4EB0A

Crystal structure of leaf-branch compost bacterial cutinase homolog
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
258
structure length
258
Chain Sequence
SNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Leaf-branch compost bacterial cutinase homolog
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords LCC
total genus 91
structure length 258
sequence length 258
ec nomenclature ec 3.1.1.74: Cutinase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12695 Abhydrolase_5 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eb0A00
1K5PA 3C5WP 3WYDA 3FCXA 1XZEA 5AKYA 4TPKA 5CURA 4Q3LA 3WYNA 1YB6A 2DHCA 2H7XA 1IUPA 4WJLA 3N0TA 4QDZA 1GT6A 4BE9A 1X70A 2BAGA 2OAEA 2PL5A 3WIBA 1QIGA 2WM2A 3BWXA 3WK6A 2Z8XA 2YYSA 1W1IA 4BC1A 5ALNA 3CN7A 4I4CA 3IUJA 5ALTA 1NU8A 5DNVA 2GYVA 5K3EA 1BRTA 2QJWA 3U1TA 4J0JA 1QFSA 3G9ZA 2BGNA 3G0BA 5IVHA 2QM0A 4ITVA 3STUA 1L7QA 1QIMA 2WIKA 2UZ0A 1QIJA 5ALEA 5IKXA 3PF8A 4UUQA 5ALHA 2PSFA 4M0MA 5DYYA 1QFMA 3DQZA 4C89A 3D2BA 1VE6A 5CT8A 4NVRA 1A8SA 5T4BA 1QLWA 3SK0A 2XUAA 3I1YA 1QIEA 3VVLA 2V96A 1LPPA 1KEZA 5ALMA 1OXMA 1HL7A 5EIEA 4HAIA 1HDEA 2C4HA 3O95A 4U2GA 2HU5A 5ALKA 1UK8A 2FX5A 3G0CA 4KAJA 3ANSA 4X92A 5JZSA 1PV1A 4GEGA 3TJMA 5YASA 1MNQA 3KWFA 4G8CA 3DDUA 5HK8A 3V1KA 3D2CA 3C5VA 3BDIA 3ZV7A 4CCWA 2PU5A 1YB7A 3HSSA 1B41A 3GELA 4BP9A 4YPVA 3WWDA 1MNAA 4AN0A 4EY6A 1XZLA 5AI9A 2H7CA 3WZLA 1LNSA 5T4FA 2DQYA 1JFRA 2XMDA 1CUYA 4FOLA 3R41A 4B6GA 4Y9SA 1NX9A 4IH1A 1SCKA 3PF9A 5JD4A 2CMFA 4FNGA 3BDVA 1DT3A 1U65A 4G4IA 3H2HA 3QM1A 2V98A 5SYMA 2R11A 1LPAB 1MN6A 1C7JA 5A6VA 2HDWA 2GBCA 4IQ4A 4C4XA 4F5ZA 1DX4A 3MUOA 1XRRA 2VT7A 1XRMA 1CUEA 2WILA 4XX1A 5LZ7A 2QZPA 2QRUA 5IVKA 3STXA 3W05A 4OD0A 4PO3X 1H2XA 3WK9A 4H7JA 1DINA 1XRPA 3QZUA 5E4TA 2ZYHA 1FSSA 1XZCA 5AM2A 4E46A 1AQLA 1CEXA 3C6XA 5EHZA 2FJ0A 5HKBA 3IBTA 1WB4A 1CUWA 2HRRA 2X5XA 4F0JA 2JGJA 5DTJA 4BRSA 4P9NA 2XUGA 4H7FA 3FYUB 1EA5A 4OU4A 3RM3A 5HF8A 4J0DA 2XMCA 3E4DA 1N8SA 4ZV7A 1LZKA 1QONA 2JGLA 4KE7A 4DYHA 5JD6A 2ZYIA 5A2GA 5I8PA 4G9GA 4KEAA 2G4LA 3BL8A 5LLSA 5ALZA 1EVQA 4X00A 3G0DA 1CUFA 2I03A 3QMWA 4AZ0A 3NUZA 3VKFA 4BB0A 2GZRA 4DGQA 1YR2A 2Y2VA 3DNMA 5C8ZA 2J3DA 4JEIA 5FXMA 5I7UA 3RLIA 5ALPA 1UFOA 1TCCA 4DMKA 1XZFA 1CUHA 2QMQA 5AM0A 1IZ8A 1N1MA 4FLEA 4G8BA 3IDAA 5ALUA 3D4LA 3GROA 2ZSHA 2WJ6A 2OG1A 1XFDA 2BFNA 3K9BA 4L9AA 4F60A 1LPMA 3LIIA 1CUZA 2Q0XA 1USWA 1TK3A 1JU4A 2RGUA 3IUNA 2ECFA 3OPMA 5AKXA 3H1AA 1BS9A 4AXBA 1T2NA 1DQZA 5AIAA 1VA4A 2D5LA 1CPYA 1CLEA 2XMQA 4B85A 5JIBA 4Y2TA 5AKLA 4C4YA 4Y2XA 3OM8A 2PX6A 4EHBA 2OPHA 1U4NA 4AO8A 2JBWA 3DL7A 4S0XA 1CUSA 4Q3OA 4BBZA 2PVSA 1AX9A 3WL6A 5JATA 3P2MA 2XMRA 4EY8A 1CUVA 4FBLA 4M0FA 4KAAA 4E11A 4IH9A 4Y2VA 4HVTA 3EQ9A 2FJPA 1F8UA 4H7EA 3IUQA 4A23A 2X8BA 3C8HA 3R3WA 4J0HA 1F6WA 1A8UA 1CFJA 3TRDA 1GGVA 4QLOA 5CW2A 2D0DA 3G9XA 2QXUA 5I9IA 4L3WA 4E14A 1XZBA 3I2HA 4TVKA 2VQ6A 4OB6A 1XQWA 5DYWA 4J03A 4ZI5A 3FLEA 5JASA 1FJ2A 3KSRA 3STWA 2WQZA 2PSHA 5JAOA 1DWPA 5JZ9A 3I2FA 4QDOA 3DEAA 5A7HA 2O7VA 2HU7A 4KRYA 3R3YA 1VXOA 5AM5A 5HF5A 1UWCA 3JWEA 1N5RA 5FPPA 4NMWA 3VJLA 1JT2A 2Z3WA 4NZZA 3RKSA 3DCNA 5ALIA 3HABA 1U2EA 5ALDA 3QH4A 5AOBA 5ALFA 1QTIA 4IH4A 1GPLA 4MXDA 4KAFA 1QO7A 5ALSA 3HRHA 3GA7A 3HC7A 3G9UA 4Y7DA 2XT0A 2VJAA 2ONCA 3E3AA 5A71A 1XZJA 4N5IX 2XQJA 2QUAA 3NWOA 2V97A 2ACKA 5JAUA 4J0IA 3WL8A 2YXPX 2XUJA 2J4FA 1WPXA 2DFPA 1YA4A 1W75A 4B83A 4WFKA 3MVEA 1EI9A 1FFDA 3ANTA 2OLEA 1VZ3A 5LZ8A 1G4HA 1ZD3A 1ORVA 4MEBA 1XRLA 4AO6A 1WB6A 2YH2A 4H0CA 4UHCA 2PU7A 2QR5A 1J2EA 1JU3A 5JAPA 1BROA 3C45A 4WY5A 1ZI9A 4KACA 5FRDA 2Z3ZA 4B84A 1GKKA 5IVIA 1P0IA 3MGAA 4D9JA 4BZWA 2CZQA 3S8YA 2VAXA 2DQZA 1HKHA 4A5SA 4C87A 1EDBA 4I3FA 4V2IA 5E4JA 2CUTA 4BRZA 3KDAA 3H1BA 2JEYA 2JEZA 1YASA 2CB9A 2JGFA 5JAHA 1YAHA 1XZHA 5ALVA 1ZIYA 2WFLB 4WDRA 4AMYA 1VXRA 3WL7A 1VZ2A 4MWTA 2OQIA 5CTAA 3WA6A 1C7IA 3GFFA 1EDEA 2HFKA 2OCKA 1F0PA 4N5HX 3V1LA 4CG3A 1CUJA 3WWPA 2XUPA 1RP1A 3R3VA 4ETWA 3H0CA 1H2WA 4HZGA 1QO9A 5JALA 1AUOA 4GHWA 2J4CA 2XQFA 2PUHA 4LXIA 4DMCA 4GBGA 1VOTA 2C5GA 3O9VA 1XLVA 1Y7HA 1EXWA 1GZ7A 1XROA 2XE4A 1Y7IA 1E8NA 1MT3A 2VJBA 1Q83A 4EZIA 1R1DA 1B6GA 4EY7A 3FLAA 1J07A 1QJ4A 4K6GA 3VDXA 2B20A 4OU5A 1IUOA 5KWJA 2QVBA 3LS2A 3PDCA 3V1MA 2JGEA 1H2YA 1QTRA 1U8EA 4G1FA 2VJCA 2WHPA 5EHNA 1H22A 1VA5A 1XRQA 4EY5A 2AJCA 1DU4A 4Y2UA 3T4UA 5DLPA 1TKRA 4HTAA 4BTVA 5KBYA 2C5FA 1XZKA 4UBMA 5HK9A 5ALXA 3PUHA 1TAHA 3D0KA 5DYTA 2VEOA 5FP0A 1JMKC 1R9NA 1ZGCA 3FSGA 2ZYSA 2WUGA 4P93A 5JYCA 1WCYA 3C6BA 1YS2X 4XVCA 1AMNA 4L0CA 1ZJ5A 3FVRA 1ZD2P 5HQ3A 3VVMA 4LIPD 3KOOA 3ESBA 3VJKA 3N2ZB 4BVKA 3H18A 1SCQA 4K2AA 1R9MA 2XQGA 3OOSA 4FFWA 3NOXA 4B9AA 4QA9A 1MO2A 4HXFB 1SCIA 3PFCA 5CT5A 4IO0A 1K63A 3M82A 3G9TA 1JJIA 3S2ZA 4MQLA 2EEPA 2RAUA 4H7DA 2WTNA 5C8VA 1JKMA 3V48A 4UBKA 2WUEA 2ROQA 4CCYB 2HA5A 1O6FA 4BDSA 4ZGBA 2WIGA 1QIDA 4P92A 4M0EA 2RONA 2BKLA 5CRIA 4KYVA 2O2HA 4B9EA 1YAJA 5ALYA 2AXEA 5LYYA 3I2GA 4UHFA 2ZJFA 4C01A 1SOMA 4KR0A 3SWWA 1GKLA 4G5XA 4DM7A 4FMPA 1MJ5A 3WLAA 4U2CA 2CKMA 2HFJA 1HPLA 2ZSIA 3WK5A 4PSUA 5DWDA 1YS1X 2ZJ7A 1E5TA 2OXEA 5ALQA 3CCCA 