4EB8A

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with dadme-immg and phosphate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
288
structure length
288
Chain Sequence
TLMENGYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANWEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eb8A00
1B8NA 4OEHA 4TYMA 4TTJA 5ETJA 3PHBE 4QAQA 1Z5PA 1JDVA 4D8XA 4I2VA 4DAOA 1YQUA 2Q7OE 2HN9A 1Z5OA 3OOHA 1SQ6A 3NBQA 4E1VA 3IOMA 1V3QE 4TXJA 3KVRA 4P54A 1PBNA 5CYGA 2IQ5A 1JE1A 4M7WA 4BMZA 1K9SA 4YMLA 1Z35A 2HSWA 1OV6A 3E9ZA 3E0QA 5B7NA 2A0WA 4NSNA 1YBFA 4NY1A 1Y6QA 1YQQA 1T8YA 4F3KA 4F2PA 2OC9A 3ONVA 4L5AA 5CXQA 3F8WA 1I80A 1PK9A 4TXLA 4G89A 3T94A 1TCVA 1ODKA 4WKNA 4H1TA 4OGKA 3K8QA 4QATA 3GGSA 4G41A 3FNQA 4D8YA 1Z5NA 3KU4A 4PR3A 3MMSA 1JE0A 1A9PA 3OZBA 4D8VA 2HWUA 5F78A 1PR1A 3NM5A 1JP7A 2HRDA 2QTGA 1OVGA 4MCHA 3DJFA 2AI2A 4WKOA 3UAYA 4F2WA 1T8SA 1A9RA 5JPCA 1Y1RA 5CYFA 4TS3A 2A0YA 4D9HA 5B7QA 4PNPA 1LVUA 2A8YA 4QASA 4GLFA 2QPLA 1RXYA 5IU6A 3FWPA 1PW7A 5F7OA 4TXMA 2A0XA 3OCCA 4DA6A 1N3IA 1VMKA 3QPBA 4L0MA 1YRYE 3O6VA 4LNAA 2P4SA 1T8RA 1QE5A 1CG6A 3GB9A 1A9TA 4LZWA 1JDTA 3UAWA 3FOWA 1C3XA 3E9RA 4OGLA 1ZL2A 3EUEA 4JWTA 4OJTA 1U1EA 4NS1A 3U40A 2OC4A 1TD1A 3FAZA 1ODJA 2BSXA 1A9OA 1RXSA 1RCTE 4R2WA 1SD2A 1A9SA 4L5YA 4MARA 4BMXA 1PR0A 1ULBA 3ODGA 3ENZA 1Z38A 3OZEA 1ULAA 4OY3A 5F7ZA 3C74A 4QARA 5B7GA 3OPVA 1K3FA 3OOEA 5F7JA 4DANA 1U1FA 4GKAA 1JYSA 4QEZA 1LV8A 4EB8A 1Z37A 1Y1QA 4F3CA 1SD1A 3BJEA 4DAEA 4UC0A 1V45E 4L6IA 5EPUA 1PR6A 2QDKA 4GMHA 5B7PA 4U2KA 4K6OA 1A69A 4TS9A 3EMVA 3OF3A 5F7XA 3FUCA 5EFOA 4YJKA 2QTTA 4TXHA 4YNBA 1VHWA 5C80A 1WTAA 1B8OA 3P0FA 3INYA 5CXSA 2I8AA 4D98A 1VHJA 1FXUA 1PK7A 4JOSA 4DA7A 3BL6A 1Z36A 4EARA 1U1CA 2RJ3A 4LNHA 1Z33A 1Q1GA 2I4TA 2ISCA 3LA8A 3P0EA 1RFGE 5I3CA 4R31A 2XRFA 4DABA 4TTIA 3LGSA 1JDZA 1V48A 1YR3A 3DPSA 1RR6A 1JDSA 4ECEA 1K27A 5IFKA 5K1ZA 1ODLA 1ECPA 1RXCA 1Z34A 4F1WA 4OF4A 1Y1SA 3K8OE 3DF9A 4LDNA 3OZDA 5FAKA 4QFBA 3MB8A 2AI3A 1JPVA 4WKCA 3UAXA 4M1EA 4TXNA 4DARA 1PF7E 3PHCA 2OECA 2H8GA 3KVYA 4TTAA 5F73A 3D1VA 3UAZA 1TCUA 3BSFA 1TGYA 1PR5A 1PR2A 3LBAA 1PWYE 2ON6A 1Y6RA 1M73E 4WKPA 4L5CA 3KUKA 1NW4A 3UT6A 4R2XA 1OTYA 2OXFA 1VFNA 1T0UA 4FFSA 2QSUA 1PR4A 3KVVA 4KN5A 1Y1TA 4M3NA 1RYZA 5F76A 4BN0A 1LX7A 2AC7A 1T8WA 3IEXA 1U1GA 4IP0A 5KB3A 3UAVA 1OU4A 3O4VA 4X24A 4DA0A 4WKBA 1CB0A 3EUFA 3BGSA 5DK6A 4G8JA 1TGVA 1PKEA 2AI1A 1V2HE 4JP5A 3EEIA 1RSZA 3PNPA 3NM6B 3DDOA 1NC3A 1ODIA 1Z39A 1V4NA 1JDUA 3PNSA 3TL6A 1RXUA 1A9QA 2PGAA 4RJ2A 4DA8A 2GUWA 3DP9A 4LKRA 1XE3A 1ZOSA 3OZCA 1U1DA 1RT9A 4BMYA 3FB1A 5F77A 4GLJA 1OUMA 5CCDA 5CCEA 1NC1A 3NM4A 3SCZA 3KHSA 1SJ9A 5EUBA 2B94A 4YO8A 1OTXA 4MCIA 1V41E 1G2OA
chains in the Genus database with same CATH superfamily
3DMGA 1R74A 1EU1A 1T9HA 3QTBA 4QXRA 2GAIA 1Q0SA 2Y2VA 3C5EA 3CXUA 1JZSA 2CY0A 4B35A 2CLCX 2V74B 5DTQA 2TMGA 5HQ3B 4ER7A 1SUPA 3RH0A 1SHJA 1V4VA 2YN2A 5AI6A 4AW9A 1Z2AA 2P91A 4OXIA 4DAOA 1AKEA 3LK7A 3ZGVA 2VHWA 2XHZA 4I4IA 4JLAA 5H4HA 4F46A 2ZI5A 2X4DA 2OXEA 3A3NA 4PTZA 1VE3A 4TRNA 3DTVA 3TVDA 2CDCA 4YRAA 5G2OA 4LJYA 4OHYA 1OA0A 1M1XB 1RDFA 1XO1A 2C99A 5BWOA 5JASA 3Q10A 4I5EA 1F8XA 3IOMA 3L1HA 1JTFA 3OX2A 3CSSA 1XYGA 5LOVB 2G0AA 4TXJA 2AQIA 2EW2A 4DLKA 1PL7A 2ZYVX 3CR3C 3NONA 1TC1A 1TF2A 1U4SA 1JA0A 3EZYA 1PZXA 4YJFB 4E5MA 5J3JA 1PBNA 1AUOA 4R4JA 3W1WA 2IQ5A 1Y3IA 3OLVA 1QQ7A 2COUA 2WP0A 4U1RA 3ODPA 4RA9B 4XR4A 4EB0A 1SVSA 5MN6A 1J2UA 2V3VA 5BRNA 5JH7F 2BHNA 2ZUDA 3O4GA 4GLBA 4Y3UA 3BH0A 4X0EA 1Z88A 4XRRA 4BO2A 1TQ8A 2C2XA 1W75A 3Q11A 1E2MA 1BXGA 2WMOB 4HRVA 4C29A 1TB4A 2I6XA 4JGIA 4M37A 3U7HB 4BO5A 2ZYHA 3GRAA 4BECA 1AGPA 1QFSA 1NIPA 2YXBA 4WFIA 2NUAA 2R62A 3SJCA 1XWIA 4UUOA 1G6KA 4ANFA 1N0WA 3G1TA 5C5EA 4Y9DA 2XB9A 3CRVA 3WVNA 2M2IA 1MQ8B 3EPLA 1DAGA 1ZK4A 4QSMA 3HB7A 2HXYA 2OHFA 4FKMA 5LQDA 1G18A 2H1LA 3HKBA 4ZT7A 3AU9A 3KOYA 2VKQA 4F3KA 2HREA 1RBYA 2OC9A 4JUAA 4LJ9A 5ANRB 1M6WA 2Q3MA 2H57A 4R6WA 1T2FA 4XGNA 4I46A 5FUVA 2ZAMA 5IKOA 4Z1MD 1LWOA 5CNJA 3ZWMA 4L3WA 4A8JC 1YJ5A 3KQUA 1TCVA 1L4MA 3FOAA 3CUWA 1ZXBA 2L42A 3U4MA 5MGNA 4WKNA 3FYDA 2B2NA 3CJTA 3QFFA 4OLAA 5CDUA 2FSIA 3RLFA 4G41A 3T1OA 1R10A 3D8NA 4NE7A 1D9ZA 2E7ZA 4PC1A 3IDFA 1Q3HA 3DF7A 4DM4A 4BOYA 2L17A 3JALB 2EHDA 2R8EA 3Q0EA 3QMVA 4YQYA 3UWOA 2Y1EA 4EWLA 2K2WA 2O3SA 4IIJA 3ZCRA 3BCHA 4AN0A 3EEYA 4BKQA 5ARBA 1E2BA 3HEAA 4DBVO 1L1QA 1JP7A 3RYIA 2FWRA 2HRDA 1CUFA 5TDHA 2R4TA 1SVLA 2J3EA 3ZZUA 4ESHA 3NGLA 2H31A 3MSCA 4IQ0A 1WP9A 2DOKA 5CFPA 2ZT5A 3HWSA 1NQWA 4OKSA 3UWPA 1UWLA 1F2TB 2C04A 3MRTA 4N3CA 4IUBS 8GPBA 4W5RA 2EBFX 1I51A 3BFXA 3JW8A 2B3DA 5KAPA 5C3UA 4E32A 3AI2A 5CM8B 2CSXA 4FD3A 4I4TA 1YSCA 1BN6A 4TV8B 5E1OA 1W44A 2O8EA 4YCLA 4TKMA 2WKPA 4BEJA 1GGEA 4IO0A 1U7WA 3QFSA 2E4UA 5TEWA 3MLAA 5I7AA 4YHBA 3I4LA 4D9HA 1C8VB 1QRDA 4D4KA 2XBMA 2MMCA 1LQUA 1TA9A 1U2GC 2C8LA 1I8TA 3DV9A 3ANMA 4EZBA 5AKXA 4RV9A 4UM8B 1SVUA 5F52A 5FAXA 3I45A 4XM0A 1B23P 2G9QA 3DZBA 1Z2NX 4R0NA 5U9CA 5LP6B 1GO2A 3QK7A 3GLVA 2Z5GA 2AG0A 2QZPA 3DYVA 2QQ5A 2UZAA 3HB5X 3JWHA 4XDHA 5CJPA 1XZ8A 3ZV4A 