4EB0A

Crystal structure of leaf-branch compost bacterial cutinase homolog
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
b'SNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LCC
molecule tags Hydrolase
source organism Uncultured bacterium
publication title Crystal structure of Leaf-branch compost bacterial cutinase homolog
rcsb
total genus 91
structure length 258
sequence length 258
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12695 Abhydrolase_5 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eb0A00
1DINA 3WWEA 4Y2PA 2HDWA 2QR5A 2WUDA 1CUAA 1W76A 3BL8A 2PL5A 5C81A 2UZ0A 3C45A 3F67A 1RP1A 1VJ5A 4GBGA 1CUVA 4G9GA 3STYA 3TJMA 1DWPA 4Q3LA 2AXEA 1T4MA 1NX9A 2XQIA 3IDAA 3PUIA 5AOAA 2OGZA 5BWBA 3QMMA 3PUHA 1CRLA 2H7YA 2OQIA 3G0DA 1QIJA 2XUHA 1JU4A 4WY5A 4W1PA 2IIVA 2BKLA 3G0BA 1F0NA 1H22A 5JD6A 2DSNA 5JYCA 1DQZA 4DMFA 2QKYA 4JUIA 1ZI8A 3L1HA 3LIIA 2ES4A 5D6OA 1Q83A 1QIDA 1ZD2P 5HK9A 1P0MA 1MAHA 4X7BA 2WUFA 1CV2A 1DU4A 3KXPA 1MX9A 1XRNA 5T4HA 3T52A 4U2BA 3FYTA 1XROA 3IVMA 5IVIA 3WIOA 1QIIA 2XUFA 3WYNA 3D4LA 1ZIXA 3R0VA 1CQWA 5ALTA 2QOEA 5A7FA 2WSLA 3VVMA 4X6UA 4JNCA 1ETHA 3GFFA 1AMNA 1WHSA 2WHPB 4G8DA 4PSCA 1DWOA 5JANA 5HF9A 4OUKX 4KE7A 5BV7A 2O7VA 2CJPA 2EEPA 1QO7A 1XQYA 1YCDA 2BFNA 1YAJA 2PBLA 1XZEA 3GROA 3P2MA 1ZIYA 3EQ7A 3F98A 2XMQA 2VEOA 4B9EA 4DIUA 5HF6A 5CH8A 4Q1VA 5FV4A 5IKXA 5ALDA 4GW3A 5ALFA 2ZSIA 2Z8XA 1LPPA 5ALMA 4X6XA 2DQZA 1QONA 5DYTA 4G8BA 4UHFA 3H1AA 4HRXA 4CIAA 1XKLA 1K8QA 2WM2A 1QIEA 4KE6A 1MX1A 2XMZA 3O0DA 3N0TA 4BE9A 3SX4A 2IX9A 4BTLA 4W1RA 2WJ4A 1IUPA 3KD2A 5AI0A 2XQGA 4AX4A 4YPVA 4OSEA 4Y2VA 1UKCA 2RGUA 1R9NA 4QWMA 2XUQA 4RE5A 4HZGA 2LIPA 3I28A 3WI7A 5AKYA 2I78A 1MNAA 3WL8A 5AM1A 4B84A 3GELA 2AJDA 5DTIA 1ZD4A 4OU4A 5IVHA 3K2IA 5AKKA 1VE6A 4W1SA 5K3FA 5DNVA 3KOOA 5A71A 3KDAA 4C89A 3C87A 3D5EA 2WG0A 3ESDA 5CTAA 5AI6A 5DNWA 1IUOA 3W06A 4FWBA 5A62A 5JAOA 4J0KA 4BCCA 5ALJA 1LZKA 4ZWNA 3WKAA 5AK6A 5AKXA 5CT4A 1VXOA 1GZ7A 1AQLA 3DKRA 4EBBA 3EQ8A 1XRQA 1QGED 4J0HA 1LPBB 5K3FB 4H0CA 1GKLA 2O2HA 5HF8A 4DNFA 4RNCA 4Q3OA 1P0QA 5ALQA 4ROTA 2PSHA 3RKSA 5ALVA 4XIIA 3DQZA 1GT6A 4DMHA 3R40A 2VTVA 4O08A 4C87A 3I6ZA 1X2EA 2C0PA 1KEZA 2XQFA 4M0MA 3DNMA 5CMLA 5K3AA 2RI6A 4KE9A 4FTWA 2X76A 5D7BA 1R9MA 4Y2UA 4HXGA 4GWLA 3IUJA 1CEXA 5DYWA 4DSZA 4H18A 3FYUB 4BCBA 3R3UA 5CT6A 1CUEA 4TPKA 4DNQA 5DTJA 5E2IA 2PPLA 1THGA 3WK7A 3WWCA 3WK9A 4X85A 4UHHA 4B83A 2FJ0A 4RE6A 5AK3A 4C4ZA 5IVDA 1VE7A 5LYYA 4AN1A 1VXRA 5C8XA 1E8DA 1GPNA 4W9RA 5K3DA 3AINA 2I3ZA 2JBWA 2WIKA 3SK0A 5AI8A 3FBWA 4Q05A 1UK6A 3I1YA 2PM8A 1AX9A 4BC1A 5LZ4A 4GEGA 3BF8A 1EDEA 4QLOA 1KU6A 4NS4A 1RYYA 5FPPA 1QTRA 4EY6A 1AURA 4P08A 4FLMA 5EIHA 3R3XA 5J3JA 3JW8A 3V9AA 2WJ3A 1BROA 2WTMA 3HC7A 3WKDA 4ZXFA 1HL7A 1R50A 3QVMA 4EUSA 3M81A 3BXPA 4J0JA 1GPLA 5AKGA 2X8BA 1CUIA 1AUOA 2XE4A 4X71A 5ALKA 1TCBA 4X90A 4J0DA 1F8UA 5LZ5A 4HXEB 3VISA 3G9UA 3JYHA 4I3FA 4UFNA 1DTEA 3HACA 4FLFA 1N8SA 3OPMA 5LZ9A 3U1TA 4B80A 4BB0A 1QO9A 2HA7A 5AI5A 1VA4A 1TCAA 3E4DA 1S8OA 1ODCA 4Y2YA 3QBJA 2OAEA 3ED1A 2HFKA 2V98A 4LKOA 1XZCA 4UHBA 2J4CA 3CCCA 1PV1A 3KWJA 4MJ3A 2HA5A 4EB0A 1THTA 3WWOA 2Y6VA 4BAZA 4BC0A 2PSDA 3B3QA 3BWXA 4EY7A 5A2GA 1ZI6A 1CUUA 2ZVDA 4H7DA 3AFIA 3PFCA 3TEJA 2B4KA 1BN7A 3C5VA 1IZ7A 4XJVA 5ALNA 1VA5A 5ALYA 1BRTA 3HZOA 2VA9A 3HRHA 3PF8A 4PSUA 4OPMA 1XZJA 3WJ1A 4Z49A 1ZGBA 4BP8A 3VDXA 2H1IA 1MX5A 3R3WA 5EGNA 1C4XA 2BGNA 3O4IA 1Y37A 2WUGA 3C6BA 4UFPA 3SWWA 3H19A 1CPYA 3WMRA 2H9YA 2HU5A 1UZAA 4B9AA 3EBLA 2D0DA 5DJ5A 1BCRA 2OGSA 2WQZA 4K5QA 4S0XA 5A7GA 1QE3A 4B85A 3BIXA 3UMJA 1YS1X 4EA6A 2VAVA 3EQ9A 4BDTA 5CBKA 5HKAA 2CZQA 4N5HX 4OU5A 4EY5A 1R88A 4OB6A 2Y1KA 1HBJA 2B20A 1XRLA 3C8HA 7YASA 4BVJA 4ZI5A 5EI5A 1GQRA 4PV7A 3EIOA 1XZGA 3H2KA 4ZV9A 4EY8A 4CIBA 2QJRA 3RLIA 4AO8A 3FYUC 3OM8A 2QUBA 2JGMA 3A2LA 1N5MA 3BDIA 1JI3A 4W1QA 4B6GA 4M0FA 2QUAA 2JGJA 3A2MA 4UBIA 4J0GA 1USWA 2WFMA 5JZSA 3WIBA 2HA6A 5KREA 1UK9A 2RIPA 1W1IA 1AKNA 1XQVA 4JYPA 4AO6A 4H7EA 1VZ2A 1L7AA 3BDVA 1DWQA 3Q0TA 2GZRA 2HU7A 2PSFA 3DEAA 2YXPX 1XZHA 2XUPA 3IUQA 5EHQA 3STWA 5FKJA 1H2ZA 5KWIA 4P9NA 5IVKA 3A6ZA 3PI6A 5JAUA 1W6RA 5K3BA 3IB3A 3DLTA 2X5XA 3I2JA 2J3DA 2ZYSA 2HA4A 3WWPA 3WYDA 3VJLA 1EA5A 1Z68A 1UOQA 4KRYA 4C88A 1CUSA 5CT9A 2WHQA 1SCIA 4JEIA 1M33A 3G7NA 1K63A 3H2IA 1ODTC 4FOLA 4FDMA 5LZ7A 4IH9A 1F0PA 2PKYX 1ZD5A 2OCGA 5CT5A 2OLEA 1FSSA 1XZLA 1BN6A 2QJWA 4AQDA 2OXEA 1EK2A 4N5IX 1MTZA 3FCXA 1GXSA 2ACEA 4U2CA 4C01A 4QDTA 5ALHA 3VVLA 2C4HA 2E3JA 4N8SA 4OYYA 1MU0A 3STTA 1SCKA 4F60A 2QT9A 2JGEA 4DGQA 4FFVA 3C6ZA 2PX6A 4B0PA 5ALEA 5HQ3A 4UBLA 5AKHA 5HZGA 4LYEA 2GBCA 4W63A 4J0CA 5DYYA 2HL6A 2ONCA 5JATA 3H04A 2OGTA 4AB1A 2BGRA 5EHNA 5CH3A 1U65A 4UBNA 3H0CA 1ACLA 4GDMA 4BBZA 4WY8A 1YASA 2DHCA 2WFZA 5HF5A 1XRRA 2BAGA 3MGAA 1CUJA 3QM1A 5AM4A 5JASA 2Z8ZA 5AM0A 1ACJA 2JIDA 3PF9A 4QA9A 2H7XA 5KBYA 3V48A 1LPMA 4MXDA 2FUKA 1HDEA 3WL6A 5FRDA 2WU3A 3PE6A 4HVTA 5ALUA 4AZ3A 1XZFA 1EDDA 3GBSA 2C58A 4FNMA 2XUKA 4L3WA 5LKRA 3GZJA 4BZZA 3G8YA 3IA2A 2O7RA 1EINA 3HABA 2HIHA 1AC5A 5AKLA 1LZLA 1WB6A 1XKTA 2WU4A 3H2JA 4MQMA 3C43A 2OAGA 