4EB0A

Crystal structure of leaf-branch compost bacterial cutinase homolog
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
SNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LCC
publication title Crystal structure of Leaf-branch compost bacterial cutinase homolog
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
total genus 91
structure length 258
sequence length 258
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12695 Abhydrolase_5 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eb0A00
1E8NA 4PSCA 1CIJA 1N5MA 1UKCA 3HXKA 3QH4A 2W6CX 3KD2A 2XUIA 1C4XA 5ALTA 2DHEA 1CRLA 4BP9A 4C01A 4K6KA 2RI6A 4X71A 2OQVA 5AKYA 5HK9A 3KWFA 3HEAA 2PUHA 5ALKA 1WPXA 2ZVDA 1CUXA 1G42A 1YA8A 3W04A 4HS9A 1BE0A 4G9EA 2XI4A 1FFDA 3PE6A 4HXGA 5HKAA 1CUYA 1EB8A 1UXOA 4FLMA 3OM8A 1YASA 2VJBA 1XKLA 3WWCA 1X70A 4KAJA 4G4IA 4Y2SA 4Y2XA 3M83A 1LZLA 1JI3A 3OTQA 3HC7A 4M0MA 2GZSA 4EY8A 1R50A 1CEXA 4YASA 1AQLA 4CCYB 3VVMA 3H19A 4RPCA 2BUAA 2QXUA 1YS2X 4UBKA 2YXPX 4QDOA 5KWJA 4AO7A 3NUZA 1SC9A 3AIOA 5FP0A 4CCWA 2WHPA 1ORWA 1U8EA 2WIFA 4B9AA 2WFLB 4Y2UA 1UWCA 1L7AA 1MAHA 4LXHA 3DDUA 2EDCA 2ZJ7A 1GT6A 3G7NA 4ROTA 3E0XA 1XRLA 4BE9A 2JBWA 4WY5A 3WA7A 1ZD5A 1BEZA 3FSGA 3DQZA 4BAUA 4EY7A 4B9EA 3N0TA 2PPLA 3UUEA 3WK5A 4G9GA 1XZDA 2GYVA 4B81A 3W06A 2C5FA 1J2EA 3ZLTA 5I7UA 1WOMA 3F96A 4J0JA 3DJYA 5ALVA 3WWPA 1XZKA 5CRIA 4AX4A 1QO9A 2Z5GA 4BC0A 4QWMA 5CXUA 3QPAA 1EA5A 3ZLVA 4WY8A 4FNMA 3KXPA 1R88A 4W63A 6YASA 1H2WA 1LPOA 5FRDA 2QUBA 1R9MA 3GUUA 4PV7A 3IUJA 3DLTA 3WMRA 1WHSA 3PF9A 1JFRA 2WHQA 1D07A 5JYCA 2VEOA 3TRDA 4Y2JA 1K5PA 3AIMA 4DSAA 3WWOA 3W9UA 4AMYA 4EB0A 1EK1A 1A88A 3C43A 3O9VA 3BF7A 5CTAA 1TCBA 5AM2A 2WJ3A 5LZ5A 2FUKA 2HA0A 3FLAA 4WDQA 4EUSA 3O4HA 5CT9A 1R4ZA 3BIXA 4W1PA 3AJAA 1TQHA 3H1AA 3WKBA 3RARA 2ORYA 3FSGD 3NWOA 4ZXFA 4MXDA 2O2IA 4P9NA 1UKBA 2WG0A 3LS2A 4DM7A 4AMZA 2WSLA 2O7RA 4FFVA 4XJVA 3STYA 1IZ8A 3F67A 3G9TA 4Z49A 1VKHA 4F0JA 1SOMA 4UHDA 3LIIA 5EHZA 1CUVA 2ZYRA 3ANSA 4CFSA 1W75A 5FPPA 4OUKX 3W2TA 1GPNA 3WLAA 2Z8XA 3DCNA 2H1IA 3BWXA 1AX9A 3WJ1A 3MVEA 1MT3A 3QZUA 3FWHA 2XUDA 5AI8A 2FX5A 3G8YA 2IITA 4X90A 5BV7A 2WG1A 3WL7A 2WIJA 2YYSA 1EDDA 4GDMA 3IIIA 1H23A 4PW0A 5AK6A 5ALMA 4WFIA 4GBGA 5EHQA 2JGFA 3AZPA 4HVTA 4C88A 1XROA 3EIOA 2ACKA 3I2JA 4Q82A 5HFNA 4AXBA 2PSHA 2XUFA 3ED1A 2OCGA 4ZI5A 2HU8A 5FLKA 2BKLA 5DNUA 1E89A 3KWJA 4H7IA 4OYLA 4UBNA 5KREA 4GLBA 1BS9A 4G4GA 4OPMA 2CBGA 1XRQA 5K3AA 1X2BA 1B41A 4X95A 2GBFA 3S2ZA 2QKYA 1C7IA 5DYWA 1LPSA 4MWSA 3WL5A 2OGTA 1XRRA 1XRPA 3IUMA 2R8BA 3QPDA 5AJHA 1DX6A 2HU7A 1HQDA 1QIEA 1UFOA 5ALUA 4J0CA 3IURA 4UBMA 4BRSA 4O08A 1THTA 1EK2A 1BCSA 4CG2A 4X97A 5ALFA 5AIAA 4QA9A 1WB4A 3D7RA 1E3QA 4MEBA 5ALEA 2C5GA 1SCKA 4B7ZA 4YPVA 3BF8A 3I2IA 2HA2A 4L0CA 4Q1VA 4JH0A 3FYTA 3GROA 4B82A 4JNCA 1U2EA 4Y2VA 2XE4A 3PF8A 4X94A 1UOQA 2J3QA 3UUFA 5JANA 4W1SA 4GXNA 1G5FA 3C70A 1XZCA 3FLEA 2HA7A 3O0DA 1B6GA 1QLWA 3C6BA 2OCIA 5JD5A 5IVKA 3R3XA 4ITVA 4NS4A 4FKBA 5K3FA 3R3ZA 1EI9A 3STVA 4UFNA 4AZ0A 2PSFA 2XQJA 3U0VA 1AMNA 1ZGBA 2IIVA 1CQWA 1WCYA 2E3JA 4DNFA 4KRYA 1CFJA 4W1QA 3D3NA 3KSRA 1NX9A 5IVDA 3AZOA 2BGNA 3V1MA 5F4ZA 4QDZA 1F0NA 5AI0A 1JU3A 5AKXA 3IVMA 2WHPB 4OU4A 3LCRA 1ODCA 5T4BA 3S8YA 1F8UA 4J3JA 1ODSA 1QJ4A 4EY6A 3D0KA 2HHAA 2AJCA 5JAUA 4KRXA 4QDTA 4P93A 5LKRA 1R3DA 4A5SA 3CCCA 2YASA 2XMSA 2HM7A 2QR5A 2HA4A 4BTVA 4ZGBA 4H18A 2Z8ZA 5AIBA 1O6FA 3RM3A 5AM3A 1QE3A 3ZI7A 2VT6A 4E15A 3V1KA 4QDUA 5AKEA 2D5LA 1R9NA 2AXEA 1MO2A 3Q8WA 3G02A 5HF9A 3IBTA 4UBLA 2RAUA 4KE8A 1E5TA 4DMHA 4QZVA 2DCMA 5KBYA 3QITA 1XZIA 2XQGA 3R3YA 1DTEA 1YR2A 3STTA 3ESDA 1M33A 4X85A 2V9ZA 1IUOA 1CLEA 5EIHA 3AFIA 2DSNA 5JD4A 3STXA 1QFSA 3L1JA 2Y2VA 4OU5A 3AIKA 2XUJA 4BRZA 4LHEA 3YASA 5C81A 3FYUA 2UZ0A 1TIBA 2V96A 4D9JA 3L1HA 3A2MA 2RHWA 1J06A 5T4FA 1H22A 2XDWA 1WHTA 3C6ZA 4UBIA 4C4XA 5HFAA 1Z68A 2BUBA 1QTIA 5ISMA 1MX5A 1JJFA 2V98A 1CUCA 3V48A 1VXOA 1VLQA 5LZ8A 1T2NA 1IUPA 1TAHA 5LZ4A 1XFDA 5AHXA 5FOQA 2DQYA 3VISA 4GHWA 2VATA 4KAFA 1XKTA 4RNCA 4I19A 5T4HA 4H7DA 4X91A 1XQYA 1USWA 3C5VA 1LPNA 5BWCA 1BCRA 2XUPA 4ZRDA 4GI1A 4E11A 1CUHA 3DL4A 3WKDA 1LPBB 1TKRA 3VXKA 5C8VA 3IUNA 2QJWA 1LBTA 1O6GA 3VVLA 3C87A 2BJHA 4RE5A 1ISPA 4KAAA 4QDXA 5H3HA 4BVLA 1CUGA 5HF5A 4X00A 4C4YA 3D2BA 5ALRA 3G0GA 4A16A 2ZYSA 4PO3X 5HQ3A 1OILA 3R3WA 3WIOA 4IH9A 5AOBA 3G0CA 4DNOA 4U2FA 5EFZA 1FSSA 3TEJA 1HDEA 1LBSA 1TCCA 3O4IA 2RONA 1UK6A 1ZJ5A 1F0PA 4IH4A 1LPAB 3WK8A 3DYVA 3HABA 3V9AA 5A62A 3O4JA 4Q3OA 2AJLI 5I9IA 3STWA 1BROA 3WK9A 1DT3A 5E4YA 1JU4A 3WK7A 1XQVA 3H04A 5DNWA 1K4YA 4KE7A 4JYMA 2I78A 1SCQA 5FV4A 2IX9A 3H2IA 2WUFA 2X76A 1XQXA 4WFJA 1N1MA 3R3UA 2EEPA 3VDXA 4CI9A 3NGMA 3ESCA 3QVMA 5ALHA 3SK0A 1DINA 1CVLA 4A23A 4CG1A 1Q83A 2ZYHA 3PUIA 1EX9A 2VAXA 1K8QA 2ZYIA 1VZ3A 3PDCA 5FPQA 3P2MA 4BAGA 2ZSHA 2OLEA 5AKZA 1ETHA 5BOVA 1MNQA 4DIUA 5HK8A 3HLKA 2WIGA 2B4KA 1UOOA 4BZZA 5LZ7A 4DTCA 1QONA 1HKHA 4TPKA 4F5ZA 5ALOA 2WFMA 3M81A 4IHAA 2ROQA 3R0VA 1EH5A 3LIPA 5E4JA 1AZWA 3CN7A 1HBJA 1VE7A 2VAVA 3V1NA 2BAGA 2WLSA 3WJ2A 1TCAA 2XMDA 2JGEA 5CXXA 1JKMA 1P0QA 2RIPA 5DYYA 5ALWA 5ALZA 1W4LA 