4EB8A

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with dadme-immg and phosphate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
288
structure length
288
Chain Sequence
TLMENGYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANWEEVLAAGKQAAQKLEQFVSILMASIPLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Purine nucleoside phosphorylase
total genus 89
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eb8A00
1U1FA 4ECEA 4TXHA 3UAWA 3OPVA 4TTAA 1A9SA 4G89A 5DK6A 4R2WA 3FB1A 3EUEA 3OZCA 1U1DA 1RXCA 1PKEA 4TS3A 5B7NA 2AI1A 4D98A 3OF3A 4GLFA 1Z5PA 1JDSA 3BL6A 3P0FA 4TXMA 5CCDA 4FFSA 4QEZA 2QDKA 4LNHA 1SD2A 5JPCA 4EARA 4OJTA 1Y6QA 3UAZA 1JDZA 1RXUA 1OTXA 5F78A 1ZL2A 1WTAA 5EFOA 5F7JA 4OEHA 3DF9A 2I4TA 1Z33A 1T0UA 4D8YA 4TTIA 4WKPA 3KVYA 4G8JA 4M3NA 3TL6A 2HRDA 3ODGA 1RXYA 4EB8A 5FAKA 1T8RA 1LV8A 4WKNA 4F1WA 3DP9A 3OOHA 3OZDA 4D8XA 1OTYA 4TTJA 3LBAA 4I2VA 4NSNA 1JDVA 3KU4A 5B7QA 4DANA 3FUCA 1JYSA 3MB8A 3MMSA 4QFBA 4BMZA 1A9OA 1SQ6A 3GB9A 1CB0A 1TGYA 4OGKA 5CYGA 4MCHA 1JPVA 1PK9A 3PHBE 1QE5A 3E0QA 4LKRA 5IFKA 4JOSA 3INYA 1B8OA 4R31A 4DA8A 1Q1GA 4BMYA 1OVGA 3DJFA 1V41E 2A0YA 1Z34A 4MARA 1PBNA 4L5AA 3F8WA 1Z36A 4QASA 1OV6A 3E9RA 4TXLA 1ODJA 3DPSA 1U1EA 4DAEA 5F76A 2OC9A 5F73A 3OCCA 4F3CA 1A9RA 2GUWA 4OY3A 1Y6RA 3LGSA 1V2HE 4PNPA 4L6IA 3UT6A 3DDOA 3EUFA 4TS9A 1U1GA 3K8OE 3IOMA 4K6OA 4IP0A 4P54A 4M7WA 5B7PA 1SJ9A 1YBFA 1JDUA 4RJ2A 1ULBA 1A9QA 1K27A 3FWPA 1PF7E 1Y1QA 3OZBA 1YR3A 1FXUA 3KHSA 3U40A 4L5YA 4F3KA 1Z5NA 5KB3A 1OU4A 4DA6A 1JE0A 3O4VA 4OGLA 2XRFA 4YO8A 3ONVA 4X24A 4NY1A 5EPUA 2OXFA 1PR2A 1NC3A 3KVRA 2RJ3A 3IEXA 5C80A 1T8WA 4F2PA 4LDNA 2Q7OE 4F2WA 4E1VA 1G2OA 1Y1RA 1RCTE 3KVVA 2AC7A 2B94A 3LA8A 1JE1A 4YJKA 3EMVA 4LNAA 4R2XA 4GKAA 4DA0A 1YQUA 3BJEA 1U1CA 1CG6A 4WKOA 5B7GA 4WKCA 5ETJA 2IQ5A 3NM5A 3UAXA 1VHWA 3K8QA 1VMKA 1LX7A 3NM6B 1ODLA 1ODIA 4M1EA 4H1TA 1Y1TA 4U2KA 1M73E 4GLJA 1T8YA 1JP7A 1RR6A 2AI3A 1NC1A 5I3CA 1K9SA 1SD1A 2H8GA 2HN9A 2QTTA 4YMLA 1JDTA 4TYMA 1Y1SA 2ON6A 1YRYE 5F7XA 3PNSA 1PR0A 1B8NA 1V48A 3QPBA 1TD1A 1RSZA 5CXQA 4BN0A 4L5CA 2PGAA 3FOWA 4JWTA 2A0WA 1PR6A 1VFNA 5F77A 3P0EA 1ODKA 1N3IA 1Z5OA 2HSWA 1A9PA 3KUKA 1ULAA 1RYZA 2BSXA 4GMHA 5IU6A 3FAZA 1TGVA 2AI2A 3NM4A 2QSUA 2HWUA 4QARA 1V45E 3BGSA 1XE3A 4OF4A 1Z37A 1K3FA 1A69A 1V3QE 1RFGE 5CXSA 2OECA 1T8SA 1Z39A 2A0XA 4LZWA 1PWYE 3GGSA 4L0MA 3NBQA 3E9ZA 2ISCA 1Z38A 3OOEA 5F7ZA 1PW7A 1TCVA 4DA7A 5EUBA 1V4NA 4JP5A 4YNBA 4QATA 1PK7A 4KN5A 1ECPA 1PR1A 3UAYA 1OUMA 3SCZA 4NS1A 3UAVA 3C74A 1VHJA 3O6VA 4D9HA 4WKBA 4G41A 4BMXA 1A9TA 4MCIA 5CYFA 5CCEA 4UC0A 1RT9A 5K1ZA 3PNPA 1ZOSA 4TXNA 1I80A 1TCUA 1RXSA 3FNQA 4DAOA 1YQQA 4D8VA 5F7OA 1PR5A 4DARA 3EEIA 3PHCA 4DABA 2QTGA 4QAQA 1C3XA 4TXJA 3T94A 1LVUA 2OC4A 3D1VA 3OZEA 1Z35A 1PR4A 3BSFA 3ENZA 2QPLA 2P4SA 1NW4A 2A8YA 4PR3A 2I8AA
chains in the Genus database with same CATH superfamily
1ZAKA 4XM0A 1NI5A 3IUNA 1RXIA 4RZIA 4LKOA 3ZDXB 3FR8A 4ZO6A 4ECEA 5K3FA 2P8SA 3PEVA 4HNHA 2QEQA 2A30A 1N3LA 3M83A 1MENA 1E5LA 3VVLA 1C1YA 1HY3A 3BERA 5EWMA 1W0JD 3K6SA 1GZ5A 4R1TA 4WXEA 2X9QA 4WXMA 1P74A 4FT4A 2PGXA 1N92A 2HZ7A 2IXBA 1V8PA 1U6KA 3PB3A 3NWEA 1QKKA 5HF5A 1U7DA 1YFKA 2W2VA 4FHGA 1IE3A 2GLXA 1E4YA 1MIOA 3Q5GA 4K9SA 1MDBA 4NAUA 2RGUA 4MI3A 3V7UA 5E6UA 3L8FA 4AX8A 2BUAA 4W1RA 2IHVA 2YWDA 2JGJA 2OZVA 1FDVA 3LUPA 2P9FA 3I1IA 4NYMR 4L74A 6GPBA 4TWRA 2AJDA 2RSLA 2QZZA 4CTKA 4OHOA 5BR7A 5I7SA 3X2FA 1JDSA 1G16A 2ATVA 1ULUA 1GQRA 2Y0CA 1JEQB 3CZQA 3THYA 4ACBA 4PRKA 3K4PA 4HLQB 3VPAA 1C9NA 1SIWA 3NTVA 1N2ZA 4R84A 1QX4A 2BM1A 2J5XA 1HETA 2OXCA 2YR0A 2FF5A 4Y8VA 1QYVA 1Z6AA 3MBOA 4LNHA 3JRWA 1J42A 2PHZA 3OTIA 1KARA 2G3YA 2QP9X 3JATB 3JXEA 2I7DA 2WKQA 2WU1A 2FUEA 3AW9A 4DTIA 1DRWA 2A0FA 1F06A 4C7VA 1WP4A 1ZJ5A 2PQMA 5B6PA 5IAAA 5E6SB 3KQNA 2QMHA 3RYIA 2A5JA 3GVCA 4BHTA 5HR5A 2ZWAA 1FQJA 2B5VA 2ZT7A 3L4BC 3K0SA 2Q9UA 4D8YA 4YMHA 4F2DA 4U7PB 3B3QA 3AM3A 3JYLA 4KRYA 3ZJ5A 1CUSA 1NMZA 3PPIA 3V8BA 5EWLA 1EEXB 5JDIA 2ZUUA 4EYQA 2Z4SA 4RD3A 4F2GA 5DULA 2WK1A 1U1IA 2Q9AA 5FAKA 2HK6A 4DSUA 4P84A 3SFVA 1SBZA 3QKRB 2OZKA 3NPAA 3MRTA 4ZT7A 1XD2B 4BJ6A 4QGSA 1IPFA 1B26A 1HRKA 3FGNA 4JJAA 4MVJG 5EPOA 3SICE 4BV3A 4EG3A 3PHJA 3T54A 4RF4A 5ALWA 1GFZA 4GBGA 5CDFA 4D8TA 2VP6A 4RV4A 2GK4A 2HADA 3GRZA 4DDUA 5GJBA 1YRQA 3BBPA 3AEZA 4CEJB 1JIKA 2E87A 1NVFA 1T2VA 4OD0A 4XWAA 3SZGA 4YWJA 4AO6A 1LTQA 2J9YB 2AFHA 3X43A 1A4IA 4R41A 1KNQA 2Z58A 3FUCA 3RVNA 4BQEA 4P3XA 4A92A 5A3QA 4YI5A 2I66A 5BR8B 1H9AA 3SDBA 5AUOB 1ULSA 4IKEA 3JYOA 3V1NA 2H3EA 2KLHA 4MUIA 2J45A 3O4RA 1NJSA 4Q4DA 3RBVA 4MIEA 4RD6A 3NONA 4P3PA 4UMVA 2IH2A 1KQFA 1O95A 4QIHA 1GZSA 1JBKA 1GUFA 2FPWA 4HAWA 1XEFA 1TGYA 5E8JA 2R5NA 2OCLA 3O95A 1PD0A 2Q3MA 3IAM1 4LNUB 5SZJA 3EIEA 2R1UA 1JPVA 3EZXA 4IGKA 5FOXA 4BFVA 3E22A 2EQ5A 3CLKA 1ZSYA 3TJMA 4O4LA 3UH1A 1XZCA 3LI2A 4XEUA 2FEKA 3VSDA 3TEFA 4N5HX 4HAVA 1NW3A 4OK3A 3R6GA 4A0HA 4IJWA 2Q5OA 2XZDA 2Z57A 4I50A 2WFLB 1EZ4A 2I8CA 4RHEA 3ZD9A 5ICFA 3ORRA 3THSA 3R3VA 5DASA 3ROMA 4DQ0A 3UB3A 2BGNA 3EIFA 3D7SA 3EDOA 2PPLA 2A0YA 3BBLA 3IVGA 2Q1UA 2NZ8A 