4EB8A

Crystal structure of purine nucleoside phosphorylase (w16y, w94y, w178y, h257w) mutant from human complexed with dadme-immg and phosphate
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
288
structure length
288
Chain Sequence
b'TLMENGYTYEDYKNTAEYLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLYKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTYKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANWEEVLAAGKQAAQKLEQFVSILMASIPLPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Catalytic Site Conformations in Human PNP by (19)F-NMR and Crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 288
sequence length 288
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4eb8A00
3DPSA 1PF7E 4L0MA 3KVYA 2QDKA 1A69A 1QE5A 3KVRA 1RXUA 3UAVA 3UT6A 4G89A 1SD2A 1PR1A 3FB1A 4OGKA 5IU6A 1OV6A 5CXQA 3MMSA 2B94A 4MCHA 4KN5A 5DK6A 4LDNA 2IQ5A 1ODLA 4MARA 4WKBA 3OPVA 4FFSA 4TXJA 1PR0A 1RXYA 1ZOSA 4JWTA 1PK9A 1OU4A 5CXSA 4F3KA 3LGSA 4I2VA 4PR3A 4YJKA 1A9TA 4NSNA 4DAEA 4F1WA 4TTJA 1U1GA 2AI2A 2ON6A 4TXLA 1U1DA 3QPBA 1PR4A 3FUCA 1V3QE 1B8NA 4OEHA 3LA8A 3UAZA 1TCVA 1C3XA 5F78A 1LX7A 3KHSA 3O6VA 5EFOA 5JPCA 3D1VA 3U40A 4E1VA 1RFGE 1PKEA 1A9OA 4WKCA 4M1EA 1T8WA 4D8XA 1Z34A 1PW7A 5KB3A 3BJEA 3ODGA 4L6IA 1PBNA 1RXCA 4BMYA 1VHJA 5F77A 4R2XA 1JPVA 1JDVA 1YQUA 4OGLA 4LZWA 5F7XA 1A9RA 1JE1A 3C74A 3EMVA 1Z36A 1LVUA 4D8YA 3DDOA 3BSFA 3NBQA 4QFBA 4WKNA 4R2WA 4DA8A 2OXFA 3E0QA 1ULAA 1U1EA 1NW4A 1Y1RA 5CYFA 2A0XA 1A9SA 4MCIA 4TXHA 1Z38A 3BGSA 3GB9A 1V48A 1CG6A 1JYSA 1FXUA 5EPUA 3PHBE 2RJ3A 2ISCA 5B7GA 1Z33A 2AI1A 4NY1A 3ONVA 3F8WA 3NM6B 4DA6A 1Z5PA 3KU4A 1PR5A 3NM4A 3UAYA 1JP7A 1T8SA 4M7WA 4OJTA 4D8VA 5F73A 3FOWA 4QATA 1U1FA 3EEIA 2QSUA 4WKOA 2A0YA 2A8YA 5C80A 3E9RA 1VFNA 3E9ZA 1K3FA 2I8AA 2HN9A 1YBFA 1PR6A 1ODJA 5IFKA 1LV8A 1TGVA 1YQQA 4LNHA 4TS9A 3DP9A 4BMXA 4F2WA 1M73E 2PGAA 3OZDA 3IEXA 1T8YA 1OTXA 4TTAA 1K27A 4R31A 3INYA 1TCUA 3EUEA 2H8GA 3MB8A 3NM5A 4GKAA 1V41E 3UAWA 1TGYA 1ZL2A 5CYGA 3TL6A 4TS3A 5K1ZA 1ECPA 2OC9A 1RCTE 1U1CA 3IOMA 2HWUA 1Z37A 2BSXA 4DARA 3DF9A 4UC0A 1V2HE 4IP0A 1SD1A 1A9QA 3PHCA 4H1TA 1V4NA 3PNSA 4JOSA 1Z5OA 1ULBA 5CCEA 4F2PA 1N3IA 1T0UA 4DANA 3FAZA 4PNPA 1PK7A 2QPLA 4DA0A 4QASA 1YRYE 2GUWA 4OY3A 1Y1SA 2HRDA 5ETJA 3P0FA 1K9SA 2A0WA 3EUFA 2Q7OE 2AC7A 1WTAA 4F3CA 4WKPA 2OECA 4L5CA 4NS1A 3BL6A 4DABA 1G2OA 4L5AA 