2OXEA 1BRTA 2K2QB 5AICA 4F60A 1QOZA 2DR0A 4MYSA 1GQRA 2B61A 1MX9A 4OB6A 4HRXA 5AI4A 2LIPA 3C6YA 3FLBA 2WTMA 1EINA 4LYDA 5K5EA 3IB3A 4ARAA 4BCDA 2HL6A 4AN0A 4FBLA 2J4CA 4AZ3A 5K3FB 3EQ9A 1THGA 1ZGCA 2VJCA 2GBGA 2YH2A 1BEEA 3STUA 1YAHA 4OCZA 2WUGA 1GPLA 3OC0A 4I3FA 3F8SA 4OB7A 4CIAA 4Q05A 4KEAA 4QLOA 4EA6A 4J0GA 3WKAA 3FCYA 1UK9A 1Y37A 3PFCA 4PSDA 2WJ4A 1DWPA 1OCEA 5AKLA 5AK5A 2WTNA 3QYJA 5HF6A 4BDSA 4BB0A 1QO7A 4G8BA 1EB9A 4EBBA 1N5RA 3U1TA 2OQIA 2QRUA 1WM1A 2PX6A 4H77A 4BATA 3ZPXA 1IVYA 1WB6A 1PV1A 4WFKA 2QM0A 4TGLA 3WYDA 3GFFA 2XMGA 1ZICA 4BCBA 1DWQA 4UFOA 5C8XA 1SCIA 1YS1X 3E4DA 2QMQA 2ZJ6A 4X92A 5C7YA 4ZWNA 1XQWA 1I6WA 4B0OA 3OURA 3W05A 4E14A 1GQSA 4X7BA 4U2GA 2EDAA 4TVKA 3IULA 1QIHA 1G4HA 1E8MA 2H7CA 4X6XA 1GXSA 1W52X 1HL7A 1UOPA 4OYYA 2PL5A 1EVEA 2HDWA 3HSSA 2JF0A 3I6YA 3BDVA 3BE8A 2PSJA 4DMKA 5JZ9A 1AUOA 1QIDA 2WFZA 1QGED 5ALNA 4BAZA 4JUIA 2I03A 4U2BA 2BFNA 1QIGA 3FYUB 5LLSA 1ZIYA 2PSDA 3SX4A 1LGYA 1JMYA 1UT6A 5AH0A 1Q0ZA 4XX1A 3B3QA 4FOLA 3AZQA 1WB5A 4UFPA 1CV2A 5IVIA 4IQ4A 3A2LA 1FFCA 1XLUA 2O2GA 1QIKA 2QS9A 4B0PA 2RHTA 1QTRA 3I28A 2Y6UA 5JATA 3A2NA 5HZGA 4H0CA 4Q3KA 2J3DA 4AO8A 1EVQA 1QIFA 4N8DA 2HU5A 2VF2A 2QUAA 2XUKA 2VSQA 3LLCA 4J0IA 1QFMA 2C0QA 1ZD2P 5HKBA 1IMJA 3I1YA 5CH8A 1AC5A 2WU3A 4HZGA 5AM5A 4QEKA 5HQ3B 1XZHA 1EDEA 1CUSA 4OB8A 3WWDA 2HRQA 2JEYA 3O9MA 4N5IX 4FTWA 4BBZA 4BCCA 4Y2TA 1CUAA 2C4HA 2Y1KA 2VJAA 3G0DA 5JZBA 1GZ7A 5AK4A 1YB7A 5ALLA 4ZREA 5JASA 4Q34A 5DNVA 3M82A 4G5XA 3I1IA 3D4LA 3OOSA 1QIMA 2XQFA 3QM1A 5AOCA 3ESAA 4N8SA 1C7JA 1H2XA 3HACA 3A6ZA 1YA4A 2D0DA 3I2FA 5D7BA 4HXEB 1YCDA 4X6YA 2XUOA 3DKRA 4UBJA 2B9VA 2QT9A 4UHFA 5ALQA 4NMWA 5SYMA 2JGKA 2P8SA 5BWBA 4WJLA 2O7VA 2XUAA 4C4ZA 5C8ZA 4F21A 2ACEA 3C8DA 3B12A 5AI6A 2C58A 2Z3ZA 1K63A 2CB9A 4L9AA 5FUMA 2PUJA 5AM1A 3HI4A 1KEZA 5EHNA 3AILA 2WHRA 1EDBA 2WQZA 2XMRA 3I6MA 5ALXA 4FHZA 5CBKA 3IA2A 1NU6A 3B5EA 5AP9A 4KE6A 1S8OA 2BUCA 5K3EA 5ALDA 4BTLA 4H35A 3C5WP 2G5TA 2QXTA 3QMVA 2HA6A 1E8DA 4PNZA 2I3ZA 1DX4A 5AI9A 3QMMA 4M0EA 1XZBA 2OAEA 4AB1A 1PJAA 2VJDA 2Y6VA 1H2YA 3GZJA 4BVKA 3RKSA 4W1RA 2C7BA 2QZPA 1LZKA 5A71A 2ECFA 2WUDA 1XZFA 1EXWA 3I2GA 4NVRA 4KR0A 2G63A 1G66A 4M0FA 5JZSA 2VT7A 4B6GA 1L7RA 1ODTC 3DEAA 3HZOA 4UHHA 1HLGA 5CW2A 4PF1A 2PSEA 5CMLA 1P0IA 4K2AA 2JIDA 4K5QA 4C6HA 4P92A 5EIEA 3C45A 2XUHA 3A70A 2VTVA 2XQKA 3DD5A 1U4NA 1LPPA 4U2DA 2XLCA 2OPHA 1WPRA 1ZI6A 2HA5A 4S0XA 3FCXA 2WG2A 3WK4A 2H7YA 4QLAA 3H1BA 1XZMA 4GECA 4DNPA 4QNNA 1J07A 3OPMA 3TJMA 2ONCA 5JAHA 1LNSA 2QTBA 1MNAA 3H2HA 2DFPA 1J1IA 3O4GA 5YASA 3F98A 5AKJA 4LYEA 4V2IA 1HPLA 2JGIA 3PICA 3DOHA 3NOXA 1ZD4A 4WCVA 1RP1A 1E66A 2DHCA 3DL7A 5IVHA 1CUDA 1QZ3A 1MU0A 4MQLA 1A8SA 4BC1A 3CCBA 2QVBA 5DWDA 2R11A 2GYWA 1JJBA 4CIBA 4X6UA 5EGNA 1TK3A 4LXIA 4EY5A 3G9XA 4ETWA 4C87A 2XMBA 3MUOA 4HTAA 5AKKA 3V1LA 4JEIA 3BDIA 4Y9SA 5JAPA 2HA3A 1JJIA 1OXMA 2ZJFA 3BXPA 2ZSIA 2XB6A 4H7HA 2XUQA 1CUUA 5JD6A 1A8QA 3QBJA 3H2JA 2FJ0A 5E2IA 4L3WA 1N8SA 1RWQA 5ALPA 2OGZA 3HRHA 1DQYA 1UK7A 2NW6A 1ZJ4A 1Q0RA 4AO6A 4CG3A 3SC2A 3WL6A 3G0IA 5IH7A 3CN9A 5LIPA 4ZV7A 3RK4A 4QWWA 5ALJA 4AQDA 3FVRA 5AK3A 2CKMA 1MPXA 3E3AA 3DKKA 5LP1A 4H7EA 3N2ZB 5A7HA 1XLWA 3FBWA 3G0BA 3M3DA 4FWBA 2VQ6A 5DYTA 2AJDA 3BJMA 2GZRA 5JAOA 5AM0A 4H7JA 1UK8A 4OD0A 3VJMA 3UMJA 5J3JA 2OAGA 3C6XA 3WKCA 4E46A 4XVCA 5CH5A 1MN6A 3WQHA 3BL8A 1XZAA 4KJXA 4GEGA 1TRHA 3F97A 1FFEA 3H18A 2Q0XA 4LIPD 1LPMA 1L7QA 5ALYA 3K9BA 4BE4A 4Y2YA 1GGVA 3WYNA 3PUHA 5EHXA 4DMCA 2H9YA 3PI6A 3CXUA 3WA6A 5ESRA 4AN1A 1FFAA 1CUIA 2WIDA 3F9CA 5T4EA 4IH1A 4DNQA 2AJ8A 1ACJA 4Y2QA 1JT2A 3ICVA 2HIHA 3D2CA 3I2KA 5CT5A 4YX9A 4Y2PA 1XZGA 4X93A 5KWIA 1QIJA 1P0PA 3JWEA 3DS8A 1VJ5A 4IO0A 1ZD3A 4HAIA 1YB6A 2BCEA 3HJUA 2I3DA 4XIIA 1R1DA 4UPDA 3AINA 2H7XA 1YAJA 3L1IA 1CUEA 3H17A 4UBOA 3T52A 1BU8A 5ALGA 4BVJA 4PQEA 1LLFA 4B85A 1ORVA 3FNBA 4N8EA 1CPYA 5FXMA 1K6EA 2WM2A 3PFBA 2ES4A 1ZI8A 3VKFA 4UHCA 1DWOA 4H7FA 4DLNA 3H2GA 4NZZA 1NU8A 2WKWA 3IUQA 1W76A 3WZMA 4MWTA 4INZA 2GYUA 3QMWA 1PFQA 1UZAA 3SWWA 4DSZA 3H2KA 3R40A 1BN7A 1XZLA 3K2IA 4G1FA 2HFJA 3VJKA 4UHEA 4HRYA 4G8CA 3MUNA 4DGQA 5LKAA 4FMPA 5K3DA 3G9ZA 5K3CA 3QPCA 3EQ7A 1VA4A 5SYNA 2PVSA 1DT5A 3D5EA 4CCYA 4RGYA 4MQMA 2CJPA 5DLPA 3WKEA 4RE6A 4JYPA 3TGLA 4G8DA 3WI7A 1P0MA 1SFRA 3Q0TA 4BYMA 2PM8A 1CQZA 4HXFB 3KOOA 2G5PA 4MYDA 4P08A 5CT6A 4U2EA 1GKLA 4LXGA 4B84A 3T4UA 1YSCA 2CUTA 1Y7HA 1VE6A 4Y2RA 2X8BA 4K6GA 5A7GA 2WFLA 4EY4A 1T4MA 1AKNA 3FAKA 3G9UA 4OSEA 4DYHA 3ZV7A 5CH3A 3W9BA 2JGLA 3DNMA 1KU6A 4FBMA 1DQZA 5CT8A 4Q3LA 1MJ5A 3R41A 2OCKA 3ICWA 3ZLUA 4QE3A 5ALSA 4G4JA 3OG9A 2DHDA 2QJRA 1CUZA 1GPKA 5D6OA 4FNGA 3GBSA 5CURA 4J0HA 3X3HA 1A8UA 1RYYA 2OCLA 2G4LA 3WZLA 3WIBA 3FVTA 2XUGA 5EI5A 1FFBA 4K6HA 5AM4A 5JALA 2DQZA 2XMQA 3WWEA 2FJPA 5FKJA 3ILSA 1ZOIA 3RLIA 4B80A 2GBIA 4UUQA 1XRMA 3WL8A 1A7UA 2XMCA 5A7FA 4ZV9A 2PBLA 3JW8A 2HRRA 2OG1A 1MX1A 4LKOA 4WDRA 2QOEA 2JEZA 2Z3WA 4BZWA 3O95A 1X2EA 2PU5A 2XLBA 1CUBA 3C8HA 1VOTA 4EZIA 3HYSA 2B20A 1CR6A 1CUWA 4GWLA 3EBLA 1ZI9A 5A2GA 5EIAA 2JGMA 3BIWA 1FJ2A 1AGYA 3K6KA 4W9RA 3VJLA 4KACA 5A6VA 5AKGA 4ARBA 2BGRA 2CEKA 2HFKA 