2WLSA 3DQPA 4I1SA 1E1RA 5DCUA 3VM6A 1YH3A 3PFHA 3JQ8A 2G63A 4EK9A 3DMRA 2BR4A 2VJAA 3CG0A 3RJMA 4OHBA 5DNUA 1X92A 2NSYA 1DHRA 1N4DA 3A1CA 4BCBA 2ZIEA 3QVXA 3PUWA 2PX3A 1JAYA 2YN0A 3THOA 1GPMA 3K0CA 2QN8A 1EQUA 4WCFB 5ALGA 4CM7A 4PYJA 2P5SA 5KTOA 4JJ8A 5DGHA 2GPSA 4CBVA 3TUZC 2B37A 3ZV3A 2FKNA 1IY0A 3BGIA 3L7JA 1C1XA 4PZZA 4UOEA 1EXVA 2VXCA 4HATA 1YQ9A 1SU7A 4B0OA 4HWSA 3G49A 1ZJYA 4KXUA 1WDLA 4MWTA 4OY3A 2ZBEA 1N5JA 1F9EA 3RR2A 4A0RA 5I9NA 4AQ7A 2QUBA 3WJAA 4Y7DA 4HDSB 3W6NA 4YLEA 1IUNA 3MFYA 2L2QA 3HVIA 4GI7A 1EX1A 4RY0A 1ZK2A 2YQ5A 4HDRA 2G04A 4S1PA 3REFA 2P65A 4PYNA 3ZOZA 3CBQA 3TE7A 4HLUC 3EGDA 1UKYA 4JU9A 3OT1A 5SYAA 3PKZA 2OFXA 2CLMB 3W2FA 3DDOA 5J47A 3KOWA 1QONA 5AJXA 1L4FA 5ILGA 2QDXA 2ZFUA 4BQOA 1XWIA 2GTIA 3LDGA 1KKUA 3QBTA 2IXFA 4RMJA 2WJJA 4C4TA 4QPNA 2IHUA 1DV1A 2CCKA 3OLXA 1KEWA 4C2TA 2AHRA 1DELA 3CZ5A 1BVRA 3MK31 3H42B 3TXXA 3MJTA 3VR2D 1FYEA 1YB7A 3ROFA 3V6LA 1A50B 4NCXA 2OQ2A 4IO1A 3T9DA 5HJ7A 2RIPA 1H2WA 1C3VA 1YDMA 3EIXA 1M74A 2PD3A 1OFUA 1P2FA 4J1QA 4NPHA 1PDVA 1JZSA 4AZVA 1E2QA 4ETWA 5AVJA 2XUGA 2ONJA 2C96A 4NE7A 4QEDA 3T5GA 5ALUA 1AN0A 3QNUA 1KI3A 3R6WA 1IIRA 3AP2A 1F3OA 5TPZA 1NRWA 2R44A 4M83A 4WZBB 5H7XA 4EGSA 2ADOA 1BJKA 3KJHA 1YNSA 3VVBA 3UPDA 5JDIC 3R4VA 5DM60 4J1TA 3OTQA 1TA9A 2A9KA 2QMZA 3IKLA 3MTQA 4TS1A 4F93B 1K7SN 1MHTA 2JFUA 3DD5A 1SZJG 4PAQA 5H0IA 3VAAA 2H16A 3S55A 2EW1A 1BDJA 1X9IA 2QRHA 5EYPB 4XD7A 3VI3B 1XWWA 3GFOA 4MVJI 3VR5D 1SIOA 3H8JA 1UDCA 1KDTA 5BW8A 5E2BA 4D26A 3WA7A 2CVZA 2IEIA 1H5QA 1IN1A 1AXEA 1O87A 1P33A 2E82A 4RO0A 4BV8A 4AKHA 3FWYA 2NXEA 2ZI7A 3MOIA 3BS4A 5KCZA 3ADDA 1UZAA 3CZAA 1L4UA 2Q5QA 1KC1A 3NRBA 3LCRA 3P2YA 4PGGA 3G2KA 4AURA 3GG9A 3LXMA 4QYXA 3HJGA 3IMEA 3TW8A 4RIFA 4DLLA 1QORA 2G8LA 2ZVPX 3AUAA 3FWNA 4JX9A 4JBIA 4KQMA 4MJ3A 1KH2A 4IH9A 5CIQA 4EIWA 8ATCA 1FQOA 1K06A 3D7MA 1XZPA 5GZ1A 5GZ3A 3ZU3A 2WWWA 9LDTA 1JQ5A 1XMPA 1U7OA 2HRZA 2RFLA 3CFYA 2AFIE 2M1XA 3HPRA 3ES9A 2I91A 4RK6A 4IYJA 5G4KA 3I09A 5I3ZA 3KR9A 5C5DA 4MP3A 4JKIA 2WHQA 1DAPA 1L5OA 3PC8C 4G25A 1XDDA 3EDRA 4ZKEA 2JLYA 1HKHA 3EBOA 1TUIA 3FAKA 2XBMA 1TM3E 4G1FA 1CF9A 4P0QB 1GLNA 1SURA 2Q6VA 4JSRA 4QSHA 3UAXA 1NDUA 4N48A 4OO3A 3X3HA 5AJYA 4B4VA 2LBPA 3I2YX 2C57A 4RFLA 3RC3A 3TCXB 1JQKA 3RSGA 3BSWA 3KKNA 3UK1A 5KIAA 1NLFA 1EUZA 1EGVB 1AX9A 3ZNOA 1EUCB 4DLXA 2H2AA 2B5WA 5BW4A 2JIQA 3RC9A 2X6RA 4BNNA 1Z0AA 1DLJA 4X44A 1Z06A 1Z29A 3H2GA 3W5JA 1S2GA 1HFJA 2Q7XA 4QYSA 1S1CA 3DMGA 3RAFC 4MWOA 3C5HA 2PMCA 1VKZA 1XZLA 5F52A 2H2HA 1JXMA 2WIGA 4GQAA 4F1KA 5FWXB 4TMYA 3FE2A 2VEDA 1QUFA 3OSUA 3V4SA 5FHQA 1XTVA 3ZGZA 1M0TA 1W2GA 3LWDA 4GXRA 4ZQBA 3IAXA 2X0FA 1F2VA 2PEZA 3PL5A 4K8RB 4EY4A 3I5YA 4N5DA 4LEIA 1NUTA 3RVDA 2HT1A 1XNQB 5DB4A 3PA6A 1NM5C 1WABA 4B8ZA 2G36A 3D3WB 1L5WA 2JJ1A 2PD6A 5FEUA 1SUBA 5E7IA 3ACDA 3V8EA 2PT6A 4P0PB 1SPXA 4HPJB 4R2JA 4WJLA 1W0CA 2QVGA 1IBRA 1S01A 3WV4A 1K4KA 1GGJA 2GD0A 2J9ZB 1BH2A 1A7UA 1XHFA 1Q1ZA 5GOZA 3WWYA 5J4LA 2HRBA 2OGUA 1X39A 5IUNC 4JY7A 2CMFA 3F97A 3MS2A 3P45A 3UPTA 1LDGA 4UBJA 3WGMA 3CBGA 1YJ5A 3GQBA 1L5RA 4P8RA 5DW3A 1GEGA 4B3JA 4E5MA 4R40A 3FOWA 3GBPA 2ZDQA 3WKAA 4EVRA 1VIDA 5T6MA 1F0KA 1ECBA 1G2IA 1OZAA 1PCXA 1LBIA 1TPZA 2QN9A 1C0EA 3VH4A 2OORA 5U9CA 2VH1A 2WG0A 3ZV6A 4JELA 2WABA 4TV8B 1K0FA 1MZVA 1XLTC 5EP4A 1JTFA 1I6MA 2VBCA 5CLGA 5TQJA 2BFOA 2X19A 1GTG1 1VYUA 2H06A 3ND7A 4M53A 5B2EA 3E81A 3M6LA 2AMJA 3I42A 3T3NA 2HSWA 1UBKS 2IEDA 1KJQA 3U5TA 1ECJA 1K8RA 2XRMA 3ESZA 5LZ8A 1YHZA 4DCPA 1IDN1 1BEZA 4ER5A 3TPCA 3SNHA 1G7SA 3KXLA 4F5WA 1UC5B 1M8JA 3CLRC 3UMFA 2F90A 3IAM6 4FM9A 5M04A 2H18A 4MRRA 3FGOA 2B8TA 3HFGA 5JTUA 2PT9A 1UQRA 1TJ4A 3FCXA 5BVHA 4DY6A 2JI7A 3QV1A 1EINA 3BIJA 4NBWA 4AY5A 1E20A 5EE1A 3AOEC 4XCVA 1C8KA 2NU9B 2H4WA 3BCHA 4TUYA 1UPUA 1L5HB 4OQLA 3F47A 2CNNA 3JQAA 1U3FA 2G71A 3UF0A 3WIEA 2OO7A 2Y1GA 3EWNA 4DPMA 3HLTA 2EZTA 2J6BA 4LPKA 3RKRA 3THYB 3HADA 1LPNA 3T5PA 1BS1A 1E60A 3O8QA 4OQEA 5JWOA 3SZMA 3HEAA 3FLEA 3M6WA 3G9XA 1DFIA 3O2NA 4FN4A 4G2NA 4ESOA 4TTPA 2X22A 3I2FA 3T35A 4OUDA 2JEOA 3T7AA 3ZDRA 3EJWA 3ZWMA 1HEUA 3MTJA 2AOVA 2J9FA 3TQTA 1NSFA 2HC9A 4UQPA 5J5VA 4FZRA 1XZAA 1OIXA 1K8XB 3RT7A 3PBKA 3ZKAA 5IZCC 2YHBA 3WJ7A 2P9BA 2IPXA 4UU7A 2KM1A 3SMVA 2JI4A 5EINA 3K09A 2P1DA 1Z2CA 4PRZA 1OUMA 4BNHA 3DBOB 1OA1A 4WASA 2O54A 2IXDA 1VHJA 2JIBA 3M5CA 2V6JA 2VTVA 5BXYA 4CETA 3DHEA 5AYVA 5KKNB 5KNBH 3ZDZB 3AR5A 2G7MC 5HGJA 4JJEA 4RJIA 4C43A 4C7XA 4E3ZA 1NU6A 2HU5A 1FUKA 3GQBB 3Q0EA 1F48A 3M9WA 2CW5A 4YT4A 5C81A 4AP9A 5SZIA 3IDFA 1E0KA 2WJ3A 4I9GA 1XC7A 4P4LA 1SKYE 3VH2A 5CHEA 1LKZA 3QJGA 1RMQA 1HPLA 3JQAB 5AKXA 1ZIYA 4LV6A 1XDSA 3KSDO 3FNBA 1CKEA 2RGXA 1YAHA 3DE7X 2H1IA 2Q29A 3DWIA 4RY8A 1Q7TA 1JR3E 1LJUA 1W96A 3HI4A 4O2BA 3R8XA 1TO1E 4AK9A 4DLZA 2OHFA 4C3UA 4RMIA 2FPXA 1N0WA 1JA9A 1E2GA 4L5IA 1LPBB 3E5NA 2HWKA 2HFJA 4C4PA 1EM8B 3B6ZA 4LV5B 2O2ZA 4EFKA 1EFRA 4IHJF 4BNZA 4Q24A 3HWRA 3RTBA 4QICA 1XTBA 2ZYRA 4ENPA 5JISA 2OC4A 3DAOA 5TB5A 5HJ2A 2QKYA 3L49A 5AK3A 3RS3A 2JKZA 2E7ZA 2GA8A 3OO0A 4ZYLA 1RAHA 5K6AC 1Q6YA 3U3MA 5EXDA 1O94A 1LH0A 2HLNA 2C92A 2MMCA 1EU1A 3AEUB 