4B9EA 3E9QA 3FCCA 3V3KA 1A5SB 4CKZA 5DX0A 4AUNA 4EB6A 1BTOA 2PXCA 3OZ7A 2WB2A 2X2FA 3EULA 3IDZA 5JNLA 4XGQA 3D0RA 3F1KA 2X58A 3AX6A 3EDQA 1YA8A 2I65A 3KT0A 2Y0PA 3VVMA 1IM2A 1PFGA 2GBLA 4ND1A 2P6RA 4EPVA 1AN0A 2GN8A 4LUCA 4R1NA 4JFRA 4BRUA 3C0KA 4Q4CA 4RVCA 4L8GA 4J49A 2AZXA 1MTZA 3CGWA 5AK5A 1A7KA 2VQ6A 1RM5A 2J5QA 1MH1A 1QG4A 4L0DA 1EDBA 3K0EA 2ZIFA 3MK31 5BQ5A 5KQLA 5T3YA 4UMEA 2PM8A 2IGTA 2XYPA 1I7PA 3ETNA 4WGGA 2VSNA 2VT7A 3OX1A 2F4NA 1AUVA 3W5DA 3ZXXA 2IYZA 4A6DA 4BVJA 4ZAWA 3G0OA 3LHIA 3QKSA 1FY2A 2Q6TA 5A03A 3VAYA 4MHSA 3MNFA 1G5RA 2G5PA 5EEGA 3T52A 4WNYA 3B78A 4AB1A 4DRXB 1YB2A 4MVJP 4LDZA 1ATZA 1MNQA 1SBCA 4RD3A 4B45A 5EHZA 2B20A 1BG6A 4MVJD 2RGUA 1N92A 3DBOB 4KXXA 4MR8A 1ZD9A 1XZNA 3LXUX 4QXOA 4TZ0A 2B8TA 1ZUIA 3IQXA 4NCJA 3ZD7A 1IQUA 4FWTA 2IOFK 3BMOB 2DTXA 4HLUA 1NQAO 1UOQA 2QJWA 4BNMA 1XCGB 3N0XA 1Z0SA 3VNQA 4MPDA 5IM4A 2WUVA 4PIMA 4DQKA 1PDVA 1L6RA 5GONB 1W5EA 4QG7A 1CUAA 3DP7A 4JQZA 4HSGA 1G19A 2OY0A 4ARUA 2FTKE 1T2VA 4P9NA 3DFMA 3VKUA 3QVUA 1SR8A 3VPFA 3ZNPA 1QIGA 2AN4A 3HCPA 3TGPA 4DY6A 1G64A 2NXWA 2RG1A 2ZE8A 2BEVA 2QLTA 5AW0A 5CM2Z 4BCCA 2YWXA 2ADMA 1LF0A 2SCUA 2WIKA 3X3HA 3ZY6A 4AS3A 1TQ6A 3C4JA 3B53X 3DKIA 4QDTA 3M1LA 3VPGA 3JZDA 2YC2C 4FN5A 4YRKA 1Z38A 3PUHA 4EPRA 1R18A 3PDCA 4A7PA 2QM7A 4W63A 2KBEA 5KYUB 2ERYA 1G4UR 3AYZB 4LYJA 1JMKC 4WXMA 3DUFB 3ZGOA 3L7DA 2PNFA 3VJMA 5L51A 3D6MA 2J3JA 4XJSA 3K70D 4FCTA 1DT5A 2O8NA 2E4VA 5DHQA 2IYRA 3ZVMA 3UMMA 1NUTA 1Z5UA 1EKXA 2BR3A 2ICAA 1KBOA 2UYOA 4I6JA 4A8JB 5CT5A 3CPSA 1WETA 4R0MA 3QUSA 2WPNA 3OQVA 4CQLB 4K9DA 4DAEA 5BP7A 5JQWA 5K0TA 1ACLA 2XOXA 3GA0A 3KLPX 2XUGA 3OA0A 2XCOA 3G9ZA 1C0IA 3KJQA 3VPXA 1UDWA 3K0FA 1E4YA 1QC5A 1ZMXA 1IBSA 1JWBB 3I8SA 1P4HA 1M7BA 2LKDA 2P4QA 2YXPX 4MV7A 4WLEA 5DO9A 4Q93A 3VV3A 2YUIA 3W7VA 2BBSA 3NEAA 1W19A 3QFHA 3AF2A 1GCIA 1W25A 5LMNB 1BX0A 1Y8QA 2ONZA 2YJNA 5THKA 2WUGA 1NDQA 3KM0A 3N0WA 5ILGA 3WZLA 3NFRA 2J7PD 5LZ5A 4ZARA 1H2HA 1SXJC 4F91B 1RZRD 4ZYZA 1JJIA 4X8LA 1TZMA 2CEKA 2NVBA 2FLWA 3CLRD 4N5DA 3QUCA 5EFOA 3ZIDA 5EJ5A 1EESA 4C6HA 4LXQA 3EAGA 3O8QA 1K7SN 1X80B 2ODNA 3IAS6 3IDOA 4UPVA 3H9GA 1H2BA 3V7UA 4YR9A 3P0FA 3T38A 1ZMOA 1MC8A 3ON5A 5HZMA 1TUGA 3LDAA 3THSA 5I7VA 1NLMA 2ZGVA 3BIWA 4JOSA 4RM3A 3U60B 5JR3A 1W85A 4QLBA 4X44A 3QBTA 4BDSA 3RUCA 5JJIA 3PXUA 1AXRA 3NRJA 3L46A 3OFKA 3A37A 4MGEA 4RWEA 3IEUA 3TL2A 4HATA 1EBUA 1YA4A 4EARA 4G0MA 3BZBA 4HYEA 1UXHA 4CM6A 4MGHA 2WOJA 1HF3A 2VDMB 3IBGA 5I7UA 1JN0A 5IJ9B 2VPQA 1ZNZA 3CTMA 4LDJA 3V5NA 1LQ2A 3VI3B 1SIBE 1MEJA 2VDNB 4LK2A 1XAGA 1T6BY 4IFTA 3CW9A 4G1BA 4RAOA 2BISA 3AVYA 3SM3A 4DJFC 1YFJA 3B6EA 1FCJA 2GZSA 2ZATA 2J3QA 2MCFA 4K81B 1O89A 1BWSA 3CINA 3LGSA 4MQFB 1AD2A 2E85A 4EFNA 3VVLA 1V11A 1V48A 1O94C 4H27A 4AJNA 3WZ2A 2AMLA 4LC9A 4G09A 1YAHA 3RYCB 1S1MA 1DAIA 2LP4Y 5IFKA 2XCSB 3K4HA 4RC9A 2GILA 2JA2A 3CNBA 4ECAA 3FXAA 3RTGA 1W36C 1DCKA 4IRUB 4C2BA 2C2MA 4BL5A 3HFRA 3D7NA 1EUDB 1Q84A 3THOA 2AUNA 3GMIA 3N8GA 4L6AA 5DFAA 2X0RA 4H4CA 4DV1B 1NG1A 3ZHZA 4F84A 3D54D 3DBRA 3F9CA 5FAKA 1BROA 3B85A 1PV4A 3LDFA 3SDZA 1H2ZA 4E46A 3MB8A 1Q19A 2VHTA 3UAXA 1PJ8A 1JA9A 2W4IA 3HNRA 3KKKA 3HY3A 3CLRC 3IXLA 1Y42X 3KOMA 3QZUA 1HZZA 2BWJA 4GNKA 4I81A 3FVWA 4Q4LA 1RQRA 3U7RA 2OOSA 3QX8A 4RJJA 3K1JA 2OCKA 4FBLA 3A8TA 4YRCA 4Z49A 5FWNA 3ZVKA 2WAAA 1LJUA 1ZM9A 2Q1WA 3D6JA 4LGCA 4AURA 2GF9A 2NTJA 3D1VA 4KR0A 4RH0A 4JVSB 3WWZA 2VDWB 3PNKA 1N2XA 1OTHA 3ITDA 1RMYA 1IEVA 4HFRA 2BJVA 4ID9A 4KFSA 5DGDA 2YJ3A 3NHAA 4FILA 4L5IA 5JY1A 2GM9A 1JLKA 1FXWA 3W3AD 5EZ6B 2A78A 3CEAA 3PFKA 1M34E 2QGNA 3G5UA 1PWYE 4XIIA 3KYDA 3GVPA 3R0QA 1BX1A 1NYLA 5KC9A 3SSNA 4DY4A 4HEA1 4DR2B 4N8EA 2CJFA 4MA0A 2O1WA 1I3LA 1JR3D 1YK0A 1XCLA 4R2XA 3OPQA 5FEMA 2O8DA 2NXCA 4EATA 4FOTA 3ANNA 2ZRFA 3A1UA 1CR4A 1C0KA 2DQZA 3KJHA 3ZNNA 2ZSJA 2ZJ7A 3IPCA 1SCKA 2BGJA 3SJAA 5FLXA 1VP3A 4LIPD 4MZXA 4R3WA 3AL0C 3AUFA 1WB9A 3VR6D 3K5HA 1EUCA 4HMPA 3N8NA 4Q4HA 1R50A 5IJAA 3UXMA 4B6PA 4KWTA 4H4DA 4CW7A 3IE1A 1O2DA 1JKMA 4FEEA 1DLIA 1V43A 3I2JA 4RLFA 1F7VA 3KL4A 1WQ4A 2JJ1A 4DCNA 4TTSA 1PW5A 4TWRA 2VDVE 2J0SA 1ZOOA 3IA7A 1M0EA 3QKTA 5KB3A 2W98A 2Y68A 1XU7A 2TMYA 3IKLA 3ONNA 4MWEA 1V3UA 4RX1A 5ALHA 1T9AA 5B1YA 1IWPB 1GLGA 5EHQA 4YJ3F 4P98A 2N0SA 1ZGBA 4DA0A 5JSQA 5B1HA 4FW9A 4EL5A 4IUCS 3AB8A 3ZWVA 4DJAA 2C7GA 5AKIA 1KAEA 4CMKA 1SXJB 3GHHA 5EAIA 3A4TA 1QRAA 1T5IA 2WJGA 2VP6A 4BRZA 4DLUA 1YUNA 1P5JA 3IODA 1XEWX 5C3MA 1OBOA 1RYBA 4RTSA 4B3TB 1NJ8A 1QO0D 2O2XA 3E6AA 3MA0A 4G8BA 1KQNA 1E9FA 3F97A 4EHDA 3UF0A 3WGMA 1CUYA 3MCVA 1S3IA 4GGMX 1YS6A 2FV8A 2GN2A 4Q7LA 1C1DB 4AMYA 1QS0B 1Q2XA 5IF3A 3I8OA 2D3WA 4GDFA 2NYAA 5E6SA 1P6UA 3A25A 5EUMA 3TRIA 5K6RA 3TK1A 1JI0A 2Z2IA 2ZUCA 1SHLA 1T2CA 4OOFA 5EIAA 2Y0CA 1N5RA 2FEPA 2IODA 2ETXA 4IIYA 1V26A 4YONB 4F92B 3L3BA 1L4GA 3D8RA 4LKRA 1XQ1A 4V03A 2ACVA 1N77A 4EW1A 2QK4A 2J5BA 2X5NA 3SHQA 3UK0A 3ZOZA 4P33A 1QVRA 1VC2A 4IF4A 1IOVA 2A92A 2QVYX 3KV3O 4WVLA 4FS3A 4YDSA 1OXUA 3IP1A 1RWMA 5A9TA 2XYQA 4NCKA 1YASA 3LUAA 4LKOA 3NDBB 2OVBA 5G0VA 3QXXA 3UC5A 4MB2A 5JATA 1IH8A 4FYMA 5SYAA 2P6NA 2R6JA 5G0UA 