVA 2XEDA 3SF8B 2HK9A 5AJWA 5IAEA 3H9UA 1JHAA 3TQTA 1KJYA 1XP8A 2YNMD 2JIZD 1NRWA 4HQFA 4AO6A 1TO2E 3O75A 5JZVA 3OKAA 1MW9X 2HF8A 3UJ3X 1I3MA 1F8YA 3GBVA 1XF9A 3IKTA 4JIMA 4L95C 2RHGB 3P9IA 3K1YA 3V2IA 5JS6A 4MWTA 1YFZA 3CRRA 5IC5A 1DKQA 3PNBA 5DLYA 1Z4PX 3OZVA 4KDEA 4KIJA 4ENQA 1D7AA 3BVPA 3LW7A 2Q3DA 5DKFA 5C35A 2PH1A 4KVFA 4HJRA 3T7RA 2GN2A 2NSLA 1DAOA 3I2JA 4M55A 2FRXA 3FLBA 4EHFA 2Z6AA 3PDWA 2L82A 2UXDB 4ALKA 3V3TA 3F97A 3W5IA 3CISA 1IIBA 1IEQA 1KP3A 1DC3A 2COUA 2CWDA 2RH4A 3F1KA 5LZ5A 4B3BA 3JYHA 1LS1A 1A72A 4CLRA 1ULHA 3TD9A 3RV3A 3CX7A 1FFBA 2NUAA 3GGGA 3QU4A 1NLZA 1VLHA 4BXOB 5HJEA 2X0IA 3TIGA 4C5AA 3GLSA 3QX8A 1GCOA 4YQFA 3LK7A 1QVVA 2Y1FA 4J49A 5BNWA 3ADCA 1OHHA 1DBSA 4DSTA 3KVRA 2WHQA 3GUVA 4GLBA 1OIWA 2FF7A 3M6UA 2R1ZA 4H1UA 3U4GA 5GINE 1MB3A 3BJRA 3EGOA 3T0GA 5AESA 3P4YA 1XNRB 1RTTA 4OXIA 3IVCA 2OO3A 3PSAA 4QRIA 5LDGA 4QXQA 3RHFA 2I8LA 4Z4QA 2EAUA 2WTXA 1NY6A 4X6LA 3KR0A 1F0KA 3NWBA 4ND4A 5K99A 4G5QA 3TZKA 2P78A 1T0UA 4PSKA 5EIBC 1DTWB 5A6VA 4G0WA 5TSDA 3KE8A 3S8YA 1BJTA 2AN1A 1P2DA 4HQOA 2NG1A 1J21A 5IN4A 3IUMA 2RI6A 2OV6A 1VHJA 4I50F 3D7MA 2GSWA 2CLFB 3VHLB 1Y6RA 4EYGA 4EAAA 3FYDA 4MW1A 1ORVA 4MR8A 4AN1A 1W48A 5CLIA 3EUAA 5AJZA 2Z8XA 3DV2A 3VU9A 2VTVA 4L75A 3ZIAD 1Z0SA 1SPBS 1U2GC 3NM5A 1VXRA 3TL6A 2VP3A 5JBNA 1WLYA 2HWKA 2H2IA 3L8GA 1TZJA 5F2EA 4PYIA 4DWJA 1Q2UA 3KJNA 2R8XA 3V1LA 3FJ1A 3KYCB 5FNVF 3Q1KA 1Q7CA 1MO3A 4BECA 1A8HA 3O3OB 1FSSA 1GCGA 5AK4A 2OILA 4FD3A 3O91A 3E0QA 2E4AA 1CY2A 3B1XA 5JO0A 4I5EA 4BIMA 2OQVA 1FB5A 2P4EA 3G8CA 1XTQA 3HHPA 1K27A 2IXBA 3H2GA 4PBSA 5GQSA 3THYB 1DEXA 2II6A 4MWZA 1DXHA 2F62A 5IT5A 4Q3AA 4MDEA 4BRUA 1XTVA 1FP2A 1KI2A 3OT1A 1QJCA 5F98A 2YJNA 4N7MA 1O03A 1ADBA 3C3KA 3UMMA 3WLOA 1CS0A 2OHXA 4XYMA 1EB9A 1FBTA 5C3MA 3LY8A 4MPRA 2DC1A 4KUHA 1L5YA 3G85A 2EGUA 4OYYA 1MEOA 3W78A 4QDTA 5BRAA 4GC5A 4LSWA 2ERCA 4DC1A 3QX7A 3DMRA 3UY4A 4NCIA 4TLBA 3NEYA 5F23A 5JQGA 3C4VA 3Q98A 4ZMBA 5CFOA 3EMBA 4ZYWA 5CDFE 2YS7A 1RI3A 2V7GA 4EHKA 2Y67A 4XM0A 3G13A 3VO1A 3AIMA 4UAJA 1A9ZA 4X3OA 4TSRA 4LI3X 5ITSA 4MSUA 4NL4H 1RYFA 5TRTA 4KQXA 4LPSA 1UADA 1GV1A 3BZUA 3GEDA 3L8ZA 1OT3A 3IGFA 1LX7A 4HL6A 4Y6RA 3S99A 2FH5B 3E0XA 4RXMA 1F60A 4UHHA 3H17A 1GLNA 3A4IA 4L0CA 2OE2A 1KKMA 1JX6A 2V96A 4KNYA 1CTQA 4MV4A 1Z4NA 2BKUA 1YRLA 1OV6A 1L7AA 3EG9B 1XKQA 4RHXA 4TL7A 4BE4A 1PS0A 5H59A 3STXA 4TOIA 3ZH9B 2GPTA 2LDXA 3VQTA 1J06A 1TC2A 1X15A 2HU2A 3M2PA 1HTBA 2WTEA 4ZREA 2I4NA 1A69A 3EC7A 4NFHA 4D5GA 1K7EB 3ZDCA 3K9GA 5EHGA 2PGDA 5DXJA 1ESNA 5FBRB 3O8RA 1UJ2A 2WDPA 2JB9A 2JEZA 2A9PA 2VHYA 4Y1GA 1NUAA 2ZIFA 4AMUA 4LZLA 4X7BA 5AVTA 1YMQA 4ZCSA 2GDJA 1I3OA 4X66B 1QH9A 3ENZA 4H7HA 3HJBA 3KT8A 4MW9A 3VA7A 2FX2A 1P7PA 4PZEA 1SN7A 2FR8A 2EIXA 2QMEA 3CF4G 4Q48A 2XJ9A 1LWOA 3U5TA 5C1IA 1L7BA 1IEWA 3FMGA 4HDSB 4K0RA 2GKGA 3C1AA 5CIQA 3B70A 1ZICA 3HPQA 5DV9A 3ROKA 4YUYA 2AE1A 3UC9A 2G9RA 1PLLA 1QAQA 3ZWYA 3KEFA 3JQ8B 1DAFA 1WQ1R 1EEXB 1XEAA 1A7KA 1YR2A 2ISCA 1JNXX 4KQGA 2Q49A 4PVDA 1QPBA 3I64A 1YJ5A 2MYPA 1RM4A 4DHWA 1BQ4A 2YTZA 3AUTA 1YZLA 1ZNZA 1PGQA 1I7PA 2LWIA 2QKYA 2BZSA 1GZ6A 3QKSB 4AWXA 3TECE 5EOVA 3UH1A 1B0AA 3A1TA 3QLTA 4US2R 3MWDA 1N57A 4KNWA 3JVEA 1XTRA 3ONFA 5ALXA 3VJKA 4D02A 1T13A 4PYLA 3H4TA 2C9ZA 3L46A 2HDNB 1NG1A 5MGBA 1M6EX 2OV3A 5AUQA 2YDYA 2R7LA 4YB8A 4G23A 4YS6A 3OY7A 4OGKA 4BKMA 1AV6A 4JLSA 3QMVA 2EWWA 1Z26A 