2GBCA 4C89A 4BDTA 1EHYA 1BN6A 1CUFA 5E4TA 2PU7A 2PKYX 4GW3A 5D3KA 3ESBA 3EQ8A 1QIIA 2WUEA 4YK7A 2J4FA 2X5XA 1ACLA 5LZ2A 2HADA 1IUNA 2AJBA 1KU0A 1XRNA 5I8PA 4MEAA 1XLVA 1GKKA 1JMKC 1XZEA 4J03A 5JADA 3MGAA 3ANTA 3R3VA 4U2CA 5JARA 2Y2UA 4KE9A 1VZ2A 2O2HA 1MAAA 4FFWA 5ALIA 5HF8A 5LYYA 2RGUA 4H7KA 1H2ZA 2CZQA 4I4CA 3DOIA 3EF3A 3FOBA 4MJ3A 4Y7DA 5K3BA 2CMFA 2WILA 5AI5A 5DTJA 2XMZA 4J0DA 3FYUC 2C0PA 4J0KA 4B83A 1CUJA 2WU4A 3H0CA 1W6RA 3BJRA 3I2HA 5JIBA 2VA9A 1U65A 3IDAA 1AURA 3D59A 4X3CA 4DMFA 4UHBA 3WK6A 2WIKA 1UKAA 3DYIA 2V97A 2XQIA 1F6WA 1IZ7A 3ZWQA 1MTZA 1Q84A 3GELA 2JGJA 4EHBA 5HCUA 1XZJA 1DU4A 3I6ZA 5AOAA 5FDFA 1VXRA 3JYHA 2W22A 3AUKA 1W1IA 4FLFA 2OGSA 3KDAA 4XWGA 3LP5A 7YASA 4FDMA 2WJ6A 5AKHA 2XT0A 1VA5A 5CT4A 4PSUA 4BP8A 5IKXA 4FLEA 4L72A 4KYVA 3GA7A 5LZ9A 5D3ZA 3D2AA 4N5HX 5DTIA 5AO9A 4J7AA 3E1GA 1ZIXA 1Y7IA 5DJ5A 5AKIA
chains in the Genus database with same CATH superfamily
3UOGA 1RZRA 1M1YA 2O0KA 3PENA 4B8ZA 3GAFA 2FQWA 3I42A 4RQUA 9LDBA 2ZJ1A 5ILOA 3HXKA 3KPJA 3PPIA 4G0OA 3X1KA 1SRQA 2HF7A 5I9BA 1D09A 4TLMB 3EZFA 3OTIA 1ECJA 1OI3A 2XTAA 4KREA 3KD2A 2IYPA 3BWEA 2XUIA 1HTBA 1L3IA 1UBUS 3EA5A 1C4XA 1UPAA 2ZYDA 5SY4A 4ZZ3A 1QRSA 3WAGA 4BP9A 5E95A 4C01A 2NVBA 4F6CA 3QX3A 3OZDA 5AKYA 4II7A 4ZMSA 2BBSA 3Q5GA 4JHLA 3U5TA 1P33A 1J2UA 2WEKA 2ZVDA 1R8YA 1W85A 4XYBA 1RPAA 1G42A 2B2XA 2ON6A 5FPKA 4XD7D 1P2GA 4GKBA 5HJ5A 4WN9A 3SZUA 4G9EA 1MC1A 2NWQA 3K9GA 3FVQA 3HNOA 4NDNE 1N5OX 1B3RA 3ID6C 1EAMA 4XSVA 1ACMA 4LFBB 3DPUA 3OAAD 4B48A 1AO3A 1T0HB 1T3TA 5HKAA 1QGDA 2GLXA 2WD8A 2ZRQA 3AFNA 2AN3A 4QJIA 4TZ0A 3MWEA 3UJPA 2CVQA 2VHTA 4QPCA 4KQ9A 4Y6PA 2WVJA 4K05A 1KI4A 2JHPA 2DMRA 2OZLA 4HQRA 3H86A 3EG9A 1LVHA 4TXHA 4G65A 4NE7A 5EXXA 5AT1A 1U7OA 4BVHA 4FYIA 1L9XA 3LWDA 3T4XA 1TLTA 2EFHB 4IIUA 2X7HA 4LHYA 4NOKA 2HMSA 3MRXA 3U4HA 4I4TA 3RUPA 2PMDA 4DSOA 5MGBA 1JI3A 1GITA 2WLTA 4UAGA 4RWZA 2XR1A 3RVQA 2EJUA 4L50A 1IN6A 2W90A 1XCPA 2Q4OA 1N2EA 2GZSA 4RLQA 3LV8A 2R2AA 3PC2A 1T3HA 2AMJA 2EBHX 1R50A 3NPAA 4BFVA 3TOZA 1M1UA 1AQLA 4BRUA 1E2JA 4GZ6A 4NEGA 3EHEA 3VVMA 4LJRA 2ONYA 2FUG1 1XV5A 1YQWA 2V59A 2LZ0A 4OHYA 2QXUA 3OPYB 4KPUA 1Z33A 1ECFA 2X1MA 4UBKA 2JAXA 4PX2A 4MDHA 4QQFA 5KZMB 3IX7A 2VRCD 1FJXA 1SURA 4PYOA 3R1IA 3QELA 4IDGA 5FP0A 1F4VA 1R4AA 4CCWA 4EKNB 4BLRA 4BMXA 1DO8A 1NXPA 2Q8NA 3EVFA 4UZFA 2WHPA 5F23A 5HZKA 1UAAA 3A9SA 4GYWA 3A6KA 3TX6A 5B1YA 1HRKA 4AICA 1QHSA 1HYHA 4D8VA 2XRZA 4L8LA 3SQLA 3GBVA 1Z7BA 5DMHA 2G3YA 4MVWA 4ZCMA 1HL3A 3H8WA 4MP6A 2OCYC 2I34A 3ORYA 3RSCA 3CV3A 2FPIB 3NATA 2B21A 3NKFA 1DBVO 4BJ6A 4LXHA 5IVPA 5JCOC 4D82A 1TD9A 2QN8A 5IM4F 1DC6A 1Q1NA 3QA9A 1JDVA 1ZH4A 2ZJ7A 2A88A 1K3UB 3GGDA 1GT6A 4BO7A 1XX6A 4ROTA 1GDHA 3C3WA 2VWPA 4OLJA 3K31A 1LQTA 3WA7A 4BFXA 4CF4A 3GV0A 1VB3A 1Y8AA 4XQ0A 3H9CA 5IJZA 1TU4A 4IDCA 2QVZX 3EPRA 1Z13A 4AMGA 4RA9A 4J0EA 2HNBA 3B1KA 2GASA 3N8KA 1XQ1A 2BFEB 4JCOA 4DUGD 5A06A 2OBFA 5T67A 5FTLA 1WTAA 3KS9A 3Q7IA 4G9GA 4X8LA 3ADDA 2GYVA 1U7HA 1K66A 1W5FA 2C5FA 4RACA 1ATZA 4IG4A 3HY6A 5CXSA 1MB9A 2J67A 3ZLTA 5B5SA 3RJMA 5EJ2A 4MUXA 5I7UA 3UFXA 2H1LA 4D74A 1ENPA 1U0GA 1PJZA 1KP2A 2V6IA 1LQ2A 4GX1A 1H94A 4WXHA 3OLZA 1F2UA 1KBQA 1EFAA 1CY0A 1J90A 2BMFA 4CMHA 4ZAXA 3UAXA 1XT6A 1U4OA 5G0SA 3CZAA 2PUEA 5JVDB 3AF2A 1YS6A 3QNMA 3MMSA 4IX1A 3P32A 3ROPA 1E98A 1SKMA 4L1KA 4CODB 3IV6A 2WKQA 4S2EA 2YOFA 2EL9A 3I76A 1PWEA 1ILEA 2QSUA 2PO7A 4UE2A 3SN6A 4NEHB 2YY7A 1GPYA 4GLFA 1QO9A 3ENQA 3E05A 1TC1A 4G85A 5BSVA 3HBAA 3LC7O 4GT1A 5CXUA 3QPAA 4NYMQ 4OJTA 2IF0A 4DVGA 1QC5B 4K9QA 4Y18A 1VECA 2Z08A 5M7EA 4WY8A 3PZBA 3KXPA 1QNFA 3PNMA 1R88A 2PGAA 5A04A 1F17A 2AOUB 1OLOA 2FG7C 1H2WA 2ZUUA 2BFFA 3L0PA 4F8YA 1U1CA 2QYTA 2C9DA 1PZXA 5C46F 2HBRA 5MFZA 3GJ4A 1IBRA 5MHTA 1CR2A 2I55A 1UEXC 3GUUA 4PX3A 4L4UA 1JSXA 4PV7A 2JC3A 3IUJA 4S35A 3RTDA 3FG9A 3TO5A 5HYVA 4X62B 2G28A 1ADJA 2PO5A 3CF4A 5F2OA 4B6SA 4M8SA 4B43A 1VHWA 4D97A 4OYRA 2G06A 5TS2A 2NU8B 3CRNA 5DU2A 5C5EA 1JA0A 1GYRA 2PH3A 1Y34E 1XXHA 2XZPA 3M1LA 2CBZA 2O23A 5CX1A 4D9NA 4DIDA 3SGLA 3UPTA 1Z6ZA 2JA2A 4BASA 2GZ3A 1KO7A 1XMQB 1Y4SA 3W9UA 2XRYA 4X8OA 1GAJA 1P5ZB 3IUPA 1D0SA 1TGYA 1J9ZA 3PHIA 4L8YA 1SQSA 2PHZA 1A88A 3C43A 4FINA 2GWRA 3RVLA 4W8GA 2E5LB 1U2PA 1ZUHA 1TX4B 5LL6P 3EXHC 4JYAB 4NYIQ 1SUBA 3JPWA 1SCAA 2G36A 3GEIA 3M6IA 4JS0A 2ZJ4A 4H4DA 2UZ3A 4LX0A 4WDQA 1Z5NA 4GPZA 4KYUA 1DOHA 3D7KA 1HQYE 1R3UA 5CT9A 4AJNA 1VKJA 3DW3X 4MS1A 2GN8A 3OWXA 3P5SA 4PR0A 5KNBD 2BCJQ 3EXG2 1PP4A 2XIQA 3EAFA 2G09A 3RARA 3WKBA 4AZ0B 1G5TA 1SD5A 2BZGA 2EZ8A 1UBMS 2QJFA 2PLAA 3HA3A 3OTHA 4EARA 2HREA 3ZIDA 5G3ZA 4KRGA 4MS4A 3CEJA 3L7JA 5C7IO 2QVXX 3DF7A 4NF2A 4OP2A 3TBFA 1E77A 2OV1A 1BXKA 3HU3A 2DLNA 1U0FA 1UKBA 2BD0A 3PQ2A 4P9NA 4QT4A 2WG0A 3FOEC 1E1QD 3RFVA 3M34A 4RBNA 3VMFA 4WK2B 3H7AA 3M6XA 2O8EB 1NRJB 3OQ1A 1CTQA 4C03A 4DXHA 3M9WA 4ARIA 3NAZA 3BD7A 2JLBA 4E08A 3KXDA 2Y92A 3QYFA 2JGDB 5JISA 3KV3O 2N0SA 5AW3A 2F55A 4OQMA 3ZHOA 2R48A 1NHWA 3FPFA 4IDHA 4BZPA 3V2UA 4AXXA 2BGKA 3WIVA 4LZOA 1T8RA 4J1QA 1CUVA 2Q6VA 3HXQA 4UPEA 2AZDA 3U4DA 1PI3A 5EJ8A 1ZRMA 1TVMA 2I2FA 4CFSA 3KSDO 4PZDA 5KAMA 1QE5A 