3CE9A 2FK7A 2JIRA 1GFSA 3KCNA 4FW8A 3SE0A 1WCWA 2CLKB 4TLBA 3SZLA 2DFVA 2WFZA 3GLRA 5KYVA 2C2GA 5JWHA 5CDUA 1D2HA 4QO7A 3SS8A 3TMAA 4DN6A 3EC1A 3AFHA 2V59A 2XGGA 3G5UA 3FNHA 3R5KA 1JZTA 4R81A 1W35A 4ZWNA 3FCAA 4LF4B 2Z2KA 5K0EA 1RRKA 1KHHA 4FSDA 3M9LA 2A8YA 3B2EA 1MJHA 1NRXA 5LIPA 1RRVA 3DL4A 1VCHA 3BG5A 4GOJA 1G21A 2VATA 2C8JA 1U2GA 1ZW1A 1B8UA 5KYWA 2WG2A 1TQ2A 4TXHA 3A27A 1LF5A 4B87A 1OW3B 4DNFA 5E6UB 3WXBA 1P4JA 3CUSA 1FUUA 3LYLA 2IW1A 4LJ7A 5COBA 3T3IA 4D7AA 5LQSA 1KBOA 2ESRA 4YIKA 1JL3A 1VBKA 3SXJA 4U9UA 4PYIA 3RE1A 2VHTA 1EDOA 3K0AB 3REOA 4UCWA 1D3AA 4HQRA 2PKXA 3ORQA 3MWEB 3K5HA 1D9ZA 1II8B 1QG0A 2VDLB 2W9XA 4Q9IA 4TKVA 2FWJA 2JJ2D 1YJQA 5EWMB 3ROPA 3M8KA 1FX0B 4I55B 5TARA 4MV0A 3BGDA 3DDWA 2IOFA 1G2QA 3AYZB 3KYIB 3R23A 4DGSA 5FNZA 5TNXA 1CY2A 1QP8A 1I1HA 2HXYA 3L0OA 1ZNZA 5HIMA 1HSOA 8ABPA 1KSHA 3FYSA 5F4BA 4NL4H 3VNQA 2NP6A 3S4YA 1ZGAA 4W63A 1DOHA 2FN9A 1AZTA 4JC4A 2UVDA 4TVKA 3B3GA 4Y9RA 5EUMA 5M3BA 2O2HA 1LDYA 4JVSB 2GEKA 3COSA 1GUBA 2WVJA 5KJFA 1XQXA 4D6PA 1U2EA 3IXQA 1PV2A 4FGJA 5FDFA 2V7WA 1WUKS 3M2TA 4RK4A 4EEZA 5AD1A 3OQMA 3BT7A 2I6SA 1XLWA 4BEJA 2HIGA 3VV2A 1FS4A 2G1UA 1EE1A 4KO4S 3FHOA 1QH8B 1KZYC 4X1KA 3UUWA 2AK3A 3OBBA 5GM1A 1CIVA 1Z0SA 3VR6A 1HXHA 1TADA 3CA8A 5AK0A 1T6BY 4N5LA 2Q4RA 3GVIA 5EMJA 4EB0A 5MFZA 3FTPA 2D2VA 3EVAA 4X91A 4YXWA 4RTKA 5FJIA 1WHTB 4UEQA 1KK2A 1V8BA 1Y1LA 4E88A 1N36B 3NTRA 4CQMD 2VAMA 2VT3A 4CMEC 3VOSA 3DEJA 5LYJB 1SKYB 3OZSA 1E2PA 1JDJA 1MNAA 3DBRA 3WK5A 1B0ZA 2OBLA 4HDOB 3K5IA 4XSVA 4DEVA 5A02A 1Q3KA 4PYOA 1U9CA 1TU0A 3LC7O 1I4DD 1PFYA 3WICA 4E5YA 4QODA 1LQ2A 4BNGA 3G1WA 1BN7A 5JMPA 1ZBDA 2QTHA 2XUZA 1H6DA 3RQSA 2JLUA 1B6GA 4NMHA 4CMBA 1WBJB 1LWOA 1XTIA 1GPYA 1IHUA 4INOA 4U7FA 4QDJA 1CHNA 1QHHB 2ISSD 1ZY2A 1HDOA 3FFBA 3NAGA 4IL5A 3LBAA 4QJ5A 1X7WA 2VJDA 1VG1A 3FOCA 3M6UA 4QPPA 2ORYA 4U7HA 3QIVA 1X7GA 2IP2A 3ZEIA 5ICSA 3A3PA 1CXZA 3PF9A 3GGPA 1NJ1A 3EGDB 1QHHA 2QE7A 1P5JA 2NTVA 3HBJA 4HZIA 4HRYA 5AQEA 3UFXB 3EVNA 4S1NA 1FMLA 1S02A 1CZRA 3EDCA 1AHPA 5IS2A 1W36C 4IQGA 1FU8A 4O2RA 3SC6A 3VU1A 4YJ3B 3SE7A 1JHUA 1XHLA 1RXEA 5KC8A 1LI5A 3GZ4A 2W6CX 3PRYA 1KI8A 3W8EA 4NYJR 2MHCA 1G1MA 1WB6A 2WB4A 4NZOA 2IYPA 4JFRA 4LZNA 1P3JA 2IYTA 2VJKA 2AQHA 3H7AA 3ZDDA 2ZKLA 2Q1SA 1EX6A 2UZAA 2AJLI 1N5IA 2XOKD 2Y67A 3RK1A 2RBKA 5A3SA 4O0LA 1D2GA 4IO0A 1B0PA 3Q7RA 3TX6A 2HR1A 4Y9UA 3AIIA 3AYXB 1G5FA 1NGSA 1U2RA 3BHIA 4FYXA 4NFYA 3ZDEA 4AY2A 2ZJ0A 2ETVA 2NSJA 4GNKA 1A8SA 5DWDA 2X0KA 4U00A 2JCXA 1TAUA 5TQ0B 4ZVQA 2K7FA 2ONKA 5CP8A 2YJZA 1A9XB 4MARA 3DXZA 3RHTA 4GMGA 2IKQA 1M6HA 4L5AA 4TKZA 2DY0A 4WH0A 4ZN6A 4DUYB 4GT1A 2EW2A 4LQ4A 4I08A 2RONA 2F9MA 3UYKA 2QZPA 4UCXA 3F8TA 4JLOA 5IKXA 1S2IA 2AJTA 5CTAA 3W78A 1LBSA 4HJRA 4C0XA 4QBTA 4P3KA 2B1GA 2QRUA 3ZBUA 1R18A 4H3HB 3TNFA 4FR2A 1T4MA 1CIPA 2FWAA 3RSSA 4C14A 3IP1A 3Q8KA 1IXSB 3CYFA 1VCOA 2FZ5A 4CL2A 2ZITA 1I1NA 4Q4AA 1OB2A 2PQ6A 3CUWA 2FG5A 2QD3A 4YRCA 3UJBA 3TW0A 3Q6IA 2BV3A 1JHOA 5E95A 3KJFA 1JLLB 2HRCA 3P27A 2V54A 1YU6A 4JLMA 2Y1CA 1S8FA 2WU8A 5FCDA 3M1IA 5FWYB 4KO1S 3RV3A 5JUWA 3ZWVA 3RFVA 4L6IA 4MTLA 4UMEA 4OI2A 4GX2A 4UCFA 3TAXA 1ZXBA 4C9BA 3F4KA 2YUTA 3TW4A 3WGNA 4MRSA 5CBPB 2J4CA 2YZNA 1BXRB 3NEPX 5D3ZA 4W5WA 5LD2C 2VKQA 1VDMA 2DE0X 1RW4A 2WBLC 1M8PA 2F59A 2GYUA 5C7YA 4B6QA 3BA6A 2POQX 1MW8X 2Z2ZA 4WAUA 1S8OA 3CCBA 3K8OE 3Q3HA 1N8TA 2QI9C 1OPRA 2HJHA 3H04A 1V96A 2Q41A 3ZIAD 4C0HA 4C06A 1Q12A 1FTNA 1O57A 4BZPA 3R7WB 4J16C 1N25A 4DLAA 1GPBA 2WWFA 4H7HA 1Z6TA 3RBAA 1Y3HA 3AF3A 2PZLA 2FR8A 2BMDA 1ETHA 1E6WA 2I4MA 2O52A 3AHCA 3R5SA 1QOZA 1U6JA 1NI3A 1ZRHA 1IZ7A 1DZIA 4OM8A 4UHCA 4AS3A 1LWNA 2XAAA 3JYHA 1RDFA 2XCLA 3U40A 3FMIA 4ZPJA 4A1OA 5HUHA 2AKYA 1Z5NA 3UOGA 2SKEA 3CUVA 3KYCB 2FEPA 2FJUA 3AFGA 1EWRA 3RYFA 4JJGA 2OL4A 3RFTA 2PRJA 3AQ4A 3U31A 4C7MA 3P9RA 5CR9A 4HQLA 3VR6D 4JVNA 4DMKA 5J4HA 1X3LA 1B73A 4E32A 2BJWA 1DO8A 1YCFA 2ODTX 1CU1A 2W6PA 4XWKA 4JT9A 1JYEA 4JX8A 1YQEA 5H59A 1V3UA 3BPSA 3QUCA 5GPBA 3SAJA 3P9CA 2YIMA 3W1VA 1LI7A 1K8YB 3WK7A 3MT9A 4C30A 3OCXA 2R4TA 1V25A 3FMVA 1ML4A 1SWWA 2CUKA 4UEWA 3S2FA 1PL7A 1YJXA 1RBQA 3C15C 4OH7A 1US8B 3W05A 2GYVA 4G1MB 4CL3A 1H3FA 2BVNA 4EA7A 2WE7A 2AUMA 3OQ1A 3PIRA 4KFSA 1L2TA 1OH8A 3PYXA 3WIUA 3HO6A 1PW5A 2DUJA 4XRGA 1YZQA 5I7VA 1IHOA 3A1NA 4HEQA 3I0NA 5AW4A 3ZNQA 1Z8FA 1XPRA 3U4DA 2ZRFA 1S8NA 3RASA 1JG1A 2DF8A 3QMPA 3FYUB 4IV5A 1H4VB 4LYFA 2FE4A 5TMDA 3JTMA 4CIBA 1N2IA 3ZE6A 2QD2A 3U4QA 3CRZA 1GU7A 2Y76A 3LL4A 1IQPA 4WKOA 1LCIA 5ETJA 5AI6A 2W6OA 1SUEA 1TQ4A 5E2AA 5TPZD 2YVQA 2D5AA 3PDCA 3NM5A 1HWYA 2ZBVA 3ESDA 2IPNA 1KRXA 4O4HF 621PA 2J3LA 4E2WA 2A6PA 3MMXA 3RCBA 3CONA 3GRCA 1ODLA 1S3IA 5FPYA 4D9EA 1TKAA 2Q5CA 2EGGA 3EH1A 2ONYA 3M5PA 2QM8A 5FTMA 3O8RA 4RETA 1FW8A 2QIOA 3OX1A 4C4YA 1NG9A 3JQDA 4MJ7A 5TX7A 3TD2A 4FB5A 5CT8A 3ZDBA 3GEGA 4JT2A 3OMLA 2P67A 1CP3A 1QOQB 2NTNA 3KQVA 3PJDA 2EATA 1GJRA 3VO8A 1CUBA 1EX9A 5KOHA 1P1CA 3IEPA 4ZPXA 2XYVA 1NW6A 3BK2A 1CQIB 3LT2A 2XEDA 3D4PA 4C29A 4RK1A 3KWJA 5A5GA 3BUSA 4OHRA 3I53A 1DWUA 3SQNA 3EPRA 3P32A 3QE4A 3OCVA 1V7ZA 4P53A 2OG2A 2BGIA 3WGUA 5HRAA 3IV9A 