4HJXA 1OILA 3IHLA 4OV6B 4GLFA 3SDBA 3UUGA 4B84A 3UJBA 5ESDA 4PZLA 1IPEA 3VC1A 1ZN9A 2OGWA 2W11A 1U04A 3TRFA 5KMGB 3ORHA 1E3EA 3H0EA 3CPJB 4RELA 1NOJA 2FKNA 1NZJA 2P0AA 4ZXFA 1WV0A 5JU6A 5DHQA 2GCOA 2BV3A 3IODA 2OV4A 2XCIA 2WTMA 2BP7B 5H5JA 2VXBA 2G7ZA 4Z7QB 3ZZ1A 4QOIA 1I1NA 1ZAYA 1IOZA 3NORA 1N5IA 4D98A 4PHTA 5H7XA 2ZPAA 1LV8A 1N3IA 1NVAA 4E88A 6GPBA 3ZGNA 2AZXA 2CKMA 3PXEA 2BTEA 2XA9A 3UUEA 5CDUA 3TJZA 2E6KA 2FG6C 1VB3A 4QUJA 3SHWA 1PUJA 4INJA 4X24A 1QX3A 4X93A 5EVCA 4ZT7A 2VHWA 2I66A 4GIBA 1JAXA 1H23A 4GSLA 5LLTA 2R1TA 2C2ZA 4PQFA 1P61B 3FDIA 3DONA 4RPKA 1QRTA 3OZFA 2EBFX 2W71A 2Y0BA 1RE1A 1TUBA 1D1PA 3W8NA 2OZPA 1UKAA 2AYXA 5J2UB 3PWTA 5FWDA 1PSZA 4GECA 2EG9A 4C3UA 2HIHA 3TLMA 1YHZA 1OBHA 4KQ6A 1JR3D 1A8UA 1E8NA 3FJYA 2GBCA 3MA0A 2VRBA 3WS7A 3DQQA 1OC2A 1VJDA 2LXNA 1PSDA 1T3GA 2A9QA 4L50A 5E8JA 2FN3A 5C37A 4ZYYA 5KBYA 1Q57A 3DL7A 3BDIA 4E2YA 1T5LA 4L8YA 1B7GO 1ZIXA 4EF4A 2VPQA 3MVEA 4YMLA 1ZZGA 2YIMA 3MJ4A 1KIMA 3QEMB 2XI4A 2O50A 4LDNA 5ARCA 2YZNA 4O2AB 1YVPA 3JQQA 4P86A 3PLRA 2ZCVA 4N7BA 4BNLA 2VDLB 4UW9A 2ORWA 5GIPE 4ZZ2A 3J81A 2FFAA 5B1HA 4KAJA 5EHNA 5C31A 3PUWA 3EFHA 3A6DA 3OOJA 4KXYA 2ZJ3A 2FLWA 5AW4A 3PUKA 4H18A 1KJ9A 3P9QA 1PEKE 2PS1A 2WWYA 3UYKA 1AGYA 4Q3LA 4IG9A 1N0IA 1EDDA 3N2NA 3TPZA 4J16A 1FFAA 3W5JA 4NPHA 3F5MA 4TMVA 4U9UA 2BE7A 2QMUA 1QIKA 1L8AA 1U2EA 2VT3A 1QYCA 3DBRB 4JB3A 1NW5A 1TAHA 4JLPA 5THKA 3GJ0A 1DELA 4Q37A 4DDHA 2WKRA 4NE2A 3U4CA 3DLIA 4J16C 3PJEA 2X8LA 3R0IA 4RM3A 1E7SA 1SR8A 4CTJA 1V41E 4ZT5A 4B3CA 5BT8A 2ZZKA 1C7QA 1X7ZB 2I4MA 5CRIA 3KUKA 3KTOA 5IDQA 2FE1A 4HEA6 2BFPA 2JCBA 3KTAA 1VPVA 4MKXA 4ZK2A 5KOYA 2ZJBA 4S05A 2BMJA 2POCA 1G7CA 2VJPA 2E1RA 3DOJA 3OO1A 1EVEA 3WISA 4YRZA 2JATA 4BGUA 4BN0A 4TYNA 4J07A 1TGYA 4M0EA 5AM4A 3ADPA 4YRSA 5F4ZA 2NYRA 4KI7A 4QULA 4ZOAA 4C4OA 3A9CA 2XTZA 2IEIA 1CIVA 2YQ4A 3L7AA 1E4OA 3NIGB 2H51A 2JAWA 4O0MA 4X92A 5E2IA 3TRKA 4WBNB 3PTAA 4OI0A 4JV5B 4O4HA 1VKOA 3FHLA 1AA6A 4W5RA 5EXDA 3L1JA 1P77A 3TB4A 1AHNA 2FYTA 3ONNA 4GD3Q 2AX4A 3NOQA 2I1WA 4E4TA 4NXNB 1AMOA 2ATCA 5F77A 1FRVA 1UOOA 5CB4A 3DBLA 4ND5A 4K5QA 4LK3A 2QBYA 4RPLA 4HI0E 4AS2A 1BX3A 2C7GA 4JLMA 2IYSA 1C81A 1CV2A 2XITA 2AN4A 2P2NA 1CT9A 3AZQA 4KO4S 3SJAA 3VDXA 3F3MA 1HRKA 1K92A 3DWFA 3GFPA 5HDQA 3VKVA 3ZV5A 1HNZB 5EP2A 3W5AA 1WF6A 3LQ2A 1AK1A 5G0TA 1FFCA 3VU1A 1E4VA 3ACBA 2FPIA 4ND6A 4CMIB 4RDXA 4L16A 1CUDA 3SF0A 1V8DA 5IARA 3IEVA 1TTHA 3RTAA 1LUAA 4KOEC 4FZ5A 5FO1A 1S3GA 4INPA 2DETA 3I2KA 3MAGA 4GMKA 4LYJA 3VPHA 4ZI5A 5F73A 1BDJA 2I6QA 4XJTA 1AKUA 4IIJB 3L6UA 4U8HA 1NQWA 3EQZA 4L4UA 5ALMA 1Z45A 3B8EA 1OLOA 3OE1A 4PAGA 2X42A 2GBFA 1W85A 1ZCJA 5E6UA 4RGBA 2B7CA 2CN1A 2WFLB 2Y0DA 3B48A 1IL0A 1SBYA 3CE9A 3FFXA 4RHYA 1IBMB 2QN1A 2O07A 4D3SA 3SLRA 3DE4X 3RE1A 4FR0A 4F92B 1L8OA 3ZHOA 1QF6A 3WGTA 2I54A 2XQVA 1F20A 2JGRA 4N5IX 2HA3A 4X44A 1ZMRA 3TRHA 1GU7A 3GRFA 4GX0A 3H2ZA 2OXEA 3IMCA 4C0XA 3FOWA 4HLQB 2GM4A 4K6OA 3WRYA 2XA1A 4B3FX 1X9HA 1JQEA 1T5IA 1MZPA 1P0QA 1ZK1A 3QTLA 2PXAA 1OLUA 3NAGA 4UHBA 2YV2A 3I76A 1HY3A 4MUBA 4WEOA 3SYRA 3WNCA 4YRKA 4A8JB 3LUJA 3ZK8A 2B9EA 3PFKA 3VYRB 3C85A 3WRYC 2CV2A 2VHTA 3C7TA 2CV0A 1TVKA 4LGYA 2VAXA 1B15A 2FWRA 4OVKA 1AZSC 1LK7A 4FS8A 4MB6A 4JBYA 3T3HA 3THXA 4CM4A 2WWXA 4FXPA 4B09A 4BNVA 3T1TA 1Y6FA 2IY8A 5F9MA 2ZTMA 1ISMA 4HDOB 3GRZA 4ZOEA 2I71A 5J3JA 3BJIC 3REOA 1A8SA 1UC5B 1ZVVA 