5C18A 2QSYA 3TPZA 5GV7A 4P84A 1GPNA 5GTDA 2SKCA 1FSPA 4JJZA 2ADOA 1M6YA 2OHFA 1CJMA 1XA3A 2WSMA 2WE8A 1TUBA 1FUKA 2IGTA 3KDPA 3N7TA 4FC7A 3TW6A 3CLUD 4OY3A 5C5IA 5E2BA 4JUAA 1KY3A 3DCNA 1JJAA 3HVHA 3OJFA 2IPMA 4HMPA 4E5MA 1LK5A 4TTRA 2CB0A 4PAQA 1SRRA 4Q7EA 4WASA 5KI6A 4DDWA 3ESZA 1CQXA 4ZYXA 3QZUA 1MT3A 2PL1A 2CUKA 2ZYTX 1VBFA 2VP6A 4O4IA 4DR7B 1INLA 3EBPA 1RRCA 4RPKA 2JAUA 4PNEA 3CA8A 3LUJA 4RCYA 2IITA 3JAMA 1E3LA 4KR6A 3TLMA 1SHKA 3GD7A 5AOVA 1C41A 4GPBA 1FCJA 2ZLBA 3VNBA 1RRGA 2C5EA 2IHJA 2WIJA 2YYSA 3RC8A 3WV5A 2B6HA 1HF3A 3IIIA 1U9ZA 5AK6A 5ALMA 5BSGA 5KTYA 4DV2B 4CPDA 2GDZA 3HVJA 2J0SA 4C0KA 3LHDA 4YFVA 3GEPA 4C4PA 3AZPA 5MN5A 1NVBA 3DBLB 2FGJA 2IXGA 4OKIA 5H80A 4ZK6A 2Q1YA 4KK3A 5L3SA 1TPZA 2Y0BA 4DGSA 2M98A 2L82A 4M49A 4MITA 1L4HA 2H4YA 4C3OB 1CYEA 1Z5ZA 2Z2JA 4LEIA 2Z04A 4EHKA 2PSHA 3VO8A 4KQHA 2FW8A 2EWMA 3PQ3A 2BKLA 4KDRA 3KE8A 3ZDRA 4CKEB 5DNUA 3I8XA 2FOXA 3BXGA 1O5TA 3BMQA 1II9A 1U7ZA 4TL8A 5I51A 3HADA 1RTKA 3L5OA 1P18A 1Z4OA 3JQAB 3ZXSA 4YT2A 1O54A 2FPIA 2JDIA 2QN7A 1DV1A 3NIDB 1BHO1 4G2NA 4O0MA 2OVFA 2JGAA 1X8XA 4G4GA 1KMCA 4M9UA 3ZH2A 3IP1A 5H81A 1C30B 1N32B 3UAZA 4BGUA 2NO0A 1LU9A 3F9IA 1H0HA 2FQYA 1NUAA 2QNIA 3WIDA 3E7WA 3THSA 1FNSA 1YFZA 3ELUA 3D7MA 3GJRA 5LP6B 4OSPA 5K3AA 4B4VA 2VNJA 3I0MA 1SCJA 2YIMA 1NW9B 1PFWA 1C7IA 1DEOA 1L4FA 2ZKLA 3LQRA 3PXDA 2OORC 4NI5A 4N6OA 4B73A 2FSFA 3K70B 4JP3A 4OHWA 3HB0A 2ORVA 3IRUA 2Z5VA 1CQIB 2WM9B 4CUZA 5JLJA 4ZGWA 4YACA 1XRRA 2XDQA 3A06A 4I2NA 5BNFA 1DX6A 1L1RA 3RRZA 1US8A 2LNDA 4UD2A 4WNCA 5LSAA 1HQDA 4C08A 3O8QB 2IYXA 5TGDA 2C4TA 1M1YE 4HRVA 4MQBA 1A2BA 3EXFA 4D44A 1XNRB 4WZAA 1GG2A 1UOEA 2B1RA 4IDDA 1E20A 1D8AA 1GYPA 3B6MA 3BHIA 3LY7A 2JJ1A 4BRSA 4G23A 1WCIB 2FSVA 3DTYA 4IDOA 2D8AA 4WLNA 3JVEA 3ZW7A 2YJNA 3WDKA 2FPPA 3GRAA 3OFNA 1C1HA 4TV8A 2NPOA 3OOEA 5F64A 3TJZA 1JLRA 1QU3A 3ODPA 1C2YA 4Q02A 3VSCA 2R68A 3C3EA 4TMFA 3MJ4A 4C5CA 2C94A 3BL6A 4QA9A 1O0BA 4AWXA 4B3TB 2GTPA 4A8PA 3PGJA 5EXDA 5FL7D 1RWOA 2IYSA 2QNRA 4JZYA 1QFJA 3EVTA 4BWFB 1QC5A 5CA1F 3JQCA 2O20A 3NDBB 1KARA 1ZINA 4BKRA 3VU8A 3LLMA 5DP2A 2JHCA 5TPWB 3FYTA 4NG4A 1ECLA 1T26A 3WRXC 2CDRA 2H5LA 2NUPA 1DKOA 2VDWA 3QXSA 4RS4A 3ZNNA 4A0RA 4B82A 4EPRA 2HUNA 1U2EA 2YMPA 5TGZA 3EC2A 3PF8A 3KPYA 5DISB 2AZ4A 4JLVA 3RABA 2FUEA 2DSTA 2GQ0A 3UUFA 1U0RA 1D4OA 1A82A 1S8FA 4QFDA 3VTAA 4PYRA 1V37A 2I1WA 4DZRA 2DFVA 3RR2A 4GXNA 3IO5A 3UZUA 3ESXA 2HPZA 4I55B 2CBXA 4RTKA 4IHJB 5JJLA 4PSVA 4MB2A 3JQ9A 3WLIA 3IJ5A 4F2DA 2WMOB 1OWPA 4XX0A 1W1UA 1XMJA 4DJJA 2HA7A 4MV5A 3PNVA 1VP3A 1ZXXA 3GEMA 3DBRA 5BMVF 2P65A 4UTVA 3K71B 1JEEA 5E7QA 2PD6A 4IOMA 3HCWA 2PGNA 1IOWA 3FHOA 3COWA 4HGZA 3UT5A 1JEDA 3UBTA 1Z18A 2ZWPA 1DKNA 1NBOA 4HY3A 1JB1A 3OWHA 5H4GA 2OCIA 1D4AA 2XGMA 4O1IA 3W6ZA 3PDJA 4DMLA 2W0MA 5IVKA 4P0PB 4HNVA 1C1XB 3JARA 5D5PA 4FKBA 5K3FA 5MN6A 3S1AB 2HF2A 3AR5A 3R3ZA 3U4AA 2J3IA 1L4UA 4UFNA 3K05A 4AZ0A 2X77A 4M53A 2PSFA 3MW8A 4JBLA 1VCIA 1HDRA 3U0VA 1NUSA 3EXIB 1ST3A 2PGDA 3K8OE 3LPAA 1TF7A 1AQYA 4GMFA 5CVEA 2P5YA 3SXUB 2Z1MA 1YS4A 3CZ9A 3KDSE 1B6TA 1ZMBA 2DGDA 2N9UA 2IIVA 1ZGZA 2E48A 4OHOA 3HRKA 1KYZA 2H9AA 4B71A 5TMPA 3X44A 3QUAA 5JZOA 1P61B 4WZ6A 2DQSA 5IZCA 4W1QA 1Z2EA 3QXHA 4RA6B 3BB3A 1MHPA 2WBLC 1TECE 4OXYA 2AD5A 4WOPA 1MEJA 1KTIA 2LR0A 4ARUA 5IVDA 3F3KA 3PSHA 4B5LA 4O4HA 2I7XA 4RQAA 2YFHA 3RRXA 3V1MA 5F4ZA 3I6BA 1LJUA 1G8KA 1SIBE 1F0NA 5AI0A 1GO2A 5AKXA 5IUNC 3Q6MA 3UJNA 3AVYA 1IZ9A 1W9MA 3IVMA 3SU8A 1Y9EA 5FORA 4OU4A 5TEWA 1IB0A 3ZY6A 5JUWA 4CKCB 2TS1A 4GPAA 1SUPA 3L40A 3IPYA 4QXOA 1Y5MA 5IUJC 1ODCA 4YAEA 1JZTA 2IK8A 3Q8KA 1FX1A 1BVYF 2BFOA 3AL0C 1LDYA 1Z45A 3ZGLA 1F8UA 1LI7A 4YAWA 2ZIZA 2IFTA 4PO9A 3EFHA 4PFQA 1BVUA 2J5RA 4FHFA 1DJOA 2AJCA 3UWMA 1IH8A 2EKDA 2OESA 4R7GA 4KRXA 4ZVSA 5FULA 3V2IA 3GJ6A 3M1AA 3SR4A 1Q0TA 4Z53A 1JKIA 3ZI0A 4MINA 2IKSA 2P5SA 1R3DA 3FUTA 3UB4A 2H1RA 1U7DA 2IZ1A 4CKYA 3CHYA 3L8CA 2Q07A 4RZ3A 3GK3A 2E55A 3F5DA 3CVOA 5J5CA 1OZAA 2PT9A 3ZI4A 4A5OA 5H1YA 2EJBA 2RARA 3AI1A 4JOCA 1RXVA 10MHA 1E94E 2QR5A 3SEAA 2A3NA 4YCAA 4D0LB 3CSUA 3F3MA 4NCJA 1N34B 2AR9A 2R1ZA 2WV9A 3OSZA 2PLNA 2Z9CA 5AIBA 5A0VA 4CKBB 2I6FA 3HVRA 1D6JA 1RTTA 2HV8A 3ZI7A 2KS6A 3NT5A 4FFDA 3FTCA 4MUMA 4ZAVA 4FYYA 3ZE2B 1UPCA 2QTFA 1V11B 3IGFA 4YJDA 3V1KA 3THYB 2PUGA 4QDUA 3N0WA 4ZAZA 3FTPA 1HZJA 2FVXA 5KKCA 1BU5A 1IY9A 1L7NA 3E7FA 4PHTA 4B3IA 2XSZA 1XCGB 4MKRA 1TUIA 3JCZA 4COOA 1XVIA 4NZNA 3G02A 5HF9A 1QTQA 2RCYA 6NULA 5F7ZA 1JUDA 1OLSB 1SQ5A 1X19A 4UBLA 1S2IA 1FP4A 3L0BA 3LXXA 2P9EA 4MYUA 1KSHA 2X8JB 4ZYZA 4NXNB 1TL7C 4LCJA 4CKEA 1A96A 4KDCA 4WQMA 3OLQA 4QFBA 4HZUA 1K8XB 2XQVA 5EJ5A 2DCMA 4ZYWA 3VNQA 4NQRA 3FHCB 2XQGA 2C84A 4QOJA 4RTLA 5FUWA 1DCTA 2YWCA 1KXZA 3R3YA 4L5AA 5EXTA 5K4HA 1YR2A 3VOAA 3I34X 3STTA 1DG1G 3MLEA 3C5CA 1HG0A 4KMMA 2Q3LA 4PGMA 4QXRA 1XXHE 1IK4A 4ENTA 3B1ZA 3TPFA 1EXVA 1M33A 4XUDA 3HSKA 4RPHA 1IUOA 5FTWA 1AKTA 4E1VA 2BH2A 2FLWA 4F56A 1VRCA 3IT3A 2NX2A 1H85A 3OIYA 2W2NA 3RGWS 2R5FA 1DGQA 1SK8A 3LT1A 4PCAA 2E1RA 1KDZA 2DBZA 3ZV4A 5J40A 4PHFA 4UU0A 1ZKDA 4A10A 3QVJA 1HFJA 3LBAA 3FWPA 3STXA 3PYMA 4MUGA 2PUTA 3SEZA 4NJOA 