5EUBA 1ODKA 4YNBA 4L5YA 1NC3A 5I3CA 4LKRA 4OF4A 1Z5NA 1T8RA 3SCZA 3OCCA 4TTIA 4RJ2A 3KUKA 1RYZA 1NC1A 1RR6A 4GLFA 1JDSA 4TXNA 1JDUA 4P54A 4DA7A 1I80A 5B7PA 3OOHA 5F7JA 1VHWA 4BN0A 3ENZA 2HSWA 2AI3A 2QTGA 5FAKA 4G41A 4YO8A 5F7OA 1XE3A 1OTYA 1YR3A 4GLJA 2P4SA 4K6OA 1JDZA 3GGSA 1PWYE 4G8JA 5F76A 4GMHA 3P0EA 3OF3A 1Z39A 1Q1GA 4LNAA 1RXSA 5CCDA 4M3NA 4U2KA 2I4TA 4JP5A 3FNQA 4QARA 1TD1A 2XRFA 3OZBA 1Y1QA 1SJ9A 1JE0A 3O4VA 5B7QA 1OVGA 1PR2A 3K8OE 3LBAA 1VMKA 1V45E 4YMLA 1Y1TA 4ECEA 2OC4A 1RSZA 4D98A 4TYMA 3K8QA 4DAOA 1ODIA 4D9HA 1RT9A 1A9PA 3KVVA 4BMZA 2QTTA 5F7ZA 3T94A 3UAXA 1B8OA 4EB8A 3DJFA 4QAQA 1Y6RA 1JDTA 3OOEA 4QEZA 3PNPA 1CB0A 5B7NA 4EARA 3FWPA 4X24A 3OZEA 1Y6QA 1OUMA 1SQ6A 1Z35A 4TXMA 3OZCA
chains in the Genus database with same CATH superfamily
2YRFA 3G13A 4KPUB 1I0IA 2PH5A 1Z0UA 4TUYB 5FOXA 3T9CA 5K3FB 1I9CA 3HCDA 4OOEA 3UYLA 4DUGA 4OHYA 5BOSB 1VJGA 5H5JA 2PUWA 2V0NA 2W37A 1CUCA 2Z9DA 3IAS6 3T4PA 5LD2B 4RA9A 3NVDA 2C84A 3PZRA 1WPXA 3FLBA 3UAVA 5BQFA 4UU0A 3KT6A 2I7CA 2XNDD 1XRLA 2H07A 1FXWA 3NKVA 1Q7GA 1BNCA 3EHEA 3A1SA 1HNNA 1ZIOA 4TROA 1BOFA 1UZUA 2Z3ZA 4NV1A 1DKQA 3M6MD 4R2IA 5FOQA 4O6VA 3VPHA 2RG1A 3OUZA 2Q5IA 3H1AA 1Y80A 3ZGOA 4YEDA 3B51X 3DFZA 4OQFA 3JQBA 5IEBA 5I4KA 4PCVA 4XUDA 4ZOEA 2VJAA 5SY6A 5TMBA 2DERA 2FQQA 3K31A 2VPYA 1DG3A 1JEOA 1OFHA 4HGYA 1TVKA 3PP8A 4X63A 1E99A 2X2FA 3MMSA 4ZVOA 3O90A 2F3PA 5KNDD 4BCDA 1AKMA 1P7CA 2O3TA 5B36A 5LNK6 2WD9A 3FJOA 5ERGB 2WILA 1D09A 3G0BA 5GMOA 3HI4A 3T52A 1QFXA 2IS2A 4MARA 5C32A 2F17A 1VLHA 1GUYA 3FVVA 3UICA 3BF8A 4Y3UA 2BM0A 4Z2YA 2NO9A 4JYMA 2FWJA 1FRZA 1UOPA 3LFUA 3PHLA 5DISB 4E5YA 4BS9A 3CNEA 1M34B 3D43A 1ZOSA 4ALIA 2C4WA 3ND7A 4RVNA 3OX3A 1DKPA 1KE2A 3LT4A 4PLTA 1R8JA 2VUUA 4HZUB 3LGSA 3AKCA 5MF6A 1GTG1 1Z7BA 2XB2A 2YNMC 1EVZA 5BN3B 4LPSA 4L8WB 2WB2A 1PV2A 3GBSA 3HB4X 2CYCA 4BVBA 4RS3A 3L6DA 1Z2EA 4G8CA 3K6KA 4KLNA 1YRBA 4OQEA 3SZRA 3U17A 1M74A 1U9YA 3CRZA 3FMFA 3NHFA 3K5HA 1ZU5A 2QN1A 3DDZX 3UB3A 4DRZA 4AJ1A 2YVKA 4C2UA 2HKIA 3NPMA 2D3TA 1GADO 4JXKA 3VR1A 1P2SA 3IHWA 4BO8A 4BJ1A 1PR4A 2QD5A 2UZ1B 3FUCA 4U2CA 3R3SA 5BNZA 2HH9A 5TY0A 3G2JA 1H6DA 4DB4A 2BFDA 1UK9A 3MWDA 2QUAA 1B8NA 4YQFA 1UPCA 4QQKA 4CRWB 1XIVA 1G5PA 4S2EA 1IXKA 3QQPA 4RO0A 1S2MA 3NNNA 1TEXA 2HPHA 2LE0A 2V4UA 4YJHA 5K4AA 1HT1E 2O2SA 2VNHA 1CC1S 1UXGA 3SM3A 5C1DA 2QX8A 5HUHA 2JCXA 3N2YA 2CXNA 3B6IA 3CNLA 5DRTA 