2GBIA 1LNSA 3C6YA 1FJ2A 4QZVA 2QXTA 2QS9A 5EFZA 3E3AA 3IULA 3W05A 3UUEA 1EB8A 4MWTA 3ZLTA 3D2BA 2DCMA 3WA6A 3MUOA 1XLVA 4KEAA 4PF1A 2OCIA 3WKBA 3QH4A 5ALSA 2HADA 1SC9A 4C4XA 2HHAA 4K6KA 4J03A 2GYWA 1YA8A 5K3EA 1HQDA 1UOPA 3QYJA 1RWQA 5A6VA 3C70A 2XMBA 4C4YA 1K5PA 2XLCA 4CI9A 4L0CA 1WPXA 1EXWA 5ALGA 1XLUA 4DNOA 3ZWQA 1WOMA 1GQSA 2JEZA 5EHXA 4INZA 5AI4A 2ZJ6A 1OXMA 4H7FA 2O2IA 3MVEA 4QLAA 4ETWA 3PDCA 1EVEA 5LKAA 3F9CA 3ZI7A 5AJHA 4RGYA 3W9UA 1E3QA 1IZ8A 1EK1A 5T4EA 4IH1A 4G9EA 4WDRA 3DL7A 2VJAA 3AIOA 3DKKA 3BF7A 5AI9A 5SYNA 5D3KA 1DT5A 1WCYA 1CFJA 2CKMA 2RONA 1W4LA 4Y9SA 2QRUA 3K9BA 3WKEA 1G66A 2Q0XA 1FFBA 4U2FA 5E4TA 2XMDA 5JARA 5CRIA 2WG2A 4CCYB 3WJ2A 3TRDA 1QTIA 2QM0A 4XVCA 1YB6A 1XRPA 1GGVA 4WDQA 1ZICA 4U2GA 2H7CA 1TRHA 1A8UA 3G9ZA 5FOQA 3OC0A 3WL7A 4IQ4A 3U0VA 3EF3A 2WLSA 3WZMA 5ALWA 3TGLA 5SYMA 2XMCA 2QZPA 1TKRA 1K6EA 4G4JA 6YASA 4UBMA 4QDOA 4E15A 5AKJA 1JMKC 2VSQA 5HFNA 4PQEA 3I6YA 2WKWA 1CUGA 1R1DA 3WA7A 1FFAA 3L1IA 3FOBA 1EB9A 2XT0A 1XZAA 2O2GA 3IURA 3D2CA 2I03A 1JFRA 2C0QA 2AJCA 2WG1A 1A88A 3R41A 1EI9A 4GLBA 1QIFA 1CUDA 5EIAA 3WK6A 2XMSA 4NMWA 1MT3A 1QLWA 3O4JA 2AJBA 5AICA 4AMZA 2IITA 1IMJA 4QE3A 1MNQA 1LPNA 4UBJA 4OB7A 3F8SA 3WKCA 5DLPA 2RHWA 1E8NA 3DYVA 3KWFA 3NGMA 1MPXA 1L7RA 2AJ8A 4P93A 4C6HA 1BEEA 1CR6A 4A16A 3UUFA 1TQHA 2ZJFA 4BE4A 4BZWA 1KU0A 1SFRA 2W6CX 4X3CA 1UK7A 1UOOA 2J3QA 1OILA 4KR0A 4X92A 3STVA 1HKHA 5AOBA 3H17A 2VAXA 3OURA 1H2WA 2DHDA 1TIBA 2B61A 1EVQA 1QIMA 4X94A 3FVTA 1WB5A 4BP9A 1ZOIA 1QIGA 1VOTA 1J2EA 2V96A 4H7KA 2WHPA 1BE0A 1CUYA 5CXUA 1UXOA 5I8PA 4LYDA 4L72A 3IIIA 4ARBA 2XUJA 1CLEA 3I1IA 4UFOA 4KAFA 5LP1A 2WIJA 4DNPA 4J7AA 1SCQA 4LHEA 3I6MA 3FNBA 4KAAA 3BJRA 4UHEA 1J07A 1T2NA 4BVLA 1P0IA 1G4HA 2XLBA 1BEZA 5JZ9A 2NW6A 1H2XA 2Z3WA 3FWHA 4UHDA 1U2EA 4AO7A 3FVRA 4FKBA 4E11A 1VZ3A 4HRYA 5CXXA 1WM1A 3FSGD 5AIAA 5AM2A 1WPRA 1E8MA 4G8CA 4I19A 1ORVA 2CMFA 3FCYA 3LS2A 2I3DA 5FP0A 5JZBA 2BUAA 5K3CA 4MEBA 3FSGA 4X91A 1A8QA 4WFIA 4Y2JA 5AOCA 4FNGA 3HSSA 5JIBA 1HLGA 5ALZA 4CCWA 5HFAA 4H7JA 5K5EA 4KJXA 2BCEA 5C8ZA 1IVYA 1JJIA 4F0JA 3AIMA 3HJUA 3CCBA 2VJDA 4ZRDA 5YASA 4CG2A 4GHWA 1EDBA 1MJ5A 2XI4A 1EH5A 1XLWA 4QNNA 3D0KA 1X70A 5CW2A 4KYVA 1UKBA 3AJAA 3HYSA 4JYMA 2GBGA 2WFLA 1BCSA 2GYVA 3DOHA 4LXGA 4Q3KA 2FJPA 4I4CA 1LBSA 3FYUA 1XZBA 2JGFA 5JADA 1TK3A 2EDCA 1Q0ZA 2CBGA 5E4YA 3WK8A 3AZQA 2RAUA 1QOZA 3BJMA 4NVRA 1G42A 4BATA 1MO2A 5FPQA 4WFKA 2DFPA 4XWGA 2W22A 5JALA 2XUGA 3CN9A 5EHZA 4AN0A 4BRSA 1XQXA 2OPHA 1XZDA 2G63A 4QDZA 2WFLB 4TGLA 4K2AA 5DWDA 2PSEA 3HEAA 4PSDA 1XZKA 1DX4A 2DHEA 3M3DA 4X6YA 3YASA 1FFDA 2HA0A 1CUCA 4QDXA 2CEKA 5ESRA 3IBTA 1LPSA 2R8BA 5C8VA 3FLEA 4YX9A 3IUMA 4EHBA 4BAUA 1QZ3A 5AO9A 1R4ZA 3ZV7A 2B9VA 3H18A 3H1BA 2ECFA 3V1MA 4DMKA 1QFMA 1YS2X 4HXFB 5FDFA 3R3YA 4FBMA 4WFJA 4L9AA 1CUBA 3AIKA 3WLAA 5CT8A 5BOVA 4NZZA 2HM7A 4Q82A 5LZ8A 3R3ZA 3AILA 3DOIA 1ORWA 4U2DA 1VLQA 4G1FA 4Y2RA 2WHRA 3BE8A 3WZLA 3O9VA 4H77A 1IUNA 2G5PA 3WQHA 4WCVA 1LPAB 5AM3A 4FLEA 4IH4A 4LXHA 3B12A 1C7IA 5FUMA 1JU3A 3F96A 2FX5A 3DS8A 3G9TA 4ZV7A 2DR0A 2PUHA 3DCNA 4B0OA 5AH0A 4K6HA 3E0XA 4H35A 1U8EA 2WIGA 3LP5A 4BCDA 3VJMA 1J06A 4DLNA 2Y6UA 3V1NA 4B82A 3D7RA 3O4GA 3ZLUA 4MEAA 3PFBA 3LLCA 3W9BA 1J1IA 3NWOA 4HS9A 4OB8A 3QPAA 1JMYA 3VKFA 1B41A 2ZYHA 5JAHA 2ROQA 5AKZA 5FXMA 2XUOA 3GUUA 2XQJA 4BTVA 4N8DA 3DL4A 1F6WA 4DMCA 4A5SA 3C5WP 2BUBA 2JGKA 3SC2A 2Y2VA 4E14A 3G0GA 3JWEA 1WB4A 5I7UA 1DQYA 2XMRA 4Y2QA 2BJHA 1ISPA 3DJYA 2VT7A 4UPDA 4DSAA 1UT6A 3HI4A 1QIKA 3N2ZB 4ZREA 3FLAA 3OTQA 2Y2UA 2ORYA 3WK5A 3VXKA 2ZJ7A 3FLBA 3W2TA 2HA2A 4ZGBA 2JEYA 1QFSA 4P92A 5HKBA 4CG1A 1MN6A 5A7HA 1UKAA 4B7ZA 5ALXA 1GKKA 2CUTA 4LXIA 4EZIA 3ICVA 3OG9A 5EIEA 4U2EA 1L7QA 2QXUA 4A23A 3M82A 3G0CA 3PICA 3ESCA 1NU6A 2C7BA 2WJ6A 2WIFA 2WIDA 2Z5GA 1Y7HA 1YAHA 4KRXA 3WWDA 2XUAA 1NU8A 1DT3A 4KACA 4CG3A 4G4IA 3O95A 1OCEA 4K6GA 4CFSA 1U4NA 4H7IA 5JD4A 1ODSA 4J0IA 1A7UA 3H2HA 3H2GA 4BYMA 1HPLA 3MUNA 4B81A 3ILSA 4Q34A 4FFWA 2GBFA 4RPCA 4YK7A 3NUZA 1D07A 4N8EA 3STUA 3QZUA 2D5LA 2VATA 1YSCA 2OG1A 1LGYA 3OOSA 3A70A 4PO3X 1PJAA 1CQZA 1YB7A 2G4LA 2V9ZA 1C7JA 4DTCA 4Y7DA 1WHTA 3ANTA 4ARAA 3D59A 4OD0A 5JD5A 1N5RA 3WK4A 2CB9A 2WUEA 4AXBA 3CN7A 3C6XA 4DYHA 1I6WA 2VF2A 3D2AA 4HAIA 4MYDA 2XB6A 3M83A 3QPDA 4BVKA 3AZPA 4BDSA 2PU5A 5AK4A 1CUZA 1O6GA 3WL5A 1A8SA 1ZJ5A 5T4FA 3HXKA 4OYLA 5I9IA 1FFEA 2VT6A 4QEKA 1UWCA 1W52X 1JJBA 4Y2TA 1Q0RA 2XUDA 3ZPXA 2ZSHA 5AM5A 3X3HA 4WJLA 5HK8A 5HCUA 4LIPD 2VJBA 3G9XA 2XQKA 2K2QB 5E4JA 2XMGA 1GPKA 5ALOA 5F4ZA 1LLFA 4QDUA 3I2KA 1ZD3A 1XZMA 1N1MA 4UUQA 2QTBA 4F5ZA 1O6FA 2JGIA 1Y7IA 4KAJA 2HRQA 5IH7A 5AHXA 5LLSA 5FLKA 2YH2A 3HLKA 3B5EA 3VJKA 2GZSA 1JT2A 2VQ6A 1CUFA 1BS9A 3LIPA 4X95A 3E1GA 4HTAA 3DD5A 3V1KA 2ZYIA 5CURA 1CUHA 1LBTA 5D3ZA 1DX6A 1Q84A 2BUCA 5HQ3B 3RK4A 2V97A 3AUKA 2ZYRA 5ALRA 4FMPA 4JH0A 1QJ4A 2EDAA 1CVLA 2PVSA 3QMVA 5LZ2A 5DNUA 5KWJA 4OCZA 3Q8WA 1W75A 4G5XA 5BWCA 2P8SA 1ZJ4A 4MWSA 1YA4A 3I2GA 4GECA 2WILA 2HFJA 5ALLA 1AZWA 4ITVA 4BAGA 4MYSA 3W04A 2YASA 2XDWA 3F97A 4IO0A 4EY4A 3KSRA 2AJLI 1YR2A 3I2HA 1ZGCA 5AP9A 4BRZA 1H2YA 2HRRA 1H23A 3R3VA 2C5FA 