1M6WA 3V2GA 1CQIA 1IZ0A 4UUAA 4JQSA 3T9CA 3ZJVA 1C9EA 2BFCA 2YVKA 5HE8A 4OJNA 1JDPA 3TQTA 4BRZA 1RWNA 4LDJA 2UZ0A 4HSEA 4R7ZA 5CVVA 5E38A 1RKUA 3H6KA 3NEAA 1OU0A 3QHAA 1WVMA 3IBCA 5G2OA 2NYUA 1XVTA 1AQIA 1V7ZA 1X14A 4H0FA 4K88A 1N0VC 4QAQA 1NY5A 4QODA 4TTAA 3W2FA 5B58C 5JXGA 2XZDA 4EPVA 2QBYA 4FC6A 1EQAA 4UBIA 3ZJ5A 3TFQA 2JG3A 1JJVA 1NF8A 2HHHB 3IDZA 1QG4A 3P0JA 1WCWA 1QTIA 1KXJA 3DMDA 1RYZA 2JCGA 3AKZA 3L0YA 1MX5A 4RFSA 1JJFA 1PJLA 2AG1A 2V98A 1Z62A 2WMYA 1V39A 1HURA 2WYVA 3CUWA 4K9RA 4WKPA 2CLFB 2FEWB 3RKUA 2Z1DA 1E6LA 5FHQA 3KE9A 2C5SA 2CF5A 2YUIA 1TAHA 4R6XA 4AZ3B 3NH9A 4LF9B 2NZWA 5AHXA 2DQYA 3CUTA 4GSKA 3TIXB 3UENA 3VISA 2XCUA 1S1MA 1MO5A 3ADOA 1SKAA 2HYIC 3VKHA 2O57A 3OJOA 1NBME 4OJQA 5T4HA 2ZQYA 2EKQA 3QUTA 4X1KA 3DDCA 2P67A 2I8LA 4X91A 4YLEA 4YT5A 1NR5A 3I3OA 3IUYA 5TPWA 3SIPA 4M22A 5JS1A 3BAZA 3ZY4A 2XCSB 3H1PA 3N87A 2JKYA 2QDKA 2ZAMA 5EVJA 4GI1A 3HFGA 2QTWB 3PT5A 3WGNA 4BO3A 4R1SA 4E11A 4X1OA 2FE1A 3BGWA 3HV2A 1E9RA 1GR1A 3OUUA 3ZVLA 4KYIB 5HBGA 5CFLA 2YHUA 4FCWA 4QGSA 3OICA 4RIIA 2F3TA 3DULA 1LPBB 3WKDA 1KEEA 2HK9A 2V45A 4JB3A 3F9RA 4XCXA 1LRKA 3LUAA 3IPXA 5DCLA 2IT1A 4XEHA 2IKQA 5TQ2B 3IUNA 3CNLA 3F5QA 5JXWA 1O6GA 1AHIA 1MOSA 3C87A 3LZ6A 1UBSB 4I55A 3VVLA 1N2CA 1OXSC 2BJHA 4RE5A 3SS9X 1ISPA 1JA9A 1OYYA 4BVLA 2AOVA 3BH0A 3R4CA 5HF5A 3WIUA 4LNUA 2V0GA 1NF2A 1H5NA 1SD1A 2FN9A 3V8MA 3MS2A 1ZKMA 2GD1O 1JDJA 1HYQA 3GQBB 3GUYA 2VHZA 3TD2A 2W2TA 4L6IA 4ZOLF 2JZNA 2M1XA 1E1RA 3PITA 3O8RA 1NT2A 1B74A 1NXSA 1UM9B 1Z06A 3A27A 4EFNA 1YDWA 1OILA 3R3WA 5HQ3A 3REOA 3UJAA 2JBAB 1UCFA 3AP3A 3PE4A 1XD9A 5JZMA 1EM6A 4C22A 5AOBA 4B6PA 1EVJA 3D8NA 3G0CA 1VLHA 4X9XA 4DNOA 4RAQA 2C4MA 2LW7A 1FSSA 4YMWA 3S40A 1WB9A 1NW7A 4FGJA 4V0MA 1T6BY 3OH8A 1EG2A 4RVSA 3HU1A 3AERB 1MXHA 1LBSA 1J0AA 5A6SB 2CF6A 2AQKA 1LS1A 1Q3TA 2FLKA 3GAAA 4B4DA 2RONA 1I2AA 5EPOA 1NJ6A 1I4WA 1UK6A 1PL6A 2H08A 4J7CA 3SXUA 1Z5OA 4LZLA 1IPEA 1LPAB 1MAWA 1T15A 2PGXA 3LCMA 4Z9YA 3VZCA 1YB2A 3MWKA 4GX5A 2PMFA 1L6RA 2CMDA 3LPDA 3S3TA 2FMHA 4LHSA 3ZZ1A 5A62A 3QVOA 3K5PA 4G24A 2Q5JA 1G5QA 4I5EA 1PJ8A 4UXHA 5ADWA 3I9V6 1XJ0A 2JJYA 2FDRA 1VI6A 3H5NA 5JTUA 3Q3VA 2RAFA 3GPIA 3Q7SA 2P62A 1H5QA 5IC5A 2V7UA 1VJ0A 1AG9A 1OTHA 2AFIB 4XM1A 3VR4D 3CO0S 1ZVJA 3DHEA 3HN6A 4UCFA 3T7TA 1M0EA 3I23A 1JU4A 1QYRA 1DUSA 5HWSA 4LRSB 2GEKA 1FYWA 3KQWA 4D26A 1EKXA 4ZQFA 5EQFA 3FMOB 3B6JA 1M2OB 2AVDA 4CKCA 4TQUS 5JMWA 2JLAA 1U3CA 4MWBA 2NNWB 5EEGA 2WJWA 1H3FA 2I78A 5DM2A 1SCQA 3V97A 3WRYC 3GRFA 1Z88A 4G1VA 3RAPR 4F3YA 4G0QA 4YP9A 4WH0A 2R25B 5FV4A 2WUFA 2VBFA 3DUWA 3QIAA 3Q5DA 3E9MA 2X76A 1OZ0A 1RLJA 2VP0A 4CM6A 2W8ZA 2YZ7A 3WTBA 3ETDA 4GR4A 4PLPA 3D6HA 1GARA 1N1MA 3R3UA 3KFLA 4F4HA 2JIZA 1XRJA 2ODAA 3QVMA 5ALHA 2C7OA 1KHHA 4UTXA 3ES9A 3NBZC 2VHWA 3CT6A 2EL7A 4A23A 4CG1A 4NP6A 4DPMA 1EX9A 3TR6A 3T7RA 4ECEA 2ZYIA 4WZAE 3CLUC 1VZ3A 4FFPA 3G2KA 3P2MA 1S5PA 2J5BA 5JS2A 3H2YA 1KZ7B 1MO6A 1KE2A 4ZDKA 1IXZA 3MJCA 4EH1A 3C2QA 1V5GA 3OU2A 2HLPA 4JVMA 4HQOA 4ABTA 1OXBB 4UATA 4HDRA 1ETHA 3IQHX 4LE1A 4BKOA 4R9UC 3MNFA 3WGVA 4U7JA 1H4VB 1MOPA 1TAQA 4ZVLA 4DIUA 1V11A 1E3TA 2FWBA 2QVCA 3AKEA 3KB6A 3PIIA 4URHA 4B4UA 1EK5A 1XPOA 1TF2A 3EWNA 4DCSA 5ITZB 4OHXA 5LD2B 4F45A 3QW4B 2ERXA 4KUHA 3ZV5A 3THXA 3HTXA 2B4KA 5BVHB 1U9JA 1UOOA 4LSZA 4GVPA 4YP5A 2CUNA 5LZ7A 3I9LA 4BZZA 1HKHA 2PG3A 2OWDA 5CBPA 5JNLA 3EW9A 1FZQA 2YV3A 3W5VA 2AEFA 4F5ZA 3IAM1 1RYDA 2D06A 2WFMA 1E9CA 3FPHA 4UVGA 4IHAA 1PD1A 4TUYF 1OGIA 4YH1A 5LQDA 3K96A 1AZWA 2YQ5A 3G1WA 2Z1NA 1HBJA 2V4MA 4NTZA 4OP1A 4U7GA 4URYR 4ZZ0A 4N3NA 4Q4DA 1QG6A 2BAGA 3ZCRA 3ENZA 4HQNA 1CLUA 1H3NA 1OJLA 3UO8B 4WCFB 3S70A 4ZQBA 4XSHA 4ZAWA 2VQDA 1RVV1 3ZE7A 4AQYB 1FQOA 4QNMA 2VAWA 4GKKB 3M89A 2P4HX 3O1HB 3EEIA 3IR7A 3H9UA 1J0EA 1WCXA 4XR4A 2OXEA 3ORRA 4WKOA 1LBIA 1WF3A 5JCOA 2B99A 4P0QB 3RC2A 4LCEA 3EVBA 1YQ9A 1EWTA 3O4RA 2HQSA 4NZOA 1H9CA 4JUBA 1V41E 4BNIA 1AE1A 1RBYA 2QV7A 3DR3A 3MGCA 3QE2A 4TWAA 3OFKA 4B87A 1L7MA 2GM5A 4I2VA 3GGPA 3DOUA 2FAXA 3PC4A 4MYSA 1Q0LA 4WZZA 3DAHA 2B61A 2GCGA 2GEBA 4ZJYA 2C7VA 4OB6A 3Q7TA 4HRXA 5AI4A 5G4LA 4F06A 3H3FA 1GNPA 2LIPA 2W7TA 4U63A 3SP1A 2CD7A 3UXHA 5UKDA 2VSXA 4H17A 5EJMA 1EINA 3AY0A 3VBEA 3OZIA 3PJDA 2B8NA 5E9JA 3ZW8A 1UBFA 4K9KA 4JJGA 1IN7A 5FOSA 3IB3A 1GQQA 1XCOA 2PBZA 3VOSA 2FPOA 3RQIA 2XNCA 3LWNA 2HL6A 2OAQ1 2P2CA 5DLYA 4M2LA 3PD1A 3QBDA 4WOCA 4AZ3A 1Y63A 1YR3A 3DM5A 3VTZA 3GCXA 2WWFA 3CVJA 1XN4A 2VCYA 3K8ZA 3AVUA 4MV7A 1CP3A 4D6YA 3ER8A 2GYYA 4M9RA 2YH2A 5I9SA 2IHUA 3IILA 4FZVA 4OCZA 2PLWA 2WUGA 1ZY2A 3RSHA 1NP7A 4KLAA 4R4JA 4OI4A 4BVGA 2NP6A 1BNCA 2OLJA 2QUKA 4CIAA 3JQ8A 1ZRHA 5TV2A 4FPXA 4Q05A 5KINB 5CDFA 1LF5A 2LUOA 3I39X 4NV0A 2JLYA 3N0RA 4FYWA 2VOEA 1XO1A 4RHTA 1VG0B 3INGA 4EA6A 4DILA 4B3GA 1I7LA 2NZ2A 2QM3A 4J0GA 3KFVA 4NNOA 4IIVA 3WKAA 5JAIA 1I7NA 3LCJA 4G5GA 1UMCA 2VNKA 4RPLA 1M0WA 1FXWA 2H1SA 1IOVA 4LG1A 3DL0A 3EUWA 1EJ2A 4OAQA 3LHIA 2C7QA 2WTNA 5ELMA 5IMBA 4R1PA 1JLMA 2YXDA 3H1GA 2HSDA 2XNDD 1DLJA 3CPJB 4FN5A 1UODA 4Y7CA 2GARA 4HFRA 4IGFA 3D02A 1OIXA 3BIJA 2ZR7A 2AHRA 1N0IA 2ZIXA 1CZNA 4LOAA 5E7JA 3L4SO 3WAKA 5JNSA 2ZRIA 3HCBA 