3GUVA 4PO1A 2IPOA 2PSJA 1SXJD 2Z5FA 4KLRA 2HHCA 5D01A 3ED5A 4DLWA 3V33A 4JU8A 4FFPA 3ZLVA 1EDDA 4K1LA 1GRVA 4IUCS 2ZJ7A 2TECE 1Y5IA 1NG1A 1PT7A 1I4TD 1VRVA 5I4CA 3HYNA 1J06A 5FEMA 3H1AA 5B58C 3OZIA 4F91B 3KYJB 4GZMA 4R6XA 3R24A 1TTTA 1YTUA 3GEBA 4IG4A 1ZKMA 4XASA 3RRFA 4IM7A 3VU0A 1T4GA 1PIWA 2LWIA 2WDPA 4CM1A 5HQTA 1XFAA 3F1LA 3W0LB 5HFNA 1P9NA 1SBNE 3GH1A 1W30A 1IXYA 3GV0A 3I0ZA 1KJIA 1LLUA 3HJRA 3OLYA 5KAMA 3OOWA 2K2WA 4F7DA 1QG4A 2V0GA 5LSAA 4AU1A 3HGMA 5D00A 2O8CB 2D1FA 3AETA 3DV0B 3PSAA 1U5CA 2VHVA 3I92A 5AKGA 4OHZA 2AF4C 5HZMA 4IQ0A 2ZIUB 3I45A 2RHWA 5F77A 1T5TA 3DP7A 3LIPA 3SK0A 1BS9A 3G82C 2L69A 2V7GA 3HUTA 4RBNA 1C0KA 3SSAA 3L9XA 5CDGA 4ERNA 4F04A 4ITRC 1T4CA 3TTWA 2FMHA 2J0UA 2R8PA 5CNIA 1KI2A 1EBBA 4KTVE 4BMCA 1SCAA 4Q03A 1YS6A 1L1FA 1QLWA 3CINA 3RSHA 5KYXA 2VF4X 1POXA 5I51A 4BMPB 4BGEA 2H0AA 2VHJA 2ZS9A 4B33A 5IM4A 1XMJA 3CE6A 2IYOA 1TA4A 4Y1EA 3QQ5A 4MR7B 2X2FA 4MGIR 4CCWA 3KZ1E 2OCIA 4QARA 1V45E 3BGSA 1E9RA 3GFQA 3KQMA 4PZPA 5DTEA 3AR3A 1K3FA 1PG2A 1XEXB 4F71A 5JMOA 1Y5LA 3W9YA 1PV1A 3ROZA 3K70B 3OQVA 4ZVPA 2L82A 2P3LA 4EA9A 2QN7A 3FI0A 3A58B 3C3PA 1T0PA 4HDMB 3PFGA 4POAA 2Z8XA 2FPSA 4IX1A 3RV4A 5FULA 5C1IA 1P6QA 2CXRA 1Y7IA 1SBTA 3RVKA 4E51A 4UTOA 5KSWB 2JCVA 4OLBA 1G42A 1OOEA 4FHEA 2QTBA 5C1OA 5EJ5A 2HLDD 3DWFA 2H0RA 4MQ4A 2VHCA 5C0OE 5EXSA 2PQ0A 2VSNA 5U4XA 1JQ3A 1L5KA 2YRFA 4G0ZA 1XTTA 1ZEJA 2V6MA 5WRFA 4YCSA 5K8CA 2W2MA 1Z5UA 4HUQA 1L4YA 4BYGA 3EFHA 1RVV1 5I9MA 3U48A 5L45A 1YC2A 3W3AA 4ZJYA 1EP3B 4TSFA 2H17A 3VZDA 4A8JC 2G6TA 3K09C 4BLPA 3BWBA 2VAXA 4HOYA 2PKQO 2YC4C 3KT3A 4ND6A 5AUQA 2XIJA 2WF6A 5CEJA 1TCAA 4IDGA 1CF2O 4TT8A 3T4XA 4PFSA 3SQXA 4KIUA 3HL0A 4ZOBA 4MNTA 4FEYA 1QNLA 3H83A 4MXDA 1PVVA 4PLHA 2J48A 2IF2A 3TSWA 2BJVA 2IS1A 3MINA 1BOOA 4X45A 1CUJA 1VYHA 3WY9A 2NP7A 2I7CA 3I2GA 1N7IA 1PFGA 3GRPA 3LKZA 4Y2RA 2VDOB 4PNEA 1BU5A 2QZ4A 5EPEA 2P6RA 1LRJA 4H7DA 1CE8A 4BCDA 2HAEA 5ITWA 1J5EB 1NOKA 1PO7A 4FKBA 5BSTA 4QDKA 4PHTA 3BF8A 3N07A 1V16A 1EX7A 1S9DA 1XTUA 3EF1A 2A67A 3VDXA 1FFSA 2JJ2A 2ET6A 1EAYA 3CUTA 2WYWA 1NF8A 3ZCTA 2SICE 1X7YB 3ESBA 4US0R 2OYCA 1KZ1A 3LSYA 2IY9A 2M6RA 3M6XA 4B09A 3KZCA 2JCSA 3GR6A 4L2IB 3C4JA 1GAJA 1TTHA 3GGGA 3REGA 5K6AA 1AU9A 1RPNA 3BHJA 2G9RA 3OU2A 4JUFA 5A3VA 3U9SA 4J1TC 1PWXA 4BO4A 1P5FA 3HBNA 3PKJA 1FVOA 3I04A 3T9FA 2CEKA 1EA7A 4YJ3A 3D6AA 2LCQA 4Y1RB 3H1BA 2Q3EA 1C9MA 4NJOA 1JT9A 4YP9A 1I2AA 1PJRA 2O8FB 1CLUA 1YV9A 1O7JA 3K16A 4OFZA 2DGDA 2XNHA 4RL6A 4C76A 3LVQE 1PFWA 1UBLS 3CPSA 3L6OO 4M8KA 4J0HA 2O6LA 4Q18A 1A9YA 2O5CA 2A1TS 2AVDA 3A1TA 4WEQA 1GCAA 2WA2A 3N2YA 4YALA 1QE0A 2J4FA 3T1VA 1E5TA 4QDXA 2WP0A 2ZUBA 4NF2A 5T64A 3S2ZA 3WAKA 2W8BA 5F2KA 4Z54A 1V3VA 2MR6A 4E09A 1KMNA 5D1NA 5A4IS 2VUTA 5LUBA 1D03A 5AXDA 2HPAA 3NNDA 4KQ6A 4OFWA 2Q07A 3ZK7A 2X6TA 2VDWA 1BFDA 2YQZA 4KQJA 4EGCB 1FMFA 1LV7A 2I22A 4ZCSA 3BFKA 2JGNA 1J22A 2P2YA 3PC8A 3QYPA 4WCFA 4XGNA 2C4UA 1RYNA 1P4HA 1KOJA 1TYAE 2XUJA 3A1DA 3CWZA 4QX6A 5FKJA 5KMGA 4YQFA 3MFQA 3CWQA 5IT9A 3D4OA 3L8HA 2R5WA 2V45A 4AF7A 1Q22A 4M9UA 2QAGA 3V4OA 1IQRA 2JJQA 4FFWA 1DKQA 1NE2A 2XA1A 4UEOA 4UTVA 1HOXA 1CUZA 4MYSA 4Q3LA 4GWLA 4BNFA 1N6LA 4X1KB 3H5TA 3FNGA 4KGZA 3LSTA 1CY4A 3KKMA 4UTPA 5CFMA 1L4GA 3RO7A 1R8QA 2ZDGA 3R0XA 4QPJC 3GRFA 5ALTA 3RS2A 5KI6A 3H2IA 1NOJA 2C97A 5DK4A 3QEBZ 2PXHA 4PCUA 5ER9A 3K4HA 5K7SA 3E2IA 3CNQS 1Z8NA 4IQ8A 3ZHZA 2X8JA 4RPKA 3RK4A 2O5EA 2OENG 3UJ8A 1WTAA 3C4QA 2W2XA 3AHGA 3NLLA 2IRWA 3OECA 4BC0A 5KDDA 1HFWA 3DF9A 3QFRA 1XI2A 2H85A 2OBFA 2OXRA 3AI3A 4MRPA 1VJTA 4YJFA 2XIQA 2BF7A 3IAUA 4YPVA 3U2QA 3KB8A 3KS9A 3V7NA 2OWEA 4F9EA 3LDHA 4FFLA 2PX8A 3DKVA 3HB7A 3JWJA 4JP1A 4MB6A 3PIIA 4N54A 2C29D 2FEWB 1ZM9A 3G8YA 3KO8A 4ZOLF 2Z09A 2H00A 1NJ2A 5FD8A 3K96A 3D64A 3MGKA 3F49S 3OSZA 1DGQA 1ZN9A 3I83A 4IMRA 2VF2A 5ARBA 3N2IA 1JMYA 2CHVA 1ORWA 3FYUC 5KU7A 4JASB 1LV8A 3IPXA 1WU7A 3EVZA 3B52X 2ZQYA 1E6MA 3DV0A 3F7NA 2Q0HA 2VI5A 4UUBA 4RK0A 3F67A 2C42A 4XW2A 3OOHA 5EKDA 1E2NA 5AT1A 1OI2A 1KQGA 4XB6B 4PSUA 4NBSA 1N34B 5CU7A 4XDZA 1X1DA 2JH9A 2C9CA 2P0EA 5HBRA 3IRUA 5TXGA 5FUMA 4TV9F 3Q5DA 4C6HA 1GT6A 4S24A 3KU4A 5DKFA 5EERA 4S0XA 1O95C 3EZGA 3JD0A 2J0EA 3UJPA 2XRZA 3NUZA 4M6WB 3UK0A 4JWKA 4Q05A 1O3YA 4OYLA 5DM1A 2IYSA 3GY0A 3HMQA 3PS9A 4JOBA 4C04A 4CEIA 1GZHB 2Q2WA 3MD9A 4HRAA 4EKNB 3CLHA 3FBTA 4BP1A 4DLUA 3GBVA 2QY9A 1IIBA 4IJKA 2GK3A 4TL9A 4NCHA 4QOIA 5H02A 2GERA 3ZU5A 4FB4A 1ZN2A 4AMYA 4D9CA 3UT0A 2C54A 1L7XA 4M89A 2AG5A 2GD6A 1GNTA 1RE1A 3ESAA 1MABA 5GY7A 3DT8A 2OFFA 4EJSC 2YOHA 1YULA 2JCGA 3EULA 2VF8A 3JRXA 4XKJA 1TUBA 4WBNA 3BEDA 3N2GA 3QF4A 5CLLA 3RODA 3EZ9A 4KUGA 1R66A 4YT5A 3TZBA 4EG0A 1PT5A 1QE5A 1Q0LA 1OH5A 4Y0NA 3WOHA 4B9AA 4LKRA 4AJ4A 4K0RA 5C9ZA 2P0AA 3B70A 3HU1A 4M0UA 1GGVA 4RSGA 3QLVC 5DU2A 3OCUA 1XCPA 4F21A 3QXXA 1W5FA 2IITA 5JJIA 2VBGA 3Q9UA 4XQCA 3USES 1P0FA 1HYQA 3AP1A 1FZTA 1FXWF 2ZJ8A 3IERA 2OYRA 4EJ6A 3S0JA 2VP9A 3HR8A 1NJGA 1L6RA 1PBNA 1FP4B 4I50B 1RPZA 1HE1C 4JS0A 1Q0SA 1MB0A 2DETA 3OPYB 3ZHQA 1ZKDA 4BO9A 4B2LA 3V2IA 4W5QA 3BGOS 3KUUA 1T6YA 2CZGA 3IQFA 3DVLA 4BKMA 3S1SA 2GN1A 4O4LB 3TFWA 