1Y3DE 3E27A 1QU3A 2JLUA 2NGRA 3WR5A 1UBCA 3WGNA 1BX3A 2Q6IA 2ZVDA 2I33A 3USZA 3ZBTA 3G9QA 2XB4A 4JJFA 3PVCA 4C2AA 2C7QA 3IEKA 3OZRA 2JBAA 1GUAA 3CH4B 2M1ZA 1N92A 1VP3A 4TYYA 2IELA 2EERA 3LVQE 4UNSA 3JWHA 4Y1RA 3EF1A 3EY4A 5G0WA 4ENSA 2F62A 1A9XA 3MTEA 4EPWA 3OPYI 5FTNA 3C85A 3HBJA 4KO8A 2P79A 1MT3A 2RK6A 5GGYA 1I4TD 3PTZA 2ZRJA 3ZR4B 2DECA 1QOQB 3CNOA 4UMEA 2PHZA 3V1LA 3HKDB 4A3SA 1FYXA 3BJEA 3FX2A 1JWBB 2O6LA 2V74B 3DBIA 4FI3C 4XH9B 4QULA 4YY3B 4EHBA 2CNNA 2DE0X 3G9UA 3HXKA 2LVBA 3ODGA 5HMLA 1XDWA 2ZS8A 3QY9A 2GN0A 2MINB 3OOSA 3WIBA 1SKAA 5ADHA 5COBA 3CB2A 5FOUA 3EPJA 3DBRA 4DYVA 3COJA 3R3HA 1KO1A 3ZH9B 1BE1A 3LHFA 2RKOA 3L06A 1YCDA 3EEQA 3GH1A 3IODA 1RQGA 1FQJA 3WRYA 4CEHA 4E03A 1A9RA 2BFBA 3LMKA 4IO1A 4OHVA 4PLGA 3TIVA 3E9CA 2HIHA 1E6UA 5I7VA 4O59O 3AC0A 3FOFC 1N7JA 1PWZA 2J67A 1FFXA 2PJUA 4CMBA 2WJAA 5CVVA 4AMGA 1LDYA 3AF6A 1K3TA 4ND8A 5CEJA 2LD4A 2WJZB 3W9UA 3DPIA 3MAAC 4ASUD 2C42A 1PHRA 3QKWA 1UBTS 5IZ4A 1FIUA 2Q0SA 2GJ8A 3U61B 1AH2A 4XARA 3QEAZ 1C41A 1KI6B 3B3AA 4BWGA 1ZG3A 1QP7A 4MROA 4DDWA 4KN6A 4WLVA 4IIEA 4Z4HA 4EJSA 3QU5A 4RSGA 5CHEA 3R9IA 2VL7A 4BMNA 1NW4A 4TZTA 3MAJA 1Z6ZA 2M32A 1U3DA 2I99A 2YMMA 3OQPA 1CUUA 2OOKA 2XE4A 2XUQA 5U4XA 3V8QA 1AA6A 1J25A 2R47A 5K01A 3ZWVA 3W78A 3OPYB 4IJ5A 1FDRA 3FWYA 3AOEC 3OFND 4CM3A 4DWOA 3WV4A 3NNSA 4HS9A 5FWAA 3CX3A 1CDOA 4FDAA 1T2CA 4YCJA 3BORA 4FI3F 2CHGA 4OJMX 4EHDA 4TKVA 4RK4A 5CXUA 2EAUA 4HTAA 5AXBA 4HWTA 5FDFA 3ZD6A 1E2LA 4C4SA 5JMWA 4MS1B 4A4DA 4MITA 4WOJA 5CK5A 4CG2A 3I4FA 1XDUA 2Y68A 1UPBA 2NTYC 3ROPA 3L6UA 4BNIA 4BU0A 3O8BA 2F90A 1OGYA 2NAFA 4PLVA 2FFJA 1S8AA 2RONA 4MTLA 4TV9B 3GLFE 4H7JA 1IRIA 2Q1YA 1FFHA 1LLUA 4BKRA 1DOZA 2DAPA 2I22A 3HB1A 3G2HA 4ZC1A 2WHQA 3LLVA 1Y8CA 3OQ6A 3OLCX 3GEMA 3QFSA 1MJNA 4XOUA 4NOMA 5GVSA 2FPXA 5K0NA 5DGIA 3EEBA 4DVJA 3EGCA 4BNYA 4TOIA 1NNLA 1MRSA 1NTOA 1U2PA 2BFOA 3H8VA 3RYCB 4I1VA 4J6EA 1ORIA 2Z8YM 1J7JA 2P6UA 4UBKA 1NKVA 5IVDA 4DMRA 3C5CA 3KR1A 2XE7A 3JATA 1Q14A 4IOLA 1BEUB 4POOA 4OBEA 3OLWA 1AB5A 3ZJYA 3ENQA 4F2HA 3NONA 5ABPA 3UWMA 5HF6A 4ZOAA 1AKNA 4N1AA 4O0LA 3VDXA 4CODB 4EM6A 1ZH2A 3KUCA 3CLRC 4M7WA 4EF4A 1KYVA 2ZRAA 3AR5A 3HPQA 4QOJA 3LDUA 4WN9A 4RKWA 3DMTA 4AIIA 4WK4B 1MUUA 3OU7A 3G7NA 5JCPA 1MT0A 1N33B 1I2CA 4WOBA 5KNLA 1JAHA 2DFPA 3QVLA 4WXMA 1K7FB 2IPNA 1NF2A 4D9IA 4E0BA 1IUOA 1KZ4A 1TO1E 1GL6A 3BE4A 5ALUA 2CV0A 1KOFA 4M9XA 