2CNDA 3CUKA 2LKCA 5EI5A 1T29A 3BORA 5FUYA 2V7QD 2Y1FA 5KI6A 3JAMA 1G3UA 4PONA 1FTGA 4JI5B 1Q0PA 1XTUA 2OQIA 4RDXA 5IWCA 3HJTA 5JEDA 1R4NA 1GDHA 3FWZA 4IWNA 5A4AA 2OCLA 4I1RA 3ROPA 5AM2A 1W36B 1V41E 3AFOA 1EVZA 1O6BA 3M0EA 1W0CA 1H2WA 1UANA 3STHA 5GZ6A 1K68A 1RRFA 2CLSA 3LFHA 3VZBA 1YK1A 3I9LA 1XLUA 1AQNA 4GEGA 1PP4A 1UBNA 1VPEA 2EBUA 3DPUA 3P20A 4I8IA 4D02A 5KNBH 1XTTA 2GAJA 1F3OA 3CX3A 5JOQA 1RLTA 4Y67A 1EUQA 4Y2RA 4K28A 4MH0R 1AA9A 2QM8A 3KXIA 3M81A 3F5DA 3NANA 1KIAA 3GYGA 2VHVA 4MI1A 5F12A 3A6GA 3LUBA 3GT3A 1F0NA 3OTGA 1NSYA 3F7TA 2YQ5A 4IFEA 4ZRNA 5DP1A 3TSAA 1ZIOA 1KO1A 4DCSA 3EVDA 3HU3A 1JALA 2PU7A 3IHLA 4U7HA 3I32A 1OGYA 3ND5A 2WHPA 1MXFA 3FWNA 5F21A 3PEWA 5BVHA 2PUHA 1L7VC 1ZKDA 4LBWA 2BEJA 3CPJB 2C1XA 3G5TA 4IXWA 5HA5A 4F9EA 5IJ0A 4UOQA 1F0PA 3K1AA 4EHFA 1V3QE 2X9GA 3DV2A 4Q3EA 5COQA 3ZCUA 4D3FA 1I13A 1K98A 1S2IA 3DD5A 3VVBA 4ZQBA 3WDMA 1WD7A 1WXDA 4B6GA 1SUEA 2AXPA 1NBMD 1YR2A 1HDEA 2H5LA 1DAFA 3PWTA 4I19A 3P9XA 4XCVA 4XOUA 4F56A 5B3JC 4WW0A 5JYEA 1EB8A 3KJXA 3NYIA 3O7WA 5L4LA 3KVOA 2P2LA 5TGTA 3UN1A 2JIBA 1XDDA 1G8MA 3N2NA 3FNBA 1MB2A 1TYCA 1UAAA 4URXR 1E1LA 4XWKA 4ZWNA 1BXZA 4B4DA 3QEKA 1CETA 5GPBA 1BMFA 5HKKD 1UT5A 1CUXA 1WDTA 1XELA 2XUQA 3DWEX 1O87A 4AMUA 2ZCVA 3OKPA 1GFZA 3JQRA 5DYIA 2QYTA 4WY8A 3KB2A 4ZT5A 2J9RA 3PNBA 4Q3CA 2GK7A 1Q0RA 5BWBA 2WD9A 3VC7A 1LH0A 4HLDA 5FFFA 1P2UA 1JMVA 2F3UA 3T5GA 4RNDB 1RE0A 5JZOA 3PNQA 3SDBA 3FGZA 4B3CA 2RSLA 1ANKA 3OCZA 7REQB 1U0JA 2PMDA 1O7JA 4DQXA 5BUZA 4X20B 4HY3A 3Q2OA 2VPYA 1GA4A 3GMDA 4WTOA 3SF0A 5TXGA 1BEEA 4EHBA 3WIOA 3BIFA 4ZCPA 1OXKB 2IYTA 2IUYA 2WF9A 2Z3VA 4P31A 1I32A 4YT2A 3TCNA 1BCSB 1HKHA 3UJNA 5KS2A 2FPSA 4OTZA 2JD2A 1ZIPA 3TRFA 3MJVA 1XWFA 3OEHA 3V4LA 1NZFA 8ABPA 4ZCMA 3EPJA 1NI3A 1KI9A 1M1YA 2ZSIA 5A0FA 3KU4A 5JDCA 5IANA 4QUJA 4CEIA 1I3OA 1WJGA 4QM6A 3I1IA 5T3UA 1IHOA 1G8HA 3LFUA 4D8VA 2KLHA 2IXFA 4XWWA 1VXOA 3PWZA 4DVGA 3IALA 3KFXA 3CO0S 1NZJA 2V5UA 3OLXA 4NBWA 1LTKA 4BCDA 1QU2A 2EW1A 5EWJA 3C85A 3RS0A 1NN0A 1AB6A 1M9NA 4B40A 5IJXA 2B35A 1KOJA 4BFXA 1U11A 1V25A 4GMXA 1Q11A 3FZNA 1IAQA 2EFYA 1SBTA 3UAYA 4AVYA 1JWLA 3U7QA 1CY1A 2E18A 3DMTA 4N54A 1VKNA 2CXHA 2BHTA 1NN5A 1ZGAA 5PNTA 5IHPA 1OLXB 2XI4A 1PD1A 1AIPA 3FLEA 1AS2A 4PGAA 3AL3A 2AH5A 4L5BA 4P7BA 4FHCA 1QQAA 3V97A 2PX4A 3KDSE 1QP4A 1LBSA 4ZIRA 3N2KA 1A9XB 1AS3A 3IIJA 2ZTHA 3BDAA 2OQVA 5AJWA 5HOEA 2CVOA 1J99A 2AOUB 2ZRDA 5A1JA 1TX4B 2O3UA 1X13A 4INPA 4J0FA 4N65A 1HUQA 1WV1A 1OAOA 4WBXC 1RYDA 5AHOA 2Z9DA 4RPCA 1PVVA 2BMAA 1J8FA 1MB9A 1P75A 2QY9A 3R6DA 1A98A 4G4IA 1KP9A 1Z3IX 1N3IA 1DTWB 1FQOA 1N9GA 1WOMA 4W9NA 3T41A 3PUWA 3JS5A 3QPBA 3THWB 1JVBA 1PYOA 5EQJB 1L7MA 1WSAA 2DP4E 3UQYS 3EG5A 3M4YA 4D4IA 5JALA 1GT6A 1T2EA 3AUTA 3ORQA 4R54A 4X65B 5HDBB 3JAWB 3KPYA 5TLSA 1UC4B 3CRRA 3DB1A 3GLHE 3GQVA 2G71A 3GJXC 3T0FA 2JFFA 5JQGA 2B1QA 2EL9A 2HY7A 1DAKA 3HXMA 3WK9A 1EA5A 4OAQA 5LQNA 2YC4C 2M6SA 2OFXA 1XXHA 4FUQA 5I7EA 1CYEA 1IMJA 3E1KA 1ZJ4A 4LZJA 4GHWA 1O03A 3D6HA 2HT6A 1Y1LA 1E59A 2ODQA 5A05A 2HLHA 1JDTA 4XIJA 4WBNF 5EQFA 3BB1A 3ZJYA 3EUEA 1O0BA 3ELBA 2KX7A 1H85A 4U7GA 3WDSA 2BKUA 4URFA 1USIA 4RGBA 3E22A 4K46A 3EQ2A 3NT2A 2M32A 5DVZA 1PRYA 5HJ5A 3H99A 4W5HA 4MA4A 1GZUA 4DWWA 1EJ2A 2QD3A 4LVOA 3ROZA 1ODJA 1C4WA 1U6IA 4LE1A 5DI3A 4Z4GA 2APJA 1K8YB 1DXOA 1N0IA 3LUHA 4LK3A 4V0LA 1W88B 3B3QA 4UUPA 4DVJA 3LL4A 1KRWA 1OWOA 4QTXA 2GESA 4FPXA 2I91A 3VSDA 2ORWA 4PGMA 1THTA 3VR2A 4W9MC 5CGQB 2FR8C 4M8IA 2DFLA 5BMVA 1Q6ZA 1SD2A 4HK4A 1VLMA 2EX1A 4G97A 3PDUA 5FP0A 1USKA 3WISA 4D5GA 1EI9A 1ZU5A 5AP9A 2BLNA 2VQSA 3IT1A 3QLUA 4GZMA 4L28A 1OLSA 5EHXA 2GAAA 4S05A 1T1EA 3AI1A 2BAGA 3LDUA 4HYTA 1G8AA 3JQ9C 4Q21A 5IZ4A 4B80A 4P5EA 2LGJA 3EIOA 3KZCA 4IJQA 4JJEA 1RKBA 1ZI8A 3F96A 1UQRA 3NNDA 4HUQA 4AKEA 5A2QA 2Y0DA 4OFXA 4JHLA 3KTAA 2GN4A 3KR2A 3MS4A 4N7MA 4WESA 3SE7A 1Z28A 3FB4A 3KEGA 2JI6A 4FINA 4MKGA 4N3NA 4EI9A 2A7XA 3KRTA 4DANA 5IXJA 2F48A 4GBJA 3QE3A 2Q5HA 2XUDA 2DQSA 4IWYA 2C82A 2OM6A 1K88A 1JHMA 3VC3A 5FOQA 1V16A 4MA5A 4L74A 2HHHB 1Z6GA 3EGOA 2GCEA 3LZ6A 3O47A 3SX4A 2EDCA 4DC0A 1HGXA 3JWEA 1Z4LA 1ZCFA 3M34A 1NVWQ 2PZBA 2XDYA 1GIAA 1FTWA 1X7WA 2TYSB 4K03A 4NAVA 4O4LF 1UDRA 1GXSA 2VCHA 3UO8B 1JFSA 3RASA 2FG6C 3Q0TA 4JLKA 3JRNA 4UC0A 4XPIB 3VZDA 5KTOA 1YVPA 4JYAB 2QLFA 5B4VA 1H4TA 3L8HA 4UMVA 1PWXA 3NIFB 2X7XA 1DPFA 1G1MA 2XGOA 5J1TB 2KSQA 4GP9A 4P84A 3TLGA 5KNCA 1YMQA 2VSQA 2YMQA 3I9JA 4BLTA 1DADA 2HLPA 3JD3A 5HQJA 2Z95A 1EZ1A 1J23A 2XOKD 5ENZA 1KDZA 5JTTA 1X8KA 1M8PA 4BO4A 1ESCA 1STOA 2VJLA 3DHNA 4NE2A 4PC6A 4U2KA 1FPMA 3V1NA 5H9WA 5JNUA 3LRPA 3DQPA 4KYVA 3V1MA 1CQPA 2D06A 3JYOA 5BUCA 2F1RA 1Z4JA 3LO8A 5FR1A 1F4VA 4TN1A 4UNNA 4F4DA 1YZHA 5LLTA 2EZ8A 4LXHA 4GX2A 4M0EA 1HDIA 5C80A 1ZRSA 4G5YA 3CVUA 3DC2A 2EFDB 2PR2A 3ELDA 3EHEA 3QMPA 2XE7A 5DGXA 4TV9F 4ZVTA 1K5DA 1A95A 3KLMX 4DA7A 5K6AA 4DB4A 2FPPA 2O1SA 3HKCB 1GQRA 3ACCA 3DE7X 3WGJA 3L8GA 3MM4A 1NF9A 2Y93A 5BN5B 2O3QA 3IOCA 4GOND 5H83A 1UBRS 3GY0A 5BY2A 3QWAA 1UJCA 1DI0A 1W5BA 3G2NA 1AF4A 2ECQA 2XE8A 3ABRB 2QT0A 1TT5A 3FFTA 4Z4FA 2QRQA 1HE3A 1BGXT 