4BTLA 3JYHA 3DKRA 5FLKA 4H7HA 4NS4A 3DYVA 4LYEA 2XDWA 5BWCA 1UOOA 1UOQA 4YK7A 2HA6A 4L72A 4ZREA 5HF9A 4DMFA 4U2DA 2X76A 3L1IA 4JNCA 1LPBB 3G8YA 2B61A 2NW6A 1QIIA 4AX4A 1UT6A 3WK7A 4X3CA 4H18A 3PFBA 4AO7A 3YASA 2IX9A 3WZMA 4DSZA 3DOIA 5IVDA 5C81A 1TIBA 2WHQA 3V9AA 1OILA 5DNWA 3ZLVA 4K6HA 4YASA 3MUNA 3FVTA 2XUDA 4AMZA 4JUIA 2XMSA 5LP1A 1EVEA 3LIPA 1A7UA 3BIXA 2OGZA 4G8DA 4OB8A 5D6OA 1CVLA 3ICVA 2GBFA 3F97A 4GW3A 3GBSA 4FDMA 5AJHA 2GBGA 1P0PA 1Z68A 2ZYRA 2Y2UA 4FNMA 4X97A 1CUAA 3QITA 1W4LA 3WQHA 3L1JA 1XQXA 3PE6A 1CUUA 4RE5A 4PSCA 3AIMA 4CCYA 1ZI8A 3C70A 1XLUA 4FLMA 2QOEA 4UBIA 3OG9A 4N8SA 5FPQA 3I6YA 3EQ7A 1MX9A 1X2EA 2QTBA 3BF8A 5FDFA 4INZA 4ZXFA 4OPMA 5JARA 1E3QA 4BZZA 3PI6A 3GUUA 2G63A 3WMRA 2HHAA 2QKYA 1BN6A 3R0VA 3WKBA 4W1PA 4X94A 2WFLA 4FHZA 4QWWA 1TQHA 4K5QA 1QE3A 5KWIA 4FWBA 3KD2A 1ODCA 5AI8A 5ALLA 3IUMA 4Y2RA 2XMBA 3H2JA 1L7AA 4H7IA 3UMJA 4DTCA 3EF3A 2QS9A 1MU0A 1SC9A 5ALGA 2WG2A 3D59A 4J0GA 2B9VA 2IIVA 3FYTA 1WOMA 1HBJA 1RYYA 1WHSA 2CJPA 1K6EA 5JANA 3O4JA 3FCYA 4OYLA 1W76A 1HLGA 2HA3A 5CXXA 3AZOA 1KU0A 4WDQA 5AM1A 4GLBA 5LKRA 3WA7A 3FYUC 3G0IA 4Y2PA 3QVMA 5A7FA 3F9CA 4MWSA 4B81A 5AKGA 3CXUA 4Q3KA 1K4YA 1SFRA 4Q05A 3HXKA 5A7GA 2LIPA 3O4GA 1R50A 2WG1A 2RHWA 2HRQA 3JW8A 2RIPA 3WI7A 3ZWQA 1EDDA 2WKWA 1VKHA 3LLCA 2WLSA 4ARAA 3KXPA 4HXGA 3E1GA 2XB6A 4BCDA 1J06A 2WHRA 3ESAA 5C7YA 4AN1A 5HFAA 3PICA 4WY8A 1AKNA 2HA0A 4X93A 2YASA 4XWGA 3I2KA 4W1RA 2PM8A 4Q82A 5AP9A 1UK6A 4GXNA 1WB5A 1ZOIA 4N8EA 2JIDA 2VT6A 2XQKA 1PJAA 3W06A 2Y6UA 2AJLI 3F67A 2PPLA 1GPKA 3ICWA 1ZGBA 2C7BA 3WWCA 4HRYA 1CUGA 4X7BA 1W6RA 2WFMA 5HQ3B 5CH5A 4BAZA 5DNUA 4B7ZA 1LPNA 1O6GA 4UFNA 3E0XA 2BJHA 4JH0A 1MAHA 1ZD4A 3FLBA 2BGRA 3M3DA 4KJXA 1G42A 1UXOA 4QNNA 3DD5A 4G4JA 4GWLA 1CUBA 1XLWA 4X6UA 5EIHA 1CUIA 5D7BA 1E89A 1ZD5A 3BXPA 3IIIA 4MYDA 2AJ8A 4UBLA 2JF0A 4UHBA 3B12A 4H7KA 4ZRDA 3WIOA 2Z8ZA 3D7RA 3DLTA 1XRNA 5ALOA 1UKBA 4BCBA 1VE7A 1LZLA 5ALWA 1K8QA 5CT4A 4MJ3A 5DTIA 5AI6A 2XUIA 2VJDA 1BE0A 1BN7A 3FAKA 4IHAA 2RHTA 2JGKA 1XQVA 2WIFA 1ZI6A 4XJVA 1IMJA 4P08A 1MTZA 3FBWA 4UFPA 5AI5A 4G4GA 5LKAA 5CH3A 3AZQA 4EBBA 1ZIXA 2GYWA 3ESDA 4X95A 5AI4A 1GQSA 4AQDA 4ZWNA 4JYPA 2GZSA 1Q84A 4J0KA 3ZLUA 2O2IA 3H04A 1BU8A 3W04A 4I19A 1WPRA 2VTVA 1R4ZA 3LCRA 1NU6A 3WWEA 1GQRA 2QJRA 3AINA 3OTQA 3A70A 2PSDA 3D5EA 3EBLA 2WSLA 3WKEA 2W6CX 4EA6A 1WHTA 3WK4A 3HEAA 1GPNA 1L7RA 1CIJA 1FFBA 4B82A 3I6ZA 2VAVA 3O9MA 3C87A 4FFVA 3D2AA 4N8DA 3G02A 1S8OA 3DL4A 4MEAA 1ODTC 4UHDA 3RK4A 1EB9A 1ODSA 3HACA 2XUQA 4UHEA 3QPDA 2ORYA 1EK2A 3O0DA 4OCZA 3QBJA 5HCUA 3Q8WA 4U2EA 3QPAA 4X90A 4BE4A 2XUHA 1EX9A 3FYUA 4AZ3A 4EUSA 2XI4A 1QGED 4GDMA 5AK4A 4DLNA 2C0QA 4KE6A 2OCGA 4LXGA 4J0CA 5ALRA 2QUBA 1E66A 2Y1KA 3A2NA 4B80A 3AZPA 1DX6A 3A2MA 1DQYA 2EDAA 5EGNA 3WJ1A 1OCEA 4O08A 1AURA 1UOPA 5FUMA 4BYMA 1CUXA 3W2TA 4YX9A 4Y2SA 2C0PA 4FLFA 4MQMA 3AFIA 4BAUA 3H2IA 3G7NA 1DWQA 2DSNA 4HRXA 3FSGD 4K6KA 2H1IA 4EB0A 2FUKA 2WFZA 2HM7A 5AI0A 5ESRA 1ACLA 2AJDA 4HS9A 4W1QA 7YASA 4LHEA 2HA2A 4KE8A 5AK6A 3W9UA 1TCBA 2O7RA 5FKJA 1XQYA 2XLBA 2ZJ6A 4X85A 3G0GA 5FOQA 2H9YA 4JYMA 5EHXA 4GI1A 1VLQA 4LXHA 1PFQA 3H19A 1FFEA 2WTMA 3ED1A 2XMGA 5AM4A 1MPXA 1TRHA 2HL6A 3DOHA 2PSEA 4W1SA 5CT6A 5LZ5A 4QE3A 2WIDA 4DNQA 3R3UA 3K6KA 1LPOA 5E2IA 5AKIA 3QMVA 3LP5A 4QZVA 2PBLA 1RWQA 4PSDA 3WKCA 1LLFA 1UK7A 2OAGA 3STYA 4FBMA 3WWOA 3ZLTA 1QZ3A 2BUBA 1EK1A 4QDUA 1THGA 4Q34A 3R3XA 1UKAA 1XZGA 2BUAA 2HU8A 5HF6A 3F8SA 2OCIA 4Q1VA 1XZIA 1IUNA 1XZDA 5ALJA 3VXKA 4RE6A 5EI5A 1ACJA 3KWJA 1QIKA 4DNFA 2VF2A 4ROTA 3AIKA 2BUCA 3IB3A 3VISA 3HYSA 2I78A 3H17A 4LYDA 3ILSA 4DIUA 4WFIA 3AUKA 4UHHA 2ES4A 2IITA 3BF7A 3IA2A 4Y2JA 5J3JA 1YSCA 1CR6A 3I2IA 3I1IA 2ACEA 2WUFA 4C6HA 5KREA 5JZBA 2E3JA 4HXEB 5FV4A 1MX5A 2EDCA 3CN9A 3FOBA 1A8QA 3EIOA 3HZOA 4OUKX 1JJFA 2PUJA 3TGLA 4CG1A 1T4MA 4OB7A 2B4KA 3K2IA 2DHDA 1QOZA 4FTWA 5EHQA 1Y37A 5LZ4A 5K5EA 1IZ7A 1F0NA 2QXTA 4GECA 4QLAA 2GYUA 5K3BA 1UZAA 2O2GA 2HA4A 1GXSA 3WKDA 3C43A 5AKEA 1EH5A 4XIIA 2GBIA 2WUDA 3UUEA 1AC5A 4KRXA 5AICA 3R40A 2C58A 1EHYA 5F4ZA 1C4XA 3SX4A 3AILA 5JADA 5AHXA 1G5FA 4LKOA 4ZV9A 1A88A 1H23A 4QDXA 4DNPA 3TEJA 1LGYA 1DT5A 1VJ5A 5H3HA 4WCVA 1JI3A 4H35A 1R3DA 5HKAA 2VSQA 5AOAA 5AKKA 1WM1A 2WHPB 1QIHA 3IURA 1MAAA 5CXUA 4OSEA 4W9RA 2PKYX 4QDTA 2J3QA 5E4YA 4BCCA 3T52A 3F96A 1DTEA 4PV7A 5K3CA 1HQDA 5T4HA 2XUOA 2W22A 4J3JA 4Z49A 4OYYA 2Y6VA 1XZMA 4ARBA 1DWOA 1BEZA 4EY4A 3WJ2A 1BCRA 4QEKA 5AK3A 2BCEA 5D3ZA 3STVA 4Y2YA 3OURA 3I28A 4PQEA 4UBOA 1CRLA 2WU4A 2VATA 5HFNA 1P0QA 3D3NA 5AM3A 3M81A 4DSAA 1AGYA 1E8DA 3O4IA 1E8MA 2RI6A 1FFCA 1IVYA 3AJAA 1XKTA 3WL5A 5LZ9A 4H77A 1M33A 5D3KA 2V9ZA 3F98A 3M83A 5BV7A 3DKKA 3IULA 2HADA 5SYNA 5LZ2A 3NGMA 2WG0A 4BVJA 2DR0A 3GZJA 5BWBA 1XZAA 1THTA 4BC0A 4AB1A 1D07A 3BJMA 4F21A 5K3FA 4X71A 4BP8A 5CMLA 3WK8A 1CUDA 5HZGA 3ZI7A 3SC2A 1ETHA 2HIHA 4UPDA 1I6WA 4G9EA 5DJ5A 2P8SA 4RNCA 2PSJA 1EB8A 3C8DA 3OC0A 3HLKA 5CT9A 1ZICA 4DNOA 5K3AA 3B3QA 2K2QB 5K3DA 3R3ZA 3UUFA 5EIAA 1YCDA 1AZWA 1Q0ZA 4BATA 3X3HA 2G5TA 5JD5A 4C88A 1QIFA 4X6XA 4PF1A 1J1IA 6YASA 3W9BA 2WIJA 2DCMA 4C4ZA 1R88A 1MX1A 4CIBA 4Y2QA 