2QM8A 1FDVA 5IUJC 5FWXA 4LV6A 1K7SN 1JPNA 1Q1ZA 3IT1A 3JZIA 4YCLA 1W96A 2J3IA 2WWVD 4O2LA 2ID4A 4YQZA 3O2JA 2TECE 5B58T 4G5HA 4PPQA 2QG9A 3HADA 4KQWA 4Q82A 3W4IA 5J4HA 4RV5A 4I9NA 2HJVA 1NOJA 1VM6A 2ARKA 3RSGA 3N7AA 5I9NA 5LZ9A 1NU6A 5JI2E 1OPRA 3P9NA 1YQ9A 4KP7A 3ZCXA 2QTLA 3C3EA 2P9ZA 3DLBA 1ZN8A 1JXOA 1O95A 2ZRPA 2WD7A 3GJ5A 4GOLD 4D3XA 1Q0PA 4ZU6X 3LA6A 2Q1TA 2Q0HA 1AS3A 4CKBA 5HPYB 1GVHA 5FUVA 3E22B 1YQWA 2ZI5A 1V8FA 3RVOA 3G1UA 2GAFA 2C5HA 4OKSA 4R05A 5IYZF 4D74A 1ZOLA 4OP3A 4DIUA 4ATNA 4J0QA 3FZEA 5G4KB 1XXHE 4UTZA 3WHIA 5C8YF 1GDTA 4OHZA 4NHOA 2I3ZA 4HAYA 3UAWA 4ZGGA 3GFFA 3P9ZA 4N0DA 2ZXUA 5JO9A 1RZUA 5AHWA 1R27A 4GR5A 4WERA 3TL6A 3Q2IA 5LJIA 1BQEA 1YB4A 4IOJA 1U2TA 3EVBA 4W8GA 4MV5A 3SBXA 3C3PA 2K2WA 4R8VA 3AH8A 3OZIA 1ZUWA 3O26A 2JF0A 3LDHA 4PHCA 5IHPA 5C31A 4G5XA 4X7RA 2KM1A 5K3EA 1P9OA 1BH2A 4JXJA 4N39A 3VPAA 2YHIA 4D96A 3KYIB 1H8HA 1N8TA 1OH5A 4WCFB 3ZQ6A 1Y5RA 3UZUA 1T1SA 3CF0A 2Y76A 1PGNA 4W5WA 1KDOA 4BUCA 1PS8A 3GJTA 4Z6KA 2H18A 3GP5A 1RW4A 5AW5A 3Q0TA 4FONA 3VPDA 1E6CA 2P6RA 2NACA 4H1TA 2C2WA 3RLIA 4JOSA 5KDDA 4UUMA 1JSCA 5EINA 5JMPA 1USUA 4OK6A 4TRJA 3RASA 1BGWA 2PUHA 4MTCA 1TU3A 3HABA 1O96B 3PD7A 5LBIA 2EZ9A 2XQJA 2RARA 2D3WA 4CYMA 5JD5A 3VDQA 1GRRA 1EGHA 1G2IA 2AJBA 3MERA 4GLBA 5TB5A 1QHHA 2VATA 4JLAA 5CGZA 3IA2A 4AF7A 2GO7A 5LQNA 4LNUB 1HFEL 3V7UA 1TUBB 3WQQA 4AJ2A 1E1MA 4FNMA 1OWMA 3W8NA 4EG3A 3KK0A 5BPHA 5L3RA 4UVHA 3CKYA 5J1SB 3R0JA 1LDMA 3OKPA 2C0CA 3GAAA 2OCGA 1E69A 5JVDB 5F64A 3A06A 4EOGA 2X4IA 2HIGA 1XWWA 3DVAA 5DN6A 5EXXA 1RHUA 2Q7OE 1B42A 3CY6A 4FE7A 3UGTA 2AIRA 2OZKA 4G0PA 1W59A 3E4DA 2ACKA 2BGIA 2BKUA 2OECA 1T35A 2ACVA 2OGTA 2ZI7A 3PDHA 3QEJA 4XPZA 5ICFA 3R77A 2MMCA 4QL3A 1WA5A 3I3OA 4WK6A 2COKA 1IN8A 2LV8A 5A4FS 3O8QB 4MW0A 3RUHA 1XEXA 2D1YA 4A2WA 1SIWA 4RAOA 4EHJA 3W04A 1VQ1A 4BRZA 4D3DA 1E8MA 3JQ7A 1UL1X 2B6HA 2IZ1A 4RZQA 4KRGA 2AOUB 2AG0A 2FMFA 3P9RA 4CDMA 2YJ6A 3EE6A 2ES4A 3KPVA 3LY5A 5EXEA 1EXVA 4BB5A 1K97A 1C9KA 4BFXA 5LB4A 1X8LA 2VQ3A 4C89A 1JDSA 3ZE9A 4QZVA 4HFNA 5JECA 1YB5A 3AY0A 1Q7RA 4UHKA 4KL8S 2GXSA 5AI0A 5TGDA 3UANA 4OHWA 5KMGB 1G20B 1NT2A 1WV0A 3C4JA 4NYIR 4QVGA 2BE7A 4HDNB 4GMFA 3ENZA 6NULA 3D1JA 3DE2X 4DUPA 3C3CA 1IEVA 2GA8A 2MJLA 3RVPA 4ZYZA 1KOGA 2HO4A 2QMOA 3THRA 1R5NA 5FAKA 5HXAA 1Y6FA 1IYZA 1G8MA 1OWLA 3BRQA 1SU8A 2B82A 2IU0A 3UFXB 1P91A 2NUBA 3ADDA 1BJRE 4JJIA 1QFSA 2PYZA 