1UFOA 1CUWA 3G0IA 3S2ZA 5LIPA 2G5TA 3CXUA 4QWWA 3LCRA 3NOXA 1ZI9A 4KE8A 2PUJA 4YASA 5AKEA 1EX9A 1XQWA 3DYIA 3GA7A 4V2IA 4PNZA 4H7HA 2QMQA 4X00A 4UBKA 3ZLVA 2R11A 5ALPA 4X93A 5AK5A 4TVKA 4UHCA 2PSJA 3G02A 4MQLA 4G4GA 4J3JA 4FHZA 4F21A 3L1JA 5AIBA 1P0PA 5C7YA 3QPCA 3QMWA 1FFCA 3RM3A 4GI1A 5AKIA 4Y2SA 2DQYA 1TAHA 2QVBA 3ICWA 2JGLA 2OQVA 1XRMA 1EHYA 2HU8A 5H3HA 5ALIA 4X97A 1PFQA 3IUNA 2J4FA 3T4UA 1JJFA 3RARA 4DM7A 2HA3A 3ESAA 4E46A 2WTNA 4AMYA 1UK8A 1E66A 4Y2XA 2C5GA 3D3NA 4IHAA 1CUXA 3S8YA 3STXA 3QITA 4UBOA 3ESBA 3BIWA 1QIHA 3A2NA 1CIJA 3FAKA 1TCCA 5T4BA 2VJCA 2XUIA 1VKHA 2PU7A 4M0EA 3AZOA 3V1LA 1XFDA 4D9JA 4CCYA 2OCKA 4XX1A 3I2FA 5CH5A 2RHTA 2GYUA 4AZ0A 1XZIA 2YYSA 1X2BA 3K6KA 5JAPA 2OCLA 1K4YA 2ACKA 1MAAA 1E89A 2Z3ZA 3C8DA 1G5FA 4PW0A 1E5TA 2JF0A 5ISMA 1SOMA 3O4HA 1R3DA 3O9MA 1BU8A 3DDUA 1LPOA 1AGYA 1JKMA 4FBLA 3I2IA 4GXNA 3ANSA 1B6GA
chains in the Genus database with same CATH superfamily
1US8B 3HNPA 5BNIA 3PKJA 5KU1A 1KDRA 2IV3A 4XGNA 4YCCA 1BX3A 1UQUA 4Y2PA 1ZU4A 5JISA 4TSKA 4RZ2A 1TIPA 1UDWA 1SVKA 2BKUA 2NNWB 1QGDA 1WW3A 4AY3A 2JLYA 2XVMA 4PLWA 2PL5A 2VLIA 1MA0A 1HMPA 4PLTA 4Y18A 1G21A 2UZ0A 5MHTA 2UXBB 5JTUA 3VR3A 2OV8A 2CXRA 4BWVA 1VJ5A 1RQ7A 5MN5A 1BJRE 3A7DA 1KK1A 3WLLA 1W36C 4U9IS 2R6DA 1G4AE 1Z4LA 2JA2A 3B6ZA 4URUR 1YE3A 2CDRA 1JA0A 2HRZA 3C3PA 3EZNA 2DBYA 3JALB 4C06A 4DQUA 2FFRA 2H2GA 3D7SA 4WQMA 3IC5A 2CXQA 2R87A 3GFQA 1P9OA 2HT6A 3AEYA 2WIAA 2EFYA 1NR5A 4EFDA 5KNDH 2W2QA 4ZP1A 5JNUA 1B0UA 1YACA 1C9YA 2AXEA 2PZGA 2X4GA 3E23A 5G1OA 4Q01A 5JD3A 2WTAA 3GD5A 4D99A 1LS1A 5DIZA 2ZSDA 2GN6A 1PEYA 3GUHA 1P74A 3TR0A 4PN3A 2B8EA 3IVXA 3VPHA 2XYRA 3PUIA 4FMBB 3EF0A 2DWPA 5AOAA 3U16A 1VJTA 3NJ4A 2WMDA 2I6QA 3KOXA 1SKYE 3RR2A 1UH5A 1Q6YA 2XEDA 3PUHA 4R8MA 3HJTA 4CIYA 1IM5A 1GZDA 4C43A 5F98A 1PFVA 2XUHA 1G8HA 1DTWA 5B12A 1KQGA 3RRJA 1ZM4A 2Q5LA 1ZJJA 1C4WA 1QV7A 3QUBA 1R0WA 4F38A 2XKAA 3NYQA 1VIVA 1WF6A 1JXAA 4KH1A 1AO3A 3ZCXA 4B8WA 1NXSA 4LDQA 3TQOA 4U8HA 5FL7A 4MPRA 1NN3A 1LX6A 2BKLA 2UYOA 3G0BA 2WF9A 4RFVA 1H22A 1HE4A 4Q37A 2QI9F 5CDSA 2FQWA 3JQGB 5L4SA 1U98A 4ZU1X 4RA9B 3LNCA 4MR9A 1Q0TA 1J0DA 4ZA2A 2H16A 3A25A 3M6WA 1A5ZA 1XD9A 3NVAA 3OT4A 3MWDB 4XUDA 5DHAA 5A3VA 3VAYA 1W0JD 3ZWPA 2OWEA 4N49A 1EK0A 4HGNA 5HK9A 3EGVA 1XTPA 4KFSA 4A8PA 2AQ8A 1SVMA 1BWPA 1VDZA 4DSNA 4NL4H 1FUEA 4KMSA 4CM3A 4OAOA 5JWRA 3NALA 3COYA 3DXYA 2WUFA 1QUEA 1DU4A 5KJEA 3KXPA 4KAXA 5F9MA 1ZL0A 1GGHA 5FA5A 4CV2A 3B53X 3N05A 3T52A 4U2BA 3W78A 1ZDMA 5IVIA 1DTWB 1QIIA 1GPJA 4JLJA 1II8A 3JZFA 4B3RB 1LKZA 2HDNB 3DDCA 4AZTA 3L4EA 1Q19A 5DO9A 1H5QA 3DLIA 4D9FA 5CCBA 5CDUA 1V8DA 1U5BA 2HU2A 2VEDA 1QG6A 3E7WA 3PGVA 2A9RA 3R0VA 9ABPA 3G6KA 2ZSAA 2QOEA 3OX2A 3RUEA 4JN6B 4ED9A 3Q11A 5HKLA 1T2AA 4RA9A 3LWNA 3AVTA 3VVMA 2VSOA 2ZI9A 2LCIA 4MUHA 4RK7A 2CLFB 4RNDB 3PQFA 2IS1A 4JLWA 4UVDA 2CHEA 5D3MB 1UBSB 1WHSA 3WTBA 1UMKA 4N5MA 1NBWB 1KH1A 4JUAA 2IDZA 2GXUA 3EMBA 4G8DA 4KI7A 4YO7A 2I33A 1XRJA 2A0UA 2BMVA 1WIWA 2FUG1 2Q49A 2ZVJA 5HF9A 3PRKE 4FT2A 2CVHA 1VKOA 4X8MA 1WMFA 2IHVA 1M67A 4RQTA 1KVUA 4J1QA 4OA5A 3WNCA 4CJXA 2X7HA 4EPVA 2AI2A 4HQ0A 3ZK7A 1E6LA 4OXNA 4BWGA 1U8AA 2WSSD 5DBEX 2NVUA 4HWPA 2MR6A 2CE7A 4H27A 1LWOA 2YBDA 3W0LB 1U6IA 1XQYA 2FQYA 1ZM7A 4KITB 1FU4A 4EPXA 3A31A 3OPYI 3SC4A 1G9SA 4BN0A 1J1UA 4BFVA 1ZIYA 3K71B 4LG1A 4IFIA 4WXRA 3QVJA 4JEHA 1OHHA 3RSQA 1CB0A 4A10A 1QR2A 3T5DA 4DJFC 4X0EA 3UMBA 2FPGA 3PRHA 3QEBZ 3VJKA 1H6AA 4DIUA 3Q8MA 2C7QA 3CVUA 2O6HA 3ETHA 4A2QA 1E9RA 2IZ0A 1JHPA 5CH8A 2FQ1A 3U37A 1N2HA 4Q6BA 1OLUA 5ALDA 4DQKA 1OUMA 2IIPA 5FV4A 5IKXA 5HKOA 3KP1A 5D3MA 2VSFA 2IF0A 4DIMA 1KK0A 3WL4A 5AVXA 2QB5A 1XAJA 5TMDA 3E7XA 3HO6A 5LIRA 2DQZA 4AJ2A 3D3EA 4K86A 4TKUA 1X1EA 4ERXA 1OXBB 3ND7A 1A9ZA 4JSYA 5C1BA 4V3CA 1D2NA 1KYWA 2BGMA 2R00A 4FW8A 4IGEA 5ECGC 5D5HA 3QWIA 4IICA 1RDFA 1RXYA 3DCJA 1FU8A 1X7YB 2BFDB 2HO5A 2P4UA 3GT0A 1Z2DA 4HRXA 8AT1A 2ZUWA 3BWVA 5ED4A 4JI7B 3X44A 4JB2A 2EZUA 3CZPA 4C7MA 2AOXA 5HIKA 3F6CA 3HKDA 1KMHA 3EIXA 2O7SA 3RHFA 4MV3A 4ZC8A 3KL2A 1U2PA 2OGUA 1DG1G 2A1UA 4EB8A 4PG8A 5FWYA 1PV4A 3ED5A 1XCOA 4KBYA 4MCIA 5KTMA 5AI0A 2RK6A 1ZHHA 4OJTA 5H80A 2ZIZA 2G4VA 1DBQA 3VU3A 4YPVA 1GNRA 1T8SA 1AO0A 3COJA 5SZJA 1DC7A 1UKCA 4J6EA 2RGUA 2CL5A 1R9NA 2A58A 4G1UC 3D1JA 4XPIB 1MG5A 3ZU2A 3UJPA 1P62B 3CLSC 4QELA 2KX7A 5FQNA 5G40A 4F72A 3IEUA 4PHCA 3D31A 1WZEA 1BNCA 1GG9A 1TFUA 1VSBA 2ESRA 3COPA 3G2KA 5ETJA 3FGZA 4FYPA 4E1AA 2HPVA 2IYVA 4DUZB 3I28A 4FBGA 3JVDA 2DKOA 4OHPA 5AW3A 2B6NA 2LDBA 1MNAA 1P3JA 5BNZA 1V35A 4OFBA 1VL2A 1T3TA 1JKFA 2QWXA 4MJ7A 2EHDA 5FTLA 4RLFA 3ZXYA 3FVVA 3VX4A 1E2KA 4UVEA 3IEIA 4QTZA 2Q5JA 1P2TA 1P75A 1ZAKA 4QYIB 1KMHB 3OF2A 4G5FA 3K2IA 3DQQA 2ARKA 5JAIA 5KKCA 4IHJB 1OZGA 3MNFA 4WOPA 4BE7B 1RKXA 1TXGA 4IDFA 5A3SA 3VO9A 2D59A 1QB7A 3MC1A 5FTKA 4CTJA 4XYLA 3MRTA 4MHTA 4PS0A 1T9DA 1OLXB 4WASA 1VMDA 5CYPA 3BE6A 2WG0A 2LWIA 3ORHA 4BVAA 3SJ7A 4O25A 3WRYC 1NVBA 1SZCA 3AEZA 3VKHA 2AX4A 3O8OB 5EMJA 2P62A 2K87A 1L8LA 3PEEA 5E3IA 5JAOA 5HDBB 1J33A 3GVIA 4BCCA 5C18A 1TEHA 5EKDA 1UPAA 1D9ZA 4TV9A 2BR4A 1G8MA 4P22A 1QMGA 4ZOBA 5CAEA 5T7BA 1LZKA 