1CUCA 5AIBA 1CQWA 4KE9A 3FNBA 3L1HA 5AK5A 3HJUA 4DMHA 3QMMA 1ORWA 4QWMA 1UK9A 1TCAA 3U0VA 5C8XA 5BOVA 3IVMA 1CQZA 4A16A 1LPSA 3H2GA 1W52X 2QT9A 2JGIA 4UBJA 2DHEA 1EINA 2WJ4A 1JMYA 3WKAA 3O4HA 5CBKA 5IH7A 3AIOA 2AJBA 3VJMA 4U2BA 1Q0RA 2OQVA 2XUFA 2Z5GA 5AKJA 4CG2A 4B0OA 1KU6A 3BJRA 2XQIA 3FWHA 4RPCA 1UKCA 5AH0A 2XUKA 3I6MA 4UBNA 3ESCA 4CIAA 4RGYA 3Q0TA 3EQ8A 1YA8A 1ZJ4A 2JGMA 5AKZA 2OCLA 2HA7A 2I3DA 4UFOA 2CBGA 4X6YA 4WFJA 4PNZA 4TGLA 3H2KA 4U2FA 3PUIA 2OGTA 3STTA 5K3FB 3DYIA 5EFZA 1ISPA 3HI4A 5T4EA 2I3ZA 4J7AA 2G5PA 4BAGA 5AOCA 5CH8A 2XMZA 3BIWA 2WU3A 2ZVDA 4B0PA 1CV2A 2CEKA 3BE8A 3QPCA 3ZPXA 3QYJA 2OGSA 2XLCA 4CI9A 5A62A 1H2ZA 4E15A 5AO9A 1FFAA 4X91A 5ISMA 3I2JA 1P0MA 1N5MA 3A6ZA 3V1NA 1X2BA 2R8BA 3DS8A 4FKBA 3RARA 3CCBA 2VA9A 3DJYA 1LBSA 3B5EA 1BEEA 1LBTA 3C6ZA 4BVLA 1BCSA 4BDTA 3A2LA 3C6YA 2H7YA 4CFSA 4W63A 2WJ3A 1G66A 5LIPA 1JJBA 5AKHA 1XKLA 4MYSA 4PW0A
chains in the Genus database with same CATH superfamily
1MOZA 1XMVA 2OR3A 2VYVA 5CNJA 2QN1A 4HCJA 1H3EA 2XWPA 3L6OO 5CX1A 3X0DA 2ZAMA 3S8EA 1FP2A 4TWIA 1V0JA 4OGWA 3BSFA 4TYNA 3IT0A 1DHRA 2PG3A 3FCXA 3TMKA 1XZEA 1JIJA 1G7RA 4FJ1A 4LG1A 4Q3LA 5CURA 3SZGA 4V03A 5BSMA 2ZI4A 2NVUB 2DE0X 2VNKA 4A9AA 4L5CA 3ZVMA 2CT8A 1YB6A 2CNDA 1A9RA 3E9QA 2EX1A 1DSSG 1N8NA 3I61A 3TPFA 2BWJA 3GEGA 3LYAA 1CIVA 2GTHA 2ZUTA 3M1AA 4WJLA 3D0QA 3REGA 3ERCA 3GJ4A 4QDZA 1GT6A 3NYIA 3LL4A 5CM8B 3VPHA 4BE9A 5C53B 3U2QA 2A6PA 2OAEA 1FIUA 4Q1BA 1Q0SA 4ZT5A 5DWQA 4D02A 2CVOA 1FTYA 2PYIA 3I4LA 1CNFA 3GVPA 5T6BA 3NV9A 4BX8A 5HGXA 4ZICA 4ENQA 3OLCX 4EO4A 4IXTA 3BWXA 4EG1A 5JS7A 3IODA 5KYUA 4HMOA 4R1SA 2FPUA 4MRPA 5AJUA 2XRZA 4I4CA 4MS4B 1XXHB 3PC3A 4C20A 5I9LA 4FGSA 5EMKA 3W9YA 2A0WA 3JQ7B 2DHRA 3AI1A 4ZYYA 1EG2A 3PLAE 4LMPA 4BQNA 2WDPA 1WXEA 3JQBA 1P5JA 1U31A 4FPXA 3HDYA 4OL9A 4D3FA 2KSQA 5MF6A 1BRTA 3D6MA 1KWGA 3DMRA 2DPHA 3U44A 4GX0A 2QJWA 2JLQA 4J0JA 1QFSA 5EXSA 3MOIA 3G9ZA 2FUNB 2BGNA 1MJHA 1IIRA 1A9QA 2HO4A 1U99A 4ISCA 4Z4QA 1BQ4A 2E4XA 2MJLA 1E9BA 4MWEA 3DV2A 4M83A 2Q5CA 3OHSX 5K0JA 1QP0A 2H4WA 1M2VA 1O6CA 1QV7A 3OWXA 2UZ0A 2GDZA 4G1VA 4B4OA 3FI9A 4R3WA 2Q1TA 3FAZA 2VF7A 3S8MA 2N1BA 5G0VA 2OO5A 3AI7A 4M0MA 5DYYA 1AUXA 3AG5A 5ENVA 2QLMA 4YBRA 1SIUA 1NP7A 4LJYA 1VE6A 2R65A 4G8JA 2P4UA 2OD7A 1QLWA 1A72A 3SZ3A 2L2QA 4EI9A 4LXQA 2XUAA 2FK7A 3I1YA 3VVLA 2OP0A 1S3IA 1IY8A 1QYCA 2VJYA 4MGIR 3C3EA 1RXWA 1KO8A 2MSEB 1SVUA 2PSSA 3ACCA 3HA5A 3OZBA 4MIYA 4R8LA 5ALMA 4ARUA 2L0XA 4WKGA 1OXMA 2R3SA 3KYDA 3PG5A 5K0BA 5KQRA 4B4UA 4CL0A 1SK9A 2ERXA 2X2FA 3V2IA 4JJIA 1HL7A 2VXCA 5ENZA 4JELA 3LPNA 4JENA 4H59A 1HDEA 1XA3A 3EJ6A 4XWKA 2IHZA 2FWNA 1AY0A 3VR4A 2VHZA 2JBHA 3QF4A 1I80A 3NHRA 5EKSA 1KC1A 1VJ1A 3DMHA 1GFIA 2V4MA 2YZMA 2H9IA 3DDNA 4HPWA 1JJVA 4ZAZA 3Q11A 3VSBA 3GLIE 4PBTA 2OK7A 2WUVA 3GT4A 3KLPX 2HXGA 1Y3FE 3IPAA 3LJKA 1LDBA 1M0SA 4WESB 1UDAA 2O5EA 1RLJA 5K0TA 3UAXA 1SBNE 4PQYA 1T3LA 4M55A 4OHZA 3UWSA 1J2UA 3M6IA 2DPYA 1MEJA 3S2EA 4HEA1 2H2FA 3M2TA 5JXHA 2CVZA 3I6BA 4ZI7A 1Y7TA 5HK8A 3AP3A 3BPSA 3OE5A 1ZG3A 1JDJA 1WY7A 1G8HA 3EUEA 4IQGA 4ZI2A 4AJNA 1I4EB 1I4LD 2EXXA 1QKIA 2F17A 3GCWA 4IUBS 3RK0A 3T5AA 2H85A 3L8ZA 4U1RA 2BC9A 1HFWA 4XJXA 2PU5A 5KO2A 1KYQA 1U2GA 1DJPA 2VAPA 1BDJA 3Q0EA 1Y42X 2OAP1 5AUOB 2PGAA 1ZR2A 3VJRA 1RLMA 3QKWA 4XDZA 4TTAA 4YPVA 5K6AA 5HDQA 2JG3A 2ZWOA 4L78A 3H8JA 4Z7QB 2JJ2A 3IIEA 1O2DA 2P3OA 5JV5A 1B76A 4EY6A 3RYIA 2P78A 5I51A 2AN4A 3LOQA 3ZDCA 3SJAA 1U2GC 2ORED 2UUPA 2GOYA 1DPFA 1VL0A 4Z9BA 3V33A 3K8QA 5KNDA 3DPIA 3NM6B 4JD5A 1Z18A 3CO0S 3LV8A 1QQBA 4QBFA 5JWRA 1NF8A 1GHTA 2XE7A 1NVUQ 3QJGA 1RXIA 3G68A 2JVKA 5KAPA 1WETA 1GLNA 2PWPA 2ZIZA 5AMXA 4JL5A 2AUMA 3R41A 2GF2A 2IYQA 4X44A 4Y9SA 4IH1A 4NFSA 1SCKA 3L7NA 1T2VA 1L3CA 2M6RA 1VIDA 1QHEA 3K0HA 1BMFA 3D4PA 4FNGA 4QGFA 4I5DA 3HBLA 1ES9A 2IV7A 2VBGA 3SC2B 4ZPJA 2AN1A 4L85A 4X1IA 2OXRA 1M66A 2PQ2A 2OV3A 4NARA 3W5HA 4EVRA 1P3Y1 1Y6RA 5F33A 5LB4A 3A4TA 2JJ1D 3H16A 4MRAA 4YAJA 2WHEA 3T34A 5GADl 1YA6A 1UF9A 2OFOA 2I2DA 3ZUGA 3PDIB 3H2HA 2IDMA 9GPBA 3ECCA 2YJ5A 5AW2A 5JNUA 1M74A 3RS2A 2R11A 4RGQA 3G23A 3IL2A 1OREA 4EKDA 4PAMA 2QRJA 4QTTB 4Z4EA 1EGQA 2GJ8A 3NHYA 4LGMA 1C7JA 1AKRA 2ZIVB 3IMEA 1R18A 5JU6A 5BUSA 4UKDA 3E22A 1GT91 2FOIA 5A6VA 2HDWA 4F8EA 4CEJA 1X1SA 3T5CA 1JFLA 2IYSA 4NCJA 4RJ2A 1DX4A 3DBIA 4A3SA 2CD7A 4NU8X 1CQJB 3SQLA 3WO0A 1XRRA 3QW2A 4MMXB 4HOYA 4TXLA 1W2HA 3BX1A 2A2ZA 2A9JA 4RA6A 4XW2A 1A2KC 3QVUA 1AG9A 2FZEA 2VDPB 2QU8A 4GICA 3AOGA 1ZSVA 2D5BA 5IM5A 4JKIA 1M2HA 1PZFA 2QRUA 4BVGA 2XNHA 3KV3O 4I3GA 1AQUA 3STXA 3U9LA 2G9RA 3AP2A 4IPTA 3KXDA 4YLGA 3CV3A 5THKA 3HCBA 1M7HA 5BNIA 4ED9A 4M22A 2JH9A 2YWJA 1EXDA 1YVDA 2YWXA 3ZWPA 3H1EA 3RC3A 5FBLB 4P54A 3I64A 3SS9X 3HFGA 3PHCA 2JGRA 1AQJA 4OMUA 4E5MA 4IFTA 3K96A 5LQJA 2RAFA 1KPHA 2FN8A 1L7VC 2ZSBA 4F3CA 1ZK4A 1ZN7A 4TV9F 1MB2A 1WTAA 3OZ7A 1TUBA 3VR6H 4RTPA 2VTBA 3PKIA 5LNK1 3T4EA 5GJBA 3VU3A 4PLPA 1DINA 2WM8A 4MP3A 3GJZA 1LV8A 1DLIA 4R1MA 1Q19A 1P74A 2GERA 3TAHA 2NM0A 3S2YA 5F9HA 4NNOA 4FS3A 3DTVA 3PPWA 2EIXA 1AQLA 3MB8A 1NVKA 2G17A 4N3AA 1NXPA 4BZPA 1ZDMA 3K5PA 1DAPA 2VDUE 3IV7A 1RZRD 2IH5A 1QTQA 5P8WA 