4PTLA 5T3YA 1KEKA 1SWVA 1ISRA 2IP4A 1H2HA 1ACMA 2TECE 3AEQA 3JAWB 4FGLA 3OEEA 3Q2OA 3T7CA 1KSJA 5CA1B 5IDXA 4PAMA 1BN7A 5DM60 1C0EA 1M0SA 3A1NA 4GMDA 4LTDA 3PUXA 3MINA 3FMOB 4RIEA 1EZ4A 1WHTB 1Z0ZA 2N42A 2Q5EA 4PTYA 4KJZA 6REQA 1MP0A 2ODTX 2WT9A 2ZEJA 3BHMA 1MC1A 2OFFA 1D6NA 1YIOA 2QK4A 4CQNA 4PONA 1KO4A 1PL6A 1SUAA 2B0JA 2EFJA 4IV5A 4K26A 1SVWA 1EA7A 3F6RA 5HOEA 4FOTA 4BO7A 1Q3HA 2TMYA 3B51X 1JJVA 4IIVA 2X8JB 1VZ2A 3W8DA 3VKFA 1FVXA 3IP6A 3P9XA 2BM8A 3QV1A 3HFJA 1JXQA 1WMFA 5KWIA 3IAM1 1CLUA 3O21A 3LW8A 5F64A 5JWHA 1CVLA 1W93A 1TJNA 4O4LB 4QIHA 2NU7B 1TJPB 3B82A 1M2NA 4G8DA 4QXMA 4WZ6A 4ZZ0A 4DV4B 5GONB 3EHDA 4MUXA 2YFKA 1KVUA 1W52X 3RODA 2A4MA 4MWSA 2WA2A 2D7JA 2V9ZA 1M5RA 1TADA 3KD3A 5T4BA 1U31A 3CX4A 1U11A 3UKOA 3DVAA 2ZG6A 2W6JA 2OHHA 2BMVA 4NBUA 4FDAA 4TXLA 1OROA 2G80A 5ICFA 3T12A 4IIFA 4DMLA 4O2LA 5A7FA 1R0YA 2ZSFA 2J9RA 3FUUA 4O2BB 1YACA 3HA2A 4H7DA 2BBTA 4LX0A 4TTAA 4BWGA 3DMNA 1M7GA 4FNGA 3RHZA 4FZRA 4YO8A 1YZKA 1DWUA 4LQLA 4PWZA 5I9MA 4EB6B 3DHNA 1DNPA 4XUCA 2FEXA 3OIYA 4K03A 1E6MA 1LPOA 3WGGA 1PV2A 1OWLA 1Q91A 4XYGA 2CKDA 2O7RA 2ZUBA 3GDOA 3PI6A 2Q27A 3QNWA 2XB9A 1ELOA 5FADA 1T0BA 2X6TA 2BGMA 4MA5A 2ZRJA 4CLEA 3EOZA 4IUDS 2A1TR 3U31A 5KJ1A 1RYHA 2PAAA 1TF7A 1LNQA 2DH6A 4KYUA 4UKDA 4B4OA 4BNDB 4CKYA 5F1YA 1CDOA 1F4VA 1UT8A 2MTBA 3DNMA 4ZAGA 3BMQA 1K75A 1PNOA 3A4VA 2QRPA 1WUHS 3EQ8A 4G4JA 4TVBA 3EBPA 3KWMA 4FWBA 4YK7A 1WW2A 1NJSA 3KTDA 2JH3A 4MVJF 3PFHA 4WBXC 1IQPA 4DLAA 3FGOA 1XCGB 4XDHA 2GXUA 1FC0A 3FNIA 3MMSA 4DM7A 1QCYA 3PNMA 5CNKA 3P5SA 1VLJA 4FWIB 2EGGA 3WHKA 4B7UA 1W96A 3GW8A 4YRJA 2WSSD 3SHTA 3SS7X 2BMEA 2VOEA 3QKRA 1TW2A 4RPIA 5HIAA 3SVTA 1R2QA 4EYSA 3BWVA 3I42A 5AVYA 1EP1B 3G0OA 3IQHX 4BATA 1RP7A 1U3UA 2VEOA 3P0RA 1BFUA 3QVUA 4IP0A 4KACA 1FYWA 2NZUG 5FLEX 4EZEA 4MVCA 3H8SA 3EQ6A 3F96A 3OIVA 3QKTA 2YZKA 1H0SA 1C8LA 2N3ZA 1UJ6A 1YUMA 1SQGA 2X7JA 2ZREA 4QJ3A 3LXRA 4F96A 3C8DA 1E89A 3HY3A 3OIDA 3WFJA 5HM8A 1YKSA 4LF7B 3AEYA 1E5QA 1FZTA 1Z2CA 4PRZA 2FW6A 1EXVA 2HREA 3D8UA 8ADHA 1NW3A 3LLMA 4BJ1A 4OUDA 3UV7A 3K6JA 5KTNA 1C14A 4QTTB 1E79A 4KQIA 2FN4A 4HX5A 3WIBA 2LCIA 2HBZA 5KAPA 4NC9A 1XMIA 4GP7A 3VR2A 5KKNB 4AKTA 2O59A 3M34A 5A4FS 1I13A 1H1LA 1L5SA 2HU8A 1JUDA 3MT9A 5B7PA 3SX0A 1QZXA 3ZZ0A 2V1XA 2QROA 1OI2A 3G7UA 3R7WB 1RJDA 4KO8A 3HUDA 4MVJD 1RKBA 2BDUA 5G1NA 2DBQA 3C7CB 3T95A 2NQTA 3DOEA 2W2TA 4QELA 5EE1A 5BXQC 3IQZA 2QZJA 2Z0MA 3M4NA 4WZAB 4XSHA 1EINA 3V8QA 5CT6A 4CT5A 5KJFA 5L7TA 3FKSA 5LQCA 5IN5A 4BE7B 4QWWA 4D6YA 3A0RB 2XGOA 2F43A 1REQA 3AHGA 4LC1A 1R9GA 5JSHA 3NMUF 1R3DA 2L18A 4NBRA 3ZHYA 5BOSA 2G9ZA 1QMGA 3AHFA 3PX7A 1WF3A 3QXSA 4D92A 4IXWA 1ESMA 2C5FA 3HCOA 3RBZA 2Q9AA 4I36A 3TIFA 3JAMA 1TYCA 4YECA 4GX5A 2JAHA 1ISJA 2FETA 1YJAA 2RC6A 4FMCB 4IX1A 3K73O 4MXDA 4TZKA 1JHDA 1N3YA 4XWOA 2QORA 3C97A 2AMLA 4W5HA 4YWHA 3TL3A 3NTXA 1THTA 3PHJA 4MRMA 4HEJA 4FMDF 2WTAA 4BUCA 4F8YA 5K8LA 3Q3CA 4FOPA 4OQNA 4AF7A 2IE8A 4WN9A 4M49A 5CVDA 3DEHA 2R6FA 1VLMA 3GY0A 5IHXA 2PBZA 4G67A 3RS2A 3DKPA 5I7OA 1L5FA 1XZQA 3EW7A 1A5SB 4OXRA 4YREA 3VR0A 5AVSA 1CQIA 7YASA 1MNQA 2YUTA 3COJA 3RABA 3SF8A 2QVCA 1AH2A 1U7XA 2R79A 1A8QA 5JWRA 3U48A 2CNKA 2Y9PB 5KOJB 1NOKA 1AM4D 1O9BA 3WOVA 2FXVA 2OGSA 4GEKA 5DI9A 4YT8A 5EWMA 5FUXA 1GZHB 3O8DA 1NKTA 1VL2A 1QH8A 3CZ5A 4I1RA 3MGBA 1RBQA 2ZP1A 3N2ZB 1IZ7A 1B6GA 5CXSA 1Q22A 3UPUA 2C78A 1SCAA 