2P4QA 1N8NA 1A0OA 1ZD4A 5FL3A 4A1FA 2X8BA 5JH7A 5DLDA 3DL2A 4RZQA 1QYXA 1WSDA 2AG0A 1V7CA 2WZCA 4NCBA 3AFOA 3HRIA 2R96A 4LZJA 4X54A 3SQLA 4KRGA 2F9FA 1ELOA 4RVNA 4U02A 1AV7A 1OWPA 2Z43A 3FIUA 3FUWA 1FU7A 3O7MA 2P4HX 4BECA 2GF9A 3KVOA 5A2QA 1NNEA 2W2NA 3H0EA 3H0CA 2V4ZA 1U9IA 3P0HA 1Y9JA 4NNOA 3E84A 2C04A 2H2IA 2YW9A 1YQTA 2QQFA 3I2KA 3KTOA 3NV7A 5C35A 2O59A 4PGFA 5JXIA 2PXCA 1GTL1 4NBRA 1N2SA 1V1MA 2WF7A 2ZB7A 3TQSA 3UT6A 3WL7A 3AI7A 3ONFA 2UAGA 2QTCA 3MWLA 4WBSA 1V9CA 4CFSA 4DIOA 1I94B 1R50A 5CVJA 2GJSA 4EQ6A 4FW9A 3LTNC 3WMFA 4J7AA 1NRJB 4HH4A 3T38A 3E8SA 4ENTA 1GQFA 3DFZA 1QHGA 4QBFA 3SJCA 4E4TA 2QG9A 4FVTA 1IBMB 2O0LA 3DV2A 3EFBA 4JL6A 1PZMA 4NU0A 2PYDA 3MS7A 4L5JA 1J00A 4J7UA 4P54A 2QL7A 1ZH4A 4EHDA 4D8UA 4ZDJA 1E2IA 5C7LO 4L3OA 5DH9A 2WJYA 2G1PA 1J07A 5EWLB 2C3PA 4CEHB 3M1AA 4IIVA 1KBQA 3FWPA 3OIYA 1F12A 2HEIA 4H0NA 1U3UA 3VGPA 2VDQB 3QFTA 4IF4A 3TF5A 1ZHOA 1XCOA 1YR3A 1XZGA 2CXPA 2IZ6A 1BVYF 3B3AA 4J03A 4P4NA 4X8MA 1O97D 3LPCA 4XGIA 3TD9A 1U9YA 3AX6A 4XI9A 3N3BC 3OIWA 2GKGA 2HZBA 3JATA 2IK8A 3IP6A 4CMIB 4DLRA 3QU2A 5BT8A 2B1RA 5I01A 4WBNF 4F4FA 1V95A 3BJZA 2GZMA 2X3FA 3I4CA 3ME5A 1MMFB 4G9BA 4KYIB 2REQB 1G20B 2PLNA 1AN9A 2N3ZA 3CTPA 4HGNA 5LZ7A 4ZZ0A 2XRFA 2OCGA 5JFGA 4AG5A 2UVQA 2Y1EA 3JYQA 1ISSA 2PLWA 4L27A 4MV5A 4B4DA 2V7QA 2VVTA 3SF8A 2G5CA 1XLUA 3S5JA 4FR5A 2OXFA 1OJLA 3HM2A 5FTNA 5DN6D 4IMIB 2OO3A 3R9XB 3IEXA 5HKBA 2GBCA 1RHKA 3WNVA 1ZJ4A 1BW9B 1XQVA 4RCZA 3FDJA 3KUDA 4MVYA 1THZA 4ZMRA 1LS6A 1NR7A 2OO5A 4YRJA 1SXPA 2NO7A 1F9AA 1FFEA 2XX3A 3AEQB 3OLQA 4Q37A 4RLFA 1PV4A 2IH4A 5BP7A 5L3ZA 2B94A 1JIQA 3FX2A 2BFEB 4I3FA 3TUIC 2GPBA 2E4WA 2BSAA 3CG4A 4HLUA 4F3TA 3WWPA 4DIEA 1TZKA 4FI3C 3HDVA 5HTKA 2QLJA 1QFSA 4LQLA 1QTRA 4I5GA 4N7RA 3TB6A 3TR0A 2QYTA 1Q77A 3UANA 2AYYA 4M0EA 1Z0KA 4GVLA 4F9GA 1EVJA 1U8XX 1FDTA 3CW8X 1E98A 1YE8A 4YJFB 3ZZ0A 3GUZA 3UKOA 1JIIA 2EF0A 1RAIA 2GEFA 3EEOA 3WQRA 2O2XA 2ZIXB 5G2OA 1R3UA 4Y98A 1JBQA 1ESEA 3JS5A 3OX3A 4GKKB 3MCUA 5TQ2A 4LISA 1ODFA 4WGFA 2R5FA 4F9FA 2WUVA 1U94A 1ZI8A 1OH7A 5DGXA 1WNFA 4A0QA 1SEPA 5K8LA 1SVKA 3WGLA 2CXHA 5CVEA 1E3LA 4BFTA 1M1NB 4LC1A 4LY6A 2AG8A 1SEVA 4GR4A 1Y1TA 1FFWA 1MN6A 3GIWA 5BUQA 1DAKA 5CRIA 3TR5A 3DCIA 2Z30A 3OOYA 5IVHA 5BNZA 3ASYA 3C0KA 1TE2A 1XMIA 1GDHA 5LU9A 2WIFA 5IPFA 1CNFA 3O74A 2Y6VA 2BL4A 4OK6A 3LOPA 4AQDA 5ALSA 3RFUA 1OGJA 1IONA 1RQ2A 1NQVA 3QSGA 1VRCA 4JH0A 1ZC3A 4YRZA 1MX9A 3CVOA 2WKPA 4JC0A 2Y68A 4ZI7A 4NDZA 2CT8A 1XGKA 1YBHA 2XT0A 3FHJA 3G3EA 5FFMA 4CHGA 2IBSA 1W5AA 4TYMA 3N2KB 4G5OA 4DQVA 1VPLA 2PKRA 3CEHA 4FFRA 4JYBA 4WJKB 5LQMA 3IURA 3O4IA 3OU6A 1COWA 1KEEB 3A3KA 3BDIA 5DNCA 3DTVA 2FEMA 1L7DA 1USIA 4AL4A 4G5QA 1ORTA 3JVVA 4FHFA 4ENUA 2ZT8A 2XY4A 4Z51A 1E9FA 3CLUD 4JSTA 4KOAA 1QR2A 5BSGA 3ZVNA 2Q62A 2W6QA 1MAHA 1FMTA 1RYFA 1UJMA 5GTDA 5JNRA 2WAXA 3ADOA 4X5OA 1RQNA 2NU8A 4Y6QA 3RIYA 1FFDA 4F86A 5FP0A 3WSWA 4RNCA 2CBZA 3K5PA 5BN3A 4UKDA 1ISPA 3NP9A 2LVBA 4JWTA 3A6HA 2XMZA 5JZ9A 2EQAA 2MSEB 3WGOA 2YDXA 4DMCA 4KREA 1FPMA 3QBDA 4LZOA 1CF4A 3VPCA 2HX1A 4YK7A 4B2IA 4MV1A 2CSUA 3UOWA 3ILXA 1CR2A 2W6JD 1FSFA 2OCYC 3RC8A 1KJ8A 1QZUA 2Q5FA 3P0EA 4O2AA 2V9ZA 3SX0A 3NKVA 5I7EA 1L6IA 1S2OA 5CT9A 1ST3A 1AS3A 1VMDA 2QJWA 3L7CA 4G36A 3H97A 1O0BA 4OQYA 3Q11A 3J80A 4FMDB 1BO6A 1O4VA 3FKQA 2BSXA 1T0IA 3ENKA 3NIWA 4ROSA 4B31A 2KWIA 2WD9A 2WWRA 1TC1A 4F46A 3WHIA 4K2HA 1XTPA 4GOOD 4A16A 3A4LA 3MXOA 1EWTA 1W6UA 1K88A 2R1TB 2QX8A 4NYIQ 2LPMA 1SXIA 2QRJA 3A4VA 3CLRD 5A0VA 2JFFA 2OV6A 3BD7A 2I2BA 4BBAA 2PN1A 1V3QE 3VTFA 1AF4A 2R1VA 4FMBB 4DQDA 3ICQB 1XVLA 3F2IA 2RGAA 3AILA 3OE7D 4PS1A 4CHTA 3FJOA 4LZWA 1T3TA 2IA5A 3TLAA 5IYZA 3OJWA 3VX4A 2Z6UA 2W22A 3CJTA 1L4BA 3GJ4A 3S8YA 5M2QA 5IF3A 1R9NA 1P0MA 1TMOA 2ZU6A 3L7YA 2Z9DA 2WV9A 3C7TA 3CGGA 4OU4A 4PG7A 4X6XA 5LQKA 1W5EA 2CVOA 1VE1A 3OURA 3JQGA 1XZIA 2ODAA 1R6UA 1C2YA 5IARA 2FQWA 4N47A 2Y1WA 4ND7A 4GUAA 3QEJA 1P1KA 3UG7A 3QVOA 2CBXA 1Q0TA 1UKCA 3OAAD 4HNRA 4R3UC 2FN4A 1WPXA 3GD5A 2GCGA 1WD5A 3M4YA 2B4KA 4PZYA 1VBFA 2WICA 3RU7A 1E5VA 1ZH2A 2IHTA 3HWX1 2RH9B 1ECPA 3MGBA 4G84A 4WNAA 1K7YA 1JJBA 2DTXA 4H4CA 2Q0XA 3LCMA 1NUHA 1RKQA 4ZAXA 5GM2A 3O6VA 1GVNB 2J5RA 3USCS 4C3OB 2ORVA 1FNSA 3V4PB 3R5TA 3T5AA 1MCZA 5F1OA 3IOEA 1F6BA 4UARA 3N2EA 3AQIA 3NIGB 1PHPA 4LI3X 3BX1A 3QQPA 4YAGA 2WHXA 4IJVA 4NOMA 3B48A 1KY5A 4TXNA 2QB5A 3B6JA 4RDIA 1KE2A 5JQWA 5KNBD 3LLCA 3QKWA 1SFRA 3OPQA 4LOIA 1IDOA 2ZWVA 3CLSD 8OHMA 3C5WP 2IDKA 4HR7A 4TMXA 2PE5A 2V7TA 2CMDA 2HMTA 5B1HA 1ZK1A 3AZQA 4WY2A 3D7NA 3E58A 4JLDA 4M9RA 4M0DA 1H2XA 4NMMA 4L78A 3WGVA 2EU8A 4BMOB 5FADA 1U7PA 2NYRA 2Q21A 1UK6A 3HN6A 3NBZC 1Z2NX 4UTRA 5HTOA 5I4KA 1UBTS 2QRMA 3E5MA 5FYQA 1IEQA 3RS4A 4I4TB 1PR5A 5BOVA 3KL2A 4YRFA 1DARA 2PKCA 1RQ7A 5EE0A 2C5SA 3R5HA 5A0TA 1KPHA 1VKJA 2F7SA 4O33A 2YOGA 1EB9A 2XNDD 3VYWA 2PUFA 1QIIA 4G8CA 2Q9BA 1LEHA 3C97A 4KXQA 3LG2A 1DINA 1ID1A 2BP7A 2XUPA 1ZIDA 2H9IA 2Y27A 3IJRA 3OZRA 4H18A 5BSKA 4A8PA 2H2WA 2HK9A 4X1OA 5E1OA 4DA9A 3HM9A 4ZAGA 1EK5A 4R3NA 2EFYA 4MVJE 2IS6A 2BMVA 2R65A 1Z73A 1PDOA 2VNIA 3G89A 3HYRA 3UWKA 3OCZA 4EABA 1SCUA 2IYNA 