2RC6A 3QVSA 4NMHA 1ORDA 4DR3B 1NVAA 1ADJA 4PLTA 2P4HX 3LPMA 1VHQA 3TSOA 3CLRC 1C7QA 2HRZA 3A9UA 3KZNA 3HYRA 3TLMA 2X5XA 4MUHA 4JI4B 1CWUA 3OCUA 1L5GB 4CWAA 2GN1A 3I2YX 2JGJA 4H0FA 3ISVA 3ON5A 1MCZA 3NNDA 4BRSA 1N32B 2B0JA 3R6GA 3EXFA 4UULA 3QVTA 1YZTA 1UMKA 3CW2A 2XUGA 1FDWA 3GBPA 3SXUA 2DETA 4UZEA 3UWMA 2BVNA 3HZZA 2WW8A 3VOSA 3B6MA 3TNJA 3S40A 5BSUA 1EA5A 2XZTA 1A04A 1U8XX 1QBKC 3MK31 3QYPA 4V0SA 3RM3A 5JDIC 1BJRE 3ADDA 1ZJ6A 4GLOA 1V26A 4QTYA 2HMYB 6AT1A 1GYRA 3GXOA 4AZTA 4D81A 1YC2A 3A1EA 5J9FA 1NN1A 1L1EA 2MWMA 3IT3A 1KIAA 1H4QA 3GD5A 1MO4A 5ILOA 3AFMA 4TS3A 2V1XA 4C0SA 1T4GA 2CXTA 1DARA 1T5HX 4KE7A 2FUG6 2IYVA 5BSVA 3BMOB 1KF0A 1NZJA 3E82A 3BBLA 3TG8A 3OQIA 4G9GA 1NG1A 5ETJA 4FMCF 4PHHA 5LLSA 5IUKC 4WX2B 4E21A 3ESZA 2CLEB 3HCRA 3OOJA 4C43A 1ZNQO 2VQFB 2QQGA 2C2ZA 1Z2DA 3GJ5A 3IOBA 4HB0A 3JQ9C 3G0DA 1JTVA 2Q3FA 2ZRFA 1U63A 3P52A 4Y1RB 4C7XA 1KVRA 1XGKA 3B85A 4BMNA 2I03A 1ADCA 4WAUA 5IKEA 2FW1A 5EPUA 4BN4A 4NDNE 5BSFA 1NN0A 4QYSA 2GCOB 3I0ZA 3PI7A 1SZPA 4BB0A 1B00A 2J09A 4R7TA 4OHWA 5H59A 1ZXXA 4B6JA 3DNMA 3SBXA 4C06A 4UU0A 2J3DA 3A04A 5CM2Z 2G06A 1BS2A 1TZ2A 1YRYE 2WLTA 4C5CA 1YH3A 4E5KA 4GGMX 1ZNWA 5D87A 3OWOA 4XI9A 3ZQKA 1ZVKA 4KQKA 5INTA 1Y3CE 2I4LA 3UN1A 5LL6P 4B4WA 3HJNA 3TK1A 3LY7A 4NZPA 2OQRA 1CUHA 1CYDA 4UOQA 2QMQA 5KDLA 4JYZA 1COWA 3LOPA 5IM4F 1KY4A 3B6EA 2ZBQA 1UADA 3CKMA 3FZYA 4CQLB 4P1ZA 4PYKA 4RVOA 2ZIXA 4BE7B 2VHQA 3D4LA 4J9VA 2EERA 4EJ0A 4EHFA 5JSZB 2VCEA 2NZ2A 2OG1A 3RRNA 1FUYB 1NVEA 4NNPA 4HFMA 4L9AA 2BFCA 3ABQB 3VPXA 1LPMA 4F60A 2Q0XA 4N5NA 3WS7A 3U7HB 1USWA 5B53A 1LFAA 4MQ6A 3UENA 2QMYA 1BOOA 3G82C 1HG0A 3B1VA 3ZY4A 3D8TA 5CYOA 5ARBA 4IFEA 2JI7A 5AVVA 4BVHA 1VLVA 1YK1A 3MQ2A 4BMVA 4EW3A 4CTKA 4Z4IA 4EF5A 1ZVVA 1NBOA 4BO4A 4AXBA 1ZOLA 2I65A 5I45A 5AIAA 4RK0A 2D2EA 5IKMA 2O3JA 4V0NA 2A1UA 3TUZC 4V0MA 5JSUA 3SZOA 1CPYA 4PHGA 1Y81A 1JX6A 4XGKA 1J1UA 1M73E 2ZTHA 1DEXA 2DT5A 2XMQA 3JQ9A 3LH5A 4G6ZA 4LJSA 3LU1A 4R3NA 1KEEA 1RJWA 4COOA 3V8RA 5AKLA 1NULA 3KEFA 4C4OA 2W98A 1TPZA 2SKDA 4PN3A 4PPQA 3JVEA 1Q0HA 4Q15A 5DNEA 5JY6A 4TSFA 1DJNA 3QKSA 1N0UA 1Z39A 4FDAA 4G41A 2OXFA 2PX6A 2Q5FA 4OO3A 2B4TO 4RMNA 4FEYA 4HNGA 2QRVA 4WK4B 3G1TA 4XVRA 5E6UA 2OYRA 5JHGB 1KEVA 4RM2A 4I08A 1RKVA 3UANA 2YZKA 3DL7A 4ZO6A 5LQKA 4LOJA 1CUSA 5MHTA 2AC2A 3EIEA 2PVSA 1K5HA 1PTKA 3NDIA 3L2OB 1Z6XA 3QBTA 4YACA 3VZRA 2CXQA 2REQB 3GRPA 1NVVQ 2E89A 3K8OE 3DFFA 4FNAA 4N9QA 1ZITA 2GM5A 5FD8A 1J0XO 2R6R1 2VS1A 2G5CA 2PLWA 1PYDA 2FZLA 3NCTA 3R7LA 1XCLA 4M0FA 1C1DB 3V46A 4PNEA 2I99A 4R40A 4E11A 1TMYA 3T5MA 3UW1A 3ZWXA 1O9BA 4KYTA 4Y2VA 4HVTA 4UM7A 1SQ0A 1XL0A 2I0FA 1SBIA 3RIMA 5GM2A 3AY7A 4XQCA 3EVFA 2ZB8A 1E5LA 2LKDA 2J3HA 1JHOA 3MERA 3K70C 2E37A 2PUCA 5F1PA 1IE3A 4ETNA 2Z0MA 1QV6A 3ASYA 2IS2A 3IUQA 2V45A 4KX5A 1I8TA 2X0KA 3C8HA 4OLFA 3O3NB 4M7WA 4M60A 4N9WA 5EKDA 4BS9A 1V16A 4G3XA 1TUGA 1JKXA 1ZUHA 3AKZA 4RY9A 5EC8A 1GGVA 2ZUDA 1PQUA 4XEHA 2IF0A 1IB0A 3H86A 1U2PA 4YUAA 1JPVA 1F60A 3G9XA 1S2MA 3EXG1 5F1YA 4AZ3B 5A1JA 1QZTA 3E3NA 2IYOA 4Z8XA 5I9IA 3K0SA 1Z0KA 2P5UA 3TRKA 2RGNA 4IMRA 2QTRA 4QC2A 4E14A 4ABTA 4UOEA 3M4JA 3WISA 5K8IA 2WFAA 3I2HA 1RAFA 3DVSX 1KAHA 4TVKA 5E9JA 4OB6A 1XQWA 1J49A 1JIQA 2ZAYA 2DG2A 3IP5A 4QFDA 4J03A 2V7BA 3IKMB 3W5IA 5KYWB 4RD6A 2CNWD 2HK9A 4DQ0A 3RC8A 2AE2A 1VKZA 2FU5C 4JBHA 1C41A 1FJ2A 1NT4A 3H8VA 2W0SA 3KSRA 2YDYA 4XQEA 2OQ2A 2P3LA 2PSHA 1PBNA 1CE8B 1PGPA 3CJRA 2PBZA 1ML4A 3QIAA 2HQRA 4IINA 4O5OA 5TF0A 3ZHRA 1QQ6A 4LVNA 4JI8B 4NK5A 3I2FA 3EJWA 2Q0SA 1GYQA 4I1SA 3U5ZB 2ZUEA 2NUPA 2AR9A 1GEEA 3G1WA 1W34A 2VPTA 2LP4Y 5JBQA 4QOIA 5EUBA 1PG5A 2EGUA 4ZU6X 3KB8A 4TN1A 2OXIA 5IZCA 1KBQA 1CQXA 2O8NA 1VXOA 3N8GA 3BVPA 4ZMSA 4WBNA 1UWCA 1ARZA 2QENA 4LHVA 4J2HA 5FPPA 4BNFA 1VPLA 5CDSA 2DMRA 2OTCA 3RR2A 5KNCH 1JT2A 4PVCA 2ZJZA 1A9XB 4NZZA 2H3EA 2OKGA 3SF0A 4D3SA 3GLRA 4G1MB 3VNBA 3DCNA 5NULA 5CDYA 3WLTA 1KOLA 2FRXA 3EH2A 3IAS6 4EYSA 3QFRA 3G2JA 5ALDA 2NUAA 4J4BA 1XVUA 1CF2O 2PZBA 4OH1A 1WL8A 5AOBA 2Y05A 5TQ2B 4C7BA 5JXWA 3ASZA 1QGYA 4L0MA 1QTIA 5ALFA 4QLBA 4IH4A 4KR3A 1DBIA 3EZ7A 4WESA 3BK1A 2PUDA 5L3SB 1EJBA 1QO7A 1WKVA 2PRZA 3E1SA 4YJGA 1W36D 3GA7A 5LA6F 1NQ5A 3HC7A 4B45A 5KC9A 5GMOA 3QXXA 4UUMA 1W35A 3LQKA 1RM4A 1ZH6A 2VK4A 4TTPA 2HWKA 3WLMA 5A5EA 3TCNA 5HS6A 4MMZB 5G2OA 2L82A 2VXOA 1OWLA 1R4MA 3ZK9A 4GZ6A 4PRKA 4LCJA 2FWPA 1UQUA 1G59A 1A7AA 1N3IA 4JR1A 2ZIEA 3MLEA 2V97A 4JP5A 3RQIA 1EWYA 2BGLA 2A84A 2PIDA 2Y66A 4M2LA 4PFQA 5TQ0A 1D0IA 2VA8A 4IFBA 4ZJUA 1C2YA 3HCNA 4JDUA 5DBOA 2YXPX 3GMDA 3O90A 2GTIA 3NRJA 1YZGA 1Z0ZA 3GFRA 3P96A 4RVHA 5CVDA 4EY3A 5KSOA 2PUAA 3CWCA 3WY9A 3HN6A 2O1EA 1PSZA 1PVVA 5HXAA 1ZRSA 3JQ6A 1Q7RA 2J9FB 3MVEA 1E92A 1Z6YA 2QSJA 4IWYA 4RDIA 1EI9A 2XTAA 1MDBA 3TTWA 2BGTA 4R98A 2IC5A 1VZ3A 2QORA 4CQNA 3OPYA 1T6ZA 5LZ8A 4AULA 3UMVA 4QOHA 3DR5A 2YJTD 1ZD3A 2XRFA 4MEBA 4MPDA 1G20B 5DH9A 2QGZA 3UMFA 8MHTA 5A4FS 5DM4A 4Y6QA 5LLTA 1WB6A 1JJAA 4BXOA 1A4XA 3R9IA 5C4MA 4FIDA 4IJUA 3RPEA 2CMKA 3AR9A 2RBEA 3G2LA 4GAEA 4IOKA 4Q9LA 1UMDA 4JLSA 1BROA 2GJAA 3PGKA 1QNFA 3PQ6A 3V3KA 4EABA 1OY1A 2MINA 1SXQA 1IN4A 1T4CA 2ZQ5A 3FCEA 1MRNA 