1P7WA 1KEEB 2WA1A 3SEFA 5CVEA 2H2IA 5IHPA 4I9HA 5JMTA 4QQ8A 2ZU0C 5JAQA 2FRDC 3KRTA 3B3JA 5CT4A 5BURA 1IHYA 3FB4A 2NP6A 2XE6A 3LT4A 3VC2A 3SICE 2C2GA 4GKAA 3TE7A 2ZS9A 4ZV4A 1QPZA 2P9EA 5E9AA 4CQNA 3QPVA 3GJZA 1XRQA 3T38A 4KPEC 4DABA 4DE5A 4KUEA 1FXWF 5FBQB 4QYIA 2GZ3A 1LPBB 1IWPB 1NW8A 1MENA 4RJJA 5M3BA 3WLNA 1K5GA 1CULC 2QRKA 5T3UA 4WTOA 4B2YA 4EG5A 2ZB3A 3KO8A 4WBNF 2Z2IA 3R77A 5CX1B 3D02A 2JIOA 3QNUA 1CY2A 3PSAA 3HFGA 1NSTA 3OPXA 4YJFA 5H7XA 4Z4QA 1FK8A 1SMKA 2X2PA 4BPBA 1CX9B 4ROTA 5CB0A 3OWHA 3H4VA 2E2WA 3M1YA 4PZ9A 5DM1A 1STOA 3S44A 5CBPB 4LF4B 1X6VA 1A76A 2N46A 2W6ZA 3OZRA 4MAAA 4AG5A 1K06A 4EHAA 2L2QA 3AHJA 3RVJA 4LHWA 1ZN8A 1LNQA 2PBFA 3QG5A 1E6KA 1JIKA 2GZ1A 3GY0A 5JEDA 2HK6A 4ZT5A 2IOYA 3DQZA 1GT6A 2QD2A 2OBLA 2VTVA 4WESA 4BMSA 1WEKA 3M6FA 3ZVMA 1N3YA 1X7GA 4PRZA 5DNYB 2H4FA 2ZROA 3DZKA 4NCIA 3O8QB 5IC6A 3RIXA 2C0PA 4CMHA 3WFZA 2DT5A 3EMKA 3F3KA 5BSRA 4DVGA 3ZV4A 4DR2B 2Q2QA 5K0NA 3LA6A 1UC4B 5ABPA 2XQFA 1FDUA 1VL0A 1X19A 2C4WA 4A2WA 4YCLA 3EWSA 5K3AA 2RI6A 5ADUS 4UAUA 5FPSA 3CNOA 4V0NA 4EEXA 3G59A 3N53A 1GCUA 4RYLA 4RD1A 3NRJA 1OU4A 2Z8YA 2YC4C 3IUBA 4HXGA 5J2TF 1E69A 3MF4A 4V0RA 1NBMD 5FL7D 4C08A 5JFTA 1IEVA 5I8WA 1T6YA 2C2OA 2FB9A 1Y4ZA 5KYWB 5CA1B 4HUJA 3EPLA 3D3JA 4W7HA 4UARA 1JDNA 2JFFA 3IRUA 2FOLA 3U81A 1OXVA 2E4AA 3FF4A 3V32A 4YRKA 4FMDB 4MSUA 3AY6A 1X15A 1Y3FE 4MV1A 3R3UA 4JJEA 5EJFA 5CT6A 3LWBA 3RDPA 1CUEA 3SU8A 1I3NA 4DNQA 3U9SA 3JQAB 1KHTA 2AG6A 2FPIA 1QLJA 3A6LA 4GPBA 5DTJA 1L3CA 4OGWA 4LXUA 4JJFA 2YKGA 2XWJI 4QYWA 2P9ZA 5DV9A 1D1QA 5IJ9A 4YA6A 3QSGA 3CO0S 1UBGA 5KOIA 1W85B 1OTXA 4FHFA 3EJWA 4UHHA 5E2BA 2FJ0A 4IWXA 1JHVA 4PQRA 4C4ZA 1SCUA 3IJPA 3QI2A 3L4KA 3I62A 4F91B 4QARA 1HNNA 4D0RA 3BKXA 2EXXA 3K0AB 3N7UA 5E6UB 5BYJA 5JBIA 1AA6A 5AVTA 1VHDA 2EJTA 4FZJA 1W9MA 2ANBA 4YIKA 2J59A 1K3TA 5C8XA 4ZEMA 2J32A 2Y1GA 1YKSA 3HCRA 1E8DA 2OFXA 3O75A 4PQYA 4D45A 4MW0A 5ITZB 2I3ZA 1GSAA 4CM6A 1FW8A 2JBWA 3H9JA 3SI7A 4QO7A 1RHUA 2X0IA 3NYWA 3FBWA 2WZCA 1E1QA 1VCNA 3UUGA 3C3XA 2ERCA 1GQYA 1UK6A 3ZD8A 5KJ6A 3OM1A 1XE3A 4R51A 2XKBA 4BC1A 5KNCD 1TL7C 1C0LA 1TA4A 3EAQA 4RKRA 1K97A 4GEGA 4BNJA 2X2EA 4US1R 1ZM3A 3BF8A 2AC7A 1IAQA 2HO4A 4QLOA 3THRA 3X1XA 5IWAB 2D2XA 3GHHA 4Z9YA 1KU6A 1SVNA 2PBZA 4LK3A 3GPIA 3V9PA 1CG6A 1OZFA 3GJ6A 4JU9A 1OIWA 4M1SA 1JLHA 3WLOA 1FNSA 1MT0A 4LBVA 3S1AA 4CN8A 1U5AA 5J3JA 4N76A 5JCXA 2B21A 4IS2A 1DC4A 4FS3A 4NEGA 2YIDA 2JHAA 2WJ3A 5C1DA 1E3LA 1QHYA 1BROA 4M9UA 3LLUA 4PHTA 3DCIA 2YVAA 1I6MA 4G89A 2WTMA 1YB5A 4KYTA 1CZLA 2FUG6 3U7QB 4TTJA 1XNGA 5E0OA 4G97A 3WKDA 2A9FA 5ITZA 2FA9A 3IVCA 1YQGA 4MQ6A 3M81A 2IGBA 1WXGA 1K92A 1PGNA 4H6WA 2MU1A 4I1RA 1J9ZA 2GA9A 1IAVA 4LCBA 3JARB 4B17A 5AW6A 4RSRA 1E9VA 2FPOA 4EB3A 2VP9A 3PGKA 3UB2A 5I48A 2J9ZB 3OE1A 2AK2A 1G3MA 1CUIA 1YI8A 1QZXA 3REQA 1XI2A 5C35A 1JXQA 1HTTA 1E4YA 1O96B 1WW8A 4NCJA 1P3DA 2PWAA 3FR7A 1U8FO 1XMVA 1NW3A 3PR2B 3NIDB 4ZI7A 1B8UA 4IVPA 4OEHA 2W4MA 4Y8VA 1C14A 2IPXA 1OD6A 2RB4A 3ZKAA 4DUGD 4KWHA 1W2WB 5JNTA 4EF6A 3V3KA 3N2GA 2HJVA 3MTGA 3OM9A 3WLKX 1OI4A 4G5QA 1E1LA 2CCJA 4RZHA 1O97D 4P5PA 4UFNA 4UAJA 4D57A 5A4JA 1DZIA 1SC4A 3QQ5A 5K99A 3DLHA 1PJLA 3VPGA 2DECA 2IU3A 2R7NA 4EHNA 1G0OA 2M2IA 3F71A 1T8PA 3QENA 4KW7A 3DE5X 3LAWA 2O07A 1KI1A 1BKYA 1OYWA 1QO9A 1V3UA 3X43A 3HFSA 1OASA 2HA7A 1SK8A 1UM9A 5AI5A 2IP4A 2JLUA 2XYGA 2VOJA 1EQAA 1ESCA 1JJVA 4OOEA 4NBKA 2JGRA 1TCAA 5JJKA 3AH8A 4KHPB 1FNNA 1NX6A 2PT5A 1SEPA 2FN7A 2EKQA 3C98A 5DW0A 3MB8A 1I7QB 4UD6A 2DPGA 2OFWA 2HCTA 1P44A 1Z62A 1IBSA 1P5HA 4E12A 1KMCA 4BWYA 1KC1A 2WE7A 3ELUA 2HFKA 1E1MA 2V98A 1GPAA 2D1QA 2I1VB 2I65A 3FCSB 3KXKA 2QZ4A 4L07A 4MAMA 1XZCA 4LDPA 1DCFA 4GF5A 4NV3A 3TSWA 1ENZA 4WOBA 3V4ZA 1U7DA 4XJXA 4MPJA 3CCCA 4YCSA 3P0EA 2X23A 3A26A 1X7WA 3KPWA 4CDRA 2CGEA 2EW8A 3OP4A 1Y1TA 4LCJA 5IF9A 3QMPA 3T4EA 4JBGA 3WWOA 1ZONA 4Q16A 4OK3A 5F2EA 1L4YA 5KQLA 3SBDA 2C4UA 4OP2A 2WWWA 2PRZA 5BMVF 5COQA 1A9QA 1MIHA 1ZI6A 2QJTA 4IDHA 4R1OA 2X6QA 4NCNA 1KETA 5ELMA 1Q1NA 1NUQA 3RYIA 1CUUA 3ZWXA 4DLYA 1AS0A 3E82A 4I08A 3RS3A 4LHZA 5KSYA 3TEJA 3WO1A 1XPJA 3NCHA 4IF6A 4I2NA 1OXUA 1TKCA 3C5VA 3K53A 4XB2A 4F3KA 1NASA 5AVYA 2B82A 1YF3A 2EKZA 2A84A 2FEWB 3QY9A 2C83A 1VKNA 3R5FA 5JI3E 3HXTA 4OJMX 1GV0A 5DBFA 5TPWA 5DHTA 1J5PA 3C3YA 3R76A 1I1HA 4MJLA 1NQVA 4IP0A 2KI5A 4JI6B 3H5AA 2ZRKA 3IAAA 3WQQA 4Z49A 3THYB 5JVDB 2GVZC 4RIGA 2FLVA 4Q7JB 5CVTA 4BP1A 5FHRA 2HQ1A 3K1AB 3QFTA 3QLVA 4G25A 4I6EA 5EGNA 4CM5A 3Q3VA 1BEUB 4DC0A 2YYZA 3ZHRA 3P4YA 2F3UA 5J4YA 1G8GA 2MYUA 4TZTA 2OO7A 1Y82A 3X1DA 3CZAA 3GEPA 4B6PA 5J58A 1C4XA 2BGNA 5EA2A 2OCXA 5IFKA 1E9CA 4EDFA 5BV8A 5L51A 4ETIA 4LZPA 3REOA 3INGA 3L04A 4YRZA 2ZBEA 5MGBA 4FEAA 1TT7A 5ED0A 5GOTA 2I8LA 1QFJA 4F9GA 5E0KB 5B2FA 3SWWA 3CEHA 4XRRA 3WMRA 1GKIA 1NYLA 2VHJA 4MS1A 1VI2A 4W7SA 3PSHA 3K7EA 3U4MA 2CD9A 2IF2A 1XXHA 4GOKA 1X1QA 1RWWA 3RSSA 4UMVA 4KVGA 2O59A 5K0FA 1MFZA 2VIIA 5FLEX 1XXLA 2TMKA 3A6FA 3C3DA 3HKEB 3L7NA 4JJ4A 4XLLA 4WNCA 3V4VB 4Z53A 1BMFD 1KY3A 1CZRA 1J8YF 1QWSA 3M6VA 4LMPA 1BXGB 2B94A 2XVZA 4ZAWA 1SKMA 4ECAA 1K6XA 1QQ7A 4YCBA 3OPYB 4P4SA 1O1YA 3TXXA 1MFPA 