4EMBA 2FQXA 1J20A 1UZMA 4KJXA 5LA6F 1VL8A 5FWDA 1PZHA 4JLNA 1N0IA 1TZMA 2J9GA 3TPZA 2H4ZA 3A4TA 5FPHA 4RGYA 2CMGA 4QDUA 4FGWA 1ORRA 1YA8A 2C5EA 3PG5A 1NY5A 4Q1BA 2FDRA 4UBLA 4ZZIA 3DXYA 4L57A 1WNTA 1OILA 2E0IA 3MJRA 2JAQA 1FNNA 3BORA 1IM8A 2EX0A 2J32A 3G5LA 1JHQA 5FUXA 3KZVA 4KQGA 5FUYA 4CLRB 1YR1A 4RPGA 2SCUA 3L0IB 4WJZA 4RTQA 2P6OA 2DCMA 1Q2UA 4EYOA 5LZ4A 1YI0A 5AESA 4Q1CA 1U6IA 1ZAYA 4RKRA 3D6VA 4RD2A 1PT9A 5G0UA 1HQCA 3WKDA 4E5VA 3Q8MA 1WBDA 3KLMX 3MWDA 4UVEA 4WZAA 3WHPA 4JGGA 3TJRA 3WX0A 3OF3A 4D56A 4F5EA 2ZDHA 2O5RA 4BO6A 2VUSA 2XA9A 4YY3B 1AXGA 4IIFA 1TMYA 3L82B 3GP3A 3RBXA 4QLBA 2XF2A 4TKUA 1T3HA 3JQFA 4JR1A 4JUDX 4CLOB 1AMUA 1RRMA 5AHOA 3VNVA 4K3VA 4MR8A 5CAEB 3R77A 2Q1YA 2P6UA 2FSPA 3OEYA 5AKZA 1EXMA 1JI0A 3O8OB 3EXHC 4QUHA 3QWHA 1ONNA 2DUNA 4GKBA 5G1PA 3VI4B 4ENVA 1EXDA 3NHJA 3TKLA 1YJCA 2BFMA 4B5LA 2ZRMA 1T9HA 2VUIB 2K87A 2WWXA 2BMAA 3AXTA 3NDIA 3AB7A 4KGVA 1G8AA 2WAOA 2VSOA 2ZIZA 3BKWA 3LQ1A 4WESA 3UCFA 2VZ8A 2NZ2A 2XKAA 4G37A 4K9QA 1CDOA 1FUYB 2GJ4A 4X8HA 3ZY5A 4AUEA 5JSQA 3EXEA 4H2DA 2A1UA 2C7GA 4RXUA 3RUIA 3NT2A 3MRSA 3ET4A 4LECA 4UE6A 4KPFC 1I01A 5JAIA 3PNQA 3U5ZB 2GN9A 1H0HA 3MWDB 4FZVA 1MKYA 4K9DA 4IFEA 3D3KA 4NULA 4TWIA 4Z3DA 3TBFA 3DTYA 4ASUA 4ZCMA 4A03A 2R8BA 2CMKA 9ABPA 3ZBQA 2YWCA 3WLJA 1FRVA 3HP7A 2HHHB 1EBFA 2H9AA 3QY0A 1ACLA 2FK8A 4MPRA 1T8RA 1OAOC 1KS9A 1I3NA 1Y89A 3GO4A 1SG0A 3TN7A 2B8JA 5JHGB 2A5LA 1UMBA 2O05A 2B4RO 1P6UA 1Z2OX 1E96A 2CJWB 3DP9A 3K2IA 2G83A 4GSYA 3W8FA 5K3FB 3WGIA 2DFDA 2VSQA 2BT4A 3FCEA 3R0IA 5SY9A 1JEYA 2C4TA 1XTQA 5CJPA 3CNHA 1G4AE 5AM4A 1XMQB 5IDWA 5E6RA 5B7QA 1RQGA 1V43A 4LYJA 5JE8A 2NWQA 5AH0A 5TIIA 5T3UA 2AW5A 3UHPA 2ZGVA 5U4QA 3U7FB 1RIFA 4WXPA 2CL5A 1KIFA 4AYTA 2ZRPA 4BX9A 3WMXA 4O8CA 2GPTA 3QXCA 2BM0A 1YD7A 3FW1A 2DLDA 3SSMA 1DFHA 1E94E 3COZA 2NYAA 5LP6C 2EOAA 4AP6A 4YYZA 4ZCTA 3ZXUB 3KEMA 4EWLA 3F9RA 4YRQA 2YX1A 2E4VA 4LC9A 4BMDA 1X1TA 3OU7A 2AR7A 5KTTA 3KOXA 1QGUB 2B2NA 3BB4A 4OGKA 1R6DA 1VLHA 2C9BA 1JHAA 1HLFA 2F4NA 1D09A 2ZIVB 3H6HA 2OBMA 2RKOA 2H11A 3QMVA 4DEXA 3E70C 2UZ1B 4HH0A 1MC8A 1G5PA 2ZTHA 1GKYA 4LE0A 4MVJH 4EPTA 5B7GA 2X2EA 1F6DA 3N8HA 1DBPA 4LRYA 3PVSA 2H08A 1YB6A 3KTAA 3LYAA 3PLRA 1XR3A 4FEEA 4IJ5A 1Z88A 4O4JB 4YJGB 1KSGA 5JS2A 4KFRA 4IQFA 4LBWA 2K5UA 4BV9A 5E3IA 3SVLA 1V41E 2AFIB 1N4AA 1Q84A 2EHDA 4IS2A 1NBMA 2JK1A 3B51X 1GTJ1 4P4SB 3F8WA 5FBWB 3RFXA 2WVHA 3SHTA 4MYRA 4B7CA 4NECA 3LPLA 1Z2EA 1L3IA 2YXDA 3DOOA 5KHAA 3IUSA 521PA 4HEA1 1GZUA 2X9GA 2YYZA 2EG5A 2YMPA 3NVMB 3E9NA 4QELA 3HVJA 1MX3A 3STVA 2WJGA 4BEWA 2BKAA 3W5VA 1WX1A 1YIDA 1WDMA 3NW9A 5AM1A 1WEKA 1YZYA 4LJRA 4W1SA 4UVIA 1A3CA 2HIAA 2RGNA 4BNLA 4C0BA 5F2NA 1TZBA 4R54A 3NHSA 4G56A 2YWGA 2O2IA 4CF4A 1TDJA 5EJMA 4DV5B 1LLDA 5GADl 3UBTA 5T41A 2BGUA 1UPCA 2DHRA 3MEQA 4QQFA 5ICCA 3K8YA 3FVQA 4ESHA 3H4TA 2VDVE 4BZQA 4C05A 1FVXA 1AS2A 2GT1A 4F38A 3CGWA 3EZ6A 3AGQA 1GWNA 1H6BA 3DL0A 1IPHA 4URXR 1QMPA 4DCVA 5CXXA 1QH0A 4OGWA 4WE3A 4CR8A 3BF7A 1TQ6A 2DU8A 2W37A 1SOVA 1IVNA 3VO2A 5BMVF 1V6SA 3QEKA 3V8VA 1X1AA 3AO0B 3K0EA 4RFSA 4B3IA 5B5SA 4YC7A 3LT4A 3RB8A 4TGLA 3C3DA 1KDPA 1ONBA 2D2XA 3E3AA 5FL7A 3VZPA 3SWWA 4B3HA 1TYDE 1IHYA 1SKMA 3AY6A 3QUQA 1QP0A 4LOJA 4HYTA 4I4NA 5F2OA 4I36A 4E2YA 5B7PA 1SJ9A 3KD2A 3W5CA 4KHPB 2VHWA 5JC1A 3HXPA 2CUNA 2QMEA 4CQMB 2YJTD 3PZBA 1XF1A 4MPDA 2Z83A 3LP5A 1CX9B 3SJ7A 1DTEA 2NUBA 2NYUA 1F8FA 3JQCA 5EMHA 2WTUA 2NVUA 4PBRA 4WPGA 1IMJA 1KQPA 3L9WA 2AOXA 721PA 1F2UA 2I4OA 3TQQA 4ZIRB 4BAZA 5BYKA 1UJ6A 3RRBA 3K9WA 1D2NA 4FIDA 4E12A 1CS0A 1CR1A 3O9MA 4BP9A 3N7UA 3O84A 3Q10A 1JTEA 1H93A 1YSCA 3ZNNA 2CF5A 4B5KA 3B60A 1AMOA 1O94C 2CGEA 3N28A 1XVVA 1P77A 4EI2A 1Z0FA 4YO8A 1G8FA 3IGFA 3CX4A 4NNPA 3BKXA 1FNMA 4V39A 1DCFA 4OI1A 3NTXA 1QIMA 1ZVJA 2TSYB 3AF0A 3OM9A 4OMUA 1XXHE 2JFHA 4X6YA 1I4WA 4JKYA 1L5LA 1N78A 5KX5F 2CB9A 2B2XA 1JQEA 2WYOA 3A70A 3GUCA 3K6KA 4DIUA 2P2DA 4KQCA 1DC8A 3DMTA 4RVOA 2FUG1 4ZANA 1T8WA 4TSFD 4A10A 1G59A 2ACWA 1DO0A 4DBZA 3ROXA 2OUIA 5EHQA 4BX8A 5KJCA 3U6BA 1T2CA 3K70D 3LBYA 3VPDA 5CFZA 3SKXA 1AVTA 1Q1AA 3BXGA 2E85A 3RTEA 3CB4A 1WPRA 4IHJB 1EK0A 2FZCA 2R7AA 4M38A 3I12A 4EVSA 4MI9A 3ZE7A 1T0BA 2I6XA 5KTSA 1S7GA 3I37X 3WNZA 1THMA 3WP0A 5ESDA 3ZDCA 2GAFA 1YQUA 4R4JA 1L5SA 1J9ZA 2XSZA 1QK4A 3DAGA 1S2DA 3T99A 5CFNA 1OFHA 4ES6A 5KKAA 1QVZA 4U1RA 1E2UA 2VKTA 5DGTA 2AOWA 5H9WA 1D6SA 1KMIY 1QPZA 1DG9A 3L43A 3EMKA 2OPBA 4CU2A 1D6MA 2BEJA 4QPZA 1FSPA 1QGAA 4TSKA 2JZNA 1B43A 3BCUA 3E23A 2DHQA 1F4LA 2FMUA 5EJIA 5TF0A 2CF6A 2Q28A 2Q49A 3R76A 4I14A 4ALKA 3SHVA 1GGKA 2AOTB 4DJAA 1DWQA 1AUVA 2BW0A 3Q7EA 4M0MA 4JKOA 4D4JA 4BRUA 3FGZA 3RANA 3PGMA 1WQ3A 2C3OA 2ZIXA 2AMYA 2A7QA 4GAEA 4MV3A 1BJRE 4FOTA 2PA3A 2QSYA 2WM9B 1HI9A 1K9SA 2HH9A 4OP1A 1I8TA 2YN2A 4WY8A 4OPMA 2ZYIA 3UMJA 3VU8A 5ELXA 1EFHA 1M54A 1I33A 3KYDA 3SR3A 1UC9A 2QM3A 1L4KA 4GL4A 4GXQA 3UT5A 4INZA 3CF4G 1FXWA 2ZWMA 3FPCA 3OO1A 4IGFA 2PLAA 3OBIA 1QJ4A 2IU6A 3JWHA 4KI7A 5A6SB 4E7OA 5BPFA 4KPUB 3TL2A 1PQ4A 2IT1A 1MFZA 2EEPA 2EGHA 2AHOA 4QUBA 3K73O 4Y6LA 2FOIA 1ZUNB 5HA5A 5AM2A 4CKWB 3CZ9A 1L7BA 1BA2A 2WNSA 1UOPA 