2UYYA 3FTNA 3OOYA 4R8MA 4N6GA 3QNWA 4K8RB 1L4UA 4ETNA 3H83A 4R7GA 2FFHA 2EDAA 1RLUA 2PZJA 1C3JA 3M4XA 4BFYA 5FB3A 4BQEA 4OGGA 5D3ZA 3SEAA 2OZVA 3K09A 2BM8A 1YULA 4RETA 3UUWA 1TM4E 4EYGA 3AHIA 3EQ9A 1U8FO 2B34A 3PUXA 1JQKA 3COSA 4YCNA 5EJ4A 3ZDAA 4ZRNA 2AD5A 4W5HA 4PONA 1SH7A 4IV8A 4OREX 5J4LA 3PFWO 5K0CA 2C78A 1PIWA 3UJPA 1XNGA 3CF2A 1Z3CA 3FVTA 4RZXA 3F6YA 1NN0A 3RF6A 2D06A 1DKNA 1G17A 1PJRA 3K72B 3LVRE 4IZ6A 4XUEA 4QT4A 1JKFA 5KHAA 3EPLA 3OCVA 1HZZC 4REMA 1AKTA 3DOCA 4ND4A 3VVCA 4YHBA 4URUR 3R5TA 1TAQA 2WDZA 1OYWA 2ZJ8A 1TL7C 4NFLA 2P9TA 1X0VA 3GO4A 1W85B 2AZMA 3NBFA 1Y9AA 1H1LA 2XUZA 4L28A 1ECBA 3BVPA 5H16A 3N2GA 3I4CA 4RD0A 2ZT5A 2MCFA 4TX1A 4RK7A 4XEHA 2XOXA 4FILA 3VVBA 4D0LB 1JLRA 3H5RA 2JAQA 1HG1A 1KZHA 1OU0A 4MP6A 3SP1A 3GJXC 3SZGA 4E13A 1TF2A 2DP4E 3NO4A 1N1GA 3B52X 3I8SA 3EWNA 3D6MA 4JROA 1UEXC 1E6KA 1EWKA 5EFZA 1RBYA 5JSHA 2DPGA 1IZ7A 3HU1A 1PL7A 2AR7A 1CV2A 1NU8A 5I7EA 5EE9A 1JDTA 2ZUBA 4QXOA 4XGIA 4GKVA 3RVJA 4CHGA 1R66A 1QF7A 2QTWB 3VBCA 1X0XA 4DLXA 2PS3A 1PE0A 1UK8A 4JVOA 2QSYA 4PQGA 3AX6A 4R9NA 3TIGA 1OT3A 2VN8A 4GGMX 1E2JA 4DV7B 3P0IA 4B6JA 2ZE5A 4WZBE 1FVHA 3AHFA 2WWWA 3PQEA 1QQBA 4N5MA 4JNKA 2JGFA 4A03A 1U9CA 3V6MA 4BEJA 4F21A 4XQEA 1IWBB 3BL5A 3KBBA 4DCVA 1D0VA 1NATA 1A69A 4PG4A 1I5EA 4KMOA 2MSDB 3GA7A 2HK9A 3C5EA 3NC1C 4CV0A 1YJXA 2QRZA 2QT9A 3U7RA 1EX6A 2QGNA 4C1BA 4E1AA 3BH7A 5HFJA 3WHPA 1FBTA 4G89A 1GKLA 3HJUA 4FMCF 4DUGD 1MQSA 4ZZ2A 1OW3B 3HMKA 2PR2A 2G0TA 2ZM5A 4KRFA 4P0PB 1DC7A 2DTXA 2ZUWA 3MINA 1OLXA 1DC8A 4G1CA 4B3IA 4BUJA 1V8ZA 3OPMA 4RFVA 1XDBA 2H65A 3T3IA 5U9CA 4LRWA 2PY6A 2ODWA 2VHTA 3QHAA 1D0IA 2RAPA 3V4FA 1I4WA 3ZWKA 3FDJA 3KB8A 1QG2A 4O4LF 1EP9A 1NZJA 3JWPA 4JUIA 4KN5A 3L8FA 1R0KA 4Z99A 3UMRA 3VC3A 3VI4B 4EO4A 4C5AA 1BVYF 2WF6A 4I8XA 4MW2A 4GP6A 4U0JA 1OAOA 4RC9A 2OBMA 5FOTA 5JZ9A 1V9CA 4D43A 3FPCA 3A14A 2MIIA 5J40A 2IT1A 4D4LA 3K4PA 3OPXA 4DWJA 1VRCA 1SKBA 1MENA 2A9RA 4B3SB 3AG6A 2WFZA 1YSCA 3JQQA 5DM70 4K9DA 6YASA 3OA0A 2MDTA 4J6FA 1GV0A 3GFOA 1G8AA 2XITA 1CJMA 4PX2A 4Y2YA 5J63A 5GZ1A 5F2EA 1E2NA 3C1OA 5DXFA 1HFKA 2Y0BA 2J0SA 3ETCA 1WHSA 1OWPA 1WW3A 4JUDX 3I0MA 1L5MA 4WECA 3ICQB 3CX7A 5HTOA 1OVMA 1TVKB 4AUNA 3TRDA 3SZLA 1DBSA 2OSBA 3QWBA 2CNKA 3U4GA 4RK0A 3V9AA 3JWGA 3MT8A 1ZRHA 2CB9A 3DGEC 3HFGA 4B80A 3IVMA 4OMDA 5MGNA 2IXBA 3VU9A 2W2TA 4NS4A 3WGOA 4AJ9A 2B8NA 2OK7A 4IIUA 4IDEA 3TM5A 2AK3A 