1GU0A 4B85A 1UPCA 3GJ0A 3L18A 3LFHA 2BTQB 2CBZA 5TS2A 3V00A 5JYBA 1GQ2A 3I1FA 2JLWA 2V9CA 5BVHB 4M1ZA 2VQSA 1YS1X 4CKYA 4E33A 5HSGA 4YP7A 2X4DA 3EQ9A 4U4AA 1D6NA 4J3NA 3D4BA 2M32A 4FJ2A 1EVLA 3PPVA 4AKHA 2QUIA 2FZ4A 5DZSA 3RREA 1NA5A 1U0NA 1W35A 1HA3A 2VNKA 3DXFA 3EULA 4X8LA 2BM8A 3LRTA 3B78A 1YUNA 4HEQA 3B9QA 2HQBA 4MKXA 4MUKA 3F9IA 3KDSE 3GAZA 4KXXA 4JYZA 3E9YA 3K72B 4ENRA 5L6LB 5E7IA 5HTOA 1YBMA 3IHLA 4L8GA 4WLVA 3GZNA 3TQHA 7YASA 3KQNA 3AR2A 3DOEA 3KOYA 2NPOA 4BVBA 1GQRA 4PV7A 4EHJA 3ORRA 2YYAA 3EIOA 4OREX 3GLFB 4ZV9A 3D0OA 4PG4A 4EY8A 4CIBA 2QJRA 3CSUA 3R0XA 4W9NA 4KV9A 3MS4A 3OM8A 1OFTA 1XL1A 4H7PA 2C88A 3TMKA 3T7RA 3CR7A 2P68A 3CVJA 1OBFO 1IHXA 4XEUA 3S5UA 2W42A 3R5TA 1JR3D 1PWXA 3BSFA 4TYWA 3Q3IA 1Z18A 4B6RA 4XM2A 5H16A 3UJDA 3A2LA 5IXJA 3D8HA 2R8XA 1MX3A 2DLDA 3RADC 2VDPB 3Q85A 3TIFA 3ZWOA 1NXWA 4R68A 4K3UA 1ATZA 1LQTA 3ETGA 4ZI3A 1P80A 4B6GA 2HMVA 3HZZA 1T4CB 1FNCA 3A9TA 3BXOA 2YJ6A 3IBGA 1TX4B 4M0FA 5AXDA 1P5RA 2Q7DA 4UMEA 2ERXA 2ZIXA 4N5DA 3SJUA 1QAOA 3H9EO 2C3UA 1OU0A 4KLNA 1RAIA 2JBHA 4PONA 1P1HA 4JB0A 4ZU3A 1WHTB 2O0JA 4KPUB 5A5DA 1XMXA 4UBIA 4JODA 3GQBA 5ENZA 1USWA 2AGVA 2V6MA 3DE3X 3G2IA 3JASB 1GPMA 2Q2VA 2HA6A 3UCXA 1C1HA 5C0OE 5AUNB 2CSUA 2IHKA 1GPUA 1EJBA 4EGJA 1FX1A 1MGOA 1G3UA 1A7AA 3LXXA 1GTSA 1Q1AA 3TVTA 4CIVA 4XVHA 3ZTWA 1TMKA 4F2PA 4BBPA 1KH3A 3SMVA 3QU7A 4H7EA 2GXAA 2G36A 2IX3A 4YP5A 4LJ4A 1SXQA 2VKTA 4GLLA 4RYDA 4HTFA 3P9QA 4GGPA 5GV7A 1QG4A 1XEXB 2HU7A 2Q5QA 3KM0A 2PSFA 3SJZA 1FDWA 3RB8A 1FCJA 3WOVA 1PNQA 5B3JC 3IUQA 1KYQA 4QHTA 4AMBA 2O2JA 2JVIA 2YWBA 2ZTVA 1SHTX 4RPLA 1JI0A 2CXHA 1T4CA 4DDMA 1WSWA 5KWIA 4P9NA 4UTXA 2PGIA 1IM2A 3E0QA 3ZY5A 2QPAA 3A6ZA 4O4IB 3AR4A 5JAUA 4D8XA 3LC2O 3LXMA 3UICA 3WSVA 3ZZTA 2G9QA 5ELLA 3N5CA 3DLTA 4PPNA 4OHFA 4U2KA 3NT2A 4K9RA 1N36B 3HN2A 4HAWA 1F1JA 3IDZA 1TYAE 3R7AA 1SHZA 2YQ5A 1M0EA 3T9BA 3W8NA 1UDXA 3KZCA 4X1YA 1N2GA 2QN6A 2ZYSA 2VRBA 2YWJA 4O3FA 3UB4A 1XWIA 1WULS 4I5EA 1EPUA 3GFTA 1T0HB 3U61B 4N1AA 5JNLA 5A4DA 1ORTA 2OEPA 3QX7A 1P4HA 4Q1BA 5CG1A 1H05A 2KE5A 2Y99A 4Q48A 1JG4A 4J1NA 2QTRA 2WHQA 4J76A 1EVKA 4LQDA 1XEXA 4DTIA 3V7NA 3D5QA 1SCIA 1H2EA 2QG4A 3H2IA 4YJ3A 5IAAA 4FOLA 4YJHA 1TF2A 4IH9A 2PKYX 3CZQA 3F2IA 4LZWA 4E09A 2QLBA 2OLEA 5CT5A 1T8TA 4BMVA 1FSSA 1KVTA 2QJWA 3M9XA 4Y1GA 1E1QD 3Q8XB 4DC9A 3H5NA 1EK2A 1LTHR 1GUFA 1MTZA 1Y3HA 2NTVA 1J8MF 3FCXA 4N5IX 2I91A 1GXSA 4RHEA 2YS7A 4QDTA 2XDYA 5TNXA 2C4HA 2E3JA 4K9SA 3PQ5A 5GIOE 3JD3A 1MO3A 1MU0A 3SIXA 1X7HA 5I51A 3EXHA 2J9GA 2C5HA 1IJKA 4C3OB 3N8HA 3OMXA 3C6ZA 2PX6A 4ALNA 3IVRA 4B0PA 1ZJYA 1JHMA 2ZDQA 4UBLA 5AKHA 4FDUA 2JHCA 1RM0A 3MJEA 3RAGA 5JZMA 3WIEA 2MYPA 5KTOA 3FZGA 4CDMA 3PNPA 1COWD 1P73A 2IOHA 4J0CA 2HL6A 3FIJA 4F97A 1DV1A 3QQPA 5JATA 2HIGA 2QMUA 3H04A 2OGTA 3LL7A 4AB1A 2I3BA 3MT8A 4UNQA 3UBTA 3MYYA 1L3IA 2X1HA 3GRAA 1BKSB 1JGTA 1RNLA 3IQDB 3WYAA 4F86A 2OCAA 1I30A 1UAAA 1A5SB 1D6JA 4BBZA 2TMYA 1GTMA 4KGZA 1YZLA 2ZZNA 1AH2A 2V7GA 1NMEA 5EXEA 3LCCA 1GXSB 1P1BA 4KN9S 4NYMQ 3TPCA 2C59A 5C5IA 4IY1A 3IPYA 5KSOA 4K87A 2BAGA 3SIRA 5E1MA 5BN1A 4LZZA 4HJRA 1TYEB 3E15A 3W1WA 4ALKA 1DB3A 2ZTMA 1Z7YA 2VYVA 1CUJA 4E3ZA 4F04A 5AM4A 1F9AA 4EL5A 1ACJA 1JHOA 3RD5A 1QE5A 1WDLA 2OHFA 1Z28A 3OZUA 4UVHA 2WP0A 4JC5A 4OM7A 5FOSA 4KWCA 3P4XA 1ZCBA 1RMTA 1Y4DE 3SQDA 3WAKA 4G5YA 4J94A 1W88B 4GYKA 5B4TA 1EGVB 3PHHA 4UCXA 1OX6A 3PFWO 5TB5A 3E7FA 3V4LA 1HDEA 1SKQA 1XVLA 5KNCH 3PE6A 4DV0B 5GM2A 5ALUA 1FRVA 4AZ3A 3TQFA 3UQZA 1EDDA 2UDPA 1FX0B 1N5IA 3GBSA 4JBHA 4LVUA 3I5AA 3JWPA 2XUKA 5TPZA 3RVBA 5DOZA 1EVIA 2PQ6A 3X1MA 1AKUA 1MQAA 2BFMA 3Q7QA 4KBGA 3TPFA 1OFUX 4JVOA 2LR0A 4OH7A 1Z83A 2BR3A 5AW4A 2CLCX 1L3BA 1JEJA 4CM8B 2HF2A 4H59A 4MYTA 1QF6A 3P9KA 1AZSC 2O7RA 1FP2A 2I9KA 3TL6A 2EEZA 4EF4A 3OZBA 1P60A 4ENWA 4C7OA 1M2HA 4H4CA 1R74A 2IEDA 4MROA 2J5BA 2JFXA 2Q41A 2C99A 2HIHA 1BYUA 1P4RA 2RGNA 1XCBA 3NHLA 4PGGA 4RJIA 3W8DA 4D41A 4ZJPA 1JAYA 3OA0A 2WU4A 2VTBB 1JR3A 2Z6UA 1XV5A 5SZIA 3VI4B 3WS7A 2NO9A 4D6YA 3KQHA 3JQFC 1JLLB 1U0SY 3OFKA 2GBIA 3C6YA 4JJ7A 4CMAA 1DBSA 1JQBA 1VB3A 1C7ZA 3BFJA 3IHWA 1KAQA 2QXTA 4TMYA 5D5QA 4X1IB 1N6PA 2EYQA 2G09A 3JV7A 3KQMA 1NATA 1DBIA 3JCZA 1TTPB 1XA0A 1ZUNA 5ICEA 1ULBA 1VQ1A 2HPAA 1YQDA 1SCNE 4MLCA 5IJ0B 4MWTA 1L4EA 3DE1X 3I9KA 3D2BA 5K8CA 8ABPA 1SXJA 2J08A 4UXIA 3MUOA 4IRXA 4WZBA 4NBTA 5AHOA 5LA6A 2G0NA 4G1MB 3R7BA 1IOWA 1LW6E 2PKQO 4PF1A 2WK1A 2HUPA 3I32A 4EW1A 4Z1MD 1QP4A 1XYYA 1M8GA 2WWXA 1FF9A 3UCFA 3ADKA 3T9EA 2OCIA 4CM8A 3UAXA 1S96A 4O6VA 5ADVA 2ORVA 5EIXA 3EIWA 4K6KA 4M54A 1VG0B 3G17A 2Q27A 1A4RA 3L8DA 1YJXA 2XRMA 4CM1A 5EWJB 4J0QA 1P9LA 1UOPA 2Y1CA 3QXCA 1UIMA 4LJAA 3AU9A 4R2LA 1V8OA 3UAYA 4MVJG 5C7LO 2I6UA 2RH8A 3IQEA 2GN9A 1UWVA 2KLBA 2OENG 3RSZA 3IILA 3BAFA 4MDHA 4BX3A 2CNNA 4CKCA 5FT9A 1PK9A 2QMZA 3RFFA 4C4YA 4B1FA 5H02A 1H42A 4X1IA 3OU6A 3BC1A 3QLVC 3NTLA 4CMIA 4AQ7A 4O0MA 2Q5CA 4EHLA 2JIZA 4IL5A 4O8CA 4PLZA 1WPXA 4NNJA 4DLXA 3TLYA 4ZYUA 3L8MA 3BD6A 3O1LA 4CKWB 4WVFA 1YQ9A 2IS2A 3I05A 3P97A 5BRNA 1IY1A 3M70A 2DGDA 3HA3A 1H6BA 1Q16A 4MB6A 2GTPA 1RXSA 5GVSA 4TQGA 2FW0A 4DNOA 1WOMA 4GLJA 3BWEA 1WD7A 4LFAB 