1ZI9A 2GPTA 4FR5A 1FTNA 4N0EA 4P3NA 1IAQA 5FRDA 3CLUC 1KQ3A 4I5FA 3RFUA 5KPDA 1A82A 2QAGB 2XXAB 5L4LA 1M8FA 2P0YA 3GLFA 2OOKA 2DRIA 5L9AA 4M6WA 3A4YA 1U5CA 5IVIA 5E2AA 3KTFA 3HJFA 2J4DA 2H08A 3GQBA 5DM1A 1UL1X 1RHRA 4G09A 2CHUA 1DQPA 2RGGA 1OFUA 3A4VA 3MGAA 3OFJA 4JLPA 1LI5A 1VSBA 4JBLA 4DIKA 2UDPA 3V1TC 3HR4A 1TW3A 3AVTA 2NNWB 2CZQA 2R96A 1HURA 1Q12A 2VAXA 4HO1X 3S8YA 2ZU6A 4XJSA 4EK9A 5B2EA 1L7MA 2HQOA 2TECE 1HKHA 2HJHA 3KOYA 3TCKA 4HY3A 4NPAA 4XASA 3P2EA 3E7FA 1EDBA 3B1XA 4IP0A 2BR5A 3ZYCA 2ATCA 2CUTA 3Q6IA 4DKJA 3JU3A 1O89A 1YCFA 1IJFA 3KDAA 1NF9A 3L01A 1J0CA 3JY6A 3T54A 3PNVA 3LPLA 2JEYA 5TPZA 2XV1A 2JGFA 1CDOA 5LWHA 1YZVA 1W4CA 2Y8EA 5JAHA 3GPDG 4LY6A 4EVSA 1V1MB 1YAHA 1NXTA 1WQ3A 2LVBA 2NT4A 4TS9A 5AJVB 4CTNA 1B6TA 1VB5A 1JA0A 3FHOA 4Q7KA 5FQNA 4EKYA 3FHTA 1PIWA 4PQGA 5HCNA 1PNRA 1VXRA 3WL7A 4NBWA 5B58C 2YN2A 1G6Q1 4B6SA 4W5OA 3OE7A 3A31A 2PJDA 2OQIA 3K35A 1C7IA 3GDOA 2BL4A 1DAMA 3A6DA 1F9AA 4L4XA 4DOMA 5AVKA 3K0AB 3MOGA 2J0QA 2F43B 3V1LA 3VZSA 1FP4B 3JALB 5CK4A 3DHYA 3V97A 3SVTA 1CUJA 2C9OA 1FY2A 1ZMTA 4HN2A 4CKCA 1FTGA 1EWRA 3TOXA 2C2MA 4BUCA 3AFGA 3K1JA 4G0PA 4IV5A 1BVYF 2VO1A 3SXPA 3EK2A 1QO9A 3LC1O 3U7JA 3DOFA 4RJKA 2LWIA 2PANA 4AF6A 4MROA 2I33A 1II0A 3P2KA 3VR3A 3EC1A 1N2OA 4NG5A 4RGBA 5C0OE 2HTFA 3KOWA 2HGSA 4HEHA 1VP9A 5JMTA 5KOJA 1FTWA 2ZCVA 5D00A 1I1NA 2IS4A 1L7XA 4G1CA 4LXIA 3Q9UA 3S70A 3FCAA 4HGQA 1GSHA 4QXQA 2GLTA 1IRXA 1F3LA 1VOTA 1L8AA 1QR2A 3OJCA 3ORRA 3OX1A 4GBGA 1OYWA 1NVDA 4YYEA 3VGPA 3ZIUA 2RHMA 3IQGX 3MWJA 1EXWA 4JK3A 1VCIA 3RIXA 4TMKA 2BFFB 1YQGA 2KX7A 1CRPA 3HEBA 1ZC4A 4INOA 1MT3A 1JR6A 1Y1SA 2TMKA 4IG4A 4BLSA 4AIRA 1JSXA 2ERYA 3WB9A 1R1DA 4RY8A 1Y5IA 3C1AA 1B6GA 1UP4A 3RGWS 1OOEA 1OAAA 1LTQA 2Q3HA 3SC4A 5BOSB 5AQEA 3I45A 3B7GA 1JA9A 3N5CA 1V7CA 3ZIAA 4FU0A 3AEKA 4RENA 5EP1A 5FNZA 1RWVA 1IXZA 1R4MB 2Q5OA 3ZZUA 2NTNA 5EMHA 1XDDA 1GU0A 3BH7A 1E61A 4BMCA 2GDJA 1GITA 1WZNA 1N6RA 2J7PD 2OZPA 1CD5A 1MC4A 3GEHA 3FPLA 2GNPA 5EQTA 4FEEA 3F46A 3GLIA 3WFZA 1Y8QA 3AHDA 4QEDA 5TT1A 3ZNPA 1DIRA 4A8JB 1YS7A 4HDNA 5GGYA 2W8BB 4YRIA 1RCFA 2MYNA 3TDKA 5KNBH 1GGKA 2EARA 1KI9A 5U4QA 1ADGA 1H2YA 1E64A 4KB5A 2EV9A 1NXWA 2JK0A 2Q6VA 3DAHA 4I4TF 3FBTA 1JW9B 1QTRA 3UT0A 1VI5A 1BRMA 1WMFA 4BKOA 5BO5A 4BO3A 4E2YA 4PAWA 5CLFA 2GZAA 4YGXB 2NO7A 2VJCA 1E7QA 2NQ2C 1H22A 1ID1A 1O94A 3OY2A 1JWBB 4O0MA 2FF5A 5D01A 2NU8B 2XADA 4DPLA 2R6ZA 1V96A 4J49A 2JDIA 4EY5A 4OQ4A 5TMPA 1DU4A 1HNZB 4A10A 4R6XA 2Y0BA 5DGTA 1WX1A 4AZ0B 2W6QA 1W49A 1OGYA 5DLPA 2ETXA 4HTAA 4J2TA 4MUJA 1BKSB 1VCNA 1XZKA 2QZSA 3K4PA 1NPYA 4P2BA 3R6LA 3DFIA 4L0DA 4UBMA 1E3IA 1U2DA 5B36A 4EG4A 1FJHA 1XCJA 4IOMA 5ALXA 1DVRA 4K0RA 4Z9YA 3PUHA 1V45E 3TVDA 4DQXA 5BVHA 2Z6UA 1MC5A 1DOAA 3CCFA 3S2UA 5D84A 1FC0A 2BBTA 3TGWA 3PX7A 3ADKA 3B9RA 3FE2A 4DYVA 1V37A 1TA4A 5I48A 5DP2A 1YUNA 4V39A 4WEQA 4UPEA 3ASVA 3CH4B 1O3YA 4LRTB 2VEOA 4ZT2A 3WHIA 1NJGA 2G70A 3IR5A 3IQXA 4L27A 2PA3A 4WEOA 1U2DC 2DX7A 1R9NA 3F8TA 2C7RA 4AECA 3FSGA 2ZYSA 2ZTLA 3AVPA 2WUGA 5JYCA 2W48A 5BWOA 1JIXA 1Q7EA 2RGDA 4IIBA 1KH2A 1U04A 1BWSA 3TNLA 4DLZA 1HT1E 4RF4A 1ZJ5A 4EPVA 1ZD2P 1Z4QA 1SU7A 2A5FA 2DQKA 3RO7A 3FUWA 3B9BA 3S29A 3UK6A 3WB2A 3C41J 1C3XA 5ITVA 2I1LA 3KYIB 3ESBA 2BMDA 2ISSD 3K9WA 3A1NA 3ENNA 4P4LA 2AOUA 2JKVA 4HAVA 1W0CA 2VTEA 3H18A 3RANA 4B7CA 1QH1B 3EEYA 3A25A 2QLJA 3FX2A 1R9MA 4XCVA 2FOXA 2P5YA 1J9GA 2LXNA 2GEKA 3DE3X 2E85A 2F8SA 2Q6KA 3FDXA 4L02A 2ZWPA 3HP1A 5G0WA 1P2DA 4QA9A 1D2GA 1MO2A 4HXFB 4DLLA 2YFKA 2JFPA 1G1MA 2ZSAA 1FJGB 2XA9A 4UE2A 1GKUB 1UMCB 2D54A 2IZ6A 2XTZA 3C5EA 5CT5A 2A0YA 5DM60 5KTNA 5CCXA 1UC9A 1XD9A 2X9LA 1EHCA 4JP1A 3R75A 2E6UX 2RHBA 1NN3A 3QJ5A 1FMJA 3ZEIA 5FR1A 3FRHA 1JJIA 2BJWA 3D1VA 1NZDA 4TV8B 5H8WA 4MRMA 4CETA 1COWD 2DBYA 1WUYA 1OH6A 3JAKB 2VDNB 2X8JA 2WICA 4AAYA 2HC9A 1NVGA 4OJYA 5I7SA 2I2BA 1XELA 4YCDA 3OSZA 3TM4A 3E8SA 2H51A 1H1LB 3HN7A 821PA 3ADBA 2D7CA 4FMDB 2W6NA 1DBVO 3GMSA 4M49A 1XTZA 1RXSA 2ROQA 1KYIA 1IY2A 3ZWWA 4CCYB 1V3VA 3IS3A 2JLWA 3DBRA 1PJBA 1DJQA 2FFRA 1OVMA 5IKPA 4LW8A 4BMZA 2XOKD 3B78A 3VPCA 1UAYA 1HE5A 2PV7A 4MP6A 4YA6A 5BQPA 3VZBA 2QQFA 4O4IF 1QIDA 4EA9A 1Z34A 3B1WA 1NBME 5ULLA 3PIRA 2P2ZA 3D4BA 1A5SB 4Q9DA 2Q4TA 4R0MA 2VNSA 4ZALA 4F4IA 1BS1A 3CUTA 5CRIA 4EJ6A 2ZCJA 1QG6A 1S3GA 3VX3A 2BFPA 2X19A 4GSYA 3ANNA 1TA0A 1X9IA 1J1ZA 1QSGA 3I53A 5E8RA 4G97A 4PICA 2W42A 4P58A 3L9WA 4JA2A 4WCFB 4C0JA 1W88A 2PHZA 1GKLA 3I72A 4G5XA 5KTRA 5JG7A 1SXJB 2W6IA 3G2IA 3PYXA 4NBTA 3W6ZA 4KPUA 3OOYA 4JB0A 1MJ5A 1D9XA 2X0JA 1DP4A 4CLHA 4Z1MD 2HWWA 4U2CA 4D8WA 5CFNA 3TQIA 5LD2C 2AFVA 4LBWA 4AY3A 5CLIA 4CF7A 1Y4SA 2P2NA 4EMTA 4JBWA 1DBWA 2P77A 3SBDA 3AJ8A 2O6HA 1EJ2A 1Y5RA 4KNWA 4MR7A 3I23A 4J6FA 3QTBA 4TQAA 4A0QA 5IBCA 1E5TA 2OXEA 5K2MA 1RLTA 5EJGA 4IIEA 3VYUB 4BTLA 2O8CA 5CX1B 3DKRA 4F97A 3QGMA 3AT1A 3X43A 1ZN9A 2F1RA 3P0HA 3M1IA 1G9TA 1WP9A 3GD7A 4RK6A 5FLKA 4CLOA 3OZSA 2IVZA 2C1XA 2XDWA 2VP9A 3LOUA 4JB3A 1Q15A 4LYEA 5FORA 4ACAA 2QLNA 5BWCA 2YY5A 3RJ5A 2XTNA 5KCMA 4BBJA 7AT1A 5I7VA 4HNRA 4NLLA 1ZH8A 2HA6A 3EZGA 4BX3A 5HF9A 3NI2A 5A3JA 1FMLA 4O4JA 1JHUA 1KMNA 1Z35A 2ILTA 