2VSNA 3V8EA 4HI0E 1BJTA 1RJ9A 1TJYA 3R3ZA 4X1KA 3W5AA 4BATA 3LHSA 5EQJB 3Q3IA 1XRPA 1AD2A 1XVLA 2FETA 2GXQA 2JH9A 1T13A 2QTAA 2WU1A 3AL3A 2G5PA 3R41A 3ZY4A 5AVUA 4QQ8A 4HB3A 1IJKA 1MF7A 4GM0A 1C3XA 4P53A 4AYWA 1QAOA 3D8SA 1X1CA 3MJRA 1EVKA 3C6YA 1X38A 3PQFA 2UUPA 4JT9A 5IT0A 1QXSA 3U19A 1BYIA 4KVGA 2J4FA 4BV8A 2HX1A 3LKVA 4MS3A 4RNDB 4YASA 4E1VA 3EEOA 4FCWA 5TJ9A 2H1WA 3H1BA 2XY4A 5BNFA 4P22A 3L1JA 5T4EA 3GG9A 4PFJA 2WM2A 2JLQA 1ZCAA 1I24A 1N34B 3EQ8A 4K26A 4CIXA 4MRMA 4UBMA 4XSHA 1UBLS 3MXOA 3ZHZA 4AX8A 4CF7A 2PA3A 2BFDB 3DFKA 5EMHA 3AM5A 4NZZA 4D6XA 1WZUA 3EA0A 4BPRA 1BU8A 1T3LA 1E1KA 4WJKB 1PW7A 5G3YA 5EIBC 3ZLTA 1JU4A 1DO0A 2PQ0A 2W98A 1XZMA 5CT8A 1QYDA 3CLUC 1WXXA 4TWZA 3V4ZA 1MX3A 4XWGA 2Q3EA 4DIBA 2IRWA 5ER9A 4NYJQ 1VXOA 4Q93A 1S5PA 3L05A 2CXTA 5EYPA 3HLTA 2ZYSA 3GT0A 3C7AA 1W0JA 4GZ5A 4QU9A 2JBAB 2QTNA 2QN8A 4IDGA 4MVXA 3ZV6A 4C3ZA 3DZ8A 1TO6A 4EATA 3FHOA 1Z9BA 2PMBA 1A9XB 4BAZA 4BAGA 3IOCA 1LJLA 1NP6A 3P9XA 5DP2A 3TK1A 3U7HB 3OF5A 3ZWDA 1NVMB 3LO5A 3S27A 5T5QA 3HXPA 4JX9A 1RP1A 1N2OA 1UFRA 3KIPA 2RHDA 2ZXFA 3MD9A 3O4GA 2OHGA 4M1WA 5BVHB 5HCIA 3I9NA 4IUCS 3H5TA 1YZYA 3EF0A 2BTQA 4KG7A 4N03A 1JZQA 2D0IA 2AN1A 2OXFA 3E0QA 1VI6A 2OQVA 2O23A 4Z4QA 3ANTA 1FFDA 4PG5A 3RVLA 4DHEA 2J3EA 4OHPA 4X9XA 1ZWKA 1I4OA 1FBNA 2SCUB 3Q7SA 3DBRB 2P6NA 1JU3A 3SC2B 4ZYWA 5I4CA 3MTAA 4FC7A 1DEOA 2NP7A 3G0CA 2BFBB 5IBCA 1RM4A 3I5AA 1X7WA 3NUQA 4HUJA 4TXHA 4EX7A 5KPJA 1NZDA 3WYFA 3TE6A 3EK2A 1MPTA 2QW0X 4AQ7A 2FKNA 3K9FC 3JW8A 2MSLA 1XGKA 4QUEA 4XGKA 4EGSA 4FUTA 4PW0A 3TB4A 1K92A 2H4YA 1UMDA 1Q57A 1Y3IA 2GQ0A 3ZHYA 4G1EB 4R2HA 2PDAA 3QMVA 4C7KA 4WRRA 1X94A 1L7NA 5K51A 3RBZA 1SBHA 2HO5A 5F5LA 2ZJ6A 3T41A 3V5NA 3IO5A 2Q5QA 3JVVA 4O1MA 4WZBA 4M98A 5C1PA 4TYQA 3H1EA 4HRVA 2F8MA 1CVLA 2GCIA 3E3MA 3M3HA 2DWUA 4A0HA 2RGCA 1HYBA 2VDWB 2WKQA 3FGOA 1HT0A 1IQRA 3NRJA 4NTZA 4TKLA 4AZVA 1NP7A 3C3KA 3NH9A 5IWAB 1W9HA 3EXHA 3CE9A 3WHLA 1P6XA 3RTCA 1E5DA 2XYQA 2IU6A 2ZB4A 3VPFA 1ND5A 1ZPDA 3U3RA 2H08A 2O7SA 2GHRA 3GRKA 1SUFA 1Z7GA 2CKMA 2ZIVB 3C48A 2HCRA 3U9SA 2R4TA 1ZSYA 4HATA 1J2TA 1PQ4A 4TT3D 3I05A 5CFOA 2EV9A 2V3VA 3D31A 1UBNA 4O08A 4LXGA 2Q5JA 4V03A 4FSXA 4N7BA 4LXQA 1DFHA 1NN5A 4PTYA 2BLLA 1P5FA 4EY5A 1IZZA 1MW9X 2GCPA 4NCJA 4PPYA 3ZXSA 5IVKA 2AG1A 1MB9A 2NSDA 2BSAA 2G04A 1Z5WA 2ZG6A 3O4RA 1YR7A 1KS9A 5CB6A 1LSUA 2AR9A 2I8AA 1Z28A 1LZKA 4KMSA 5CA0A 