4CM3A 2WJAA 2IELA 2NZVG 3LXXA 2QZ4A 1XK7A 3MIZA 2J5XA 2NAPA 4WKBA 3OA0A 3QEJA 1LSSA 1QFSA 4GP6A 3AT1A 2QTCA 1BIFA 1QSGA 5KYYB 4FINA 4JSTA 1UPTA 4AWBA 2V7TA 1BH2A 1B76A 3PNSA 1VIMA 4B3DA 2PGAA 3EUEA 1KQFA 3D2AA 2IOFK 5ITZB 3FR8A 4PYJA 3NBXX 1FFEA 3DL2A 4G24A 1VL1A 4CIVA 5J4HA 2IBSA 4M53A 3C1TA 4W5WA 1XRLA 5B7NA 2HL6A 2JKZA 4OJYA 1F6DA 1EFVB 2BFDA 2RGAA 5CVVA 2CLOB 3ZGXA 3K70C 4JH0A 4JYBA 2C4TA 1CDZA 2EHJA 3I0NA 4I9FA 2ZBVA 4I6GA 2VAVA 1ULUA 4AZ0A 3V8RA 1VG1A 2AG8A 3BKXA 2YV3A 5A4IS 2MMCA 3WYNA 4AUNA 2NYUA 1NBIA 1XL1A 2RH8A 1XZNA 3MJTA 4INAA 1KXJA 3NHAA 1HUQA 1TMKA 2Y1GA 2EBHX 1QAOA 3ANLA 2GR9A 5HJ7A 1EHCA 3U16A 1ZAKA 4P8RA 1P31A 3OZUA 3IIKA 3WICA 1VHDA 1MB2A 4CMAA 4Q12A 1IXYA 1AS2A 1S2GA 4XR4A 3HA5A 4DIUA 1M7HA 1LKZA 4LNHA 1KYXA 1T8YA 3MOGA 4HNVA 2BFBB 3H7IA 1JR2A 2YYYA 3I9V6 2UYOA 3D4IA 1DTWA 4F5DA 2NO1A 2GKSA 1XQXA 4IQ0A 3GP8A 4D0SA 1VKNA 5C2JB 5CNJA 1IC6A 3UT6A 3KHSA 5BMOA 2AQ8A 4CJXA 4BMYA 1QHYA 2VK8A 5JJ5A 3PXUA 4FFDA 4OI1A 5J1SB 1CY8A 5BSRA 4RJIA 2WF6A 2D1SA 4JEIA 1IHXA 4JUAA 5ELLA 3MCAA 1RJFA 4LOKA 1PKEA 1SVUA 3G5UA 1ZIDA 1HLDA 4QTUB 2YXNA 2D5CA 1A5ZA 5C32A 1U8XX 3BA1A 3CG0A 4HDNA 1N36B 4B3RB 4GGMX 3DDZX 3K3PA 4W8HA 3ULKA 4G1MB 1QZTA 4YRDA 4X7RA 4XJXA 3RJMA 4TQGA 3ZWWA 3AHCA 4COOA 4F86A 1KI4A 1T29A 2HLDA 2LUOA 4GBGA 4NH4A 1DX6A 4RQTA 2IUUA 1RIIA 4G4GA 3ZQUA 1J99A 1P81A 3B3QA 2K7ZA 3KOXA 3UFBA 3H8VA 2HSJA 3THYA 3JZDA 3T15A 3GFFA 4S3MA 5I9LA 3KSBC 1NT4A 1ZKDA 4Q7KA 5EIFA 4YCCA 1NN1A 1GL6A 2B8WA 3FYUB 1R8XA 4MJ3A 4Q3EA 2UZ0A 4OJNA 2FOLA 5IM4F 1P5ZB 4YAJA 3KT0A 4Q9NA 1S2MA 1TK2A 1QGZA 2C29D 3A6GA 2IIBA 4V0SA 1CHNA 4AL4A 3BCUA 2YWDA 1ZD9A 4PZZA 3MBKA 1I6KA 4M4SA 3IQIX 3BK1A 2CGEA 3CZCA 4P5PA 3U13A 3UXHA 4BZXA 5KTYA 5LSAA 2ST1A 1KHTA 1K8QA 4NZ9A 3LFUA 4LZNA 4Z5XA 5C8DA 1IQUA 4B4DA 1KPGA 2DR3A 1ZWLA 3FCUB 1HDOA 3MGKA 1JDSA 5KYXB 2HSZA 2O06A 2QNBA 3EC2A 3VVLA 4QLBA 1XYVA 1C2YA 1Z8DA 3Q3VA 5EHZA 2CFIA 2O0JA 1I3NA 1NF8A 5K8JB 3OMLA 4UARA 1ZN8A 4HNQA 5F12A 2FQ1A 3K32A 4MQUA 3ZEAA 5TPZA 2F17A 3OPYA 4KXUA 3Q6NA 4PCVA 3W8FA 1NTRA 2F1HA 2DEUA 2OMKA 2XT6A 3KAPA 2QRUA 2X8WA 3D9QX 5JAIA 5FEMA 5ALKA 2O20A 3M9LA 3PTZA 2H52A 4IY1A 3ZBUA 3WIDA 3IXMA 2N47A 4LOHA 1NV9A 2O2IA 2QF7A 1OZGA 3IMGA 4HTFB 3GYGA 1E1NA 4MYDA 3QUSA 1XAHA 2P2ZA 3CVJA 2O14A 4ZZ3A 1LBSA 1A9YA 4KFSA 3VH4A 1U7ZA 4DUYB 4EFLA 1BGVA 4HDKB 1K3FA 1DQNA 4JP2A 4LI0A 1TZKA 4NZYA 4AD8A 3GMTA 1Z7EA 1TPZA 2FGKA 4EKDA 3FKJA 4R9RA 4WNCA 3UWDA 3ZOZA 3I5MA 4PG4A 1YL6A 2PPLA 5ENDA 4LJRA 5AW7A 3PL5A 2O8NA 1OTHA 5A3JA 3R6DA 1KOLA 2LBPA 3K1JA 4W1PA 4HWTA 4JDUA 5DMHA 3NBKA 5KTRA 1Z0AA 2XQKA 1V8BA 3A4TA 4L0MA 1E18A 1HDEA 1Q0SA 5D87A 1NBMD 2H7CA 2YN2A 4WDQA 1O0CA 1FX0B 1SC1A 2WAMA 2V7UA 2H4YA 4LGMA 2O05A 3OQPA 1UZLA 3CNNA 4JVOA 4HNUA 2P2LA 4CTKA 2A1IA 3OT5A 3ICQB 1LBHA 1IY2A 1CR2A 1NATA 4M9CA 1IXSB 1XMSA 4QNRA 1VSQA 4GUDA 1Y3CE 5CTAA 3ASZA 3AIIA 3LX8A 2YWHA 5K0TA 1NXWA 5DNYB 3ZU3A 1W4CA 4TZTA 4Y6SA 5C80A 7MDHA 3TIVA 2Z6QA 2DUMA 3DM9B 2VJAA 4KE9A 4P32A 3TCNA 2PX0A 1AA9A 2RBEA 4MEAA 4IJQA 2RHDA 4QBHA 2ZYRA 3JCZA 2BFAA 4XGIA 2XPCA 1G4HA 3CVXA 2GNAA 1SULA 2Q1WA 2V7VA 4WXRA 1E5VA 2H16A 2R5FA 3JS5A 3MPUA 3MUEA 2FPSA 2DHCA 2W2QA 2YHIB 3A8TA 2H1WA 2RGGA 4R1MA 4S1WA 3YASA 4BFZA 1GL7A 4EYQA 1O0SA 3OAAD 5JO9A 3SIRA 2VNIA 3ICOA 2BP7A 1CIPA 4FD2A 1C4XA 5EJ2A 1WHSB 5F1KA 5TE9A 3Q7EA 4WLOA 4O8ZA 1WV1A 1SAYA 2OHFA 