4F60A 5KKNB 3LX5A 4X7PA 1AV7A 1US8A 4II7A 5B3KA 1R4MB 1XHFA 2DLDA 1TVKA 4CR8A 1U3GA 4LHEA 4H7JA 5K0CA 4UE6A 4OLHA 5IYZF 3HB9A 3L4KA 3L4BC 3U39A 2VXYA 2L18A 3SPXA 4S1NA 4BFCA 4OSOA 3REQA 3AFNA 3UAGA 2W6QA 4UBLA 8AT1A 2W70A 3NI2A 3TPCA 9LDBA 3CY6A 3X1ZA 1WO8A 2QN8A 1M6VB 4JLMA 5GZ1A 5K0EA 1ZVQA 1I2CA 2AE2A 2YNMA 4GMGA 1HXHA 1R6TA 1E2IA 3I52A 2DH6A 4YGXB 2PGIA 3BXHA 1RXCA 1XU9A 1Z34A 1FTNA 2RHBA 1P91A 1U2ZA 1ZPDA 1LPMA 1WW2A 1K2VN 2XUIA 2Q5CA 4FX5A 3VNRA 1OXXK 1VPDA 4LW8A 1G6Q1 1G8GA 4D3YA 2MIIA 4ARSA 3HYNA 3LP5A 2BEUB 3K31A 4WCFA 3RS7A 4EGCB 3GLGB 4MUEA 1PGQA 4XDGA 2R0QC 1UDBA 1N2CE 1VE5A 1EVJA 5CDFA 3SIRA 3WLPA 4BX3A 1HSZA 1NVFA 2PGNA 4CU5A 1IOLA 2J7KA 4CKWB 1O08A 1L9XA 1NDUA 1T4CA 3MOIA 4U2BA 5DHUA 4ARZA 3BHNA 1O96A 4BYGA 5I01A 2ZVPX 3ZWAA 1ZWLA 3EXFA 1J97A 3P1JA 1Q0ZA 3JPYA 3V8VA 4DGSA 4EJFA 4JJ7A 2H5IA 3SWWA 1ZMRA 5AW6A 2YKGA 1ST3A 1Z5VA 2XY4A 4DHWA 4ETNA 4L8LA 1WU7A 1K66A 4EKNB 5KSOA 2VDRB 4BLOA 3IOEA 2WJVA 2P9CA 3P8ZA 1QK5A 1IHXA 1VDMA 1JRLA 2B30A 2DTDA 1EDDA 2PWPA 3F2VA 4JI2B 1YRBA 3B1ZA 3CLSD 1WAMA 1OLUB 1I4DD 1Y9DA 2YHIB 4BCBA 4ZI2A 5K20A 1Y6RA 2JDID 1R0BA 4NI5A 4BWFB 4KVFA 3WK7A 3CYFA 4HQNA 4LV5B 4HT3B 5A1TA 4FYVA 4GGOA 2PGDA 2QSZA 3OIWA 4A2PA 2LRHA 4AG5A 4NU6A 4RTJA 2IK8A 3GV0A 2BP7A 4H60A 1BJRE 4LC1A 2XJ4A 5C4MA 5LC1A 2K2QB 2BCJQ 3HYSA 1DEXA 4NBUA 4X6UA 2UUPA 5BSMA 1Y8ZA 1L1RA 1CS0B 3N76A 1RAHA 4CEHB 1ZINA 1V35A 2EFJA 2XCRB 2BR5A 3HJNA 2BFWA 2ZBVA 2W6OA 2X1LA 3OJ0A 3G7UA 4BUZA 1UT6A 2BM0A 4URZR 2A57A 4H7HA 5K0NA 4K0KB 3ZLTA 4C7JA 1RYZA 4LPKA 1V5IA 2Z98A 4MVJE 2I2FA 1Y5LA 3SHFA 1C9DB 3ZU4A 3AC0A 4P3YA 1U0SY 1U3UA 1VCNA 2FU5C 3B1VA 5DW3A 2QQGA 5C34B 3WIDA 1V9LA 1NA5A 4N39A 4F4FA 3ORSA 4Z9XA 2ST1A 1QZUA 3CPHA 1C29B 1OMOA 2PD4A 4WDQA 1RQPA 2E48A 2WFAA 1YTLA 3R6WA 1TUEA 2I03A 3OJEA 3AIIA 1GQFA 2OD2A 3CNQS 4BMVA 2LXNA 1TZBA 2Q1UA 2PRKA 4UU7A 4X1KA 4PYJA 3U3ZA 1BVHA 2V54A 4KQHA 1CU1A 3HNPA 1D2MA 5CIWA 1ZM2A 1CUIA 2G17A 2XGJA 1X1DA 3QEMB 1F20A 1TPYA 4YQFA 2IVZA 3AM4A 2RC6A 3BB3A 3IV9A 4EMSA 4RBNA 3EPHA 1KBQA 2IV2X 1K3UB 3EEIA 2QRGA 4YP9A 1QXSA 2PD3A 4ZQIA 4RHUA 1Q83A 1E6UA 4TQUS 3U3MA 3JVUA 4F96A 2FWMX 3N59A 3DGEC 1P0MA 2WU3A 2NO5A 4DT1B 1KEUA 2PCLA 3TW4A 1T5OA 3MCAA 1L4NA 3R3VA 4EUKA 4Q9NA 3GLFA 4Q7MB 2ATCA 3KCQA 5U4XA 2CL5A 3CLSC 4W5OA 1WXFA 3NDIA 4GKBA 2O0MA 4Q7JB 1QG2A 2IXEA 3M6IA 4G01B 4YLEA 4INJA 2VDPB 1CBUA 1NJ6A 3A0UA 3M6XA 4L15A 1SIUA 3LC2O 4H7PA 2OPHA 3R7NA 1CTQA 2Q3BA 3P0RA 3H9UA 4FLFA 3QTTA 2FEWB 3ER8A 4IEIA 2R8XA 3EUWA 2PWZA 4UVDA 4IQ4A 3IGFA 2JEYA 4LSMA 1FSFA 2G72A 2W2TA 3FTDA 1M2EA 1PN3A 4RZQA 3PQ2A 2I6FA 3VH1A 3VZRA 5CFMA 1GPUA 3ZI7A 5I4CA 5E38A 3HL0A 4ZVPA 2CK3D 3FNGA 1Q0HA 3FSRA 1ZH6A 4JHXA 4NK5A 2XTAA 4MWCA 1X1EA 2D2VA 1L5QA 1S96A 4UBOA 2A7QA 7MDHA 3U6KA 1VCMA 2OO5C 1IRIA 1QYDA 2GKSA 4JGGA 4YAWA 5DJ5A 4ZV7A 5CA1F 1B76A 5KHOC 2CFRA 5IXYA 4QGSA 3BN3A 1AURA 4OHFA 1QP0A 4AJ9A 1ISHA 1YRAA 1T6YA 4CMHA 1SN7A 2OENG 3MTQA 4JU8A 2FRDC 2Y27A 4PCLA 4PWZA 4RS4A 4BNIA 3FPCA 2DSNA 1DDIA 3UT0A 5ICEA 1DQRA 1JIUA 1BW9A 4UKDA 5EINA 4QXAA 3CT6A 4Q15A 1KDTA 3RSHA 2PMWB 4QDXA 2JFZA 4G5GA 2Q4DA 5GOTA 4DSOA 4PZZA 5K4GA 3LX4A 4F4IA 4PTYA 1W49A 1Q91A 2PRJA 1FMJA 4D41A 4AN1A 4CV3A 3VGJA 3FCOA 3X0DA 1DQSA 3KPUA 3KOUA 4YP1A 4CL3A 3DTTA 5FF9A 3M3PA 4DSAA 5KYYB 3NVKI 5K0SA 4KREA 2J4CA 1EP2B 1MRSA 4ZRDA 3VPSA 1RLIA 3EEFA 4M9SA 5C8YA 1KDVA 5JIBA 4YCNA 4R6XA 4EA7A 3MJDA 4DSNA 4PZEA 4ENQA 3B20A 2X41A 3IRVA 3ESRA 1LDYA 2YYYA 4XR9A 3WWYA 4C4AA 4OJQA 5IPFA 4FM9A 4OQDA 2R5NA 4CBVA 2WWFA 1OY1A 5CYGA 1P4GA 4DYDA 2AHOA 1U02A 3RU3A 4DIUA 3FMVA 3EXHA 2Z58A 1M76A 5AHRA 1U9CA 2PTGA 4M7WA 2XZOA 4YV7A 3BTOA 2Z5LA 2F8TA 4BMZA 1OX4A 3CVJA 3ZVRA 3PXGA 1E3LA 4MDEA 1YVDA 3TLKA 3DM5A 1CSEE 1WM1A 4HN4B 3QVJA 2WA1A 3CZPA 3VVCA 4D79A 2QTLA 4IGAA 1U0TA 4Y6SA 1XSEA 2PKWA 3KETA 2O2GA 3EZNA 3BFVA 3OC6A 1UBCA 3OOSA 1AN9A 4NSNA 1W5TA 3AXSA 3R5KA 1YD7A 4Z51A 4V0QA 4TOIA 3BXFA 2BRUC 4ZVRA 3K2IA 4PEVA 3MMNA 4G0NA 4P7JA 4AIIA 2D2XA 3WL8A 2A3NA 2D5IA 4BXOA 4JXKA 2QVLA 5U1PA 1N0HA 4QPCA 3NHZA 1U0BB 1GZ6A 4W5JA 1K6EA 3TCKA 3OTOB 3GN2A 1F2DA 3V46A 3UWKA 2EFHB 5CCBA 3ZGXA 2WIDA 3WWCA 5CB4A 1F17A 3PFWO 1L1EA 2WHRA 4HDSB 4OHOA 1DEKA 2UUOA 1KOFA 3L6CA 1Y7IA 5BT8A 4RY2A 3FETA 4XAQA 2AFIB 5F2OA 4C7XA 4XYBA 1B16A 1ODKA 3SIWA 3O8NA 3X2EA 1QRTA 1CEEA 1R3UA 5KVQA 3MZ0A 4HN2A 4WK0B 3T7RA 4WECA 2HMVA 3I1JA 5A4DA 3D8UA 3HK2A 3WLSA 3H2BA 2PQMA 3T15A 2FRVA 3WTCA 2OESA 3RHZA 3WDKA 3LF2A 2HRZA 5C53B 5EZYF 1XZJA 4MUGA 1GUFA 4MMXB 4ZV4A 1ESDA 1JR3E 1K4YA 2QXTA 2VBGA 4XPZA 2AJLI 4XFJA 3QI7A 3GEGA 1BDIA 4DRYA 2JVIA 4EF5A 4LJ7A 1GGFA 3Q85A 4C20A 3AOGA 1IZYA 4TMYA 4BMPB 4D82A 1AQJA 1E8MA 2PGJA 3L7MA 4G4GA 4MCHA 5FI3A 4ZYYA 5LKRA 1VHLA 5FTMA 1CUHA 3A6FA 3S2FA 4HMOA 2YWEA 3J80A 5JWRA 5SY9A 1Y4ZA 2Q3LA 2V97A 3VTFA 1QOPB 3R3UA 1YF3A 2QB5A 3OIVA 3DEFA 5K3FB 3KSAC 4RDCA 4EYEA 3T1NA 2JH8A 3RWBA 4ZOCA 3ST7A 2E4AA 4U8HA 2HO5A 4E22A 3HYTA 5I4KA 1GSIA 1LPPA 2P4EA 2G83A 5CLJA 5HJ7A 4U2GA 1BE0A 1MH9A 1Z56C 3DYBA 4W82A 3KR0A 2A8YA 1PGPA 4MP8A 5ALXA 2QZZA 3GN1A 2DFTA 2RHDA 1GNLA 1GV1A 