3C8DA 2J33A 1AXGA 1F2UA 2D4AA 3AK4A 1MAHA 3ENWA 4NPAA 1ODJA 2GEUA 5G3ZA 4AJNA 4NOKA 3ND9A 2V7BA 1AE1A 2HF8A 4WEQA 3WMFA 2BAGA 1ZUNA 2IHJA 3HWSA 4C21A 5EZSA 2IYOA 4UXJA 4EX6A 2RBEA 2WJIA 3G8AA 2D2EA 5AT1A 4YFVA 1AJEA 4RLFA 3FOZA 2ZE7A 4MMXB 4L85A 1F8UA 1C1DA 3JS5A 1ZNZA 2QJOA 2X9NA 1GR0A 2HRRA 1JALA 4JCCA 3W2TA 4WN9B 2I91A 4RY8A 1GTSA 1L4LA 3QZUA 3PS9A 2I2FA 2Q7XA 3CN7A 5TQ2B 2EYUA 3SKYA 4IFTA 1I2BA 1TQDA 2FWIA 1EAYA 1G64A 1PVDA 3GY0A 2I4OA 3IUSA 2XGJA 2YY6A 1XLVA 1Z62A 4EI9A 4GWGA 1IM5A 3N7UA 1LS1A 1P9WA 2VF8A 3QUSA 1H2RS 2A30A 1K2VN 2O3JA 2O2JA 1AMOA 1SXQA 4DIKA 5FWXB 4JJGA 4NZPA 3WX0A 4MZDA 3HUTA 4P3PA 1HDIA 3KQMA 4HWKA 1D03A 4IIDA 4LRQA 3HXMA 3TOSA 2BELA 1NFFA 2BKEA 2P9QA 1MX5A 2VJYA 4I9UA 4PO1A 4Y1FA 3F8TA 3SLRA 1XJWA 4S1OA 1J2JA 3KOYA 2ZR7A 3AI2A 1XQVA 2FJUA 2TS1A 2YQ4A 4ZPXA 4IO0A 5TX7A 2MYPA 2C2GA 2EKZA 3I39X 4MRNA 3RFUA 3JD1A 3W90A 2BZ1A 5JT1A 2ZBRA 2XDYA 1F9EA 1ISRA 1W34A 4MUGA 4W5OA 4H7KA 2O8BA 1YUMA 1B0UA 4YRPA 1ZJ5A 4IX1A 2IDMA 2IEGA 2Q5HA 3DF9A 5H4GA 4C0LA 4Y67A 2GHIA 5CVDA 3RM3A 4EYEA 1H8HD 1H93A 2JH8A 1K6IA 1JHZA 4NDNE 4HGZA 2X19A 3AFNA 3FYTA 3NBKA 4P7GA 4JC5A 5D87A 1XP5A 5LLSA 1XVUA 1MVOA 1QO9A 3IILA 3RDPA 2CC2A 1QLWA 1G9XA 1V4NA 1E98A 1XTPA 4PAOA 4RVDA 4IY1A 4QHYA 1LBSA 3LUBA 1Z74A 2WTNA 5CFLA 3GZNA 1BEEA 4OXQA 4OHFA 5LA6A 2OKCA 3DO6A 3FAZA 4F5WA 2PYDA 2AHOA 4PNPA 2FZKA 1X39A 4RHEA 3FIUA 2XXJA 3TEJA 4PLZA 4AY2A 1Z6PA 4JLKA 1L7AA 1SCUA 2R1VA 4FKBA 1XFDA 4B47A 2A94A 2Q1SA 5HE9A 1J33A 1Q0ZA 2V97A 1N0WA 2OBLA 1QYRA 4AYTA 1TA0A 3BMOA 5CX1B 4MDFA 2PV0A 2VDKB 3ME5A 5EZ5A 3DMHA 1EB9A 1FMCA 1S1MA 3QLUA 4K2HA 1USVA 1X8JA 2FW8A 3GLVA 3NI2A 4WZ6A 2UVPA 2OYRA 4Z3DA 5HM8A 3LSTA 3WLEA 2OAEA 3NHKA 5HRAA 5DBOA 5ICEA 1AQJA 1DNPA 4Q1FA 2A0WA 1E5LA 1PLKA 2MOKA 2ZJ1A 4U2FA 4R41A 1H2WA 1ZJZA 4YRAA 1S9HA 3RLFA 1T15A 2P9BA 2PBLA 1YI0A 3RS7A 5JAIA 1QGUA 4DLPA 4DDVA 4BLTA 1GY8A 4ONEA 5EOVA 2VZ9A 1IXSB 3AMVA 2JIOA 4NRDA 1J0XO 1VFPA 4IIHA 1TQ8A 3AI3A 5TSDA 3WFIA 5IT9A 3FWNA 1B2RA 3LRTA 1ZOOA 1SOAA 2YXPX 3DUFA 4MJLA 4UVIA 2DTEA 2G72A 4YUZA 1C30B 1KJYA 2GX6A 2J9YB 2JVIA 4R81A 2FLWA 1QHHB 3DT9A 3P2EA 1T5IA 1OJLA 1HTWA 5IX8A 4IDPA 1G2OA 4WTOA 1I7SB 4WXRA 2RAFA 2B7LA 2XUGA 5AVYA 4R1PA 3JXEA 5BQPA 1BEZA 3O7WA 2ZS7A 3HUUA 4IIBA 2CD7A 4WPGA 1GGKA 2GN2A 3G17A 3LH5A 5EWLB 3GV0A 3GJ7A 3LNTA 3C3AA 5KDLA 4BQQA 3DVAB 1A1VA 2YWRA 4C3VA 5DTEA 2ZE8A 3MF4A 