1KIFA 4YHHB 1Q7EA 5DX0A 4CTMA 1PYGA 3HB1A 1AA9A 4L5YA 1FDTA 4KKXB 2B1QA 4W7IA 5TPZA 3Q40A 4EBBA 4YMSA 3LW7A 1RXWA 3DT9A 1OUMA 4BX8A 3H1EA 4CFYA 2OCAA 1G5PA 4H77A 1Q3HA 2HBQA 4B2LA 4EX6A 4FEAA 1G3IA 1PV1A 2IYVA 4WFKA 3DDZX 3EXHA 4PR3A 1SBQA 2O50A 4MW4A 4P81A 2PN1A 5J63A 3GFFA 2XMGA 3NDIA 3TOSA 4UNQA 3R5HA 3CKKA 3QYPA 4ESEA 1DWQA 4ARCA 2DJ5A 3LC0A 4NARA 3UCEA 4HATA 4JC5A 3VR2A 5AHRA 3CNOA 4HGNA 1YS1X 2PX5A 3WNVA 1I36A 3D1JA 4JWKA 5JEEA 2EBFX 2ZWAA 1L5LA 4A7PA 4W5NA 1EHIA 3OTGA 3E4DA 3TAUA 3MCWA 3G6WA 2QMQA 4FSHA 4U7WA 2RI0A 4X92A 5C7YA 1IHOA 1L3CA 3J80A 3OEWA 4ZWNA 2HMTA 3HB9A 3WMWA 1KYYA 1P74A 3W05A 3MHPA 5EUMA 2IE0A 4X7BA 1M0SA 1V5EA 5KYTA 4TS9A 4ZRNA 3S99A 2H2WA 4DV4B 3VPBA 4V0OA 2QM8A 3QY0A 1AKWA 2RC5A 4RENA 3T9EA 3KU4A 3QVTA 2CV0A 1M2OA 4ROSA 1KP9A 2AV6A 4ZEWA 4KQMA 2MJLA 1L1EA 1ZCAA 2RHJA 1N78A 1O95A 1W59A 4RAOA 1E79A 4MK4A 4NAVA 4WGFA 3RWOA 4EYEA 3DLIA 1NQXA 5DXAA 5IDWA 3BWCA 2J6BA 1NFQA 5JOQA 4MCJA 5KVVA 1RQGA 1IVNA 2B92A 3F1LA 1EVEA 1IXYA 1MA0A 1PUJA 4KZKA 3HSSA 3DE7X 1MQSA 2XPCA 3A6JA 4M9SA 1EJ0A 4Z7OB 3KTDA 4BP3A 5ESWA 1MIOA 4FQ8A 3H9QA 3CX3A 4AK9A 3AGQA 3SVLA 2OHGA 1EYZA 1UKZA 2G8NA 3GMDA 4N5NA 2NUAB 4B8WA 3BMCB 3N07A 4GMXA 3EG5A 1V35A 3GIDA 4CMIB 1FP7A 4P35A 4ZVMA 4EGQA 4MA4A 2O8BB 2DX7A 2J7PD 2YHAA 3EGCA 2CSUA 3G7SA 3HJBA 3FTEA 2BGJA 3OETA 1GGHA 2YZKA 1EVKA 3UB3A 5KVAA 2ZYAA 2FWRA 3PQCA 4DJ5X 2PD4A 2YXBA 3BHMA 4EUHA 2NUTB 2Z8YA 5T3UA 5ITZA 3ZDCA 3HA2A 2Q6KA 1OW3B 3G8AA 3HKBB 2FMFA 3N2GB 3OIFA 3U80A 1GM5A 3TBHA 3JD1A 5JPCA 3H4TA 4JOQA 4HH0A 4PFJA 1WSDA 2X7XA 4REQA 4YQEA 3D4OA 4W7HA 3WGQA 3ZHVA 4FOLA 1KGSA 1S02A 1WB5A 4O4LA 3UNXA 1CV2A 2HSEA 2XF2A 3X1XA 4IR7A 2X2PA 4UASA 3LPCA 1WUKS 1FFXB 2GRAA 3NNSA 5IVIA 3DNPA 3O4FA 3OLYA 3NOQA 4ZAGA 3EB9A 4HBZA 4L4YA 3RFXA 4CDMA 3QBEA 1QIKA 3SHTA 2EZ4A 1P29A 1XPUA 3HVIA 4JN6B 4JENA 5JG7A 2YRXA 2G71A 4ARZB 4XWWA 1TADA 1QTRA 2GPJA 1Z5GA 3N05A 3ZJTA 2FCRA 1LSJA 1SQ6A 2JRLA 3W7AA 2QR3A 4CW7A 1N2CE 1RRVA 4CR8A 4WCFA 1Y5IA 3A2NA 4EF5A 1PV4A 4LMAA 2EG9A 3MMPA 4H0CA 1BCRB 3AVVA 4KIJA 1D03A 1JHAA 3K53A 3SYLA 2O4CA 5BN4A 5E2AA 3F78A 4TN5A 2H48A 1TQ4A 2UYGA 1BH6A 1S2OA 1ORIA 4LRWA 4N8DA 1XU7A 3E9YA 4WXRA 3GLFA 1YR7A 4ILEA 4L7QA 3KJIA 2J32A 3AJRA 2DWPA 2QQFA 1CEYA 2PANA 4JKIA 2H2AA 2JFGA 3IFSA 5CLLA 3TQFA 1PNTA 2XYHA 2JJ8A 2HR1A 3LLCA 2CLCX 3F7OA 4G6ZA 4EY3A 3NTUA 5A5VA 2HZBA 2OORA 4OOFA 3ZDBA 1IMJA 4YLGA 5ULLA 2BFAA 3C3BA 5KWEA 2VHVA 4JB8A 1GWNA 1SG6A 4P82A 4G86A 4RD6A 2BPOA 2EFEB 4KQ6A 1L8XA 4OQQA 1K7EB 3ZQUA 4UDXX 1SVUA 4NMXB 3W90A 4AUNA 4AP9A 1WMBA 2XNSA 2Z4SA 4FMDB 2R0QC 1E1CA 1HOTA 1O8CA 2JCXA 1CUSA 4IIJF 1QK4A 5A1TA 3ZIAA 1HRDA 1VBMA 2LDXA 1W0JA 2GCNA 4WXPA 1KL7A 2ACWA 3EMDA 3HJNA 3O9MA 2VRBA 1JW9B 3O4VA 4HLCA 5FA5A 1RYHA 2OGUA 1V3VA 1NVDA 4WA7A 3WSTA 5J4LA 4L5CA 1QRAA 2ZWOA 4FTWA 4JY7A 4F3NA 1FUUA 1MC4A 2BZ1A 4XFJA 3DLHA 4NXMB 2BTEA 1H05A 5BSWA 1JH9A 4ND5A 1EFLA 1ODFA 1PCXA 2Y0DA 3TLGB 4KIGA 4U5XA 1IEWA 4L2IB 3V46A 3ZVNA 4GPEA 2VJAA 3G0DA 4YMUA 4CEIB 2PH7A 2PMBA 2TMYA 4EM6A 1C5KA 4CF5A 3FPSA 5AK4A 1X7ZA 2FRXA 3ABZA 3FUXA 5FTNA 1B8UA 1L6IA 3AP1A 3L92A 4ZREA 4M88A 3PTLA 3W2GA 1U5BA 1CFZA 1G1MA 5JASA 5AUPB 1YZYA 2GPNA 1QB7A 3CUVA 3DWFA 4KUGA 4RC9A 3THWB 2CHUA 3RF6A 1NDQA 1HYBA 1C9DB 2C95A 3A14A 1QIMA 2AR7A 3BYZA 3IAS6 4C21A 4D9EA 3KAQA 4O02B 5HVNA 1U2GC 3CVYA 3T3IA 3V4RA 3KELA 3ESAA 3U7HB 2WWXA 4R51A 2UZAA 4BBJA 2F4VB 4A4DA 2A30A 1IY0A 2IZOA 3N6RA 5JJKA 2K4MA 2WJIA 1GDDA 2C9BA 3KUDA 4HJRA 1BMFD 1P4AA 2PRSA 3LOUA 3RVMA 3UJHA 3TG8A 4MDEA 3N1UA 2F8TA 3TRHA 3O3CA 4BO0A 2NN3C 2OHHA 3RTBA 4HVLA 3I61A 5E1BA 1KZ9A 1G1AA 1QZUA 2XUOA 5EJFA 2QP4A 4PZPA 3OQJA 4UEJA 1E3MA 1W25A 3BE4A 1J33A 1GQFA 3ODGA 4YP0A 4GVLA 1E2KA 1DKUA 2EVWX 4W6QA 2G70A 1J0BA 1Q77A 3DV0A 2JGKA 1DAEA 1IMOA 2OZEA 4PGFA 3M2PA 4WJLA 5DLDA 4IP0A 1S1CA 4E88A 4DLRA 2YWXA 5FAKA 2EKBA 3WBBA 2IW3A 4MPPA 2GKOA 2DEUA 2VBCA 4ENRA 5KPDA 4NMHA 4ASUD 3DPSA 1I2BA 2ACEA 2GVNA 5FR2A 3D8SA 9MHTA 2J33A 1N7GA 1BO6A 2GGSA 2WWRA 1E7SA 1XELA 2V8BA 1JNYA 1TO6A 1I24A 2F8SA 3KD3A 1NLZA 2QQGA 3K4QA 3L8GA 5AM1A 2CT8A 1PJ2A 1RPJA 1ZLXA 2Q5CA 1CYDA 3A3YA 2P4UA 3QRWA 4QPDA 5KHOC 1W29A 3AILA 2WHRA 1IJEA 4QXMA 3HNRA 1L7PA 2RHOA 1E3SA 4ZIRB 2DTXA 3A28A 5I7EA 1ZNYA 3RVPA 2HJRA 5CBKA 1N75A 1KVRA 1PR2A 1T1GA 4R9VA 4UMVA 1M6HA 3BSYA 1AUPA 1Q50A 2ZB3A 2PS3A 3QOFA 5NULA 1EUCA 4PXSA 4IAOA 1FF9A 2BUCA 4FGKA 4XQGA 5DK4A 4HNUA 4AJPA 5K3EA 1UAYA 4LFCB 4BTLA 1CF9A 4IIHA 5HRUA 3L7KA 3C5WP 3KQTA 2G5TA 3M70A 5K3SA 2A0UA 2BI8A 2Q3JA 4X63A 3GDFA 1EA7A 2BHSA 5SZJA 6AT1A 3FHJA 2JI4A 1HDXA 3D1VA 3SMVA 3SOPA 1P39A 1CQJB 3D7NA 3W6PA 4YRBA 3IP7A 4WXMA 1E8DA 4L75A 5AI9A 1Q1EA 3QMMA 2BGWA 4FDAA 4ZEMA 5EL0A 3CB2A 3BA6A 4D0GA 4GX0A 2UYHA 3GFVA 2Y6VA 4XD7A 4AAYA 2GB4A 2D1QA 3RKSA 1LRLA 2C7BA 2WC1A 5I6DA 4YAFA 4Z99A 1DEAA 2JL1A 3WSVA 4Q15A 4HAWA 3OAAA 1Z38A 3TZEA 4ZU3A 1MABB 2QLNA 5IWCA 2P90A 4F93B 4MKZA 2RHHA 3LVRE 1Z8FA 2ZATA 1X0XA 2RHLA 2WF9A 4UKDA 1G66A 1W8DA 4QTTB 5JZSA 3GOHA 4WEQA 3DZJA 3RIXA 4B6GA 3KK0A 2CGEA 1MZVA 3NFRA 1OZFA 3N2GA 1U3VA 2P30A 2UYCA 3A25A 3HZOA 2MSEB 2ZE5A 3DZFA 3Q0IA 