2V4ZA 4K05A 3G2KA 2GCGA 3RFTA 1AGNA 1J8QA 4H3HB 5HQ3A 1RXEA 4H31A 3E9EA 4WK2B 4BB5A 3CNEA 3B1XA 2VJYA 3GRCA 5JCPA 1ZJ5A 4X00A 3LUDA 3D0QA 4KQ6A 4TXMA 3K1ZA 1UH5A 2ZJBA 5E9AA 3ESZA 3RS4A 2H0AA 3L1VA 1SCAA 4B8ZA 2VWQA 3G5LA 1D6SA 1UBSB 1CP3A 3LY9A 3I42A 2YJTD 3LU1A 1FYVA 2IP1A 3O6VA 3QU9A 4NMHA 3WMWA 4L27A 2JFHA 1NLZA 4EO4A 1ADBA 5AVOA 5LOVA 2RGAA 1JAXA 5D85A 2WVGA 4LHVA 2PL1A 1EE9A 4GOOD 1RPJA 5EHNA 1WVIA 2B1RA 1UPTA 4YJFA 1NPYA 4NP6A 3OU6A 1JHRA 3BICA 3PCRB 4RA9A 3ROEA 3KWLA 1CRQA 1E64A 3F8SA 1QKJA 3MJFA 1PX0A 1D8TA 2WY2D 3PJRA 4NYMR 5AVVA 5LDDC 2H92A 4S35A 3U81A 4FBMA 4LJ5A 4NBRA 2QAIA 1SVMA 4FHFA 4OA5A 4RCYA 5EXPA 3K6RA 4I6EA 1QONA 1U0GA 2HXGA 4LEIA 4NS1A 3OIFA 3LKVA 3ROGA 3W5HA 5HUHA 2IOQA 3LX8A 1ECJA 3QPUA 4NMXB 5DIZA 5KTRA 1PJRA 3KKLA 3AF1A 3F5FA 1NLYA 4JEIA 1VB3A 4LVCA 4OVKA 4R0VA 5DRTA 1QCDA 5AQEA 4PG4A 3RHSA 4IDBA 1GITA 1H2EA 5L9AA 2CVPA 3TSCA 5SICE 1TF5A 3L9WA 5A7FA 1E2HA 4UNPA 4B7AA 5I4BA 1QOQB 1ORDA 2QAGC 4GYYA 1JXMA 4L9SA 2H2IA 1ISFA 5IABA 4HDKB 3UKOA 1RWKA 2ANCA 2FF5A 2BKAA 2VYNA 4LCJA 1SULA 5C31A 1XDZA 5KU7A 4YIKA 2JW5A 2BZ1A 3SC6A 3CR7A 1SQGA 3ENZA 4PS0A 4KMSA 3F71A 5CVUA 1PNTA 2NT4A 4MW9A 1HEUA 1JQLB 5J59A 3P4YA 3UMCA 2IKQA 4DKXA 1GHTA 3B36A 1EWKA 3DO8A 3NC4A 5C7YA 5IF9A 1M2KA 5MFZA 2OBYA 1N5DA 3RF6A 2G63A 4F5EA 2C58A 1M2JA 3CG0A 1YHNA 1HRKA 1UXGA 3QNWA 4L4ZA 3JALA 3TB4A 1JIQA 1U2DC 2GEUA 3GFFA 1RJFA 3KQWA 3OX4A 5K2MA 2QLNA 4Y2UA 4J94A 3TZEA 4A10A 3H65A 4COKA 1M5RA 4AECA 2P6OA 3B7GA 4QC2A 4J1SA 2O20A 1XGKA 4AQ7A 2NO1A 5AVJA 4EUFA 3NHYA 2ADFA 5IVKA 3MCUA 5CB6A 1GCUA 3QG5A 2ZSHA 3DMHA 1JDBC 4QYWA 4JL6A 4RORA 4UVGA 2AXEA 2CXUA 2A1TS 4R81A 4CM9D 1F2TA 4QZVA 1CUJA 1UP4A 1Z0JA 3QVSA 4WACA 3R7FA 4C3ZA 1FU8A 3WADA 1NBME 5AJTA 5FPQA 5JZ9A 2FKAA 1VE6A 4HB0A 1VA5A 3BDVA 4RPHA 4TV8A 3RRFA 2VUIB 1DEOA 4BVFA 1PEDA 4BMSA 4DTCA 5HUJA 1KJNA 3T3OA 3G2QA 3LWBA 2CN1A 4QYIB 3R9IA 1IYZA 1YB5A 4QL3A 5HXAA 3MWLA 1S2DA 1A69A 5K5EA 5EJIA 3EMVA 1GV0A 4XH9B 3E9YA 3UJ8A 5CFRA 5F7XA 4YJKA 5E6UB 3P94A 1NQUA 3IPXA 4WIAA 2RI6A 3B8EA 4TXHA 1CK4A 5LP6A 3C6ZA 3L05A 4DSZA 4UFPA 2G06A 2YWBA 1EVIA 3FY4A 2HOQA 4B4WA 3A27A 1SEVA 3AFIA 1OFUA 3KXDA 3R9KA 1RZVA 3WLJA 5P8WA 1SA0B 1VHJA 3NV9A 4AJHA 2O7QA 1HDGO 3LBNA 4GOLD 1XJCA 1WCV1 4JUCA 5UKDA 1RABA 4AJPA 3VZCA 2IUFA 1WHTB 5L3RA 2IE8A 1A5TA 4CV1A 4DEYA 1SHUX 4D9MA 1ZNWA 3N6XA 2RGRA 2JFWA 3HNOA 4X1OA 2YMMA 1J20A 4E4YA 3R74A 1Z45A 4YX9A 3UHPA 1HOTA 2SNIE 2XGSA 4FW8A 4KE6A 2XYHA 1JDNA 4OMUA 4AWAA 2F8MA 4AKHA 3HE3A 3V2HA 4R2HA 4CCSA 2IHNA 3W2EA 2R00C 3ZK9A 2WP8J 1VB5A 2GA8A 2DCUA 2B1GA 2ZJZA 3INRA 5AUOB 4D46A 2IPNA 4UCFA 3RSGA 2OXCA 1OYVA 1XLWA 2CXRA 3CX6A 4GZ5A 4O4JB 3FHJA 3T99A 5JYBA 3N3AC 2QBYB 1SWWA 1OHHA 1JILA 2AOVA 1VKZA 5K09A 1QDEA 2VSFA 3ZU5A 1P9LA 5AKLA 5LQRA 3R9XB 4YUZA 3BXPA 2B1JA 4EGAA 1AQUA 2C4HA 1B8UA 1CR0A 1UFVA 2ENUA 2VJCA 3BMOA 3SN6A 3TW6A 3FTEA 3IAAA 2CNWD 4RK0A 4IG4A 1WS6A 4RLQA 1CS4C 2CLOB 1IOZA 3TLJA 1W0KA 4C0XA 2BONA 2PRIA 3LLCA 3PR1A 1YUMA 3Q6IA 5GONA 1G5QA 1NMEA 2X1HA 3DB2A 2O2SA 2R6ZA 4GZLA 1Z47A 4KNVA 2O5EA 1L4YA 1KNQA 1JUDA 4MLCA 2VL7A 4W1QA 1FFCA 4AG3A 2XGGA 3GVCA 4BBAA 4DDTA 5L40A 4HEA6 4B6RA 3IRUA 1JNYA 5DULA 3FOEC 4DQDA 1GZHB 4DARA 4LF8B 4G25A 1C3EA 2QRLA 2XNDA 2Y0EA 3FVVA 4G36A 4M60A 4C4YA 4HRYA 1RBZA 1B1CA 2DWCA 2C57A 3PIIA 5TV2A 1UJ2A 2F2TA 2B7BA 2FEOA 2RJOA 3LKZA 4KSYA 1ADYA 1CY6A 3A6HA 3AP2A 5KYUA 4CTKA 1ZR4A 5FNVA 5FFNA 1Q95A 2JB9A 1J5PA 1X1TA 3BF7A 5ECDA 1AHHA 2QAGB 1PR5A 3DUFA 2VJBA 2VWGA 2M6RA 3PC2A 4PZDA 4QUHA 4CDMA 1FNSA 1UQTA 2DUUA 3GFTA 4ER6A 2O06A 1B43A 3A9RA 4YJHB 4YUAA 2PH3A 4YTEA 4Y6LA 2RGEA 3AR9A 4ND8B 3GJ5A 4N5IX 4V3CA 2IHKA 2KW5A 1HYQA 5I45A 1RYEA 3F6CA 1H2XA 3E3OA 3RCBA 5C1DA 5KWVA 1IDN1 4A8JA 5CLGA 2O8CB 1P6QA 4M49A 3DZIA 4P5PA 5DM70 1IEXA 2YBEA 4G5OA 4CQLA 3TD6A 3CVVA 3CW8X 1JI3A 4RELA 3IMEA 3S2UA 3ZBPA 4O2AF 3LC7O 4M55A 3ML1A 1EP9A 2M6LA 3G7NA 3VISA 3VZPA 4HGNA 4B09A 4IUYA 5FPTA 4BN5A 3THYB 5FPPA 4UAVA 3UA3A 1SCNE 1W4CA 3FNIA 1G5HA 1X7YB 1Y4DE 2UKDA 1C8LA 3I23A 5AVRA 5IUJC 4X3PA 3E9DA 1PI3A 1UEIA 1MN6A 2AGVA 2HMTA 3ROFA 2DCMA 3RFUA 2BSQA 3IEMA 4AP9A 2G5CA 3O90A 4XKJA 1P1RA 2OWEA 3BWVA 3MFYA 5EJ4A 2R79A 3R5TA 4EG6A 4MRNA 3NCTA 4MPJA 3IAHA 5F76A 4G1UC 1B6TA 3AKDA 1TA4A 1C7FA 1JDBB 3BFKA 5CUQA 2ZETA 5C4GB 4CGZA 4PG8A 3QYPA 1R9NA 1MOSA 1U0EA 1G6OA 1LBQA 1U8AA 2Q6OA 2QROA 1N5IA 2R3SA 1XEWY 2RK3A 1XKTA 4YPFA 3V4OA 1X80A 5EJ9A 3NHWA 4P8RA 5DISB 3KHKA 3UAVA 4EJMA 3RTAA 1WXWA 3HBFA 2ID7A 3M3DA 2I1QA 1YJ8A 1AKNA 2V03A 3S3TA 4TT3D 3TOCA 1MC5A 3UMFA 2BEKA 2GRJA 1U2GA 4NZPA 4YI5A 3VKWA 3UWMA 3H84A 2AK3A 1YV9A 2CJYA 2JGAA 2JZCA 2PMBA 1E1CB 1E98A 1M6EX 4YCJA 4ACAA 1R6XA 3ICCA 3NYRA 1RAIA 1Z6QA 5CJ2A 1BA3A 5IJ9A 4Y2SA 3GDGA 4M9CA 4S2EA 1NVVR 3IO3A 1U7TA 4GL4A 5DKFA 4BP8A 4H18A 4QWWA 4O1IA 5JD6A 1P0IA 3V2IA 3F7NA 3HCNA 2WYHA 2C0CA 2IA5A 1IVNA 3M6LA 4HMQA 5FL3A 5D6NA 1Z0ZA 2DMRA 1T9KA 4MQFA 1M10A 4PO3X 3GBPA 3WHKA 4RTRA 1HMYA 2X76A 3N3BC 1A9QA 3VA7A 4XEUA 3PXEA 3NHUA 1O95C 4EW6A 5BXYA 4I1YA 4OQMA 4QVIA 3RK4A 4EI7A 3RYCA 5G0SA 4QOSA 3AB3A 5TARA 