4NOKA 4UXHA 2CBXA 5BW5A 4EAQA 2FCRA 1P7YA 1I4TD 1Z07A 1UMDB 4MGZR 2OFFA 2EL7A 3VNSA 3G8YA 3LECA 3M6MD 3C3CA 3RUPA 4ER5A 1PGQA 5ELMA 4PGHA 5TS3A 3LT5A 2HYDA 2KB0A 4HWKA 4HDSB 2C5HA 2P30A 1PEKE 4OQMA 2Z8YA 4TWJA 1EK6A 1DO2A 3WK7A 2GFHA 2VYCA 2AI1A 4GVPA 3EXIB 1GPUA 1KJIA 3U4MA 4UM5A 2Q3BA 3PFBA 5KYUB 4KXFB 3I30X 3W5AA 4RACA 1SBCA 2YYAA 1EM8A 1L5ZA 3LLMA 1OKKA 4HEJA 3ZGYA 1RZRA 4NSNA 4QGAA 3A37A 3MCAA 4CEIB 1YJ5A 4FSHA 3LRTA 5KOJB 1SXHA 1US8A 2A5YB 5C81A 3U9TA 2WHQA 5AVUA 3QWIA 4WGGA 1TVEA 1T1EA 1Z16A 1HT2E 2VDWB 5DNWA 5D51S 4OLAA 4ACBA 5AHOA 2K6GA 1TGVA 4LDPA 4LK2A 4LJ4A 4YRMA 1QLHA 4NCNA 3KCNA 3JWHA 1CFZA 1DG1G 5D1NA 2CLKB 1E2JA 3G8DA 3RKRA 1OYYA 1XYVA 4E3WA 1M6WA 2JAXA 2JASA 3L02A 4A1FA 4MIOA 1P31A 1B8PA 1Y3AA 2YIMA 2D1FA 2GNOA 4EX6A 2OGZA 3UFBA 4EENA 4R51A 2CJYA 2RJ3A 3ENVA 3COYA 4AP5A 3FGNA 1CVLA 4TTVA 4BUZA 3ICVA 1NI3A 4O6VA 2GBFA 4JS0A 1P1KA 2GCEA 2EVWX 4RF3A 1YIDA 5I5GA 2NYAA 3F2IA 1QVAA 1AA9A 1TFUA 1PSWA 5E1OA 1XMPA 1WBBA 3QBEA 1CZOA 1VG1A 1K6IA 4M1TA 1U0HC 5LBTA 1A98A 3LYUA 3SM9A 2GBGA 3UFXB 1WY5A 4EHDA 3NP7A 4OM8A 3L0PA 4I50A 2CV0A 5IRCD 3BCRA 2Y2UA 4GKBA 1O94D 4EYQA 5IEJA 4PIPA 3UMBA 3ZV3A 1U1DA 2A0XA 4ALKA 5T5QA 3KYBA 3EIFA 1LC0A 1CUAA 1FLVA 3OAAD 3QITA 3DEHA 2HJWA 2IUTA 2XNKA 4LSGA 2OZLA 2PWBA 3SC6A 3L1JA 5BN4B 1JUDA 1G16A 3L40A 1XZQA 1CUUA 3OZEA 3TD9A 2IJGX 3F6SA 5DV9A 4TS4A 3VH4A 3KKOA 3K20A 3A2KA 2QX4A 4ZYLA 3JS5A 2D2IA 1JEDA 1HUQA 1XLUA 2QOEA 3O4RA 4WKPA 2W4QA 3CW8X 2WOJA 1XNHA 2B25A 4ND7A 2VWPA 2BFDA 1MPTA 3I6YA 2PS3A 2OT3B 3EQ7A 3TL2A 1MX9A 1NTRA 1R6TA 1X2EA 2QUJA 5GIOE 1CZUA 2W2KA 4NBNA 2I1QA 1F2UA 2XDQA 1QO0A 4JSRA 1YZKA 4JEUA 4EYKA 4BMXA 5FDFA 4Q3DA 4B79A 5CA1A 1TYBE 4S1NA 2EKQA 1ZO8A 2GILA 5FOTA 5LQAA 3F6PA 2X8AA 4H4DA 4OPMA 4XM2A 3O26A 1KVQA 1GQOA 4NAVA 3BRCA 5MN4A 4II3A 2JLCA 4JODA 5LLDA 1N9GA 4OI0A 1XNQB 1NVMB 1UDRA 3RVJA 3E70C 2JFBA 4G5QA 3WMRA 4C1NA 1BN6A 2IUSA 5GZ3A 3BRSA 1OHHA 3BK2A 5KYGA 1N6PA 3VNRA 2FZCA 5CG1A 1FP7A 3VSEA 2QQ0A 5DULA 1V8DA 3RUAA 2VUTA 1ELOA 3VZPA 3IEVA 3NC1C 4K5QA 2J08A 2LUOA 2VBFA 4F4JA 3OOWA 2H29A 1YHNA 1H6AA 1QE3A 4DA7A 1QG0A 3PDJA 1QCYA 1U02A 4YJFA 4RXTA 1ZRMA 2WTEA 3T5PA 3WL3A 1NLZA 5ALLA 1JG6A 3NC4A 2C2HA 4A73A 4Y2RA 2INGX 1W46A 2XIJA 2EFJA 3HJHA 1DIHA 1EU1A 3GZ4A 4M9RA 2AD1A 4DTCA 4IOLA 2QS9A 4FMDF 2J7PA 5IMSA 3FDZA 1QGUB 5M34A 3QKTA 4M0CA 1F7UA 4QUIA 3BREA 2F8MA 5K03A 3K3PA 4L15A 2WG2A 1M67A 3BERA 3B20A 3UATA 1HBJA 1WOMA 1X7ZB 4GMXA 3U0BA 3CZQA 3U3RA 2P62A 1DRJA 1K6EA 4B32A 3W8DA 4Z53A 3O4JA 4LRWA 4FP9A 3FSRA 2AOXA 1MRZA 2A1TS 2IXDA 3GBVA 4NCHA 5JISA 3EEIA 3OLYA 4OXKA 5FA6A 1I2DA 2R47A 3U49A 1VYVA 4FHEA 4R8RA 3QVMA 4MULA 2YN0A 4ILEA 2H18A 4XFJA 5A7FA 2P27A 4F7WA 2ADMA 3CX3A 3Q41A 4RMIA 3DAGA 4X8LA 4HKTA 5AKGA 3TLAA 4XLTA 1NAIA 3F1KA 4K88A 4B7XA 3GGJA 5JYDA 2RI0A 2QSUA 2VQSA 4PEVA 3MTBA 1K4YA 1SFRA 2ZTSA 4QHYA 2AB0A 3LLUA 5CFOA 1ZN2A 1CQJA 2PTGA 4ZAFA 1U2ZA 5HKKD 4PAQA 4RMGA 3VO1A 1E2LA 1RZVA 5A7GA 5J58A 2LIPA 1X19A 1YS6A 4P7KA 3GDFA 4BNVA 4MQFB 1Y8QB 2GETA 2J0EA 2QP4A 1J90A 4TMWA 4L95C 3TTSA 3EVBA 1IVNA 4F96A 4AP9A 4BJ6A 3PWSA 4A2WA 3M6FA 4RJIA 2QROA 4HAWA 2YV5A 4I6GA 5DM0A 1UR5A 2QTTA 3WI7A 2REBA 5IK2D 3RFCA 2ZZMA 1OROA 5DASA 5FYQA 4FQ5A 3VDQA 1MJGA 4BO9A 4E5VA 2F59A 3NJ8A 4HUJA 5KINB 1NPDA 3JZFA 1RC0A 1CS4C 5KJ6A 3QV2A 1XSEA 3TW0A 1EYZA 1FP6A 3LCCA 4Q48A 5AWFC 4WZAB 3OU2A 3TLYA 3EPLA 3USCS 4CQMA 1FJXA 1V2GA 3BJEA 3UWDA 2ADFA 4D2IA 4ZCIA 4MUGA 4YTEA 4HXGA 4O4JF 2PGDA 2WKSA 1E7MA 1U9JA 3HXLA 4DJEC 1OX4B 4EKGA 5L4NA 3K70D 1J06A 1R74A 2ZR9A 4FMBB 2X7XA 2Z04A 1C8KA 4BO8A 4RTQA 4GPBA 1TRKA 3WGOA 3CR8A 4RCYA 1BYIA 3ECSA 4WY8A 2D0PB 3DQPA 1FL9A 2WWFA 1AKNA 2O0KA 3UEOA 3JD2A 4C76A 4OOFA 4KXWA 4XWGA 2Q29A 5IXSA 3B89A 1FFHA 1QCDA 3VV2A 4M8SA 4Q82A 3HI6A 2QP3A 2B8WA 1VTKA 2CHQA 1SBHA 2G9VA 4GXNA 1WB5A 4EARA 1HL3A 3L7CA 4YRLA 3K71B 3FH0A 1M6HA 1NJ1A 2Y6UA 1JLKA 2DSTA 1G21E 3M6AA 2FW0A 2PPLA 4MK4A 4LYJA 4KVFA 1GPKA 3DLHA 3ICWA 1LRJA 2MSNA 1UMBA 1N5OX 2VBCA 4FJ0A 5B2ZA 2EGHA 1XA0A 2GEUA 1REQA 3ONNA 4JXZA 3WWCA 3T7RA 1CUGA 1CY6A 5EEHA 3BIFA 3OI7A 2ZTUA 4Q4JA 1XTVA 5D5PA 3ZWDA 3L93A 4BNGA 1R0WA 2X77A 2E49A 4ZU3A 5BW8A 4BAZA 2PH7A 1U9CA 1XYGA 1W96A 2IEBA 3EGOA 4FK8A 4KFUA 4O4HA 4PFJA 1LPNA 3QRWA 1O6GA 2G88A 3GB9A 3E0XA 2CVHA 1SKBA 5TC4A 4HRVA 2R1ZA 2BJHA 3AEZA 4GXTA 4JQYA 4JH0A 4E1AA 1MB0A 3M6WA 2AKAB 2NIPA 3BD8A 5LA6B 4B6FA 2ONKA 2YUIA 3GG9A 3KCQA 3FLBA 3NDPA 4LZJA 5DLQC 1NFFA 3AUUA 2RBKA 3THWA 3WHPA 3Q2IA 3LUKA 4HVCA 4QG7A 4MQ5A 4QNNA 1YCGA 2WE8A 1UBNA 4DNXA 4KQ6A 3H2ZA 2MSCB 1TJNA 3AI2A 1LC3A 5KQGA 3Q5GA 4YJFB 3VH2A 3K73O 4W7IA 1WD7A 1SKYE 2PFGA 5EIHA 2QMOA 1A50B 1I33A 3O75A 3NYQA 1ONNA 3BXPA 3LBAA 4G5FA 4ALNA 4QIHA 4N3CA 3KDSE 3I6IA 4EVQA 3EA4A 1X38A 1TJ4A 4MYDA 4I7EA 3L8MA 4MRMB 5CYFA 4UBLA 5JTTA 1P4AA 1EDOA 1GPJA 1YMVA 3FPCA 2IZ1A 3GUCA 4R1PA 1VG0B 3HU2A 4JT2A 1HFKA 1JTEA 1JYFA 4ZRDA 2UYOA 2HXYA 2BSQA 4CM8B 2JVJA 3A6LA 1Z22A 3NEAA 5ALOA 1K7XB 2IW1A 3SM3A 1VE7A 3ZBTA 3L4SO 5ALWA 2NPOA 2P91A 3AF6A 5JAIA 1RIIA 2I4OA 3R0QA 5A6SA 3GPLA 1BA2A 2JIBA 3L82B 1QHIA 1IHYA 5FL3A 2IPMA 4QU9A 4QXAA 3WSTA 