1XXLA 2OBNA 1OHHD 3DFIA 3DE0X 4KH1A 1HEYA 4DJ5X 3TD6A 2ZEJA 4W5HA 1QXSA 1XL0A 1G3IA 4I9FA 2W6MA 3BDAA 3EHEA 1MW9X 1T1GA 4KXXA 1OD6A 1ZWKA 1P2VA 4RZXA 5DE3A 5A71A 4BTVA 3VZRA 3MCZA 1GT91 2UZIR 5KYYB 2JNWA 4EITA 1SOUA 3D1LA 4G5GA 4PIPA 3JWEA 3JALB 1RWWA 4IZIA 1H8HD 2P3OA 2KLBA 3IAHA 2H5IA 4HN2A 4LBZA 2HSGA 3BWEA 5JAZA 1N2JA 1GPWB 4P58A 3G1UA 4ZDIA 3MQ4A 1Y48E 1EDZA 1NVWQ 2IUSA 2REBA 3A2MA 3BREA 1KF0A 3MBKA 3WHLA 2M32A 3H5AA 2QN6A 4DJTA 3IVAA 3DVQX 4UHBA 3NBUA 2GPNA 5HMMA 3VYVA 4UPEA 4I6JA 2WAYA 3K9QO 5DP1A 1B14A 2OV8A 3U4HA 2QVXX 3NDJA 3ORYA 4KQWA 5IW8A 4CPDA 1N32B 3TSZA 2ZSEA 4ZCIA 3N70A 1O96A 1G0NA 2KS6A 4FC7A 1GA6A 1P4GA 1GZ7A 3RU2A 2VJCA 1MBZA 5D3MA 2YRWA 4CM4B 3R8CA 2ID4A 2Y1KA 4CIWA 1X9HA 3E9MA 3N5CA 1U0BB 3FTNA 4ZO7A 3UN1A 3PUJA 1JSLA 5CXSA 4LF8B 1QQ5A 2BFDB 2XODA 1PUJA 3BB1A 3U0BA 1B41A 2XWQA 4HZGA 5A9RA 3T1TA 1UM8A 3LF1A 3HCAA 3NAQA 4NEGA 2ZJYA 4G65A 1QMGA 1VSBA 4FJ0A 1X1QA 4ABYA 2BBTA 1ZVVA 5L53A 4ZICA 4X94A 1K7CA 3CEJA 1ADCA 4EMTA 4FNGA 2X1HA 3EXFA 1H66A 3SYLA 3H1EA 1IH8A 4EYEA 5BNTA 3QLJA 5LMUB 4H6XA 1D2CA 1ZICA 1MIOB 2O0KA 3GFVA 3PUKA 2IS4A 1HYHA 1V6AA 7GPBA 1QFXA 3GC6A 1RI5A 4RTSA 1ZJZA 3A2LA 1PK7A 2OT3B 3DDHA 5GGYA 5JMTA 2VNJA 1NKSA 3TKAA 4RWZA 4PZUA 2NADA 2PRIA 2BR3A 3I32A 3SBXA 4D9NA 3ZHTA 2FHSA 5CA0B 5H4GA 3LRTA 3IODA 3UJAA 2D0OB 2C0QA 3OJXA 1CS4C 2I80A 5B55A 2B21A 2EZ8A 2EARA 4DJDC 1IB6A 1UBHS 4X60A 4BRSA 1ADFA 3L79A 1PWEA 1RT9A 4YRDA 3SQMA 2Q4TA 3I9V1 1ZOSA 1U7WA 2GN8A 1ZMTA 1QK3A 4FZJA 4QJIA 3RRYA 3CPHA 2BE9A 2UZ1A 3LBIA 1SCDA 4URHA 5KNDH 3FHTA 2DX7A 3GLGA 1B42A 3EUWA 4TWAA 1UFKA 3SBDA 1ZIOA 3LHKA 1KJ9A 1H3EA 4HN4B 1FRQA 1IY9A 1GP2A 3EEFA 2ZE5A 3N0XA 4M7PA 3OE7A 1FFBA 1KY4A 4DPKA 1SC3A 3ZS9A 2Y9MB 2D00A 2OZEA 1KP2A 1KPGA 2FXVA 4BO1A 1HNNA 3HB1A 3WRXC 2JDIA 3QENA 1M2HA 2ZZMA 3LL7A 3GA5A 1E3JA 2WJHA 3DAFA 3FPKA 3A2KA 2WQ7A 4RDHA 1ILWA 2YTZA 1ISFA 1PR9A 2JGKA 4XX0A 4DABA 4KDRA 3REQB 1W4AA 1ZOPA 4M9CA 3KZKA 2RAUA 2AD1A 1GCIA 2VSXA 1SPBS 3OWXA 3S28A 1RM5A 2UZ3A 3EC7A 3GLSA 3VNRA 2EQBA 1QO0A 4L85A 4N1AA 4MHTA 3OZUA 3Q3JB 3R7AA 1GIAA 1PK8A 2CD9A 1Z35A 4LGVA 1K7XB 2Y05A 3R7LA 2AMVA 4N6GA 4N7BA 2L17A 3QKSA 2H7YA 3N59A 2G0NA 4II2A 3PCXA 1TAHA 4DT1A 3QOFA 2IP1A 3AVPA 2IDMA 2QPLA 1ZU5A 1KZGB 3O38A 3EQ2A 2VLIA 1ZM7A 4N8EA 5DTMA 3LWZA 3ZDAA 5K2MA 1VSTA 2FPOA 1BEUB 3CXRA 1WCIA 1KYVA 3KEFA 4DOMA 2X8AA 4PR3A 1Z74A 1XDUA 1ZS9A 2X9LA 1CQWA 2I1QA 2ZJ3A 1JJAA 2O0JA 3KU1A 3O0TA 4GRIA 4MJLA 2NU6A 3BMCA 4P7GA 3WI7A 2Y0BA 3A26A 4PHCA 3ZX5A 3GPBA 5AOBA 3O75A 3FKSD 3H3JA 3OPVA 5EZ6B 4BFCA 4CDRA 5GAJA 1YUMA 4G89A 5JYDA 3FB1A 1A1VA 3H2ZA 3QWAA 3PD1A 1AUQA 3DZFA 3GDGA 1QQ6A 3X1DA 2PMDA 4RK7A 3SPXA 5BUZA 3HA5A 3AR6A 3O3NB 4YV2A 4AKIA 3OJEA 4P32A 1UWKA 2FW0A 3K6JA 5IABA 2VHXA 1UBOS 2EDCA 3HKBB 3LUAA 2FEAA 2QD5A 3C3MA 3G9QA 4Q3AA 5HK9A 4AJJA 1ZU4A 5DNVA 3VH1A 2GBIA 2E9SA 1CR4A 4J49A 4RGQA 4LX8A 3H2BA 3UCXA 2A2ZA 2VAWA 3KKEA 1ZHFA 4AF6A 4N12A 2C20A 2YWRA 1Z0ZA 1BKYA 4NCAA 5G40A 1XPOA 3WXMA 3AGPA 2AF3C 2J3DA 2KMLA 1I1OA 5TPWA 2Q5JA 1NRIA 3VO9A 4GI3A 5BWOA 1AKYA 4DV7B 2QT1A 4LDJA 1G41A 4N40A 4MWSA 2YJ3A 1NV9A 5K3BA 2Q0QA 1SXHA 5JDCC 1GSHA 4ZV9A 4A0FA 1YQDA 5JPCA 3FDXA 5ADWA 3TTXA 5T7BA 1J2UA 4QJBA 4IDPA 3EG9B 2RI0A 2XTJA 1N3BA 1KNXA 2PSFA 1VB5A 2AMLA 3G6KA 2G4CA 4Z9BA 5IJAA 4UZSA 5EMLA 3K9NA 4OB8A 4XIGS 4N8DA 3RUCA 3ABRB 3JD3A 4EG4A 3SOZA 4RH3A 1WA5A 4KAJA 4N3AA 1DIGA 5D3QA 3WMEA 2XZTA 1X7ZA 3RG8A 2ZUEA 1USUA 5BVGB 1SXQA 1AT1A 3RU9A 2H4HA 4AO7A 1N2XA 1OWLA 3DDUA 5IVKA 1CUYA 3Q3IA 5B2FA 2X23A 4RIEA 2ECQA 4KRXA 1USKA 2AXEA 1E3WA 5LC1A 4H7KA 3P9IA 1DAOA 3OVMA 4BJHB 3CF0A 3KQWA 1A95A 1WXXA 2O23A 4M1TA 5K0CA 2YQ4A 4ZEWA 3KG2A 5F12A 3UWPA 2E18A 3UXYA 3AKYA 4JENA 5DF1A 1E6CA 1T9CA 2DBVO 3U1BA 4HAOA 5JT1A 3L1HA 5L7YA 2VRCD 3N39C 4MKIA 3ULKA 1LY1A 1LDMA 5KPJA 4UNQA 2MDTA 3IPAA 2Q8PA 4EGFA 4HT3B 3PNOA 1V6CA 1Q0QA 4FE3A 4O29A 4HAIA 4WQMA 4X20A 3ABZA 3FA2A 2WILA 3OT4A 2WQ6A 5LBIA 3RRMA 4JDUA 1DKLA 4QFBA 5EJ2A 1IBKB 1LPSA 1WVIA 2DPXA 3I1FA 4REOA 1IEXA 2FFBA 4RTMA 2M1ZA 3D7RA 4LDPA 4JQCA 4JI7B 2BBWA 1KAMA 5K3AA 2XI4A 1QZXA 3KZOA 4P80A 5D3KA 1RJ9B 1VJDA 3I6ZA 5BUSA 3AEXA 4OQPA 1P44A 3V9AA 1I2ZA 2BKXA 3NHKA 1GITA 3WADA 1YXMA 2J7PA 1MO4A 1I1QB 3B9QA 1QQTA 1YVDA 2QBYB 4DUGD 5KC9A 1CUWA 2WHPA 2V03A 1R4NA 2EKQA 3A1WA 1J21A 1L7EA 1ZD2P 1CD5A 1G5HA 2XYGA 4MMYB 4YB8A 2ZBQA 5LQNA 2Z6QA 2ZJ1A 5F3DA 4RANA 1IC6A 3H11A 2ERXA 1CJSA 3M6MD 4EHFA 5C5EA 4JIGA 5AUNB 1I7DA 5LOVB 3M6VA 4ZCRA 3U4MA 5TGDA 4PG5A 4YAWA 4P82A 1PT8A 3G2LA 3AVYA 1FS5A 2EF1A 4TXLA 4W5TA 2XXBA 1W19A 2IHJA 2YASA 2JEZA 3OTWA 3Q3CA 5TRTA 2VP0A 4DRYA 1B00A 1F8XA 1XKTA 5AM5A 5HKAA 2PJUA 4K6CA 1M6YA 1OLXA 2DQYA 2QVBA 3TRDA 1FJXA 2V97A 1O77A 3HCRA 3KPWA 1PGNA 1Z6PA 1XQYA 3A9UA 3OUUA 5E2IA 3HK2A 2H7VA 4CM9A 1QDUA 2PQ2A 221PA 4GX0A 4F2HA 2UUOA 4Q7KA 121PA 1DNPA 4C4AA 1QM5A 5TY0A 4KFCA 1KYXA 3ILVA 3EFOB 4P35A 2BWJA 2R1VB 3SZOA 3KT0A 3TQFA 3DZGA 2GAIA 3ZTTA 2O8EB 1VLLA 3ETGA 2GF0A 1X8XA 4ZCLA 4IKOA 5J4KA 3BMQA 4OU5A 4AYXA 3T1OA 2H59A 5EHNA 2J87A 1NVGA 1VJ5A 2BEWB 1KVUA 3EXG2 3TMYA 2KHZA 3ZJYA 3VR6H 4KQIA 