2W58A 1WMEA 1KMCA 3F1LA 4JYMA 4KLCA 4Z4EA 4BNNA 3VH3A 3L8ZA 1Q7TA 3F9IA 5DW0A 2O4CA 1E3QA 4UE3S 1EUDA 2G07A 3FB1A 2AFHE 3NT5A 4RK6A 2C8KA 1SEPA 2ARKA 3F49S 1A5BB 1ABBA 4N47A 1F60A 4BO6A 1IN8A 4RTPA 4V39A 4QOIA 3BZUA 4UREA 1GAJA 3PXXA 4PPFA 5JDIC 4L0CA 3Q7IA 1LCIA 4JI3B 3RYFB 4AL4A 5INTA 1NYQA 4X45A 3CMMA 4OAPA 1HQDA 1LRKA 5FWXA 1LPBB 5LUBA 1RHRA 3DT6A 4YO8A 4H15A 4YI3A 2DBRA 4YV1A 3QXJA 2JATA 1BRTA 3QW4B 1WBJB 5GJVC 4XIFA 3U0VA 1UJ5A 4S1VA 2WK1A 5CVTA 1DG9A 3TOXA 4PLVA 2VDWA 2JLQA 2ZVJA 5KIAA 2J4DA 3NG1A 3ND7A 4BC0A 1HK7A 3OAAD 4KMRA 4PAOA 3H9BA 1JSCA 3I2FA 1ZY2A 5G02A 4N01A 1D6MA 2ZUVA 5EP1A 4EABA 1FMCA 3OTWA 3OEED 1WY5A 4FMCB 1JDVA 1UIMA 3PC4A 3NQ41 5EPOA 1VKHA 1IPHA 3WNDA 1UBFA 3WL4A 2QMYA 4JS0A 2BFNA 1E4OA 5HJ2A 4UJ5A 2PVCA 2Q6IA 1R6DA 4B79A 4C5AA 4EY3A 3NTXA 4TL7A 5SY4A 1N4AA 4BNTA 1DCTA 2L82A 2HCFA 1G3MA 1KQPA 4M83A 1OB2A 5LB2A 2QT1A 1CFZA 4NECA 3TJMA 2FSHA 4HWOA 3ICQB 4CM5A 3LXRA 3GLIB 1UFQA 3I6YA 3OI7A 4KXLA 4MS3B 1AMNA 2VZ8A 1V96A 3PV0A 4WWHA 3B6KA 2JCSA 3LPNA 1RIIA 3CLTD 1U2RA 4NG5A 5TGZA 1WZEA 1DIOB 4QVGA 3RDPA 1JEYA 3LRXA 1AE1A 1GTL1 2A9FA 2NQ8A 2OBXA 3P9PA 4CNQA 4QXPA 4IAOA 5EYPB 1PZFA 4MWOA 1KAGA 2EATA 1JEEA 2H1OA 1SOUA 2A5GA 3I5YA 1GNRA 4FDMA 1E7MA 4OBWA 3F0TA 3VBEA 1CC1S 2WQZA 4OKNA 5JCJA 4RTOA 1R2QA 1FQKA 1Z06A 2CVQA 2FOIA 2JCXA 4G0XA 4HAOA 1BWPA 4Q1AA 1YZNA 3EW7A 3ZU6A 3L5KA 1KDYA 4B76A 3L0OA 4Q7QA 3HVHA 5ITVA 3F4LA 2H9AA 1CZUA 4BKRA 3U44B 3BREA 2ZWVA 4P08A 1KJWA 5KSYA 4RMIA 2HAEA 4C5CA 3MUEA 1YTUA 3VU9B 1JQBA 4Y2HA 1SXJA 1YQDA 4I4TF 1H6DA 2P68A 2H48A 3CU5A 3DDCA 5K3DA 4OU4A 1JFTA 4DSUA 4D0SA 1SQSA 4O5AA 4JMPA 3MILA 4XDYA 4F21A 4L8VA 4QICA 1BAPA 5TMBA 2HYIC 2NAPA 3SEZA 4ITRC 4KO8A 1YNSA 5D3MB 1MDFA 4S24A 3WB9A 3A1TA 4CGYA 2PUGA 1H8HD 2VDQB 4D2IA 2HJGA 1ZWKA 1VIMA 3AJRA 3WP0A 3BWBA 1TM5E 3BRQA 2YJGA 5LU8A 1DBQA 4N82A 1DKMA 4NC9A 1ZONA 2VHEA 3RIMA 1C1DA 4BIMA 1QS0A 1TM7E 1GPWB 2R25B 3ZWBA 4BFYA 3WJ7A 3ZZ1A 3GJ6A 3MD9A 1U0NA 4NBSA 2EG9A 4PHCA 4QAJA 3UTDA 1UPUA 3MMSA 3RV3A 1ULSA 3A4MA 5FTWA 1OSNA 2JK1A 5JBIA 1ZRHA 2QYSA 4LWQA 4MMZB 3RT1A 2N75A 5F78A 3MMPA 1F5SA 4JOCA 3RVDA 3IVXA 4WOBA 5EP2A 4UUAA 1I94B 2YINC 1UPXA 5EP4A 1PFUA 3MCTA 2IVFA 4JKOA 3U4GA 1W6RA 1E96A 3CB4A 2FEMA 2UVDA 5C46F 5L3VA 3ICWA 1OFUX 1U3FA 3D59A 3P2JA 5KAMA 2IYYA 1O94A 3ZBTA 3B60A 2B7LA 2DHCA 3ZWWA 2AOXA 5J47A 2DGDA 1GQQA 2C1ZA 1R37A 2BKXA 3KL2A 2XXBA 4YMSA 2WB4A 4KMMA 4N5HX 5JS1A 1ISSA 2QVXX 5TGDA 2ZJFA 3GUZA 2C4WA 3DYIA 5AKGA 4UU8A 1V9CA 3QU5A 4LZZA 2PIDA 5H16A 1W1UA 3TLMA 4KP7A 4HVCA 1UP7A 2B9EA 3ZWQA 3VOTA 5AW8A 5AYVA 2YVAA 1HYEA 2BGKA 2QZ4A 2QN7A 3JYPA 3SZ3A 3TIGA 3N6RA 4JI8B 4WJKB 1GZDA 2WC1A 5LQKA 1MD9A 4A92A 3BJZA 4Z4IA 2AVNA 5I8ZA 2YZKA 3E48A 1PFWA 1CR6A 1G20E 1H0KA 3BMCB 3I9MA 1Z7WA 4Q7KA 1E6WA 9LDTA 1KWGA 5IM4F 2QA5A 2PSDA 1U8YA 3VHXB 4BO8A 1QPZA 3UGTA 3M8KA 4MUNA 2XWBF 4W1PA 4BV9A 4B0PA 2ZBFA 1Y5RA 4KLRA 3S2YA 5JRDS 1FLNA 3QX9A 5DH9A 1A9XA 4P4NA 3LUJA 3M2TA 3SSMA 4QOGA 1A8HA 3DJYA 3KJFA 1K06A 3GDOA 4WMLA 2B3TA 4RQAA 4LNAA 1MX1A 1XQ9A 2W6IA 3AKYA 5HF8A 1QFZA 2QPOA 2C5LA 2BKVA 4QBFA 4X95A 4Y6OA 4XEHA 3ELWA 4V1CB 3KXKA 3OFVA 2FOLA 1KZ7B 3NVMB 4RE6A 2HEGA 4QGGA 3CGGA 5G4KB 4D4GA 4IQ8A 1T3HA 3NOVA 3WJAA 2IPLA 3F2IA 1GILA 4LX8A 4JZKA 3IKJA 3UKDA 3DOOA 4YYEA 1BGVA 3EXAA 1G6HA 4RVHA 1XVLA 3GPCA 3CKKA 3IVGA 1R5OA 1C3XA 2AN9A 4NHOA 1EVYA 1JYFA 1MX5A 2H29A 4PGGA 3SZRA 2X5XA 5IG2A 4F3RA 3LKBA 1C50A 2F43B 4MKFA 3EIHA 5JVDB 2CT8A 1G5PA 1YNOA 2GJKA 1IULA 2COEA 5K3CA 2C9YA 4UASA 4MICA 5FOTA 4NXMB 1V5GA 1GL9B 2QOEA 5DV9A 1OZHA 2YQ4A 2CLMB 3Q2IA 2IDZA 4FSXA 4RJKA 4HQ6A 4J90A 5B53A 2A0KA 1IY2A 3UANA 1XRJA 1FUYB 4B3RB 4OL0A 4OP1A 3K20A 2DBQA 3NS7A 4MQLA 4EB3A 4GPIB 4YC7A 7REQA 3T9BA 4H7DA 4DYHA 1JHYA 4OXYA 4GR5A 4ZTBA 4X20A 1FFXB 4B73A 3FZYA 4CIVA 4YB8A 3A2LA 1RKXA 2I3GA 3NEJA 4KQJA 4IDEA 3B82A 4P4TA 4CDGA 4K9NA 4Q1EA 4TSKA 5LQSA 5HIAA 3QX3A 4HF7A 3M1YA 1ULAA 3OZEA 4II2A 4Z86A 2ACWA 2EP8A 3ET4A 4TS1A 3OP1A 3E9CA 4LMRA 4MTLA 4QU0A 3TRKA 2XA1A 3HO1A 1ZM7A 1TL7C 2R7AA 2GHTA 4C5BA 3ZGZA 1Q74A 3AKEA 1M33A 4N7JA 1LSUA 4P3XA 5IT4A 5KSZA 2ZT8A 2C5SA 3T1QA 3NPMA 1A97A 4M9QA 4XQEA 3WJ2A 5F3DA 1MJ5A 1W4AA 4TUYB 4YEDA 5LA6B 1OREA 1FFWA 3EJWA 1AO3A 1YUBA 3WKBA 4KW7A 4RENA 1BJKA 2NGRA 3BD7A 3E8XA 3GAMA 1K3TA 1NJ1A 1R0ZA 2Q5OA 3TEMA 5EJFA 3TO5A 3TG2A 3F73A 4OL9A 1OB5A 1NVMB 1FQWA 1NDHA 1E2LA 1NUSA 2Z2ZA 2GA9A 4DKJA 2JIPA 3PFHA 3AJ9A 3KYBA 1W0JA 1L5GB 1XDBA 1OLXA 2PYIA 1M2WA 4K9QA 3W1VA 2ZS8A 2VPZA 4YBZA 3STUA 5FUQA 1U90A 4I99A 4GMHA 2IXTA 3C3CA 2ZAOA 3A70A 1E92A 3BIJA 3JX9A 3NC0C 2ZAYA 3O92A 5ESWA 5ALEA 4AXBA 2C2KA 1DKOA 4NAUA 3IYLW 4NDNE 3ZDRA 1SUBA 2ZDQA 4EDFA 3CUVA 2XE6A 1A72A 1XMJA 4TS9A 3WQSB 2AOUA 2QQEA 1U5BB 1OYYA 1GDTA 1AY0A 3FIJA 1IG3A 1G8YA 1QZTA 3FUCA 4YJGB 3SBOA 3GNLA 1OV4A 2I4LA 2QXUA 5B6IA 2WTNA 1P44A 3FSJX 2Y3IA 1VCOA 3EAFA 2ZT7A 2YZNA 1WTAA 2GZ3A 3DKKA 1N1EA 3G7SA 4FIDA 4EHKA 3PUJA 4KIJA 3CXRA 3QBDA 5C8XA 1PBTA 1DTWA 1F2VA 4K1LA 4KO1S 2MSEB 4QFCA 5I9TA 3TPFA 3THWA 2AN3A 3FRHA 1JF8A 2E55A 3QOFA 1P9RA 5H5JA 3P2IA 2QSJA 