2ZK7A 5KSOA 1FP4A 5EIEA 3HGQA 5ILQA 1XYYA 3HZHA 3KSRA 1XWWA 3AR7A 1GSHA 2VF2A 1T9ZA 3MWKA 4JLNA 4RANA 3VR3D 4AQDA 4GAEA 3V7UA 1KDPA 4QYIA 2R3SA 3UGTA 1P9WA 4QGGA 5IULC 2GETA 2VF4X 4XQ0A 2Y2VA 1X39A 3T1QA 3AL0C 2C57A 4OQYA 1YC5A 1P29A 1X8LA 4RIIA 4PLCA 5CCEA 5M2QA 2PWYA 1DDIA 5KVSA 3WDMA 4D4LA 3ZHXA 1XRSB 2ECQA 4L1KA 1DQZA 4GH5A 1L5QA 2OSBA 2WAOA 4IZOA 4N6NA 3PSHA 1Z33A 3AW9A 3VKUA 4DF3A 3H2SA 5J2UA 1M8GA 2QTTA 3R6WA 1A9RA 1O89A 3IVRA 3R3VA 1ZJ5A 3K96A 1STOA 1C8BA 1QGAA 1RRKA 5TQJA 3V33A 2FN7A 1YS1X 1FU8A 1VL6A 1WMDA 3DEIA 2JIDA 3EY4A 1VYUA 1TX4B 4JC5A 5AW1A 5LWQA 3WA7A 1YR9A 2V54A 5JXHA 3GUUA 3WADA 4BX8A 3H87A 2V6JA 1ZONA 2ZRCA 3K9LA 1IPHA 1YZQA 3I01A 4HV4A 4LGVA 4MDHA 4LZOA 4M1QA 1VDMA 3CMMA 3EWSA 5D84A 3ZU6A 1GA6A 3NBQA 4HZUB 3NATA 1X7GA 1FFXB 1DCKA 3VJLA 3IAHA 3HDGA 2C5AA 2C83A 2CVHA 5DCWA 3N0VA 4RGQA 1W9MA 4RK4A 2Q6VA 1Z6AA 1Y5LA 5IXYA 4BQSA 2W8BA 3C3WA 4AU1A 4C0LA 1WOYA 4LECA 4Y2YA 4ZEOA 1Q0QA 1YH3A 3EX7C 2ZSHA 3GBSA 3A4LA 3LVBA 5LMCA 3PEYA 3CEHA 1FJGB 2XV1A 2WSMA 1YS4A 4IDEA 5IBQA 1HFKA 5CJ2A 3GBPA 4BX0A 1Y0BA 1D0SA 4OL9A 2AWNA 5HHTA 5HE8A 3N28A 5DOVA 1NW4A 1YFKA 1M2VA 1X7ZA 4GKKB 3KOZA 2CEKA 3A10A 1JB1A 1PJ2A 2FZ5A 2IF0A 4MB0A 1MJHA 3EQ9A 4MGKR 4OXNA 4PR0A 4BVAA 4EB0A 1YRBA 4MH0R 1HBJA 1G2IA 1VL5A 3CS3A 5T67A 2AFHE 1YI1A 5A6SB 4DR3B 1MUUA 4UJ3A 3LRPA 3P8ZA 5KNCD 1WZNA 1Y8RA 5JSZA 1QU3A 4MV9A 2NLOA 1RABA 5HK8A 1XJ5A 1CIJA 1YQWA 5SZKB 2VSOA 1ZJ4A 4DXDA 1SBCA 4NFLA 1Y8ZA 4YAFA 2OENG 4NBSA 4WBNA 3QJGA 4CFZA 3H9JA 3SYNA 3AKEA 1TQ8A 4EY4A 3Q5GA 1Q1GA 3QLVA 1S2NA 4FN5A 4D80A 2G4LA 3ZQJA 1RJWA 2BGJA 5DWDA 1O5OA 1B8PA 1IOLA 4XA8A 5KEIA 2XYHA 2J6CA 5AHXA 4P3YA 1GSOA 1G5PA 1VGVA 3SSOA 4JUIA 2O5VA 2G1UA 4UAUA 1NBOA 2CJWB 2C95A 1JPVA 3I30X 4Y6OA 5BN4B 3KQUA 3DZIA 1VOTA 4YUVA 3VOTA 2RBGA 5E9AA 1X38A 1W36B 4RYLA 3KUUA 4MPJA 4W82A 4E3ZA 2Z2JA 1MORA 4ZEMA 3CVYA 4WBSA 3P96A 3ZPXA 1TZCA 1WEHA 1JQLB 3QI7A 1S2OA 5B58T 2WIBA 5AJHA 1GADO 2Y8EA 3D1JA 2NNLD 1M83A 1M1NB 4IMIB 4HFNA 3WQHA 4N03A 2RIRA 1NVDA 2G88A 1U2QA 3AI1A 3D5TA 3DAGA 1CE8A 4WTOA 1OAAA 3MS2A 3IEXA 5BQXA 4JXXA 1T8PA 1HO3A 5CURA 4AMYA 4BQEA 4OIFA 3G0HA 3MXOA 1GAJA 3GH1A 4M1SA 1J33A 1EM8A 1Z62A 2XDQB 4TKMA 4W8OA 1G8KA 1G20B 4H08A 2GHQA 4RDCA 3IVMA 1OE0A 5IM5A 4YJDA 4B5LA 3VZPA 2OHIA 5A9SB 2VDRB 4Q4HA 3RUAA 2O2SA 3OCYA 2OWDA 4JIGA 3UGJA 2ZGVA 3FPEA 4HYTA 4UEKA 5NULA 2Q5IA 3IUSA 3EH2A 2B3TA 3W7AA 5JDIA 4AMBA 3PFCA 3PNPA 4NF2A 1P1JA 3BH7A 4B9AA 4EY3A 4YJ2F 4K6MA 1LDMA 3GLFA 5DVZA 1Y81A 4KPEC 3ZHRA 4Q1DA 2XWBF 3ZE6A 4UZEA 4OCZA 3C5VA 4H3HB 4G1UC 3TRJA 4E1AA 5BUCA 2P3LA 3ELUA 1QGUA 2WWRA 1ENPA 3BTUA 4RCYA 3HJNA 1LPMA 3NHRA 4AUEA 3R5HA 4D3ZA 5JDIC 3MUFA 4ISCA 4D8VA 1IY0A 2J33A 2J3MA 3OEHA 4NTZA 2WWTA 2ZE5A 1TZ2A 1YOVB 5WRFA 2GXSA 3D3JA 1KRHA 3M9WA 3I05A 4RVSA 1HE4A 4OHZA 2P6OA 1T1JA 3UPTA 5A05A 4PAOA 1XF1A 3GNTA 4TUYA 3SKYA 4DA6A 4A8JC 4CFSA 3V6MA 5LJLA 5JSYA 1XU4A 2IUYA 3PRHA 4AZVA 5COAA 3EDQA 1O6CA 3WIOA 3DS8A 5HGXA 3N70A 4EABA 1IYZA 2WKSA 4RJTA 2C2XA 2I9PA 1WXIA 1E9EA 3KP1A 2JD0A 4J75A 5TDHA 4HAVA 3JAWA 4RSHA 3BK2A 3SG0A 1J9EA 1NP7A 4PNHA 1UKEA 4IRMA 2HRBA 5J43A 1ZVQA 3KELA 2DHDA 3MN1A 1QWSA 4BRZA 1GU0A 2E1PA 5DLDA 5LR6A 2ZYIA 5AKEA 1I1OA 1UBNA 3CR7A 1X1QA 4GOJA 3KT6A 4OHVA 2COEA 2YHBA 5UKDA 3K16A 2H0AA 4GMHA 1GTJ1 3E23A 1JLLB 1W36D 2X23A 3CGGA 3GRAA 1KMHA 3TLZA 2H1VA 1XEXB 2WJIA 