2JEZA 1FXWA 3T61A 5EHXA 1PKXA 1YRQA 5ITSA 1F1BA 2OD2A 5CU7A 4WZ6A 3CE9A 4H7FA 1YZHA 1U7OA 3HV2A 4EQ6B 4IJWA 5BN3B 1T26A 4EMUA 1LDYA 5BV1A 1CJUC 4MWBA 2D2IA 1SOUA 4PXAA 1VMAA 1DKOA 4XM0A 3ZI7A 1QORA 1RSZA 1UADA 2GAAA 1CEEA 4KR9A 2IH5A 2YHAA 3ILYA 4UVGA 4OQMA 1E3QA 4FE7A 2FPPB 3LQKA 1JMVA 4KFCA 2R1VA 4G9EA 1EFKA 1RVV1 3C8ZA 2ZUSA 4DYDA 1IHUA 1GZVA 4FW9A 4C6SA 1HFEL 2ODPA 3AB3A 1V25A 4B3BA 2NTJA 1Y9ZA 3JR3A 3EW9A 3BF7A 5AI9A 3O3OB 5TMBA 1M8PA 2B98A 2JAUA 4NBVA 1CFJA 2HNKA 3E3OA 2IEGA 3HY3A 4MKZA 1A1SA 3RBVA 4DLTA 5L4NA 4EQZA 3IYLW 1ECPA 4Q3NA 2GSDA 3ITEA 4QUAA 4TRMA 3FLMA 2QRUA 4OMCA 5F64A 1T4BA 5SYAA 2JI9A 4A0SA 1EFUA 4URXR 1VBKA 4A0RA 3EPHA 2JCGA 2MWMA 2WWRA 1P1KA 2Q8PA 4HNQA 2VDKB 1RAEA 3K4HA 4HFMA 1ILEA 2WMNB 3ZBUA 3ONNA 4X1KA 1KKLA 5E4TA 2RHBA 3LZCA 1G60A 2OLKA 5JARA 3HDQA 4E1VA 1NKSA 4CCYB 4ZHQA 1E4VA 4M8IA 3VZSA 4P3YA 1QNFA 2WD7A 3O8DA 4HNUA 1V1MA 4GI5A 2FG7C 2XGSA 3QTLA 4TM8A 1W46A 4FEYA 4XDGA 3TRDA 4CMEC 1IXKA 1I01A 4EG8A 4ESHA 1GRQA 3A4YA 2SHKA 3C3WA 1E2UA 4XVCA 1GZ6A 3T7AA 4IIBA 4WEQA 5JYEA 2RIRA 2MCFA 4LF8B 5LQDA 3B89A 3FFWA 3WSTA 5CXQA 5SY6A 1YFLA 3KTOA 1Z4JA 2PHZA 2WHYA 3D6VA 3FRJA 4US2R 1NQTA 2QUHA 3R6TA 4I81A 4K46A 1J90A 1XNQB 3WGNA 3QSYA 1LBEA 3TSOA 5MN4A 1A77A 3I58A 4YRCA 1TZKA 3EF3A 2Q3MA 5LR6A 3RC9A 1RPTA 1WUTA 1UAGA 3FXAA 3MAAC 4HADA 3ZVRA 2WKPA 3TGLA 1CJSA 1H4SA 4OATA 1R8JA 2NIPA 1LI4A 4AK9A 1LU9A 3I92A 2ZBFA 2PWZA 3DPUA 1K6EA 1XU4A 2YFYA 3M5PA 6YASA 4PZPA 3H1PA 2PXXA 4QTXA 2VSXA 4UBMA 3SBOA 3QX3A 1ODLA 5DHQA 4QDOA 4UOEA 2C95A 3NHFA 3GGGA 3ONVA 5JC1A 3HMKA 3FROA 5K45A 3DC2A 3ER8A 4PQEA 2IBSA 3AERB 4RVDA 1CUGA 4OGLA 1JIXA 1ND5A 2AFIB 1F06A 2F9FA 4U00A 3U31A 3ZE6A 3WA7A 3JAMA 4YNBA 4M8LA 3W8EA 1GG5A 3QNMA 4OGFA 3FDXA 1IXYA 1V4NA 3EGDB 3FOBA 3O73A 1EB9A 4A6PA 4J75A 3HJBA 2O2GA 2GFIA 3VNRA 3T15A 1YHNA 1ZW1A 4ZOLA 1CEQA 4KQHA 4EUNA 1NIJA 2V3VA 2AJCA 1HSOA 2QMEA 3DHWC 3INTA 4P8RA 4R9RA 3THSA 3UAVA 5CA1F 1RKBA 2DY0A 2IPOA 1ZNYA 1EI9A 1L5OA 1UUFA 3BRSA 3R41A 4GLBA 3RYFA 3W6ZA 4EYEA 2FX3A 4G36A 5EIAA 2OQRA 3O31A 3Q8KA 3CX7A 4AG3A 4JZKA 4NBNA 2IGTA 2XMSA 3ET5A 1A4IA 3EQ2A 4XVQA 1QLWA 2JFWA 4NBWA 3KZKA 2J5XA 4R01A 3EGXB 4OFZA 3WNVA 4BNMA 1UPTA 5A9SB 1XR3A 3QLUC 1N1DA 1OWOA 2YMPA 3ORSA 3VZPA 1EVYA 3PWZA 5AICA 4WE3A 1NV8A 1ISJA 3DZGA 3HBMA 3KXIA 5DN6A 3STHA 1D4ZA 1QP0A 4UEJA 1IMJA 1L8QA 1GDHA 1FMTA 1YB4A 3LUHA 1Q5PA 3AERA 1BD4A 1LPNA 2BFCA 5AT1A 1PUIA 4Q47A 3OJXA 2FPGB 3F8SA 4GICA 3GR6A 3HY4A 2PMCA 3WKCA 2R8OA 1HDCA 4DUPA 5EJ8A 4JLBA 1JSZA 3ILXA 3KWFA 3N39C 4GXQA 1MPXA 5HIIA 1L7RA 4CEHA 2ECOA 2ZAOA 2YJ3A 4FFLA 4YAKA 2AJ8A 2I66A 2C61A 1G8YA 1I7PA 4CKEB 3SSAA 3BTOA 3ZE1B 4CODB 4ZDIA 1D1SA 4HLNA 4BE4A 2I0FA 3V8BA 5JMPA 3V42A 3BMCA 5BRJA 4D3DA 1BGXT 1BTOA 2G8NA 2W6CX 3DEFA 3EEBA 2P9JA 4JT4A 4RH1A 1A9XA 5JDCC 3E3NA 3WRXC 2PO5A 2BFDA 3H42B 3QPBA 1E6EA 2QSJA 4L8WB 1YJ5A 1AV7A 1KI8A 1PJ3A 3U60B 1DKLA 3S29A 4DIKA 3HKDB 3BS4A 3OECA 2JS7A 3ZUPA 1ICEA 5LP6C 2PVPA 2UYCA 1RRVA 3MM4A 4NMLA 5DP2A 2MT9A 2A1UB 1H2WA 2C92A 4AF6A 2BMEA 2WOJA 1H65A 3NAGA 2H1SA 1I7SB 1IU9A 3UAZA 4XTRA 1H6DA 5EWLA 5KDOA 1QIMA 3FUCA 1ZISA 2C9YA 2J9XB 4TMTA 4EYOA 2B1GA 4DB4A 3ROZA 2V7EA 3FVTA 2JIZD 1AT1A 2FZVA 2PEZA 3AP2A 3EDYA 4J16C 1I32A 2EU8A 3PC7A 5EGSA 3B52X 3BGOS 4LF5B 1JB9A 4BP9A 3AEUA 4NICA 4XPIA 1PYOA 1QIGA 2DPHA 1VGVA 1QBGA 2VHZA 3U9LA 3KVYA 2ON6A 5DCLA 2V96A 4MPTA 4XCVA 5FBHA 4C7XA 1ZN7A 5TDHA 5FIUA 5CDFE 3TFOA 2V0GA 1CUYA 1CFZA 1UZNA 4AKIA 1QQTA 3R5SA 4L74A 3OD5A 1FFHA 5I8PA 3DZJA 3GP3A 3BHNA 5DHFA 5JSZA 1ATIA 3D0RA 3VC7A 3DMRA 1Z2AA 5IK2A 1Y34E 4DNPA 2DQ4A 2FG5A 4J7AA 3T3GA 2GD2A 3AJEA 2DTXA 3G2HA 1E7QA 3QJ5A 3VHXB 3PX7A 3LBHA 4CRWB 3GARA 1H2HA 1NVWQ 1YU9A 3Q41A 2VS1A 5AHWA 1J07A 2NVWA 2MSCB 1EMDA 2PIAA 3H6KA 3OQPA 1WV1A 4KFRA 5TMEA 1N5JA 5B53A 3V7WA 4BVLA 1E61A 1N6RA 1K8RA 4ZQBA 3UGQA 3CJRA 1G4HA 2C1EA 2ZE8A 1G7SA 4PYRA 1G8PA 1Z17A 5A5GA 2WSSA 3G2LA 3INNA 1EFTA 4A8JB 4AMGA 4GL2A 1X1CA 1YKFA 5ESXA 5M5BA 5CCEA 4DA6A 5J59A 2OK7A 1NYQA 1MIOB 3N3BC 2YVUA 5JY6A 2JLVA 1J0BA 3BFKA 3GUZA 1ECJA 4R2IA 3WLRA 4GX0A 1FTYA 2GK3A 1VPTA 2VXYA 3FWHA 4UHDA 3AHIA 3VR4D 4AO7A 1V41E 3GP5A 1Z7WA 3HXLA 2XOEA 3IEPA 1DC8A 1ZP6A 4QRDA 2NXNA 4QSHA 3VNSA 1FP7A 6NULA 1XAIA 2WT8A 4FKBA 4IIVA 3TRFA 3F47A 4JVMA 3RIYA 1XO1A 5AIAA 1PWZA 3RHZA 3V1TC 4M3NA 1P33A 4FFMA 4HNTA 2AKAB 4HYTA 3IAEA 5JS2A 4ZEVA 4PVCA 4IIJF 4KI0A 4S3MA 5FOTA 1WKCA 1E8MA 3QVWA 4LTNA 2LD4A 4Q66C 4DV2B 1EA7A 1K86A 4J2OA 2P67A 5EIOA 1UJMA 2CMFA 3FCYA 1QO0A 1G2PA 3LS2A 5G53C 4BU0A 3LOPA 5GM1A 4FB4A 2XCLA 4HS4A 4DS3A 1IATA 3IV9A 5JZBA 3FOCA 3DUFA 1MC5A 1PGQA 1Z12A 3BMNA 3LDFA 3E5HA 4JFAA 1YGPA 5D8DA 3DBLB 1GIAA 4HB0A 4F3TA 1JHUA 5I6DA 1GOTA 3B6KA 3GLIE 4GXTA 4WFIA 2F8TA 5AOCA 2PLAA 3AHEA 3PK0A 1TQ6A 3T9DA 3HSSA 3W5DA 3F1KA 4UEQA 5FEUA 2EIHA 1HLGA 5ALZA 4I4TA 1M10A 3SVTA 4TXHA 3TLCA 3OEHD 3TVDA 3T7SA 1KJWA 3UJHA 5C8ZA 1PJ4A 4KO8A 3RVDA 3ZU3A 2PXCA 1SWWA 3L92A 4WIAA 5JFOA 1RQPA 5D3QA 4DG9A 2FR0A 1ORHA 3TG8A 4MWGA 3EX7C 2VJDA 1DAFA 3NWBA 3NNSA 2HWUA 1DRUA 2D0OB 1OFUA 4RK1A 2OMKA 4DIOA 4TMXA 4HQ6A 5FEMA 1N0IA 3HSKA 4IOJA 