2W4IA 1II8B 1IHUA 3MBIA 3OZAA 2XUIA 2R1TB 3ETEA 4I14A 4N0DA 3ZH9B 3L8FA 2QP9X 3WGQA 1IWOA 2BKVA 3FAKA 1JQAA 2JZOA 1G3RA 3DBHA 4IHAA 4NATA 4A03A 2WSBA 2R1UA 4GYKA 4M36A 2WIFA 4RHCA 1T3HA 1ODIA 2X9GA 3NHKA 3UH0A 1BXRA 4A8TA 1N77A 3PJRA 4H4EA 3KP1A 1GM5A 1SUSA 1AN9A 2AUTA 2HSGA 2PAAA 5FF9A 3ZHBA 3EQZA 1PR3A 2D8AA 2BKXA 3T1TA 1A69A 3GLGB 5K09A 4DCVA 1RBQA 2ZYGA 3MG9A 1CZHA 1NRWA 5CDTA 1DC7A 1M3SA 4AF8A 4BV9A 5FADA 4HVAA 1AE1A 2FZKA 2F6RA 3KXIA 4NJMB 5KIAA 5AI4A 1EFRA 1DTWB 2FWAA 2PGJA 3CG0A 2W4MA 5FNVF 3RS0A 1YGPA 2B2NA 1YF3A 3J80A 2YVUA 2C1ZA 3ZE7A 4KH1A 3EA5A 1M7BA 1MFPA 3M5CA 4UVHA 3UQZA 3WR5A 4LSZA 1SG6A 2R7AA 2ZAGA 4V24A 3PQCA 5J63A 2C96A 4J0KA 4BECA 5L6LB 2A57A 2NO5A 1JBQA 1XN1A 2OORA 3GP3A 3MWGA 3PT9A 4WOJA 5DCWA 1GCAA 5G0UA 2OL4A 2Q3EA 3BD6A 1WPRA 5L3QA 2QZJA 1YZUA 3WBKA 2J85A 5CJ2A 2FG5A 4IIGA 5EERA 4XWWA 1XDWA 4D9CA 4JC5A 2O19A 3LL7A 1RQRA 5JEDA 2KW5A 3C3KA 3OIWA 4BB5A 1MHTA 4LWQA 1VPEA 2Q9UA 4YRZA 1K8YB 1YZYA 1XP5A 2FG7C 1CX9B 1L5MA 2DLNA 4P7FA 3WK4A 2YYYA 4MINA 2D00A 1NM5C 4ZDKA 1SURA 2BGIA 3JQPA 4BOYA 2XITA 3PDUA 4QEZA 1FFBA 2JIOA 1BOFA 1U5AA 3EIQA 3LI2A 4U6SA 5FIUA 3O9MA 3TLEA 3C87A 4A6PA 4G0VA 3QEMB 1KYTA 3LT1A 3DTVB 4ZOBA 3D2AA 4N8DA 1Q5PA 4EGSA 1VBMA 5HE8A 2WM9B 5C8YF 3PNPA 5B4VA 4BQIA 4Q6BA 2KE5A 1P5FA 3FA2A 3EC7A 3U09A 4UHDA 1PKEA 4FYPA 1QH8A 3L0IB 3L8EA 4DMLA 1ODSA 4YJ2B 2F2TA 5CNIA 2PBRA 3E3MA 3Q6MA 3TZQA 3ZGNA 1H65A 5CDGA 1GA6A 3QPDA 1AZLA 3CSUA 2C7PA 2C9CA 3IJPA 2BGKA 1T1SA 1YJCA 3AF2A 2BZGA 3QBJA 4DLUA 4QYMA 4XOIA 4Y7CA 1BKYA 1AS0A 1JVNA 4L6IA 1KE1A 3T0FA 4KK3A 3THYB 3RTAA 1CZRA 4N48A 2OCXA 4F5DA 1UBSB 3VAZA 2VG8A 4BE4A 1XMOB 3MF4A 4HSEA 1A9YA 1N9GB 4DLWA 3OIYA 5JZMA 4B74A 1LX7A 2GZMA 3RG2A 1YQDA 4FFPA 2JA1A 1NP3A 3U5TA 5AVYA 4MVWA 2WJJA 4LSWA 5AK4A 4CHGA 5FHRA 1P45A 1X6VA 1Z2CA 2ZUBA 4N7RA 3AWDA 2XJ4A 2WJAA 3QXHA 5CD1A 3AOEA 4OIMA 2QUBA 1INLA 2Y1KA 1DKLA 2VWQA 4MVCA 4QSHA 1YDFA 4BFYA 9ATCA 2R00C 4WA8A 1Y63A 2A3RA 3P9CA 5AW6A 5FEMA 2BD0A 2EDAA 1IZZA 2VR1A 1OI3A 3QPVA 1ONBA 1IXYA 1TTTA 2OHXA 3FCSB 3QU2A 4Z7NB 1HRDA 1UOPA 2J6HA 4KI0A 1TU4A 3JVVA 3RVSA 5FUMA 3WSWA 2AEFA 3CYFA 3VYRB 1RWNA 2J0UB 1EZZA 2CXOA 1U1IA 3E5RA 1R6XA 5BN4A 3FB1A 2RK4A 5JECA 4M53A 1E96A 4UTZA 5JTUA 4FLFA 1MIOA 3T38A 4PE5B 1ZCJA 4QUDA 3L49A 3RAPR 4A8JC 2NVWA 1JIVA 2WKRA 2XRMA 4HNHA 4BAUA 4BVEA 4YV2A 5A03A 5IN4A 2GBPA 3DZIA 4LUCA 2X4IA 3KZMA 1GLVA 2Z5VA 3BTSA 1JQEA 4R9NA 1F8FA 4FMCB 2CFIA 4UE3S 1CIPA 3NASA 1AM4D 3NZEA 2XCSB 1CNEA 1K8ZB 1BXGB 1KH1A 1ZHOA 5JRDS 3AF5A 4KUEA 5FV7A 1ECGA 2H1IA 4XIFA 4EB0A 1OH5A 1T8WA 2VPZA 4UDOA 5ESRA 5A9RA 1I0LA 1RMTA 4N5MA 4FCVA 2OCBA 2AJDA 3A6GA 2OILA 4HS9A 3AETB 2MU1A 2WM3A 5IK2A 1F9EA 7YASA 4I6EA 2ZIXB 4KK4A 4RLFA 4E31A 3NXSA 2W2OA 1L7BA 2JFOA 1D7AA 1JTFA 1U2SA 2XLBA 3BMNA 1OXXK 4QNMA 3SYKA 2GKSA 4M7PA 2AFRA 1XD2A 2UZAA 2XCRB 4M7OA 1HEYA 4LBVA 4NJMA 3BDAA 4JMPA 3D2LA 2C9BA 2H9YA 1X14A 4JYMA 1IY9A 4WK0B 1NVTA 2WZQA 5EIFA 5CB6A 1SZJG 1WXGA 3CX6A 3FKQA 3H1GA 4IR7A 4JJFA 4JLMA 5ERXA 4BQQA 4D5GA 5L95A 3GNTA 1K6MA 2GJ9A 3MD0A 2IBTA 1FFEA 4D25A 2RJOA 5F3DA 3AX6A 1ZY2A 4PCLA 2MSKA 1T2EA 4ONEA 3M3HA 1C8VB 3DZFA 1V8BA 1TRHA 3PSAA 3RWBA 4KQXA 3CZAA 2CHVA 2O5CA 3FWPA 4MPRA 2PSEA 1XNGA 1GQYA 4RLQA 1G2PA 1XJCA 1HYBA 3RUFA 5BVGA 2R6CA 5EKXA 1QUEA 1F1BA 1ZS9A 5H4HA 3T1QA 1GDHA 4QE3A 1QHNA 1J0EA 2QN3A 3UVEA 3KZOA 4DNQA 3FTEA 4S1OA 3IUSA 3K6KA 3HE3A 2BP7B 5DBIA 5H81A 1L6RA 2B6NA 2FTKE 5AKIA 5HPYB 3WX0A 1W19A 2G7MC 3DDHA 4O2LA 4QOEA 3WFJA 3QELB 1UOEA 1KPGA 2F1HA 4XB6B 5L51A 2E2WA 2FQWA 1QLJA 4M0LA 3CR7A 3R3HA 4DWJA 3LC0A 4KQ1A 2D1TA 3PFIA 4FC6A 2JHAA 2W6ID 2N0SA 3A4LA 3NP9A 4P3XA 2PT9A 2XODA 4CMHA 2H1LA 2JJ1A 1UJMA 1JDBC 1HNNA 1EK1A 1N5IA 2UVQA 4GPD1 4UD2A 1M6VB 1WHSB 3KAKA 1D2AA 1EP9A 2XF8A 4G25A 4FYIA 1C4OA 1UKAA 1IQPA 1XZGA 3ENKA 2JJQA 3HDGA 5I8ZA 1TADA 2TRSB 3I73A 2OCIA 4Q1VA 1ONSA 1XZIA 3LUHA 3NHMA 3W2EA 4HUTA 3QPWA 4F3YA 1COZA 1ADBA 3PXDA 3AKDA 2D4HA 4DG5A 2V7GA 1S2DA 2CNKA 3MXOA 4OHVA 3RYHB 5C32A 1BDIA 1ACJA 1SKUA 2ZATA 2E4ZA 1E6KA 1ZD8A 3DZJA 4RCVA 4LGYA 4YN3A 4E1BA 3ICQB 2QBYB 4PLWA 2VF2A 3N7UA 2ZUCA 1EZ4A 3IB3A 4IXNA 4Q4JB 2YN4A 3CZ4A 4R2KA 3ILSA 1K3FA 3DLPX 2I54A 4J8PA 4EIWA 3QVGB 4XWOA 2ZPTX 2R1VB 4A5OA 2XBMA 2NV6A 2P1DA 4WFIA 4KBFA 1O03A 5KVAA 5KAMA 2NZYA 1F51E 1ST2A 3AM3A 3JPWA 1N2CE 2R2GA 1NXVA 4UMDA 1UKVY 2ZYTX 3KR0A 3PC2A 3ONFA 2FPPB 5ICFA 1J8VA 4DC1A 2IITA 1OJLA 3IA2A 5TMDA 3DR3A 2WZCA 3A9SA 3K0CC 3T15A 1Y4UA 5I4KA 4AT1A 3ZZ0A 1YVRA 3KU1A 3LKZA 3WLIA 3U61B 1TYAE 4KSCA 5B7NA 1BMFD 2WTBA 5KHOC 1AB6A 3D4OA 3OBIA 3ZEAA 1O9HA 3I2IA 3GCZA 1DQSA 1E18A 2WUFA 3ANXA 5KDDA 1O94C 2RJNA 3DKPA 2QAJA 2E3JA 2IFTA 3AF1A 1W85B 4K1XA 3SE0A 4DRZA 5FV4A 2FSPA 5LOVA 3JQGB 1J25A 3FOBA 3M6XA 2DKOA 3BILA 3HRIA 4TLEA 5BV8A 1IG0A 4E88A 1I6KA 2WNHA 1JJFA 2HPHA 2Z5FA 1OI4A 2ZYUX 4MAAA 1D4ZA 4W6ZA 2C77A 5IBQA 5J5CA 4DUPA 1KEKA 1Z29A 1U9IC 3ZN2A 1A96A 2GN9A 3QKRB 1NUSA 4PGGA 3RU3A 3C3BA 5HKLA 4E09A 4P34A 2DFKB 3Q88A 2BISA 2BHNA 4ME6A 3UC9A 2I8LA 5EYPB 4RSGA 5K9ZA 1QOZA 5EP4A 4RC9A 1T0BA 1Y37A 3KO8A 1K9VF 4XGIA 2QD4A 2HHHB 2HDHA 4ZK6A 3HN2A 4I3HA 