3DTYA 4QXMA 3PQFA 3IDSA 1LK0A 2DR0A 2ADOA 5L3SB 3JAWA 2Q0HA 1QHEA 2OWDA 5F1KA 2CUNA 2IEBA 4N49A 4QYXA 4AY6A 1TI7A 3D2BA 4EG3A 4OKIA 4U2FA 2DWPA 2P78A 4F12A 3TR0A 4KAJA 4DWJA 2BFCB 3D5QA 4PYRA 5A4KA 1FNCA 2ZM5A 3CF2A 4BBZA 4TWJA 5JU6A 4ES6A 1EK6A 1KYIA 1R5NA 2W6PA 5A9RA 2BKLA 3WLKX 1QO0A 1FXWF 5FEUA 4U0JA 2D2FA 1JDZA 1MP0A 3MTJA 2OG1A 2ZSBA 1YR3A 4QU9A 4QOJA 3W8NA 9MHTA 3VYSB 1G4HA 3VYTB 4EY6A 2AJ8A 1Q14A 1U31A 1V7CA 3PEYA 2GBGA 2GB4A 1GPMA 1K8XB 3UOAB 3O2QB 2QUHA 4A03A 2XDAA 1P39A 4DIEA 1KZ1A 1PYGA 2IZOA 1Q7GA 3B3FA 1L5NA 5GTDA 4B5KA 2CVZA 2YY7A 1SB9A 2JH9A 3K8YA 1ZVKA 3WBJA 4LTNA 3BIOA 1R0WA 5CPBA 2XHEA 1W88A 4BZZA 3PVZA 2R6CA 2DUWA 3AGQA 4K8RB 4WV3A 4U2CA 1GKYA 2X6QA 3JR3A 1XL0A 2W6NA 1SKYE 1NL3A 4UM7A 4FVTA 1NF8A 1QGAA 2P5SA 3HZOA 4P58A 2O8FB 3C3JA 3K0CA 3P9IA 4ZVNA 4ZYTA 3KQKA 4PAGA 2ODEA 2P9ZA 4C04A 3SQWA 2FOXA 1UCFA 3FSGD 5DN9A 2O8VA 3D7LA 3PNMA 1Y3DE 2Z5VA 1FLAA 1VG0B 4ZI7B 1UEJA 1ZBQA 2WKSA 3NTQA 2D5BA 4LHZA 2V6GA 4ZOEA 2G77B 4YQZA 4C4OA 4I66A 3O1LA 1KFKB 2RHCA 3FZGA 4K6CA 1D2RA 4MO9A 3RIGA 1J2TA 4L5JA 4QREA 1RADA 3GOQA 1B6RA 1Y82A 5HJEA 1DT3A 1PSWA 3ROTA 4NNPA 2YZMA 3TEJA 1ZL0A 3JY6A 5ITSA 2YZ7A 4Z2YA 3HMKA 1GPJA 1N1GA 4MWTA 5A6SB 1WZIA 3UCEA 4OQ4A 3R24A 2BUAA 1L5WA 4Q3OA 2GD0A 5K3EA 4NQRA 2IOYA 3I5MA 2NM0A 4XPIA 1B0PA 3ILXA 5CCXA 3IAUA 5JTUA 1P2VA 4TYQA 1SUSA 2JEZA 4GC5A 3UXYA 4F5YA 1FTSA 5KYVA 4A73A 3GEIA 4GM0A 3QQ5A 3P9RA 5B30A 4HX9A 3H2SA 3IKTA 4OI2A 1B14A 1HT1E 4IDOA 5LDGA 3UK6A 5K01A 3GFOA 2WFLB 3OC0A 4XWAA 1IMOA 3EDOA 3E8MA 4FKZA 4KR6A 1RI2A 2QD2A 4HAXA 1IN7A 5EE9A 4RKYA 8ADHA 1Y6GA 1ZSYA 3DHYA 3CG4A 3L4JA 4R71A 1JQEA 2F59A 2BMVA 2NSHA 3RTDA 2W2PA 4BWVA 3KB8A 1HFWA 1I2MA 3NAGA 5AMXA 2J32A 4BO0A 2NXJA 2WE7A 3PKJA 2FQYA 4EG4A 2REQB 4RKQA 4H17A 1CZNA 3QX7A 2YOGA 4WZAB 2AB0A 4GX5A 1NTRA 4HGQA 2HDHA 4YV2A 3HKCA 5HKKA 3OWXA 3NHPA 4GW3A 4IVPA 3EIEA 1SK8A 2C4MA 3VU3A 5BN5A 3U2QA 1G291 1PDWA 3PUVA 3LIIA 3HRKA 3VR4H 1YKSA 3C1UA 5KPJA 1ST2A 4R2JA 5FH9A 3DDUA 1ZD1A 3S27A 2VTVA 1HDCA 2R84A 1FFHA 2V0NA 3MBIA 2WMDA 1MGPA 1SQ5A 1EHIA 1RWPA 2IDJA 2OCAA 3MQ2A 3P9ZA 2OO7A 5EE3A 2I76A 3R7SA 3TLCA 5K4HA 4GUDA 1R4MA 1RWXA 4NEHB 4IKPA 5AIAA 2MSDB 3ZWNA 3Q15C 4E4TA 1V4NA 5TS3A 4CM8B 3COZA 3OIYA 3FUTA 4Z8YA 4UHJA 3TAUA 3G2LA 3HPQA 3CURA 4GE0A 3V1YA 2C3MA 1OFVA 4LBYA 2BBOA 4BJ1A 4UFNA 4ZREA 3NHRA 3VNSA 4HXEB 3UG6A 5IBCA 2FMHA 5LZ9A 4D96A 1M6VA 2XB8A 3NBMA 4YCCA 3B48A 3HCWA 1ZX1A 4AZTA 2WDPA 4ZT6A 3VKGA 3WGQA 1OA1A 3DVLA 3Q8WA 2WT9A 4E12A 3RWOA 5HCIA 4DIDA 2BMDA 4BMYA 4P0PB 2OFWA 1PVOA 2XD4A 3CH7A 5T4HA 4TTQA 5FKJA 3CLVA 1SC1A 2YFKA 3GLGA 2BEUA 3H13A 3VAAA 3B9RA 3WIEA 4CI0B 2O4UX 2PEYA 2JKZA 2J3MA 3HO8A 5DBFA 2ZBRA 4RANA 4DL9A 3A9UA 3ZE7A 4BUCA 1L7AA 1JKXA 4CKWA 1Y3CE 2JK0A 3DTVD 2W8BB 3QKIA 3RVMA 1GGJA 5I5EA 2YIVX 1BH6A 4UW9A 2C0PA 1TVEA 2V55B 3VYWA 1CUZA 4RVSA 4BJHB 4XVRA 4OP2A 2H11A 4MUKA 4NATA 3UGJA 4BQRA 3HXLA 4TL6A 1OFIA 1CP2A 5H02A 2I29A 1A9YA 5FBVB 2FR8A 1AQLA 4O4IF 4UXHA 4I8XA 1J4AA 1I36A 4UD2A 4ALKA 1AKVA 3Q7TA 2DB3A 4QRIA 3I62A 1ACMA 2R6AA 4UNIA 3DFIA 4BQSA 3WYFA 3W06A 1P6XA 1E1QD 1S2NA 2J5XA 4Y7DA 4HAVA 2WJPA 5HBGA 1OFGA 1OLUA 2YHIA 4Q16A 3GJQA 3JQ9A 2P1DA 4XZ3A 1R4ZA 4YACA 3GUCA 4FKBA 2ONKA 1M54A 1A5AB 1L7BA 1A1VA 1YO6A 2RD2A 1QV9A 5L6MB 1JJ7A 3WP1B 3TVYA 4CKEB 4XWOA 1IN4A 4N76A 2RHHA 1ZMTA 2G0TA 3FI9A 2AOTB 3LTNC 3W6PA 4GYKA 3WFJA 3DNFA 5AHKA 2YV3A 2QL9A 1MJNA 1A50B 3AHHA 3JQGA 4MQ5A 1QVZA 1T8PA 1J21A 3KVRA 4Y7CA 3T3NA 4CEHA 1YVUA 2PSJA 2VRCA 4X97A 1XRQA 2XMZA 4UATA 1O8CA 3KSDO 5AW4A 4PSDA 4U7WA 1JE1A 2FN3A 3F4KA 1J7JA 2VH1A 5KUTA 3HR7A 1ZK1A 2R11A 3D8HA 3IHTA 3DS8A 3TQQA 1UKYA 3ORHA 1K9SA 1ZW1A 2QL6A 4YV0A 8OHMA 1ARZA 4DREA 5JROA 1HWYA 1TD9A 5JCZA 1GA6A 3A9SA 2Y6UA 1GAXA 3FG9A 2WT4A 4PVDA 3EUAA 1L4HA 4LYEA 4OQFA 2A3RA 3L9XA 1S3FA 2MSNA 3U4QB 4KGDA 4AUEA 3BHIA 1QTIA 2H3EA 3O9MA 5BSFA 1PT9A 2C3OA 3OZGA 1TJPB 1E2JA 4LXYA 1CD5A 2NTYC 2W11A 4IZ6A 3WMFA 3QEMA 4DHEA 2AQ8A 4OJYA 1XP8A 3ZDDA 2HRQA 1I7SB 3Q3GE 1EUYA 4RTKA 2O7SA 1WBBA 1DVRA 3TUJC 2G1JA 1EGHA 2YV2A 3H5TA 3KQSA 3MTGA 4K1XA 5BNZA 1NV9A 5C8DA 2Y76A 2FX2A 5FLKA 5E3HA 1MAHA 3KJGA 4K9MA 4N8DA 2DRIA 3SEFA 3B1KA 3BKXA 4KXVA 5U4QA 1UK7A 1YACA 4DW8A 5JUWA 1CULC 3IBCA 5KMGB 2EWMA 3FHLA 4W5WA 2GJAA 4DT1A 1IC6A 2OCDA 1XTZA 2X0IA 3OOYA 5BQOA 2YYAA 2FZ5A 2IXBA 4KN8A 4PCAA 3W7AA 3SOZA 5H3HA 2SKDA 3WO1A 1VL6A 5LN1A 5C9ZA 4TLLB 2WDZA 4R9SA 2H06A 2P1ZA 5C5IA 1LDNA 4H3VA 5FUBA 1A2BA 1Z2EA 2VN8A 5HKAA 1TMYA 1P33A 1NR7A 2IIBA 4BE9A 3RVRA 1Q1ZA 3AR5A 2ZP1A 5FJIA 1ZOIA 1TPZA 2J5KA 2JAOA 3AFHA 3T3GA 1LW7A 2EKPA 2EXXA 3HUTA 5TY0A 4FMDF 2Y67A 1P72A 2IHBA 2PUFA 3H17A 4GVLA 3WV4A 1ULHA 2CNKA 2GZRA 2HFJA 1IQRA 2YWFA 1P45A 4J2OA 4K9SA 4WA7A 2YYZA 1QDLB 3NHJA 3PPYA 5IH3A 5KX5B 5ILOA 1TMGE 3L4BA 5IBQA 5JQGF 5F9HA 2X8JB 2PSSA 3P2MA 5JH7B 3W5AA 3HA5A 1G21B 1NLUA 1R16A 2B4KA 4G0OA 5H68A 1T8SA 1NF2A 2B5WA 5HG0A 4PLWA 1AKWA 4DLWA 4HRAA 3H83A 3BOSA 4J1TC 2P30A 1D2EA 3UK2A 3BBPA 3UJCA 1E9BA 1Y7TA 2FFBA 1UOOA 1W29A 1LI7A 1USVA 3LP8A 3D6TB 4KXUA 1YJBA 1COWA 2I54A 2J3HA 2P35A 2VUSA 