3IP5A 3D8TA 4RWZA 3UV6A 1RIFA 2D0IA 3OVMA 4QOFA 5CW2A 3A1TA 4KYVA 5DGCA 1JQAA 2BFAA 1Q21A 1LBQA 1YZNA 3QLJA 1L6IA 2W4QA 4MNTA 3WL3A 4TV8B 4B35A 3HL4A 2YOGA 1OGJA 1J8DA 1N9KA 3GEHA 2KBEA 3H0EA 5EUCA 5JCOA 5CA1A 1RWPA 3IXLA 3QK7A 2EFJA 1EFRD 1BCSA 4NG4A 4QQRA 4BLPA 2VNIA 1OXXK 5FUYA 4XGKA 3RU3A 4P36A 5FX2A 1Q0SA 2QQ0A 4MVJH 4X8OA 3JSXA 1G5TA 3A1WA 3WHLA 5JADA 4M86A 2EDCA 1EXVA 1F2TB 5CYOA 1B6RA 4LYHA 4H08A 3TUIC 1HF3A 2CBGA 2JJ8A 1GGEA 3W79A 5E4YA 3VU1A 1TCUA 4BNHA 3AZQA 3KZ1E 1GTRA 2BIFA 2XOKD 2VUUA 1TUBB 5H59A 1A5AB 5TJHA 4CF3A 2AZXA 1A0OA 1VIYA 1ZUWA 1QOZA 3UWOA 4D3SA 1DO0A 4GPIB 3LO8A 4YROA 4BATA 2W2LA 4KREA 3DWFA 1UBHS 1KVQA 3PEUA 1MO2A 2MTBA 4M7OA 5EZ5A 3BHIA 3NHWA 1VMKA 1Q1QA 5K4GA 1IBMB 5FPTA 4Y9RA 3ER9A 1YBHA 2CN1A 2D8AA 3WLEA 5FCDA 2Z5LA 5EWMA 5JPCA 1D1PA 1HUQA 2XUGA 5EMLA 5EHZA 4AN0A 4F3RA 4Q7EA 4AJLA 3K1TA 2AOUA 1Y9AA 5AYVA 3D8RA 1XZPA 3C6QA 3EYWA 1XZDA 3KDPA 1WY5A 4IZHA 2WWVD 2XZLA 1EUDA 2XEXA 3TL2A 1Y33E 1ZSYA 1HG1A 4YRSA 1GNSA 2YFHA 3OJOA 3FUXA 5FAXA 4DCVA 1C3JA 1W5BA 2V7WA 2OCYC 2VP0A 2YXBA 2IHZA 3QJYA 3KLMX 4I55A 1PJRA 1V45E 4L73A 2ABWA 1L7EA 5MF6A 4PSDA 1TU4A 1XZKA 4QEDA 3GF4A 4QJ4A 2E85A 1NBEA 3GMDA 4JP2A 1KDVA 3PUJA 3SX2A 1DX4A 2DHEA 4IV5A 5CLFA 3O8QA 2LNDA 2H1FA 4MS3A 4QDXA 1VBNA 2DBRA 2QLLA 4EHHA 4KSCA 3X1KA 5FLYA 4U7HA 1PL8A 3BGWA 3U26A 4XWTA 4XCXA 1LPSA 4JP5A 3KEFA 2H06A 3GA0A 5ICCA 1NQUA 3TW8A 5C8VA 3G49A 1KPIA 2YW2A 3FLEA 3BJEA 3I64A 1GAXA 3C3CA 2FVYA 4BAUA 1RI3A 1UWLA 5CVVA 1Y3DE 3C4VA 2H59A 3HB7A 3P52A 2CVZA 1H3FA 1TMYA 5TT0A 1ENOA 4ZYTA 4Z0TA 5EZYF 3ZV7A 4O4LA 3AY7A 1V8BA 2KM1A 2P69A 1GD1O 2B6HA 2TECE 4F92B 1P1RA 1M66A 1VYHA 3BXXA 4UM8B 5BR8B 5KYXB 4N65A 1MZVA 1D4FA 1TJNA 2J07A 2PFSA 4DCSA 2XNKA 4H6PA 5A0FA 5CT8A 2AG8A 2DC1A 2FMKA 1JPVA 5CVUA 3VPFA 4RADA 4ZVRA 5LZ8A 1UDCA 2QX9A 2EBFX 3ABOB 4KXLA 4B2IA 1H2AS 2AF3C 2CLMB 3QE2A 5IH3A 3OZWA 1RYNA 3ODPA 4KN6A 5IZCA 4M0UA 4ZICA 1REQB 4G1FA 4ZMSA 5SZKB 2PJDA 4ALJA 5I7RA 2ZB2A 5F4BA 3WZLA 1C1YA 1RAFA 4WINA 2FSPA 4R9SA 4MUFA 4JMPA 1T3HA 1W49A 1Y1LA 3PQ2A 4O5OA 4Q4JB 2EW2A 3WDLA 4G8JA 1FMLA 4NECA 8ATCA 5BYKA 3ELWA 4HNVA 2I1WA 4YMUA 3CPEA 2WVAA 5KNLA 1FMCA 4BKQA 4XRGA 5KBYA 1U1EA 1JDZA 4L5BA 1JU3A 1T25A 1TU0A 2Z43A 1LB1B 4E2FA 4RJKA 2WJVA 4I1VA 3I01M 1ODJA 3DG9A 3NHMA 4PO1A 3LK7A 3UYLA 4ARUA 4PIMA 4F2WA 1VCMA 4HB4A 1R37A 2IZZA 4IJ6A 1JHAA 4WN9A 3FAZA 3QV2A 4DLSA 2GLTA 4K6HA 4G85A 3LW7A 1JIUA 4NU0A 3L8HA 4FCCA 4IIEA 1UXHA 1JG7A 2E82A 4FNOA 1VE1A 4OUDA 4ALLA 2ZIAA 1U1GA 3H7IA 2MSLA 3R0ZA 4GP7A 1XOIA 2XWPA 1RJ9A 3RJTA 3IKTA 3CZRA 1PJCA 3SC2B 1T9KA 2FAXA 2Y6UA 2O8EB 2ZRQA 3KHSA 2X4IA 3GV0A 4OHUA 3R7WA 1ZXXA 3V1NA 4B82A 5CFNA 1K8YB 1RQRA 1ZCFA 3NDPA 2XOXA 3GT7A 3L9XA 3MBKA 3GD7A 5DYNA 3L46A 2PBRA 2Q29A 2XGGA 3IIJA 3O8BA 2FPSA 1TO2E 2D5IA 1ST3A 1PBTA 3ASZA 3DE0X 1YIDA 1U7TA 2VDMB 1XVUA 1DEHA 1INLA 3OQ1A 1JXOA 2YHIA 3JRWA 4RXUA 5ERGB 4KVZA 2A2ZA 5AVJA 4C0SA 4DLPA 5LVAA 2HGSA 3PNQA 2AI3A 3PUKA 4HS9A 1I51A 1VHWA 3QPAA 4MW4A 4MW6A 5TY0A 3R75A 3WMWA 4L9SA 1GKUB 1GKYA 4B6SA 3PNBA 2AC2A 3EGOA 2Q45A 3AFNA 4L2IA 5F7XA 4V0KA 2HPZA 1R2QA 4M1TA 4R54A 3I9FA 4D96A 3MHTA 2XUOA 3GUUA 2J0SA 1VCOA 5CIWA 2GD6A 1I2MA 2C5LA 3AEQA 3L7CA 4UNNA 4YQEA 4MUMA 2HJHA 5C8DA 1RQXA 1V6SA 2ALJA 1JDUA 1KMIY 1ODIA 1V16B 2ORWA 2W00A 3NEYA 3NWPA 1WCWA 4LEIA 4DMCA 3THYA 2MMCA 4A5SA 3BUSA 3SC2A 2QU7A 2Y2VA 4WJKB 4E14A 1T0BA 2GCGA 4YT5A 4ISCA 3R7WB 4P33A 4UJ5A 3ZW8A 3NBKA 1SBYA 3A7EA 5EIBC 3DZCA 3FDJA 4I9UA 3VH1A 2AD1A 2VT7A 2ZKLA 3KALA 3N2GB 3CONA 5EE1A 3ZDFA 4D25A 3LQ2A 2EGGA 3TLXA 3UW1A 2I4TA 2PKWA 3VOTA 1LSUA 4AY5A 1PG0A 2ZJ3A 2Y2UA 2W58A 2ORYA 3CNEA 3LT0A 1EFRA 3OTQA 2ZIUB 1UT8A 4JR1A 2HK9A 4NK4A 2OXTA 3WK5A 4B4KA 1PJ2A 3FLBA 2P9BA 1KFEB 4ZGBA 4AU1A 2JEYA 2J0QA 4PCLA 1OVGA 4P92A 2XTNA 5BV0A 3OZAA 3A4TA 3G89A 5ALXA 3FNIA 4EZIA 3G1UA 5AR1A 3W34A 1XIVA 2JFPA 9LDTA 1Z25A 4R1PA 5GZ6A 1V43A 5BN4A 3FKQA 2I8CA 3COZA 2W2TA 3C8UA 3KR1A 3TD6A 1L7QA 2QXUA 4DCJA 1DQSA 4XR4A 3RE1A 1KK2A 1LK5A 4BNKA 3G0CA 3EXG2 1T2CA 4YRFA 4ZJUA 3IAS1 4FN4A 4EVIA 3R23A 3Q10A 2ZBRA 2PKRA 5DP1A 5BN5B 1FUUA 3NP9A 3ZU4A 5J47A 4J8PA 1XDSA 1LBHA 2JARA 4X65B 1QZZA 4LHYA 1KYTA 2JJQA 4GZLA 2Z5GA 2ZK7A 1CRWG 3N2IA 3P9XA 3O8CA 1I14A 3BGIA 3QXHA 4F12A 4MQBA 1FYFA 4D9EA 4CLHA 1BH2A 1ISRA 1SY7A 4PLHA 1NU8A 4MHSA 4Q1CA 3SMQA 4CG3A 4ZJZA 4AS1A 1F2UB 1SOWA 2KSQA 2ZRGA 3DQPA 4GR9A 3KKNA 1OCEA 2BP7A 3EOBI 4CV3A 4D9MA 5J4KA 1UKEA 3ZOZA 1FJHA 1ZIDA 1SD5A 3UV7A 3H2HA 2VZLA 2XAUA 3OT1A 2QP3A 2UZ1A 4V1CI 4A8HA 3P8ZA 4B81A 2CXUA 3TOSA 4Q34A 4HQKA 1S2MA 1K2WA 2XCTB 5HUHA 1OH6A 2CLLB 4FT4A 4BV2A 2IS4A 3EVGA 1Z4IA 4OQZA 4OQ4A 3PUZA 3RHTA 2OZLA 3OIDA 2X5KO 1TPZA 2IE0A 4Z9XA 3WNZA 2Q4TA 5FUBA 5I7VA 2AZTA 1MB2A 1D2RA 5T5QA 3CLVA 2HLHA 4MLPA 2YIJA 2IW1A 1U90A 2Q3FA 4FUQA 4BVEA 3TGPA 2VJPA 2D5LA 3QZUA 4NEHB 1WXHA 3LQQA 3KAJA 1ZH6A 3T3EA 2OG1A 3PENA 1KY2A 1D2AA 1U2GA 1EAMA 2DCUA 2QTVB 2V7QD 3Q9LA 2XYHA 3A70A 2BFEA 1RKVA 3ASUA 3IBYA 1KJ8A 3W5JA 2AG5A 1YB7A 4IDPA 4F4CA 2WT9A 2CE2X 4BV8A 4BNFA 4CHGA 1MHTA 4TYQA 1C7JA 4DTCA 2HQRA 1WD5A 2QPLA 2QW1A 3ICPA 1B23P 5F1KA 4KUGA 