1OYOA 3M5CA 4MRMA 4UHHA 2B78A 2YRFA 4OK5A 3TQHA 4EGAA 4S24A 3I01A 4PF1A 4E5VA 3O8NA 4UVDA 3IQGX 3OLCX 1RM3A 2PTHA 4K2AA 1V7QA 4Y6SA 4F4FA 3CG0A 1FFXA 4K5QA 4C6HA 5ENZA 5CDFE 2V55B 1T13A 3LDFA 4IOJA 5EIEA 4RJJA 2P5TB 2HX1A 2VDPB 1ZJJA 3PNSA 4HDAA 4IYJA 2I91A 1BA2A 3DO5A 4G56A 4NU6A 3A04A 4PO1A 2ASVA 3A70A 4G9BA 2ZTSA 4ZO6A 3T4EA 3W77A 2ZZMA 3T7JA 6CHYA 4PTYA 5JQGB 1R4NA 4U2DA 1QKKA 3U3DA 3QKIA 2YHIB 1WPRA 2OXRA 2VRCA 5H3CA 3AW8A 2GCOA 4K1LA 1CZHA 2YJ5A 4JIGA 4PC6A 4IRXA 2HA5A 2HJ9A 2O7QA 3IJRA 4KW7A 5IABA 3C5HA 3PLNA 1A9XA 3UK2A 2WG2A 2WIBA 4RYLA 1NLUA 1E61A 3HDTA 1W7AA 1T6YA 1UF9A 4M54A 3QVVA 1XZMA 1OAOA 2GX6A 2C2OA 1P7ZA 1WULS 2WICA 5CDTA 3C85A 1LNSA 4U5QA 3ZWOA 2QTBA 4GKVA 3ZDXB 4BO1A 1F0KA 2DFPA 4XGQA 3OX4A 1JIUA 4P4LA 5G3YA 4X8MA 3OZBA 4URFA 3ZDDA 4L73A 4TKZA 1M83A 1KQOA 3IEXA 4S1PA 2OM6A 4FB4A 1WVGA 3N28A 3K8QA 3MJTA 4F1JA 2WRZA 4LYEA 4ALKA 1HPLA 3JSAA 4ENQA 3NOXA 1ZD4A 3BXXA 2FZEA 4A8TA 4J6EA 5D2CA 4EW1A 3QVKA 3CUYA 1FB5A 3WNCA 4P4TA 5JJ5A 3AEKA 3TZ6A 4BY9E 1B43A 1CVIA 1T8WA 2DHCA 3U49A 1YE8A 2I7CA 2A0KA 4NZ9A 4ALMA 2JFFA 4PVCA 5IVHA 1OD6A 4DUGA 4GD3Q 3HWRA 4BGDA 2OWEA 1VYUA 1C3EA 1P62B 2ZB8A 2PMEA 3MAGA 4R3WA 3OC6A 4AKTA 1KJZA 3BPSA 1N5LA 3OT1B 1G291 1I5EA 3LYUA 3GLIE 1EP9A 4B3SB 1IZYA 4U6NA 5C1PA 2G17A 1M8JA 3ZWBA 5BR1A 1EUQA 2MIIA 2J3HA 3MJVA 1TK3A 3QVWA 3LTNC 3CGGA 1R8JA 5KQLA 4CEIA 3AGPA 1G0NA 1X74A 2EJVA 4IGAA 5HILA 1VGRA 4DQDA 3EJ6A 3HN7A 1JJ7A 4UC0A 4ZQGA 4Z2AA 3KETA 3BDIA 3ENVA 4MTLA 1MGPA 1OIWA 2HA3A 1N2OA 3OOWA 3W3AA 4GO1A 4LYYA 1JJIA 3HEMA 1EE9A 3ZY3A 2IH5A 3FFXA 2OYCA 2AB0A 2FW7A 3E9ZA 1D1TA 2QTMA 3SEFA 3UG6A 4D4MA 3PDWA 3TNYA 2XZLA 2ZJFA 1IE3A 1WMAA 3GP8A 1EZZA 2HIMA 3VO9A 3AR8A 5TDHA 1A9ZA 2V7EA 1JHDA 2A1TR 3DDOA 1HT0A 1TW3A 1DDIA 1NAHA 1YZQA 1A4XA 2VUIB 2ZTHA 3KX2A 1CUUA 4QT0A 1O6ZA 1DEKA 1DJNA 4TTVA 1YIOA 3MTQA 2H2FA 3D1LA 2P9FA 2JH3A 1FYDA 4KFTA 1DTSA 1OOEA 3QBJA 3AI3A 1E5XA 2B30A 1H2FA 3FMGA 3T34A 1XDSA 2ONKA 2OV6A 3H2JA 3MWLA 4J49A 5TT0A 5B4VA 1MVOA 1N8SA 2R8RA 5GM1A 5HDQA 2CNBA 2YTZA 3TL2A 1NIJA 1RT9A 2BKVA 2OP1A 5K0NA 3UKDA 1FU4A 2ZSAA 4Z4HA 1WQ3A 5ALPA 3W2HA 1JS1X 3LVQE 1X7YA 2OGZA 3PD7A 2O0LA 3MQ4A 4WK0B 1DQYA 1HZZC 3Q41A 1PDVA 1MJGM 2XHZA 3PEEA 3MBOA 5LMUB 1L7OA 1Z08A 1JQBA 1V9SA 3O2QB 4KGDA 4Q18A 5F1OA 3W1EA 2IXTA 4BQPA 3ZWNA 1EE1A 2BE7A 3OFJA 3RYFA 5CLFA 2QK4A 2ZRMA 4QATA 4AJKA 5IASA 4N76A 3A1CA 3DWIA 3WL6A 5LQMA 2AI2A 4IY1A 3NHZA 3G0IA 4HX9A 5F9HA 4E2FA 2VJLA 3CN9A 3EPPA 1E6EA 2WT8A 1HE2A 2ZRHA 3GO4A 2EW8A 3BICA 1JALA 2R85A 3I6QA 1AF7A 1ODKA 4ZV7A 3WYBA 4QWWA 2G9QA 5KNDD 5ALJA 4AQDA 5CU7A 3FVRA 5CW1A 2XKKA 4CGZA 2GXUA 3CWZA 3H3XA 4DLVA 2B4YA 1E6MA 1JSCA 1OC4A 3DKKA 1KNQA 1WAMA 3ILXA 1Y5RA 5CDHA 4DA9A 5DIFA 1Y8CA 5GONB 3TLYA 5KNBA 1K5GA 1JEQA 1TIKA 1OROA 3IVAA 4Q0MA 4CQJA 1YDHA 2G40A 4DIEA 1XALA 5B1SA 3GMSA 3T61A 3G0BA 4I6GA 1IEXA 3U3MA 2B3DA 1TUGA 2LP4Y 5F1PA 1QX3A 1MF7A 1BDMA 1XTPA 5DYTA 5J4YA 3BFJA 3OVMA 2HHCA 2QLBA 2VDUE 3ZBPA 2MYPA 1EUDA 4UCQA 1QZZA 3OBBA 4H7JA 2QP9X 1LUAA 3KVYA 3AMVA 1E1QA 1MCZA 2XOKD 3HWWA 4XIJA 3VJMA 1TMOA 5M3BA 2NO5A 3UMJA 5J3JA 1NV9A 1W93A 2OYSA 3K0AA 1B3BA 4XAQA 5E6RB 2XCIA 4I4TF 2BELA 3WKCA 3GLFE 1DQRA 1M5RA 4P2BA 3NC0C 3DEKA 4AIRA 1H6BA 4ZVNA 1CQJA 5CH5A 1MN6A 2EFYA 3V32A 3BL8A 3HY4A 4ZDWA 4YRSA 3M6WA 4YUXA 5L6MB 3KLPX 4EG3A 2LBPA 3X1YA 2HW8A 2R4QA 1Y1PA 5AJZA 1DRWA 3NB0A 3CLHA 1QMGA 4XM2A 1JDBC 5DNCA 4I4IA 3A36A 4OK3A 3UK0A 3PEYA 1OT3A 2TSYB 4EGJA 4UMEA 2RDMA 2Q0XA 2OZPA 4LDZA 1B6RA 1KWKA 1LPMA 1T0PA 2PE5A 4RW0A 1KPIA 4QPZA 4LECA 5JHGB 5EJIA 3NDPA 2PT7A 3Q9LA 3NEPX 4ZI2A 3WISA 4DJDC 4JJ7A 3WYNA 3MPOA 1VI2A 3PUHA 4JB0A 1FQJA 2OHIA 1A76A 2A9FA 3K20A 1CDDA 1YGPA 2V9CA 4D0SA 1E6CA 4EJ2A 1R0YA 4OREX 2DUMA 1Y48E 2H9YA 1J2RA 1NOKA 4IRMA 2O3RA 2V6FA 3R6WA 4AN1A 3RAGA 2NT4A 2EZTA 1KH2A 1ZNXA 3K1AB 4MDFA 3UB2A 1A3CA 1XD2B 3GYBA 4LJKA 1FS6A 1PG2A 5F73A 4EAAA 5AW1A 3BTVA 1WUTA 3EZ2A 2XF8A 4JV5B 4AG6A 1CCWA 2AJ8A 4OBXA 3B8HA 5AW9A 2WF6A 2JASA 1UMDB 1E1DA 3PHBE 3VUEA 4E22A 4OGFA 3S2GA 3ETNA 2YCLA 4ZI7B 5I4KA 1C7ZA 1XA4A 1X1BA 3TINA 1Z4JA 4P5DA 5BSMA 1TJ5A 4EL0A 1YJCA 2VUSA 2WHXA 3NIFB 4ZEOA 1A2OA 5B30A 1VPLA 2ERYA 1I1HA 2YJGA 1XZGA 1D2GA 3H0EA 3LY8A 3MLAA 4HGRA 2Z2ZA 4DM3A 4AY2A 1JR6A 2D2FA 1KFBB 5KWIA 2XKBA 4EYGA 1DAOA 1N9ZA 2C3MA 3BUSA 5TSDA 4EZBA 5JDCA 5G0UA 2QY6A 1C4OA 1NDHA 4LS3A 4WFQA 2F1IA 3LUFA 3PUKA 2ZIVB 1G20E 3DXFA 1ZD3A 5BVGA 1G8FA 2V7PA 2NTNA 2ANBA 2PL9A 1Z56C 3BRQA 4K26A 4O33A 4OXXA 2Q7OE 4TTTS 1T0UA 4EJSC 2Y3IA 1X1EA 3PQEA 3UICA 4CL8A 2ZJ5A 1CUEA 1Z4PX 3UTDA 4LF5B 2OB1A 3H17A 4JEUA 3HJRA 2JJ2D 4DG8A 1PDOA 2XEDA 1P5FA 5ALGA 4F9FA 3ONFA 2W98A 3PUZA 4I99A 3D0QA 1ORVA 5D8DA 3WMGA 2X9LA 1WY5A 4HB2A 4P4GA 1U1EA 4ENWA 3Q3CA 2QYOA 2ZROA 1U7WA 4FXPA 5L3RA 3LOQA 3A0UA 1T9HA 3FNQA 4XRRA 4UVEA 5HRAA 4G0MA 3L82B 4YQYA 1KMHA 3OJCA 5CM8B 1BKYA 4URUR 2WM2A 3PFBA 2ES4A 3NHWA 4AQ7A 5BUQA 1VKRA 2G4VA 2Z6QA 1P6QA 1GCIA 4DWJA 5M34A 1WIWA 3AR9A 3U7JA 3KHUA 4H7FA 5SZKB 1K3FA 4NCAA 1JQDA 4OQPA 5F35A 1B1AA 5IW8A 4D9HA 3R9IA 2HSZA 2HEGA 3AOGA 3H2GA 2W6MA 1BKDR 3CLRC 2G82A 1DKLA 4MWTA 4MV4A 