4Q7JB 1G21B 1Z2DA 3U39A 4V0OA 2NZYA 1UMKA 2ZRBA 3N9IA 4MS4A 2ATEA 1Y1TA 3LPLA 1QONA 4BVHA 2ANCA 2OCLA 3AILA 3LYUA 3AF2A 1H8ED 3C14C 2HFKA 4GR5A 4KQWA 4YCJA 2E48A 4ZO9A 3BIFA 5KAMA 4CWAA 2B2CA 2NU7A 4DRYA 5DGDA 1DO2A 1N4DA 1ISSA 2J9XB 1DFHA 4P82A 3GLKA 3BXXA 3N07A 2VTBB 1R5BA 2O8FA 1R1DA 4BGIA 3DMPA 2HK7A 4ETNA 3TO5A 1XWFA 4O2BA 4KMRA 4QECA 3NRJA 2E4VA 4D57A 5DN6D 2OFPA 3C70A 4UATA 3CNOA 3LHKA 4WOPA 3DZCA 4RJLA 5ADUS 4YV1A 3UTDA 5JQWA 5FWXA 3RAEC 3MJRA 3ICWA 1L0BA 5FTMA 2J3IA 2CNLA 4CCSA 4ZN6A 4YJFB 5JAQA 4M9XA 1A71A 2XZPA 4DXHA 1SD5A 3SHOA 4YPOA 2XMPA 4LISA 4JNCA 1O2DA 1JEEA 5DCUA 3V7NA 4UFOA 1AJEA 3WI7A 1MXHA 4FWTA 3BX1A 1L4YA 2PL5A 1AXRA 3I2IA 4GW3A 4I7EA 2G0NA 1PDWA 3IIEA 5AH0A 1SC6A 5C51B 1B4DA 1NVBA 2OFXA 3A1SA 3FLEA 3R7SA 3CE6A 3GOQA 3L7DA 1XC7A 1PZFA 2O23A 1V2HE 2VDKB 2H4XA 3BFXA 3GJ7A 5AHWA 3WMWA 3W5VA 1ESDA 2WIJA 4DXAA 1NL3A 3LVRE 1SQSA 3MTJA 2ALJA 2R4UA 1NUHA 4M2LA 4DLZA 3PD1A 1GNQA 1SUBA 4TWJA 1Z5GA 5EIOA 1OU0A 2FPKA 4JI6B 3CA8A 3SZGA 4F6RB 3K9WA 4FHCA 1QNFA 3SYTA 4YJGA 3S8EA 4IKPA 1QGYA 2PMEA 4DKJA 1F8GA 3F7MA 3UXYA 1BJKA 4I4LA 1Z17A 2MWMA 3I2FA 5T8KA 3CPSA 4QHSA 2QDXA 5M5BA 5JS1A 3PHLA 4KLZA 4LDQA 4ZI2A 3OLVA 3SX2A 3LV8A 2PRIA 5FL7A 3ZE0B 4GOOD 4GU5A 1UEJA 5EGSA 1D2NA 2ZJOA 1WDLA 2VNSA 3DE3X 1T6XA 4WAUA 3EY9A 1M7BA 3TNYA 1B0PA 5E6SA 5T8KC 3LKDA 4H2DA 5H9WA 4UM8B 1E6KA 3QBJA 4PZYA 4D9BA 3F6YA 1I7LA 2F6RA 2Q5OA 4KQ9A 4L8FA 4DSAA 2PKQO 4JL5A 1SIUA 1XO1A 3JAKA 4CNQA 3T06B 5AM3A 3PC6A 5B36A 5JPDA 2BISA 1KORA 4DAOA 4FT2A 3EUWA 4LHVA 2G40A 2PRJA 2VAMA 3EXFB 4IIEA 2TS1A 3VSEA 1PFQA 1K89A 1N0UA 1U99A 3G7NA 4IZIA 4CGYA 5JE8A 3RTDA 1SM4A 2IZZA 1XMJA 2ZJZA 1RPJA 4H35A 4NZNA 1ZRNA 2A9JA 3CH5A 3LBYA 5JLAA 4PU0A 5TPWB 3DTTA 3NWPA 2CE2X 3LYLA 2E4ZA 2VWGA 2AJDA 2YJ5A 3QW2A 4LNUB 4XWYA 1ORIA 3WIVA 5CBKA 4FGUA 5CT4A 3KLBA 3B1YA 4FBLA 4GS5A 1D2EA 3GRVA 4BC1A 5KTPA 1XZCA 3JALA 3QHAA 3GN1A 4H4EA 4LV6A 5AK3A 3VTKA 1DAMA 4D9EA 3DF7A 2ATIA 3A58B 3O8BA 4DNXA 2BM9A 3OQBA 4K9LA 1FFYA 2JC3A 5AW3A 2NGRA 1Z25A 1CJKC 3ZWDA 5IMBA 5J63A 1QHIA 1SNYA 2VLIA 1Z2AA 1F4PA 3EIUA 4GYJA 5AK6A 3ZXUB 4LW8A 4RZ3A 4A16A 4TV8B 1SFRA 2IX9A 3U80A 3WZMA 1P73A 1VMAA 5ETJA 1KDZA 2AB0A 1Q0TA 1P4GA 1GQOA 4LC0A 4WKOA 3T35A 3WNQA 4KWEA 2RDMA 3UEOA 4HLNA 2K2WA 1Z18A 2VYFA 2Z04A 4QX6A 1FTNA 3MUNA 1URPA 4R3UC 3EPHA 1R4AA 1SIBE 1SXIA 3N2YA 1WTAA 5E7IA 5CFNA 2J4CA 3CX8A 4RACA 1XQ6A 1XVUA 3TZBA 3UM9A 4BFSA 1HDZA 2EOAA 2X5KO 2DPXA 3OZWA 3TTVA 2R8BA 2JRCA 1M9NA 1N6RA 4AKEA 3ER8A 4HAZA 3M3DA 2RBKA 2GXAA 3IOMA 4D9CA 3KJIA 4QRHA 1GM5A 1DJNA 1L1FA 3OIFA 5G0VA 2CCJA 2VDWB 4AZ3B 5HRCA 4HAOA 4NU6A 1YVRA 2QV0A 4OP2A 1CUSA 1IDOA 1R6TA 2VUUA 3M8KA 3FTEA 3FWKA 1Z0DA 2LKDA 1AUPA 3NH6A 4OYLA 4AY5A 3KSMA 4YGYA 4UXJA 3O3CA 3ASUA 5KQGA 3UGQA 2XLCA 5LA6B 1GUFA 1VPLA 3DHYA 4KPYA 3U0BA 3I9MA 5DNUA 3PENA 5ALQA 4ADSG 5BORA 3GEBA 3JQ6A 4DPMA 5ICGA 5B53A 3RYCB 1ESEA 1SHTX 4DCOA 2XMRA 4KC0A 4IJUA 3W5SA 1T0IA 2AJLI 4B6SA 4DA0A 3O2QB 2WWHA 1EMDA 2WHEA 2C4WA 1M1ZA 4L74A 4XTCS 4QGSA 2KW5A 2RKOA 5FLKA 5HP4A 4IMJB 2FZLA 2ORVA 2Y9MB 3A26A 3KZNA 4L7QA 4AXXA 2Z9CA 5JNTA 3S1AB 6YASA 2OFWA 2ZRDA 3L6CA 3AIKA 3ZWXA 2CCGA 1PT9A 1HT1E 3QA9A 4OHCA 4O25A 2E4UA 2WE7A 2XUFA 1ENYA 1LPNA 1HDIA 3LZ6A 4JVLA 4DSUA 1SXJD 3INNA 1NMEA 2R7NA 3JQ9A 3ND6A 4MHOA 4PSUA 4YJKA 3DEYX 4W7SA 2ZVJA 1Q0ZA 3I37X 1V1RB 5ECGC 3Q7RA 5FOSA 