3DXFA 5B58C 2ZIAA 4IIUA 3ZPXA 3H42B 2XZDA 3FR7A 3HJFA 4PFQA 1NXPA 1Z73A 4IDFA 4RGYA 5F9MA 2PZLA 4RZ2A 3RBZA 2DEUA 2OGTA 2VF2A 4MUIA 1EGMB 3OZWA 3UJBA 4B4KA 3OKCA 3HBJA 5FO0A 1P60A 2X15A 3KWFA 4Z7OB 1C9NA 1TJ3A 4ZVUA 2GXQA 2J3LA 3S28A 3UXEA 2OTCA 5TT0A 4BO7A 3E4DA 2D6FA 1XG5A 3AY6A 5F2EA 4K40A 1YFLA 5KYYA 5M29A 4BAZA 2QDXA 4L50A 1KYYA 3KOXA 1GZSA 5ALKA 2A4MA 3U37A 4BAGA 1EFKA 3K9HA 3R4VA 1JMYA 1T8RA 2RE8A 3ADPA 1VRWA 3PYMA 4M1MA 4XUEA 5A71A 4K86A 1A8QA 4D3SA 4LI3X 1HY3A 1K4KA 3QWBA 2J0UB 1P7CA 1D03A 3A04A 1KK3A 3G8DA 1ODFA 3UCFA 3T3PB 1VMIA 1S7GA 3TSYA 2XZTA 2H51A 2Q4OA 1WCYA 3E18A 3G0CA 1M3SA 4URWR 5IK2A 1XQWA 2A9KA 2XUPA 3E9RA 3MYYA 4NJMB 4A1FA 5K3OA 3EPKA 3A3YA 3RS5A 1LWNA 1UBUS 2XIJA 2GZMA 1XVUA 2V7WA 3GDWA 2KE5A 5ICFA 3UAOA 3TSZA 1ZN9A 3O5AA 2Z2JA 4TVKA 3QEJA 3U40A 2J6HA 1G42A 4BV8A 2WTUA 2CKDA 4M1OA 5LQUA 3EISA 2ERCA 2GHQA 2WYIA 3EC2A 1P1FA 3DZKA 4J0GA 3DL2A 4IGKA 2WJ4A 3KNZA 1L4UA 5E2AA 2O0JA 1G41A 2A2ZA 1YZGA 4M1TA 5CU7A 5K4AA 1XOIA 5LSAA 4ZYVA 3PFCA 3UPDA 1JJVA 1W59A 4C14A 3RRMA 5B57C 1FFGA 2GH1A 5GP1A 1FDTA 2NQ2C 1SCJA 2B0CA 2I4IA 1BDJA 1YZQA 4G37A 4M21A 2OHVA 3YASA 2NYUA 2ZK7A 4YAKA 5KVCA 1N34B 1DC6A 1KERA 1ULBA 2GYWA 3MWDB 2VFAA 4M54A 1SY7A 4HDSA 4R9UC 3VO9A 1H4SA 3AOEC 5EKDA 2AFIA 2V0CA 3U26A 1QX4A 1XD2B 4KPFC 2PYZA 4OM8A 1KHTA 3DLTA 3L0DA 4KO4S 4YDRA 3UH0A 1T3LA 4OH1A 1T0HB 2FMKA 2IUTA 1W35A 3B3AA 1J5EB 2PHZA 3PYLA 3PVCA 1SBNE 3FNEA 1GTG1 3PCXA 4KVZA 5C18A 1N2BA 3EZ9A 4FGUA 3LBFA 5JSZB 3IX7A 3I04A 3QE0A 1D4OA 2GSDA 4N9QA 5EXSA 4X61A 3ZCXA 5C5CA 5ER6A 1JWAB 4X8OA 3AEZA 2JG3A 1Y5IA 1AF7A 4MYRA 1OPXA 4EB8A 2C2HA 5JHHB 3EK2A 1KKMA 1JHZA 3S1AB 3AVWA 2ZTLA 4LWPA 2W6JD 1SBHA 4EHHA 3OQHA 4FYWA 2I87A 4GSYA 3HCFA 4KN9S 3GH3A 3I61A 1Z0AA 3ZH2A 1KGDA 1MG0A 2ZULA 1R8QA 4OMDA 4E30A 3JVDA 1AV6A 1YHYA 3C39A 2ZIGA 1LY1A 5AW1A 4KXMA 2OYRA 2HKIA 2VHQA 4ZT4A 2AG6A 3MJCA 4N6NA 4YRLA 4C6TB 4RHEA 1WZCA 5K3FA 1RP7A 4QTTB 5I8PA 5IKPA 2F1OA 5SZJA 4WY2A 3WSWA 4RV4A 3BEDA 2Y4OA 5AI8A 3ZY5A 8ATCA 1HT2E 3ZKWB 1E79D 2H00A 4B7CA 1Q7CA 4N18A 2ODTX 4NYMQ 1LDMA 4P7KA 2ZTMA 1EFCA 3HEBA 2CZCA 3PG5A 2OYSA 2FPKA 2JGDB 5K99A 3C5CA 3D02A 3NUZA 1YDFA 2DU8A 2L69A 2ZWMA 4BB9A 5CIYA 1KE1A 4R7GA 1XTPA 4TN5A 3OE7A 4UOEA 2FPXA 2OO5A 3CISA 5BV8A 5CXSA 4KQCA 1QU3A 2J9FA 3R75A 1Q22A 2ZSFA 3I92A 3ISVA 4JROA 2CYCA 1Y5MA 3B89A 4O3MA 3KC2A 2R1VB 2I55A 2QE7A 4BLWA 2V59A 1HNNA 2IEYA 2FRDA 3BMQB 4KDEA 1IZ9A 3H3XA 3RE1A 5JD5A 2A9JA 1A8SA 1H3NA 1T24A 3DVRX 4LX0A 4B3BA 2NO9A 1YI0A 1F2UB 1SUCA 1WMFA 3LQ4A 2OYCA 3LA8A 3KJZA 5DHFA 1IXSB 1M8GA 3LNCA 3WV5A 5CDGA 1K0UA 2ZIWB 3AILA 4FOOA 6REQB 5KCMA 2YFHA 4M7RA 3BMNB 3QTLA 2FE4A 4GNRA 1XDUA 2BMWA 3O93A 4QOFA 1FA9A 4ZZ3A 3WC4A 2FX5A 4ML3A 4DABA 3NBUA 1KH1A 3HVUA 4UAUA 1ZOLA 3U9TA 221PA 3ENNA 2XA9A 3HCDA 2I67A 3NGXA 2IYQA 2NVUB 2Y1OA 4V24A 3GGGA 1JQDA 1NUUA 2O48X 3BMXA 4NARA 3GCZA 3R3XA 5AFSA 1HSOA 2HI0A 2O07A 2DFDA 4A6XA 1R6AA 4YAJA 3MCWA 2XRYA 4QUDA 2HQ1A 5BUSA 1ZGCA 3OECA 4Q3LA 1DBPA 3RHTA 4OF4A 2OHGA 3MS2A 4PZ0A 1FX0B 1MBZA 3QXHA 1XPRA 4QNNA 3WLRA 1WOYA 2JI8A 5E7IA 1N57A 1JR4A 4HDKA 3MEQA 3S44A 4MYHA 4W9RA 1W4LA 5KJ6A 4MHTA 4L3OA 1CUEA 1MRZA 2G9VA 4JJ4A 5AVZA 2OAEA 2P2NA 4N6GA 4RSRA 2PMEA 3ZX5A 1H3EA 1GZVA 1MPXA 3GR6A 3WRYA 1APBA 3L49A 2BRUA 4NONA 1V8BA 3CVOA 3HACA 2WG1A 3ETJA 2R8OA 3LQQA 4J2TA 1F06A 3KWJA 2BGMA 4XM1A 3PPVA 3UW1A 3DLHA 4HX5A 3NIGB 3JQ7B 1FFBA 2P3LA 3HFJA 2XAAA 3H86A 1A27A 4Q01A 3HGMA 1SMKA 3ETEA 3HB1A 4IV0A 4DLRA 4Y2JA 3UBTA 3IBSA 2FCAA 4WD3A 2OOKA 4FDVA 1ONPA 1PQWA 1ZIDA 2GPWA 2FW0A 4EY8A 1PL0A 3KT3A 4MS4B 3RARA 3INGA 2AJCA 2JJ1D 3PQ3A 1M73E 1HH4A 1NRXA 1S1CA 1YS1X 3OLQA 4INAA 4JBHA 4K8OA 3WX0A 3OO0A 2HH9A 3KUKA 3TZQA 5K8CA 5LQCA 3IR6A 5DNDA 3BJMA 3FUVA 1IZ8A 3TR6A 3RVJA 3VSBA 3BSWA 4ZCTA 4Y0AA 1PLJA 2NSJA 4YYZA 5LUAA 1RWNA 2GO1A 3WLHA 1QB8A 4RACA 1L8AA 3L0PA 1T0UA 4R9RA 3ZKAA 5JXJA 3UHJA 4CG2A 1HLFA 2X0KA 3FOBA 4ND7A 5C0OE 3V3TA 3AU8A 4LQCA 3TSWA 5B64A 4LECA 5IS2A 3RC2A 1W2GA 1M2VB 2GCIA 3RRBA 4BFWA 1YOBA 1UBLS 1UMBB 1AMOA 1QGUB 5HKOA 4QYIA 2A0UA 5AM4A 2I6TA 2EX4A 5COAA 3LYAA 3LHSA 3IUBA 4RKRA 1QIMA 2J0EA 5BSWA 3ETGA 4NFLA 4TQAA 4BDTA 1NE7A 2JRCA 2RKBA 3C5HA 3GGDA 5E6UA 4CCYB 1I4TD 3EWIA 2XWJI 2QD4A 1T3SA 3AIOA 5DCWA 3LPMA 3EC1A 4XA8A 4E14A 5HP4A 2ZZNA 5GJBA 5CH5A 5EN4A 1N7JA 4M7PA 3W9SA 1I1OA 3G2IA 3PPIA 3PEEA 1SA0A 3U16A 3KEOA 1CB0A 3OQPA 4HWRA 2NZXA 1H0SA 4P2BA 4NIMA 4YUVA 1TAUA 1OBVA 2Z2XA 1IPEA 1BKYA 1WHTA 2C7OA 5K8UA 4GVPA 3LL7A 1QYRA 1TLTA 2LCIA 2PZFA 1MO6A 2HQBA 3QE4A 4R8LA 5ELXA 1H9CA 4EA6A 3KDAA 1A8UA 2LR0A 4MHOA 2OP1A 3L02A 3ZGLA 2VCYA 3RV4A 1EP1B 1RI4A 4TM8A 4CMBA 1J8DA 2D59A 2X7JA 4EA9A 2I22A 2YN4A 1L7QA 3MPOA 3PNSA 1H23A 2GDJA 3GLQA 1D7AA 1HRDA 1T5TA 3K0KA 1NQ5A 1UMKA 3Q0IA 4DBLC 3A6PC 4L2IB 1X1SA 3IIIA 4GC9A 4NMMA 3ZCSA 4L78A 1XMIA 5BN1A 3T0IA 3TRDA 3VUEA 4DA8A 2UDPA 4DR7B 1GSAA 1N6OA 3RC3A 2CLKB 2GUWA 2XNCA 2NWQA 3K8ZA 1KSGA 3ZI4A 5BW4A 4WZ6A 5AJVB 3VBCA 1P80A 2YDYA 5GOZA 4DMKA 3NHSA 2G8LA 2C07A 3ZJUA 3DZDA 3MTAA 2B4QA 4LSGA 2GSWA 3F6BX 1QZ3A 5D84A 1QUFA 5C8YF 3RBVA