2YRFA 4ZVKA 2G71A 5EWJA 2CXSA 4QBHA 4GECA 2X5JO 2WU1A 4K9PA 4QLAA 2WU8A 1UZAA 4NXMB 2POCA 2YV2A 3AIIA 3GFTA 4XQ0A 4C0LA 1YJ8A 2HA4A 1KVUA 1KQOA 3AETA 1GXSA 2JL1A 3CUVA 3WKDA 5A9TA 1N5DA 1T9HA 4Y8VA 1JDNA 4FE3A 2QN2A 4OJNA 4YUYA 2IPLA 5HRAA 5IWCA 4O4HB 1Z6AA 1Y7PA 8GPBA 5J4KA 5K8LA 2FR0A 2YS6A 3CVOA 1GPYA 2Z2IA 3FUTA 2G5GX 2YXDA 4D9IA 3K6SA 2FPGA 4E5UA 5JC8A 4RHUA 4R84A 5BRNA 4KQHA 1QYRA 1Z36A 2JFNA 4ZZ1A 2H1RA 1C4XA 4CL2A 4FWTA 2JI6A 3MCUA 4GOJA 2HT6A 1ITZA 5CVUA 4PPYA 1KSFX 2A5JA 1XCOA 5EMLA 2JCSA 4QUJA 2UKDA 1QG4A 3G5MA 5C51B 4DIFA 5HS4A 2DQSA 3VKHA 5F5XA 1IEVA 4LKOA 3L0BA 3Q10A 2OGUA 4Q4HA 1K2VN 4WT7A 1XF1A 3AJ9A 4QDXA 3S2IA 3VKVA 1TQ6A 4YR7A 3NT5A 3EVCA 1TAUA 1SVOA 3HA2A 4BNWA 5H3HA 4AJIA 3MNFA 2FCAA 1U0NA 2UV8A 3K9HA 3P9ZA 3T12A 5JCZA 3DHNA 1QHHB 1JHMA 1FUUA 2WMOB 2Y67A 4R2WA 4B40A 4ES6A 4JFRA 2O05A 3EH1A 5D3MA 1RXCA 2DPXA 1OLXA 2B21A 2V59A 4BQFA 2VPXA 3F3YA 1MAAA 2J32A 5DGCA 2VT2A 3N8IA 4DL9A 1I3CA 4HWRA 3T5GA 4HQRA 2IYZA 2PZKA 1I3MA 1WF3A 1YJQA 5E4YA 2R8YA 1YS9A 4FHFA 1XPRA 4OTZA 3T52A 5JRJA 2HCBA 3DXXA 1RRMA 5EZQA 3RT1A 5DI9A 1CY1A 2BJVA 3WRXC 3NBFA 4EGQA 4YNBA 3KQLA 5K3CA 3THXB 4MQUA 4U0KA 2W37A 3B3JA 5JYBA 3NEJA 3KPUA 2GYYA 1FU4A 4WN9B 2R9VA 2L19A 1WPQA 2WWWA 3U26A 5A5FA 2OEPA 5EJ5A 4JT9A 5GY7A 2PMBA 4P83A 3SS8A 2H2WA 2CSUA 2C82A 3SEQA 2HF2A 3R20A 3P9XA 3PWTA 2O07A 4MYCA 3QEOA 3S2FA 4F72A 4I4IA 2HHLA 2A94A 1ZZGA 3RW9A 3F7NA 2EKPA 1YVUA 2IHVA 5IAKA 4YECA 3NT4A 3WGVA 1LLDA 3DDCA 4P81A 5MN5A 1BCRA 1WO8A 4IZIA 1VCHA 2BCEA 3CGWA 4D56A 4ENSA 1NLYA 2R8EA 2CY0A 4IOJA 1XMIA 4KKVA 3STVA 4L5JA 1JAIA 1H05A 4DF3A 1XVIA 3MRVA 2HQSA 1GNQA 2PJZA 1ADYA 3IX7A 4FKZA 5TR9A 4IWXA 2WU4A 4GBED 4B7AA 3VDMA 5HQTA 1JEYB 3D3NA 1QH1A 2Q9BA 5DEIA 4BY9E 5KNCD 4HNAA 3ZG6A 4AZWA 1NLUA 2C5EA 4OATA 1QVZA 1F6DA 1AGYA 1SUPA 1Z88A 1UPTA 2OUKA 2QRZA 3UHJA 2C57A 1PTJA 3GPIA 3KIPA 2M6LA 2FMTA 1YFJA 3E9NA 1WSDA 3B2NA 2X9NA 1P60A 4L8FA 4YALA 5LB2A 4DIOA 4EBFA 2GTPA 4HYYA 4NBRA 5TPWA 2XGOA 3HGQA 3MT0A 5LZ9A 1ICIA 1M33A 4F2DA 2W0MA 1C7ZA 4RKQA 1U3GA 1HMPA 2WY2D 4EB6A 1XL1A 3VR4D 5L3QB 3FY4A 2N47A 3M83A 3PRKE 4XWYA 3IJRA 2IZ5A 2O0MA 4P5DA 5L6MB 1YFKA 5BV7A 3PQEA 2CLFB 2ATIA 4I2NA 5LZ2A 3I5YA 1GCIA 1EDZA 3NGMA 4G23A 2WG0A 1JDSA 4OQEA 3WRWA 4BVJA 1U7WA 1NRXA 4RH3A 2V8BA 1EFDN 1XZAA 1THTA 3F6BX 3NLLA 4K9QA 5KNCA 2MDTA 5SZKB 3TNYA 3MYRA 4F21A 5BW4A 3ML1A 3UT6A 4BKQA 3NAQA 1AGXA 4KXNA 4UUOA 3PGVA 3B5JA 4IS3A 5CMLA 2GK7A 1OBCA 2IYRA 3JQQA 4X65B 1UJ4A 3QFTA 1ULSA 3GWZA 5A4KA 2XZDA 4FSDA 3O21A 3IQDB 4UEJA 3ZI7A 4DJ5X 5L7WA 3Q5DA 5HNKA 3FCCA 1GLGA 2QI9C 3T3IA 5DJ5A 2BONA 2JIRA 4Q5IA 1NXQA 3WDMA 2PSJA 4F9GA 5FLXA 4R9SA 4I66A 4GZLA 1F2VA 1QGAA 1RIFA 3RWMB 3LUCA 4RNDB 5JNLA 5JVDA 3HLKA 4NU0A 5KQMA 1GG5A 2JW5A 2Q3MA 4NKRA 1DZIA 4WNYA 2ORVA 3DGEC 4NWIA 2CC2A 1KZ7B 1KAEA 2QAGC 1HDYA 5ED0A 3VH1A 3K6SB 1IVSA 3HFJA 3NHZA 4H31A 4Y9UA 4UU8A 2I2XB 4OHPA 5EJ7A 1Z0SA 3R7BA 3T3GA 3WLQA 3CF4G 5K51A 4OJQA 1NBMD 1DMRA 2UAGA 3GQVA 5C37A 3W1WA 1EVKA 1W88B 4LC0A 2PRYA 5CJJA 2O52A 2RB4A 3M6LA 4MV6A 3X3HA 1TCUA 3RVKA 3LGAA 4M89A 2Z4SA 5CBPA 1XD2B 1Q2XA 2HMAA 2HPVA 3X1JA 1EVYA 1WZCA 3VOTA 4MJXA 2DHQA 5HIKA 3LF1A 3I09A 2HF8A 3IKVA 3GRCA 4IUYA 4C88A 4EKEA 5JD5A 2YNMC 4I1UA 4Z2AA 4HNQA 1CS0A 4B71A 3DKVA 5DGIA 3AB8A 1J1IA 2OVBA 3LHIA 4PYIA 6YASA 4CM9A 1LI7A 2Q6IA 3W9BA 2RAVA 1GCOA 2N46A 5EAIA 1OA0A 2I1WA 4HWSA 4B48A 3LDAA 2EGGA 2BDEA 4C4ZA 5BVGB 1MX1A 3WG9A 2XOEA 3I3SR 2CL0X 4R0NA 4GZ3A 4Y2QA 2RCNA 2G7ZA 5B4UA 3UWKA 2NZVG 2IOYA 3CEPB 4MV5A 4JBXA 3HJUA 1NW9B 3PTZA 4FX2A 3EEOA 1Y8ZA 4YRAA 4FW9A 4BU1A 2P4EA 3GGOA 3QMMA 3SYTA 4MLPA 2PJUA 3GJ7A 4QTUB 2Y1FA 1FE8A 1TCAA 1RAGA 2W2NA 2GVDC 5FBZA 5J23A 3IVMA 5EUCA 3TBHA 3WE7A 4GVLA 1CQZA 2X7HA 2JDID 4Q7JB 5JQWA 1BA3A 2P1RA 3ZGOA 2HMSA 4KWIA 5HRCA 3VAYA 4KPYA 3H2GA 3C3XA 1AB5A 4CN9A 4DM4A 5CB4F 5BQFA 4LE1A 3PV0A 2SICE 4LWOA 3WP1B 2DHEA 1DUVG 3S99A 3NTQA 4RS3A 1P1HA 3LSTA 2VPPA 3ED5A 3N8DA 4XAQA 1TLLA 1WD5A 3U4HA 3A14A 2R0QC 2EP5A 1BO6A 2PN1A 3L8GA 4AYXA 3PA8A 5CBKA 3A6PC 1X77A 4LMRA 4M9UA 3W79A 3TIGA 1P2UA 2XWJI 5C2JB 1JEAA 1TD9A 3R9WA 3NHBA 5KNBD 2VNHA 1ADFA 3RKUA 2MMCA 2EG9A 4YMTA 2JBAB 1DCMA 1N57A 3MMPA 4N54A 4ZGWA 1D9ZA 5AKJA 3T41A 4C4RA 2MR5A 3Q3HA 3U44B 3G89A 3HHEA 3W2GA 4IF4A 1KU6A 3BXZA 3OY7A 3SEAA 4TZTA 4C0WA 4C6SA 4KTVE 3PXEA 4DZRA 4EMSA 4OXNA 2DERA 3MPOA 3AHGA 2YMMA 3LX8A 3H4VA 6Q21A 4CR7A 2JLBA 1CQPA 3X2FA 1NE2A 4KITB 1N2EA 1AMUA 4U00A 1YZ3A 5AH0A 3MGCA 1VYHA 1GAEO 4WNAA 4WV3A 4DTIA 4RGYA 4CIAA 1C0EA 4F84A 2NUTB 1JG3A 5DRTA 2JATA 1BDBA 2C00A 2OB2A 3GO4A 4JL8A 3A6KA 3T9BA 4O2BB 3SQWA 3WIEA 4YCCA 3EPHA 1HQCA 1D2NA 1D4FA 1FTSA 1ND6A 2PKXA 1N7HA 4PXAA 3NHFA 1WW3A 2JC3A 2AK2A 2I3DA 3L43A 4HX2A 4X6YA 4X7MA 4MWGA 2O3QA 4UXJA 2VPQA 3W6UA 4HGOA 1N2XA 2X0NA 2H2HA 2RKOA 3KHTA 3WGGA 4YCMA 1KI2A 3GT3A 2WABA 1CY0A 1ZUIA 3QUBA 5K3FB 4R3UC 1QE0A 2JRCA 3PXCX 4JC0A 4HS4A 3TMAA 1VJDA 2QNRA 1S6YA 3ISTA 3VR4H 2FE4A 5J4HA 1CVIA 2Q5IA 3G88A 2VNIA 4Y1EA 2ZVPX 2PWYA 3BXGA 3FVVA 3UHFA 2YZNA 2QRGA 3SYLA 2FXVA 3SR3A 1E4YA 2PNFA 5UKDA 5JR3A 1E1RD 1PS9A 4BV8A 4FGZA 2RGRA 1E5VA 1NY6A