3RU2A 4LOIA 4C4PA 4E2WA 4EGJA 2I7CA 1U2ZA 2M2IA 4BDTA 1NLYA 2DJIA 1C0LA 2WF7A 1OYWA 2Q29A 1GRVA 3EVAA 4LYDA 4XW2A 4YFVA 4YYZA 1I5RA 2X7HA 1E0AA 1XTKA 2NXCA 3HB4X 3ISJA 4QRDA 1WOMA 3HB0A 2QW8A 1PNTA 3T9CA 1VLLA 2NTJA 1UJBA 1L1RA 4H6PA 4KLCA 4CHTA 5BRJA 3E5NA 1NHGA 2MDTA 3G9TA 3LMKA 3MFYA 3OCJA 4WKGA 5KC8A 1P0MA 1HQDA 3R9WA 4RTLA 3GUCA 3WZLA 4KUEA 4UVDA 3BXFA 2H0RA 4MW7A 5DP1A 5A62A 1PG0A 2CE7A 4NS4A 5AP9A 1F12A 3D4PA 1RLUA 3EPPA 4FYIA 1IONA 4IF6A 4I50B 5FT9A 1E5XA 4QD3A 4ZAYA 3RSGA 3TQOA 1ZH0A 5CX1A 5EIAA 1KMMA 2RCNA 4RK1A 4FI3F 2QN7A 3PNOA 4BB5A 3OH8A 5KKCA 5B4TA 4ED9A 3NLLA 3RVDA 3AWIA 5JSUA 3CRW1 3GRCA 3EGXB 4DARA 4HB4A 1Q74A 1ZVMA 2AF3C 2HCJB 2JJ2D 2J07A 3QQPA 5FNVB 5AI6A 1U8AA 2L19A 3TR6A 1XJ0A 2IYUA 4IHJB 2VWHA 4M6WB 2W4QA 4B45A 1RLIA 2BGRA 2Y1WA 5FV4A 5I9NA 1KFCB 3ZY5A 3WV5A 1QYWA 3M1LA 3P27A 1N5LA 4KYIB 1OH7A 5K05A 4JYAB 4I4CA 1SC4A 3ABRB 1P4RA 2JBAB 4PHHA 1Q12A 4EUKA 1GPNA 1P2GA 2CNOA 3BYZA 4JBWA 1XMQB 5J5CA 1CQXA 3TSZA 3WTCA 1D2MA 4F38A 1P2FA 3D6JA 3THWA 5DBGA 1OW3B 3QFFA 4BCBA 1SHLA 2WUGA 1EKXA 2QIPA 4B47A 4AB1A 5HJ5A 4DAEA 2GEJA 1EQAA 2GLUA 2J85A 2ZIXA 4DCNA 4P36A 2XKAA 3GGSA 2NXEA 5JAOA 1DO0A 2B36A 1T2VA 3OECA 3Q7QA 3HFRA 4C04A 2EGHA 2ZIUB 1U80A 2X1VA 3WLSA 1N1DA 3HB5X 3VDMA 1MGOA 2XMCA 2Y0PA 3FA2A 1FXWF 1R9NA 3ITNA 2BR3A 3RF7A 2Q4TA 3VNVA 3I6YA 1XKXA 2A6PA 4YP1A 5FUVA 4S1TA 1GG5A 4QBKA 3TEMA 4XXHA 4I1VA 4QUHA 1O94D 1ACLA 3S1SA 3AR9A 4LGCA 2JFBA 3TLKA 4YCSA 1TEXA 4NNPA 4F72A 4OQQA 1YE3A 1BCRB 1B26A 4H27A 2WTNA 4ZARA 2ZTHA 1Z68A 3O2JA 4BN4A 5F2KA 1ANKA 4PXYA 1AQIA 2GN0A 2WTBA 2WU3A 4OREX 4MMZB 5EPOA 5TQVA 3T41A 4CW7A 3LP6A 1PK8A 2C2BA 3AKCA 2O2DA 1PJZA 4OXXA 2OXFA 5K3OA 4HTFA 4HBGA 4I81A 4ARZA 3NEAA 1R6BX 4JJ7A 3ZCVA 4BRWA 4XVCA 5KYUB 4RL4A 3IB3A 1L5RA 1RQRA 3GVPA 1QIFA 3FOAA 2GBLA 3Q6IA 4FKMA 1DQSA 2R751 2MINA 4HDKA 1OASA 5EN4A 5EMNA 5C5DA 5CXXA 3LC2O 1YNOA 2I6XA 3FYHA 1N2EA 4NBVA 2QNRA 3I9FA 3BEOA 5DX8A 4A91A 1XELA 4CE6A 4EG8A 2XCTB 3Q8KA 3ADDA 4J29A 2EIHA 3L0YA 1R4MB 2GBLC 2J3DA 5E6RB 3VVBA 2CXXA 2R8EA 3DNFA 4I55A 4Q02A 1UBUS 1F8FA 4B2IA 2GZAA 2C5EA 3TPFA 5CLLA 3GLIE 4P1ZA 4BO2A 3ZD7A 4R3WA 1MQ8B 2BGTA 5IKOA 2PWAA 3HEBA 4KODA 3EVGA 1XVIA 3WK4A 4CG0A 1FFDA 3ZKAA 2ZUDA 4H7FA 3DL4A 2JAXA 3BGVA 4RY0A 3ZU5A 5SV2A 1P4SA 4E0BA 5AVVA 1U4OA 4ICIA 2Z5FA 1FRNA 2ZE6A 4CBVA 3LTNC 2Z30A 1JWAB 1GL9B 4UMDA 5ALJA 3W90A 5H82A 1RR6A 1U7PA 3PEUA 4KV7A 2N1BA 3C6MA 1AN9A 1I14A 2VQDA 3C1OA 4FJ0A 4G9GA 1NU8A 2BEWA 5ALEA 1OU4A 3EA4A 2GB4A 4KX5A 4RY9A 3CNQS 3LU1A 3ILYA 2QV7A 4C5CA 3JSXA 2IHVA 3ZWVA 1ZIPA 2WB4A 3KQWA 1DKNA 1KDTA 1PGPA 1F5SA 2AEEA 3ESQA 2O7VA 3LIIA 4D6XA 2G6TA 3ZWQA 1TMGE 4IFBA 4POAA 5KQMA 4N3NA 5LMUB 4CIWA 1NSYA 5HZKA 4EY6A 3D6TB 4XWTA 1RXCA 4QLOA 5D5QA 3THRA 5L7YA 3G2PA 3WWEA 4L9RA 3HGTA 1OZ0A 4CEHB 1N2HA 5JASA 3PGVA 1TD1A 3LX4A 3ZKWB 1WULS 1YZHA 2IQIA 4CUZA 2R9VA 4IH9A 3ENQA 5FNZA 2ZBRA 3MERA 2HIAA 3WQBA 4GEGA 9ABPA 3NU1A 5KHAA 1OLXA 3FSGA 4RM2A 1MAUA 2ZBEA 3MWYW 4LTMA 4KWHA 3T3DA 5AKJA 1MC8A 1KO7A 1Z22A 5BT9A 3OOEA 2NU8B 4FYHA 1LPAB 3A4NA 5LDDC 4FQ7A 4LV5B 4DLUA 3VNBA 4JQCA 1KR5A 3GH3A 3NT4A 3QSYA 2Z2ZA 5J4LA 1GRRA 2PS3A 2IPMA 1E2QA 2J3HA 3G59A 3WBFA 1U0OC 3KQMA 4BNIA 1BRMA 1UBFA 3MGAA 4BB6A 3ROFA 1ECPA 3C6YA 1I30A 3HMKA 1POXA 3VO9A 2FSSA 1AKRA 2XXBA 3VU8A 3WWPA 3GVXA 3K8ZA 1TFRA 2XDWA 4GXRA 1EK0A 4Q6WA 5HGJA 4AP6A 4BKQA 