4GMHA 2HXGA 3LD9A 4OLJA 1UP4A 1CZOA 2IIQA 3GH1A 5FTJA 3GQBB 1QK3A 1Y5IA 3LQRA 4JWKA 3VOBA 3E3MA 2QORA 2VSNA 4RLHA 3ANTA 5JXIA 2ZSEA 3JASA 3A3OA 1QRAA 2E4WA 3D59A 3L82B 4PIPA 3SHQA 3OSUA 1E5DA 4ARAA 5M04A 4N47A 1N5RA 2YMLA 2ADMA 2CB9A 1ZK2A 3DLAA 3TTUA 4ZXPA 2EAUA 3WK4A 3CN7A 5DN9A 4AXBA 4DYHA 4DADA 1CLUA 1Q11A 3E6AA 2WB4A 4OP1A 5JNSA 2W6IA 3BG5A 1M6WA 4MYDA 4ACAA 2VJNA 2W6MA 2V3CC 1PD0A 3OPYA 1NVTA 4P4SB 5KYUB 3PUYA 1V3TA 2WHEA 4MWEA 3VTAA 4CIDA 3EA4A 2BTQA 2GUGA 3LY9A 3AW9A 4MDEA 1DLJA 3PNOA 3PFIA 1MKYA 2QLMA 4YJDA 3SX0A 5K51A 5FADA 1JSXA 4E03A 2EP8A 3LT2A 3WL5A 1C0PA 5LL6P 4ALMA 4AJPA 3KJIA 3N59A 4B45A 4EJSA 3L8EA 5F3DA 2JD1A 1NVGA 3VH4A 1MJFA 3AF0A 1C41A 5I9IA 2QR2A 1FFEA 2QLFA 4A1FA 1CNFA 4PLPA 2JI4A 3V80A 1FP4A 1N3IA 2F90A 3EK2A 4D8YA 4BGDA 4LJRA 4WJLA 3DDOA 4F06A 4ZHQF 3W7BA 1VP3A 3PNSA 1WPQA 3Q3CA 1HY3A 2XB8A 2WVGA 4YJKA 1IVNA 4H16A 1KMMA 3G9XA 1GAJA 1U7PA 1CRQA 2I6FA 2X6RA 2ZWPA 4GM0A 3GLSA 4J4HA 5E4JA 5CA0B 1NJ1A 4HBGA 4FZVA 3HXQA 1I7NA 1JLSA 3PLRA 4GKVA 3TH5A 2NZWA 3KTAA 3D6TB 4Q1AA 4ABTA 5T64A 4YCJA 1IRIA 5L3SA 1RXIA 2IZ1A 3EG5A 1NVMB 4LWPA 2P0AA 4HSEA 1ZKDA 4R0NA 3U7HB 1N6HA 1N1MA 4UUQA 4OI1A 5I01A 4Q4AA 4CL2A 1O6FA 2JGIA 1Y7IA 3SD7A 4C5BA 3E1KA 1QR6A 4PYJA 1KIFA 3BM5A 3QEOA 5JMWA 3WXMA 2BGJA 2HZ7A 3KWMA 1NPYA 1TKAA 1W5SA 1QUFA 1VPWA 4ARIA 1OB2A 1T6BY 1OXKB 1NI4B 1E1DA 1Z73A 1ZS9A 1W0JA 1YBVA 3KU1A 2ZRIA 3RVLA 4JJKA 2YV2A 2VPIA 3B5EA 3HLKA 1L4MA 2ZUUA 1JQJC 4Q1DA 5D51S 2IEBA 2NU8A 4DV7B 1VTKA 1X38A 3LIPA 4NFSA 2BZSA 1KAEA 4X95A 6AT1A 2YQ4A 1QYXA 1SH7A 3I76A 3V1KA 2W2VA 4TMFA 3A11A 3LPNA 3FNFA 1LBTA 5D3ZA 1DX6A 5I9SA 2VWQA 2BUCA 3MMZA 2DZDA 2QRPA 3DKPA 3G82C 3O4VA 5AVZA 2Q2OA 5L3VA 5F2KA 2I22A 5JPIA 4YQFA 4G0VA 1EVJA 4QBGB 1E99A 4XOUA 1AQ6A 4XOIA 4D6XA 2XXAA 4GQBA 1YZ3A 4ZCLA 4DL9A 4G3XA 2BTEA 4XD2A 1ZA1A 1QKJA 4JH0A 1I4DD 5C53B 1Y81A 4OJYA 4V39A 3PDHA 5HZMA 2PVSA 1B8NA 5EAIA 2QBYB 3SJBA 3JQCA 2GB4A 4ZIRA 5BPHA 3K35A 2YHUA 4UTVA 2EW1A 2PZKA 4LV5B 3IUYA 4LS3A 1JXMA 1L1QA 4QHSA 4HLUA 4D8VA 1JLKA 3RKRA 1IE3A 4PX5A 4FYWA 4RY8A 4ZAGA 4E4TA 1WABA 2ZB4A 3I4FA 1CK4A 1LV7A 4FDTA 4PM4A 3HWRA 4MVWA 3IP1A 5EN4A 2DPMA 4X1OA 1YA4A 2QNRA 3PTZA 2NU8B 2N1MA 3TTYA 1Y1QA 5IEBA 3ZIAA 4E94A 8LDHA 3O92A 1TQ2A 4Z1MA 2M9MA 5JVDF 4BAGA 1MXHA 1NNUA 4U39A 3C3MA 1ZMBA 2FLWA 2P1ZA 2VRNA 5TSDA 3RF7A 1YR9A 3HDTA 1NMSA 3GVXA 4I8IA 4YDQA 1EIWA 4DANA 1H1DA 2OK8A 1GDTA 3L8CA 4QAJA 1K8XB 4Z4IA 3JQ9A 1YUBA 1KR5A 4LNAA 4OVKA 4NZMA 3JQ7B 3U39A 3B1KA 3KSRA 3TKAA 3ZJUA 4UNSA 4W6QA 3GP8A 1DHTA 4F85A 4XSGA 2ZJBA 3QBEA 1IN8A 3ANMA 1XJQA 1YR2A 2REBA 3B7WA 1SXJE 2IW3A 2PO7A 3NNNA 4WZBE 4OX9Y 5D00A 1H1TA 2GN8A 3UOAB 2Z4TA 1UDAA 4IFTA 2G06A 4K40A 1HQYE 1U8XX 5KYKA 1IEWA 4NABA 2C5FA 2BEUA 1IBCA 2OP1A 2VQEB 2Q0QA 1RLJA 5DFAA 3G0IA 2QK4A 4DARA 4EYGA 2FOIA 4CV0A 1UBEA 2KYRA 2G5TA 4CEIB 2O8VA 1KERA 1AB6A 4GX2A 3K16A 3M9LA 1TPYA 1AZLA 2G9RA 2V9PA 2F3RA 2TSYB 2BFBA 1RW4A 1BVYF 1ZI9A 3NOXA 2G6BA 4KDEA 3I73A 3MFQA 4XFJA 1MVNA 2RCNA 2CL7X 1LRLA 4YQZA 1DKRA 1A9PA 2PUJA 5AMXA 3LA8A 5T8KC 3QBTA 1VBFA 3CRRA 4MQUA 1WZCA 1U7UA 2AMVA 4K03A 5KVSA 3PQ3A 1KGDA 1M76A 3ADBA 1X8JA 3B51X 1LK7A 2ZAGA 1SUBA 1FQJA 2QZSA 5HXAA 2AWNA 3PJRA 1CHNA 2P7HA 4EHIA 3Q4GA 3DYIA 3KC2A 3ROQA 3B5IA 3O2QB 2FK8A 1IQUA 4PZYA 3R3SA 4PNZA 4TX1A 1KR2A 3ZHZA 4JB8A 2BGWA 3HVJA 1AE1A 2Q5FA 2G82A 5KOJB 1D7OA 2QMYA 2IXFA 4NBLA 3ZV3A 1A2KC 2BW0A 4HH4A 4YUWA 1Y4UA 2G6TA 3GLHE 5CJ2A 2RGRA 3CEJA 4II7A 2ZU6A 3NU1A 3R5JA 1RRCA 4FX2A 2JCXA 4FB5A 3EFHA 2JFYA 2ZAIA 3MWYW 3S2FA 3W5BA 5J43A 4KFTA 1SQ6A 1IJBA 3JYOA 5AIBA 3MHPA 5A2QA 3U7GA 1R8XA 1J20A 4F3NA 13PKA 5DRTA 2P77A 5HM8A 4UTZA 1A72A 2VPTA 1HLFA 4R1LA 5B3KA 1YDMA 4RW0A 5DGHA 4IR7A 3S2GA 2EATA 1YE5A 5U4QA 4DY6A 3KNZA 2Z6AA 1EK6A 3MTEA 1UMDA 3ZJ4A 1VE3A 1ZPDA 2BY4A 2AUTA 5HZKA 4GI1A 2GT1A 5AKIA 1Y1SA 3CRVA 2BKVA 4OXQA 4YAIA 3BFVA 2IYUA 1CRPA 2OBXA 2PA3A 2ZKIA 3EVNA 1FVFA 2PX5A 1TAHA 5L4LA 3EH1A 3TLAA 5H1YA 2WJGA 3ICWA 1OI3A 4N0QA 3QVGB 4KO1S 1XRMA 4MUBA 1E2BA 1JX6A 2FWNA 2V59A 1M1YA 1J70A 3LX5A 3ML1A 3I9JA 4Y3UA 1BQEA 1SCBA 5D6NA 3PIRA 1XMJA 1YC2A 4RVSA 4X97A 4Z9BA 3V8NA 2JCSA 4Z3KA 3CF4A 3IUNA 3U4HA 3RU7A 2XGJA 2BEVB 4ZMRA 1ECBA 2UZIR 1M2VA 1KSGA 1CY7A 4R1MA 4NFLA 2QT1A 4BMDA 4RS3A 4M9XA 2RAPA 3VAAA 3EZXA 4R2HA 1ZOSA 2HA3A 4MWZA 3UTDA 1NKTA 2OYSA 2ZYWX 3Q6NA 4JIMA 5DLYA 3UJAA 4EJ0A 3UXYA 4B7UA 2DHRA 5B37A 1OFVA 6LDHA 1GYPA 5HBGA 1R8QA 4CV1A 2PVCA 2BMDA 3PG5A 1SKYB 1JZTA 2ICAA 2RBGA 4Y2XA 4JX9A 4A0QA 1I33A 2IFTA 2GK7A 3X1WA 2OVBA 2ZM5A 3L5OA 4BMCA 1R6AA 3AR6A 1Y4AE 1BW9A 1R0ZA 3FA2A 3QITA 1I4WA 3BIWA 3KR2A 2F55A 3FAKA 5EKTA 1S7GA 5MFPA 5EJGA 2R96A 1UODA 3S68A 4TZKA 5EYPB 4BFZA 3ELDA 3RTEA 4B6EA 3GMSA 1JG1A 3I45A 2P0EA 4LAFA 1T6ZA 5EQJB 4PGHA 3H7AA 4DEVA 4MMZB 1K2VN 3KD3A 1A71A 1S2GA 2YNMD 1VKHA 3RRXA 1OBCA 1XCPA 2ZWIA 4QECA 4W9NC 5KWVA 3FYSA 2RB5A 1E5LA 3EISA 1R64A 1A8PA 2REXB 3DBVO 4BLQA 2HMYB 3B6MA 3I5UA 2HTFA 4CZ2A 4LI3X 3AHGA 3FFXA 4A5OA 3V4RA 3OQIA 1FW6A 4PCVA 3U3ZA 1SQ0A 2WD7B 2CNBA 4QDKA 1FDRA 3SYNA 2I2XB 4F5WA 1PL0A 4ARZB 5AJWA 3QYPA 1TCVA 4O3MA 1C9JA 1I6LA 3C16C </