4GICA 1BQ3A 1GUZA 3P9ZA 1PE0A 1NVTA 1N8SA 5LDDC 2IH5A 4KQKA 5C8YA 3GU3A 4F56A 4WCFC 2C7PA 1G0OA 4PXYA 1E2BA 4FJ1A 1Z7WA 2QLMA 4OFXA 2PZKA 4H3KB 1Y8ZA 1CIJA 4V1CA 1YKFA 1XDGA 1B8VA 3QFHA 4FBLA 1YB5A 1NJ8A 2XE6A 4LVNA 4BWYA 1ZA1A 1IL0A 4ARAA 3SC2B 3L8YA 2XCQA 1UIMA 2J46A 3Q88A 4HXYA 1YVRA 3GRYA 4A2QA 2UZ0A 3ANYB 3TQCA 1RWBA 3CF6R 1VG9B 2XQGA 4K8OA 4PCAA 5BUCA 1NP7A 5ALZA 3TL3A 3A31A 4M76B 3KQTA 4RH0A 3U19A 2C7BA 1HURA 3KHSA 5FV4A 2A5GA 3OE4A 4RC9A 5CDFE 1I4EB 4HQ0A 3TSAA 3LMKA 3U3XA 1U5BB 4WNIA 2OQVA 3KQSA 2YJ4A 1X42A 3GLFE 1GZ3A 1T3LA 4N9WA 6AT1A 1RYEA 4J75A 4Z0TA 1UJCA 1EESA 4NJEA 3LUBA 3SSOA 4Z9AA 5ECYA 2IEGA 2PL3A 2QUAA 3O31A 4X8OA 1XMOB 4N7JA 2A58A 3J7TA 3FFWA 2JEYA 2O14A 3CT4A 1ENZA 2RK6A 2J8ZA 4L4YA 3PR1A 4RTRA 1P72A 1Y9ZA 4YJDA 4EUSA 1E1NA 1EK1A 3RYTC 5CH8A 1BCRA 2LCFA 3OM8A 1KAQA 3WDKA 2I7TA 2DYKA 1EAMA 3E18A 4ALNA 2WTNA 4OP3A 5IAGA 2ANCA 3GDWA 2O8BA 5EIFA 2G4VA 5IWAB 3ZKWB 2AN1A 3T3MB 4JNKA 2JIOA 3PXCX 5SV2A 1U7UA 4FDVA 5FOSA 4Z1MA 3D59A 1UFVA 1VIAA 3GCWA 4C4XA 2F55A 3I8SA 3FBWA 4WK0B 1X7XB 2PGLA 4K40A 3NYRA 4GP7A 5I45A 1U28A 5JY6A 3GJZA 2EBHX 1QDLB 3R6LA 1GM5A 3G0BA 5B3AA 2B9EA 4G4SP 3TNLA 1S3SA 1SO8A 2VRCA 3BJEA 4PTYA 3WLEA 4AAYA 1X7HA 2QGZA 1TQDA 3JYNA 4LY9A 4EECA 3AP3A 2QR3A 3OE5A 5THXA 2GUGA 2IXAA 4FGZA 1BMDA 4CN9A 3FRIA 5JMWA 5CYPA 2BLLA 3EF3A 4MTCA 4AUMA 1A71A 4ISCA 3EWIA 3R5XA 5KOHB 1BXGA 4M7OA 3TQRA 2VP5A 2AYXA 2QGFA 2I2AA 3LJKA 1HDZA 3A4IA 4FONA 2I2FA 3A14A 3SC4A 5KVSA 5CIYA 1RD4A 4RA6A 5HDQA 4ZO4A 3RKUA 1W2HA 3EEQA 3N0TA 3BWYA 3KFVA 1ZNXA 5JCZA 1KK1A 1EFAA 2I62A 3C1TA 3CZRA 1TT5B 3I2JA 3HBLA 3ZCVA 3HDJA 4M88A 3RT9A 5BORA 4XQEA 1CLEA 2DWCA 1HOTA 5ISMA 1AGYA 1PL6A 1I0IA 1CJCA 2IYUA 1C7ZA 3ED1A 3TEMA 1QPBA 4UBMA 1H05A 2QD1A 1XVTA 3BTUA 3B9PA 3DBVO 4B3FX 2ZR9A 1FYDA 5CGQB 3B2QA 3QELB 4FTWA 4IJQA 5LZ9A 4JI0B 1JVBA 2BGKA 3CVJA 2OHGA 2NO9A 3JQBA 3MA0A 5K0JA 5FRDA 5DBIA 1WQ1R 4HAUA 4DCNA 2PR2A 4CTOA 1YDFA 4EHHA 4XJVA 1B8PA 3M89A 1VFPA 1FTGA 4U8HA 2E49A 1IM2A 1C4OA 1AGXA 2YHIA 3ICWA 5G0WA 4DQKA 3TB4A 2INGX 4KV9A 1BDHA 3I61A 2GCPA 5BO5A 3TKYA 5HK8A 1XT6A 4FOPA 1VYTA 4RU1A 4YMTA 2C5LA 4HQOA 3QOYA 5HM6A 3DPUA 1DEXA 2EFEB 1ZNWA 4BAUA 3L6UA 3CIOA 3QFSA 4EY3A 1V48A 2N0SA 1J1IA 3PWKA 2VZ9A 4LVOA 4ZAWA 2O3UA 1SA0A 3FWHA 5CB4B 1TD1A 2J3EA 1TIPA 3G59A 1VE3A 5CW2A 2XKJE 4C0AC 2MR5A 3MSXA 5KX5A 3OCJA 1RSZA 2PMKA 1QAMA 3IBSA 1MXFA 1UJNA 5D87A 4F4HA 2W2LA 5JYEA 4NDNE 1B0UA 3H7IA 4ZAZA 1F4VA 1R16A 1JNYA 4ZAFA 2PJRA 4BY9E 2IY8A 4COOA 3FTQA 3M6IA 4ZTZB 4F6CA 5JALA 4TKLA 3DE2X 2PT7A 2Z8YA 2FQQA 2QAJA 1JQDA 3L92A 4U7JA 1VKRA 1R9JA 3TBKA 5HZKA 5DPMA 1YACA 3FCOA 3NBKA 4YCNA 2ZBUA 3IT2A 5DGDA 1H9CA 4CMJA 2ZW9A 4JEMA 2XB2A 3R0ZA 2O2YA 1TYEB 1KYYA 3IUQA 1TM7E 2JH3A 1YS4A 3N5KA 5FBVB 3K9LA 3HZRA 4Q1DA 4Z4GA 1JIXA 2OLEA 1DVRA 1KRHA 1V5EA 4JYCA 4YJHA 3U44B 4JBNA 5IC4A 1C3OA 1K9VF 1TW2A 2IEYA 5IU6A 2HUNA 4UAJA 2VTDA 1BCSB 3Q8WA 1O5OA 1FFAA 2CHEA 4U2DA 3LFHA 3PJGA 4NYIR 5F3RA 3NM4A 4EF5A 3OICA 4EHJA 2YDYA 2OG1A 3E1KA 4QRIA 3K30A 4BNJA 4KAXA 1ZSNA 1A69A 2GHTA 1RMYA 3RKSA 4WFIA 3R3HA 4LK2A 4JI3B 3W7BA 1E7RA 3I1JA 1L7OA 3VR3A 1F6WA 1DTWA 4N7MA 1DPGA 4EMSA 3JQAD 2FMTA 4MW7A 3WMWA 4R51A 4BVAA 5TC4A 3PKIA 2NSHA 3FPEA 5KAPA 3D2LA 3P97A 3U56A 3HN2A 3GAAA 3ER6A 2R48A 2WJWA 2X4GA 3B9BA 4KIFA 4MDHA 4YMIA 5AK5A 5KNDA 3RYCB 1J97A 1R0YA 4EKDA 4LSZA 4MKXA 4J0FA 3IIEA 3MCWA 2BELA 4H4EA 3NXKA 4TV9B 1G63A 3JCZA 2IKSA 3RD5A 2OV1A 2FE1A 5A03A 1WEHA 4HZUA 1QKIA 2XGJA 2XUAA 1E0SA 4KHZA 3P4YA 4KLAA 4ZYTA 4GDFA 4WW0A 1X1RA 2ZAOA 1UFQA 1SD5A 2QPTA 3HBMA 3K53A 1GCOA 3CLVA 3NHZA 1DFGA 5GZ6A 4CG3A 4GHWA 3RSZA 2CSXA 3SCZA 4TVBA 1E1DA 1RCFA 3GI1A 4X7BA 3O5AA 3AOGA 4YQZA 4OP2A 4JBXA 3VKUA 5DBFA 3PGXA 2X42A 1Z6XA 4JODA 4Q15A 5JAOA 4MVJF 3GJ5A 2XW6A 5LP6A 3JVIA 8LDHA 4H1WA 2CLOB 1SBCA 1TCUA 4O4IB 3ZGOA 2EDAA 1A8IA 3ECCA 1XMVA 4KXMA 1ZH0A 5JQGA 2HIHA 2IHBA 1F0YA 1OLUA 2LZ0A 5I8WA 2PX0A 1MABB 2Y4NA 3FH0A 3Q9NA 1OI3A 3EPHA 3U1TA 1MH1A 1EM6A 3UWMA 3JQ9C 4BO7A 1M6EX 4MW0A 5DIZA 5EAIA 4DAOA 3ZLTA 1OX4B 4Q19A 4B8WA 1BEEA 2VBFA 4RADA 2OD7A 2A88A 2FWRA 3I05A 5AKIA 5LB4A 3W4KA 4XPZA 1DDIA 1KI6A 2VPIA 1JA0A 3I3OA 3FNFA 4KNWA 1R74A 3D2CA 4OKIA 3VHXB 4CTJA 1S89A 1E7QA 4CEIB 4MUYA 5DNYB 1LW6E 3VNUA 3MT8A 3U7IA 3EJ6A 4QAQA 1VI6A 4TXJA 4F6RA 2GRUA 3DQQA 3ZJTA 1LVUA 1TK2A 4I9NA 2AV6A 3O73A 4QU8A 5MHTA 3JR3A 2AC2A 3PCTA 4AJNA 1VL5A 1EFRD 3KZXA 1OIWA 3V80A 4INPA 4L75A 4RPCA 3D3JA 1JSRA 2R6DA 1NU8A 3KKOA 4NLLA 4URYR 2ZI4A 1KP9A 3NHRA 3FUXA 2HMVA 4NFLA 5H5JA 1D5CA 1OT3A 4TRJA 1OE0A 1RPTA 3S1AB 4ZVSA 1XPUA 1PRYA 1UBGA 1UQTA 2HSEA 2M2IA 4NU8X 3KOOA 3C85A 4X1IA 2JFGA 2QL9A 2IELA 4DVJA 4CU5A 1T2EA 1IB0A 3B3FA 4EX7A 2ZQ5A 4CG2A 2QUIA 5L3SB 4MUEA 3TVYA 3MD0A 5B3LA 1MJ5A 4EY6A 2O07A 2G1AA 3B8EA 3QF7A 3T1HB 2E4ZA 4W5RA 3RFFA 3Q7SA 1QFJA 1W46A 2JBAA 4JP8A 2BISA 4CKCB 4PXAA 4D99A 3I5XA 1JFFB 1SH7A 4A8JA 4IDDA 1R7RA 4MV4A 1KMHB 2R87A 1LC3A 3Q4GA 1E58A 4UNIA 1DJLA 3OZCA 1T9KA 2I3BA 4B3XA 4BIIA 1R0WA 1DUIA 2KPOA 3GEPA 4QHYA 2BF4A 2ZB4A 1Z5VA 1G66A 3LLUA 4OQZA 3W2IA 1T9DA 4AWAA 5EJ4A 2JD2A 1ND6A