1YHYA 2JGFA 3O26A 1EJ2A 3BWEA 5A03A 3K0FB 1QANA 1HOXA 3M81A 3ROPA 2I22A 3NNDA 3NALA 1QDEA 5IDWA 1KRWA 5ALDA 5KSWB 3BEDA 3A1CA 3HJGA 4B74A 1AS3A 2GT1A 4YWJA 2FGJA 4P0QB 3CVVA 1VPEA 1DXQA 4DNOA 1S7GA 3E9CA 2Q9UA 4NMLA 1NX6A 2IEBA 2JGMA 2A5YB 3ZTTA 3UMSA 3RT9A 1GDHA 3M7IA 4D3FA 3ZW8A 3F3SA 1YZYA 3TOVA 1KERA 5LLDA 2CLLB 4LJYA 5DTJA 4DIOA 3HZZA 5DM70 4DDUA 3P19A 2WW8A 1RQ2A 3QVSA 4F71A 2JANA 3P0FA 1J2TA 4OJMX 1YR3A 5EXTA 2P0EA 3WK9A 4A9AA 2WMYA 4ZPXA 2NP7A 1C9DB 1EP2B 1WWKA 2NPOA 1FMFA 2CXNA 2QTBA 2K7FA 2IV2X 4G85A 5IAAA 3PD0A 5LYJF 3SS9X 2QPLA 4LXGA 4DJ5X 3ZCXA 1HPLA 2IUSA 4L6CA 3PRYA 3AUAA 3HUTA 2HXYA 5AXAA 3VPSA 3AC0A 1NVFA 4FLMA 4ABTA 3WMEA 4NMMA 3U1TA 2WVJA 5BVGA 1V35A 4PLYA 1NVGA 3UJ8A 3OE7A 4X3PA 1P0CA 3D2LA 3C1UA 3FF1A 3H6KA 5B2FA 2C4NA 1F2UB 4I5IA 3AMVA 4UVGA 4LOJA 2MR6A 1B8VA 1G0OA 2X0NA 3BORA 3LXMA 4JZYA 1QK3A 4WXMA 1T9BA 2OQIA 2A30A 4RMNA 4WXHA 5TARA 3ZU2A 4Q9HA 1XEWX 3U56A 4EJ6A 1VBMA 2YJ6A 2X15A 2NT3A 1NMXA 1JU9A 1F6WA 1QOPB 2V5VA 4XB2A 2J09A 3ST7A 3B8HA 4URVR 2QL5A 4XD7D 3WKAA 2ARKA 3K8OE 2WOOA 2LW7A 3H5TA 1QIDA 4UOQA 4X8OA 3WL6A 1QNLA 1RW4A 4E33A 5A6SA 3HBAA 2OXTA 3AHJA 3NIWA 3U5ZB 1BFKA 2DPGA 3L6BA 2X5OA 4CKCB 1GLGA 5ES4B 3ZWNA 4P9NA 1FDVA 1QVAA 1MC4A 2P2GA 3DOOA 4QQ8A 4WIAA 5EMJA 5B3AA 4DJFC 3WOHA 2JLXA 2NTNA 1MEEA 4E1VA 1XZJA 1U3TA 1YHNA 2UZ1B 3AVOA 4GR4A 1DTEA 4FEGA 5E8RA 1D03A 2PE5A 2JRLA 3W9SA 2P91A 2Q6TA 2OZEA 2XB4A 2VZ0A 1Q20A 2ZE7A 4QXAA 4EHHA 1E0JA 1W87A 3CUYA 3CXRA 3L92A 2YCLA 4DLLA 3L8FA 2WSYB 4HLUA 3RROA 3PICA 1J0DA 1ZITA 2BGIA 3FBTA 1RXEA 4LYEA 4UQPA 1TA4A 2GILA 3OD1A 3OWXA 1W4LA 3ZXXA 3PEEA 4JQSA 4FN4A 5EZSA 5JCJA 4E5VA 1II0A 2XCUA 3MJHA 5L3SA 5KNBH 3CN9A 3OZIA 3OPNA 4L5YA 4B73A 4DLYA 4F1KA 3C8ZA 3KZ1E 4OY3A 3HXMA 1ATZA 3B6KA 3E9DA 1X80B 4CDGA 4CLOA 3MELA 4HLUC 1DIOB 2GEKA 3ESZA 3RQIA 2AKAB 3T9BA 3A3NA 3BIOA 1XNGA 3SIWA 3JVIA 3VZCA 2IZ1A 1K8ZB 3BMNB 4Y1RA 2DU8A 1FU4A 2A0XA 3HKDA 3IVGA 4B8WA 2OKCA 5YASA 1ZY2A 3II6X 3BWCA 4G5SA 2VPTA 3DDWA 5FBQB 3SMVA 1PT5A 3AERA 5ERXA 4BVKA 2IV7A 2RHCA 1PJLA 5IP5A 1S9HA 1S4QA 2AN5A 4TTJA 5H1YA 1Q6ZA 2O3SA 4HFRA 5CFMA 3A6JA 3QYFA 3TBFA 1CYEA 1CJUC 3V8EA 5IF9A 1K7XB 2IOYA 5CDTA 1KS2A 2FEAA 2HNAA 4M8LA 3TTUA 4E5SA 3CLUD 2ZJ2A 1PD1A 4TKUA 4KKVA 2MYUA 4CF5A 1N6IA 4UUAA 3T9EA 1EJBA 4DIDA 1JEYB 4K7JA 1M3SA 1J0CA 2OKGA 3ZK9A 3U7QA 4S12A 5HR5A 1G19A 2HT6A 4P83A 3TNJA 5TR9A 1TECE 4L4ZA 3ZE8A 1GGMA 4BPBA 3HBLA 4C01A 5BSWA 1C41A 1GNRA 1DARA 5A9SA 4DIMA 3MMXA 2J5RA 1T9GS 3I4LA 1VP9A 3HM2A 4D4JA 1UCFA 1AUVA 4TWBA 2JIMA 4ESOA 1YJ8A 1D1TA 1KL7A 1OTYA 5FA6A 4EDHA 3EPLA 4NEQA 1XXHA 2HWWA 4GOMD 1B14A 1Q5PA 3LFHA 4QO8A 1LGYA 1BOOA 4P3XA 3T1HB 2FCRA 2Y77A 4RMHA 3VMFA 4KR9A 5JJCA 3TTWA 5KX5B 4OFXA 5JVDF 1GD1O 5LQMA 2WT4A 2COKA 3L8MA 3AEUA 1JBQA 4R2WA 5IASA 4QG3A 1YBHA 2J0UA 1CZKA 1P0IA 2R66A 4F6LA 1HL3A 1I2BA 2WWFA 1YE5A 3K8QA 1KDRA 1UPUA 2C07A 2C7VA 2DPLA 2QX7A 3N39C 4IGFA 4J7CA 4YJHA 4TQUS 5E7JA 4B3XA 1RC8A 3KFLA 4LE2A 3ZXSA 3RQSA 1LBTA 3MHPA 3QW4B 4M1ZA 3KQQA 4MR9A 4PG6A 4TYWA 5C4MA 1JG1A 5I5GA 3LSYA 1G5IA 4ZMRA 1O96B 1TUIA 2VNHA 1I3KA 3A04A 3NEJA 5LIRA 5K3FA 4NK4A 4P7JA 4CF6A 5TGTA 1Q15A 2QG9A 3H3XA 4DYHA 3MJDA 4Q6BA 2BCJQ 4J3JA 4IJWA 1RS0A 3ANMA 3NBYC 3KQLA 4F1WA 2N75A 3NH9A 4PZAA 5EJGA 2HSDA 1PDOA 2JKVA 4HDCA 5I7UA 4II2A 2LRHA 4S0ZA 1C3OB 3QOXA 1O6FA 2X1HA 2C1ZA 1GPKA 5TVGA 4B3SB