3P0RA 1ZVKA 3TOVA 2GYUA 1N1DA 3GRZA 3WLTA 1JKFA 1P9WA 2QZZA 3K0BA 2EX1A 1WEKA 4O8CA 2OXTA 1M75A 3ZDYB 4LQDA 4C7OA 1P2UA 1EGQA 1BVRA 2VYND 5EXEA 4I36A 4QG3A 2CKDA 1Z2AA 1YJ5A 3RDPA 2QTZA 2HJHA 1PWHA 3LRPA 1RP7A 1XP5A 3ADKA 2EIHA 4EVRA 1XZLA 1DX9A 1RZ3A 3AEQB 3DE6X 4BL5A 4DVJA 4GI2A 1UJCA 2OHXA 3EIWA 4H9GA 4XLLA 3H4IA 4Z51A 3RCBA 1UBNA 1R6UA 3V8EA 3HGMA 3VRHA 4NBTA 1ML4A 2YV4A 4NFHA 4LZZA 4ZA2A 2UUAB 2YC2C 5FL7A 4G5SA 4WOBA 2QRJA 3MUFA 3OZ7A 4U9HS 3C5EA 5K3CA 4DYVA 4I4LA 3S2EA 1VA4A 3B6ZA 1IC6A 5G02A 1DT5A 2EV9A 4L4ZA 4LZWA 4RQBA 4R0NA 3HN2A 3NYWA 3D5EA 5KX5A 5KYXA 3HO6A 3UA4A 3OX1A 4ZT3A 3DMPA 1X8JA 2ZOSA 4PX9A 4HT3B 1E3JA 4WBXC 5DLPA 3ZE8A 4JT2A 3TGLA 1YQGA 4IOKA 1HV8A 3UH1A 2IYFA 3QEMB 5BW5A 2PM8A 3DTVD 5JQGF 2XCRB 1DRJA 1E4VA 3UJDA 3V1UA 2FZCA 5J2TF 3IPCA 2G5PA 3FR7A 4P08A 4BQNA 4CM8B 1GKLA 3A4NA 5H70A 3T3GA 5J47A 2PMKA 3DBHB 2AMFA 3WLQA 4B84A 1LH0A 1E6WA 1G41A 4IDNA 1J39A 4Y1FA 5HA5A 3JD4A 2CXRA 3GJ7A 5EPEA 4ZOQI 1HKUA 1II8B 1Y7HA 2NO9A 2WAMA 4OMCA 1J7JA 1GV0A 2VTEA 2WFLA 1CG6A 4I6EA 3MK31 3QTBA 1Z2OX 1K88A 3CLVA 2M6RA 1GOTA 1E7YA 3INYA 3MFYA 4FR5A 3TLBA 3ZJUA 2ZM6B 4YHBA 4Q7MB 1VL5A 3ZV7A 2D3WA 4I0WB 5BQ5A 3RYHB 2QG4A 2M32A 3GVIA 4FBMA 1AKUA 1V9CA 2ECPA 1MOQA 4Q3LA 4YY3B 1MJ5A 2VF8A 4MWDA 1U0TA 2VH1A 2WWTA 3Q9NA 4JLSA 3R41A 5H3LA 1GFIA 3R5JA 1JHVA 2XVYA 1KSGA 5ALSA 3ZLUA 2Q4BA 1GL7A 4EUEA 1P0CA 1UPTA 1W49A 4TWRA 1U0LA 3FCCA 4BLWA 1BA3A 3UMFA 5K0GA 2QJRA 4REOA 1ZUNB 5HIIA 1GPKA 1H42A 2FEMA 4FT2A 1F14A 4QUHA 3R7LA 1V3UA 4YECA 2B25A 4BMOB 2Y1GA 3IJEB 4JBNA 1O5IA 4J0HA 1ARZA 1PL7A 4N0EA 3LCVB 1A8UA 1RYYA 2CJWB 4MI3A 1QYXA 1D1PA 1RSZA 2G80A 2ZTVA 3Q85A 4QU9A 4A26A 4RIFA 1O6BA 2UZIR 2XUGA 3B9RA 3FVTA 4NBKA 3LFHA 4NK4A 4PLVA 1DS6A 1GU0A 1SM4A 1QH1B 2AGVA 1EFPB 3R3JA 1H6CA 5KKAA 2Q9BA 4FXOA 1FDVA 1OTXA 5JALA 2DQZA 1YBAA 4PTZA 1KQPA 2WYHA 2JLQA 1I30A 2R00C 2ZRDA 1EEXB 5JHHB 1SELA 3CFYA 2IBSA 3ILSA 4F5YA 3LUCA 1ZOIA 3RLIA 2WB4A 3IC5A 4B80A 2I3AA 3OZCA 2W6NA 1O08A 3SSAA 2IYWA 2F59A 4RK5A 4CF3A 5FJIA 3R7WB 2P6RA 4ZV9A 3Q9UA 2JH9A 4BNGA 3PUXA 5IFLA 4DEVA 2HRRA 2D7CA 2FQQA 1U28C 1PJQA 1MX1A 1W581 4C06A 5F33A 3JVIA 4TRNA 1P4SA 2X3FA 1OE0A 3RANA 1G21A 1PL8A 2ONZA 2ZBVA 3TPCA 2Z2YA 2ZR9A 3P0IA 4ENSA 3B85A 3ANLA 1F60A 1Q0SA 3FKSD 2ZREA 3GZNA 2UAGA 3MMNA 1H4QA 3K1AA 5D51S 3KJQA 3MEQA 1XD2A 4MZDA 4PLGA 4YRIA 2PX0A 3A6DA 4WOJA 2QSZA 3AU9A 2PZMA 4FHEA 2Z98A 4P7BA 5EIAA 3TZKA 4BB9A 4CIWA 1I8TA 3BIWA 3K6KA 1AGYA 4ARVA 3TOCA 4W9RA 4LBVA 4UHKA 1RAIA 4C4SA 1UADA 3WYGA 5C8YA 1P9LA 3VJLA 1GTSA 2VPWA 8LDHA 3U7GA 3GRKA 1LK7A 1P80A 3NC1C 2DVMA 4R16A 3AJDA 1GTMA 1LKZA 2CEKA 1Y7TA 4Q3CA 4YXWA 3RVOA 2OKGA 3QFSA 1SOVA 2GBCA 3I9MA 4C89A 2Q3MA 1L5HB 5E3JA 4BDTA 1EHYA 1BN6A 3PB3A 3RV3A 4TYQA 2AH5A 4EX7A 3MCUA 2GWHA 4XFDA 4G1MB 1CX9B 2FQXA 4JJ6A 2XH8A 5DBIA 3RTGA 2PU7A 4DIOA 1OLXB 1JQAA 2VK8A 1K5HA 2PKYX 3HKEA 4IDPA 1Z29A 3E9CA 1ODJA 1NULA 4N3GA 3VYTB 4DMMA 4DR1B 4AMBA 3EDYA 4JMLA 4DJTA 2OL4A 4MO9A 4RY8A 1NRIA 5BYKA 1WXDA 1FQWA 3N2KB 1J56A 3P27A 2HGSA 4CT5A 4JU8A 2QTNA 1WKVA 5GONF 3H11A 2PRKA 1FA9A 3CBGA 1IUNA 1KU0A 3OO1A 5BWMA 3SICE 2KHZA 4OQ4A 3LDUA 4IIDA 5I8PA 5I8WA 1N33B 4TQ9A 4MEAA 1XLVA 2ZRFA 1VHQA 3AP2A 4GS5A 5FL3A 1KTVA 1GKKA 6PFKA 1LD3A 4Q3BA 2WYIA 4JUFA 3M8KA 4RV5A 1AF4A 1P7CA 2REOA 3TVDA 1T9KA 4MUKA 5B12A 3HXLA 2R6FA 4J03A 1GTZA 2C4UA 2O1EA 3AY6A 4IILA 1KH1A 3VR1A 5JADA 1ZOLA 2DY0A 5FO1A 4S3MA 1QK5A 2QAIA 5C4IA 3GPDG 4YAOA 1UP4A 4WHMA 3CLSD 3R3VA 4JSTA 4RJ2A 1BE6A 1W36B 1BDJA 4JU9A 4FZRA 1FYVA 3CRVA 2OYRA 1RQXA 1XTZA 3IMKA 4G37A 1WZIA 3W5HA 1VDZA 3RSZA 1MAAA 1I7DA 1M34A 3CUSA 1JRLA 4LQCA 5ALIA 1H2EA 1Y8QB 3CEAA 1R0WA 2G6BA 3EUFA 2WNSA 2W2KB 1H2ZA 3KVRA 5AJXA 2XTJA 1ZJWA 5EZYB 4G26A 3VYRB 3C3DA 1IWBB 1IY1A 1YZVA 3HFRA 3E15A 5FTKA 3ZCXA 1KJJA 5AI5A 4QBKA 3EBOA 1VLLA 5DTJA 5K03A 2CZCA 4JROA 5ARDA 1LQUA 3CVVA 1NOJA 4JHXA 3RYTC 1WZEA 3ZWCA 1ENYA 2C0PA 5EKDA 4HDMA 1Z6AA 4B83A 4LDPA 2WU4A 2YYYA 1U31A 1W4AA 3AVXA 2BVNA 3ELWA 4QVKA 4RWEA 3GHHA 1R4MA 2HMVA 4W6ZA 2VP2A 4MHTA 2WF5A 4ZT2A 5AD1A 3U44A 1G8HA 2KI5A 3E8XA 3ZKAA 3VHXB 2A58A 5BV8A 1U8CB 4UDOA 2PZKA 2YV2A 2I4NA 3ZY2A 2POQX 4FOOA 2FXIA 3N5CA 3GRPA 4OX9B 4B3XA 1T2UA 4W7SA 3H16A 3Q10A 1FPQA 4C3ZA 4KQ1A 3RC9A 1XTBA 1L5SA 3P9CA 5DBHX 2C4KA 5LDHA 2IEIA 4EGCB 4MIEA 4NAHA 1NA5A 1X87A 1ZM4A 4G8JA 2V97A 4IMPA 4XWKA 4A0HA 4Q9AA 1ZBDA 1XLTC 2XQIA 1N6NA 5INTA 4BUZA 5KJ6A 2O2XA 3EULA 1ZP6A 4ZKEA 5IUKC 1LJ8A 1RWMA 1PGOA 2FN7A 1AKRA 2X7JA 3O21A 1YNSA 1MTZA 2QW0X 4QUEA 3AF6A 2X5OA 2JGJA 1SN7A 3GEBA 4EHBA 1CRZA 4UCXA 2BMEA 4F4CA 4Z1OA 2SHKA 4Z7QB 3T3DA 3GL9A 3FJ1A 3MWDB 1H2HA 3PWSA 2QHXA 2GF9A 2E9SA 3R7DA 1YCFA 3ELDA 4Y2HA 3PU6A 4ZYLA 3GLTA 3LT5A 2QZJA 3EWIA 5AOAA 1OXVA 3FCAA 2OBBA 2HUPA 2Z58A 3H83A 2OV3A 1AVTA 3H2BA 2GVZC 3RYHA 4QGBA 2KW5A 1W1IA 2WF8A 4FLFA 4O2BB 4PC1A 1UXHA 3R6LA 4EEKA 2OGSA 3RVJA 1LRJA 1QVVA 3HG7A 5A3VA 5LQSA 5FIUA 4BFUA 3EIQA 3W5CA 4X61A 4BFSA 3NR2A 4P7GA 3Q3IA 4PX5A 1YK1A 4FDMA 5EZSA 1ZGJA 3D8RA 721PA 4Q6BA 5ITVA 1Y5NA 2ID9A 3HWX1 3KOYA 5A05A 1IHDA 1F7UA 4TYNA 3X2EA 4MEJA 4PG7A 1U04A 3QHPA 4B7UA 2XT0A