3MUOA 2JFOA 2G67A 4KHPB 3OLVA 1Y1KE 3N53A 3SFZA 4EITA 3LOPA 3AV3A 5FLEX 2QVYX 3AERB 3GK3A 2GAJA 4NF2A 4ZKDA 4YO8A 2FZWA 2NV0A 4KAJA 3SIRA 1KJNA 3FCCA 1T9KA 2DCUA 2NYVA 3FFTA 3KUUA 1XEXB 3CF4A 4ZODA 2GZMA 4RYLA 2Q2VA 4MA5A 2WIJA 3TIFA 3SZ3A 3TI7A 3DOIA 3JQ7B 2AK2A 5CXXA 1JDZA 4UTVA 3UMMA 5J2TA 3RFXA 4BYGA 1XPJA 3L43A 2WIBA 4H6WA 2NUAA 1XUOA 4ZALA 2O54A 5EEGA 1T3HA 1IEXA 2VDUE 3LI2A 5HQTA 3AXTA 2CMGA 2OY0A 1RIFA 4DQ0A 1WEHA 5IM5A 4G0QA 5E4JA 5HWSA 3AJAA 3N05A 1J99A 4OSOA 4RUKA 4EQZA 5AW3A 1MO6A 3O74A 3GLFB 4HMQA 4AU1A 3FMIA 4MRAA 1UPAA 1TOAA 1Z0JA 4TMYA 3KXLA 3WGQA 2GAOA 2FW6A 2O2GA 3BK7A 1F4VA 4R01A 1LBHA 4ZAYA 3H0EA 3ZHOA 3CVJA 4HAZA 3VX4A 1J9EA 2I65A 3TD9A 1CZLA 4QPNA 3NT2A 4DZZA 4QJ5A 4AKIA 2QGFA 4CM4A 4BHTA 3KE9A 1TW2A 1NNI1 4CG3A 3B1ZA 1G3UA 3W3AH 1ZINA 1ZD2P 2VOJA 1NBHA 2IP1A 4QG7A 1JTFA 3TECE 1GL3A 2HT6A 1R8XA 4PAQA 3P20A 5F5NA 4ZQEA 5HS4A 4PSKA 3RARA 1O0SA 1VL1A 2I3BA 4ZVMA 1XTTA 2PS1A 2XE6A 3AP3A 2G9NA 3TKAA 4XTRA 2V6IA 1NKTA 2OA0A 1ODIA 3QF4B 2Q50A 5FCDA 3QYJA 2QTTA 2R48A 3PQ4A 4JENA 521PA 4JLBA 3TTSA 4D7AA 4MQ5A 4GU5A 3EJ6A 5JXJA 4N7RA 2E87A 5LYJB 1DJNA 1Y89A 2P5UA 5GGXA 3TINA 4YRIA 3WE7A 4NE2A 4BQSA 5FUYA 2AMVA 1DOAA 2CFIA 3RSFA 4D3YA 4YT4A 3VNUA 3ZHQA 2RH8A 3S7TA 3FNHA 2QLJA 4DMUB 1JEYA 3HJNA 2X8JB 3BF7A 3GPCA 1I7NA 4FCCA 4J8PA 2CLCX 2PWPA 3ZHVA 3K92A 4Q01A 5CR9A 3M1AA 2PZLA 1NI3A 2E4VA 3MC1A 3MCZA 2ZCJA 1C0KA 2OORC 1SQ6A 2GNOA 3N2GB 5FX2A 2WTUA 1P2DA 3TW8A 4S3MA 3WB0A 3RVRA 1L8LA 1OI7A 4MCAA 1PJ8A 3V8MA 4K1LA 4YGXB 4HWPA 3JQ8B 4QREA 1JG4A 3THSA 1N6IA 2GTIA 3F0TA 4HADA 5E6RA 3OZTA 2AN3A 2WPNA 1WU7A 2WTBA 2FPIB 3NFYA 4FP9A 4X3PA 2QZJA 3GPDG 3VNSA 1XA4A 4JDUA 1C3OB 1JMVA 2KLBA 2DWOA 5TIIA 3IJPA 1L7XA 5IAEA 1QP0A 2GJKA 2ORIA 2DRIA 4PYRA 2ZBUA 4RGBA 3WL8A 1SD2A 3AKYA 3FYUA 3GRPA 2R5FA 3WKAA 1J8YF 3PVZA 5C18A 1HM5A 1XRQA 1M2EA 1TK9A 2XADA 3BDIA 5IZCC 2HFJA 2Q41A 3ITDA 3OP4A 4YJDA 3PSHA 2BEJA 3D54D 3SFVA 1Z0IA 1SVNA 1D7AA 1UKEA 1PUJA 2QMEA 4JHLA 2RGGA 2Q6OA 4GR4A 4AD8A 2EW8A 5EMNA 2O0HA 3RFVA 1DIOB 1QK3A 5TEWA 4G5YA 2ZRFA 2PRIA 1XXHB 1AM4D 1KJ8A 5IUKC 1UF9A 3FCSB 4U5XA 1W7AA 1ZNQO 1SCQA 1Z8NA 4XSGA 3N6RA 1E7SA 4TXJA 1E1DA 1WCWA 3I6BA 1GRQA 1HMYA 4FNOA 4XIFA 4YH1A 3OMWA 5T8KA 5BNIA 3TEFA 2EQ5A 3MLAA 1B26A 2QTVA 1AK2A 1O2DA 5CNJA 4FHCA 2FN3A 1U63A 1PL0A 3Q7IA 5E3JA 5GV8A 3NDBB 3AJ9A 1UODA 2VZLA 4B43A 1SHLA 3ESAA 4PS1A 3ZHBA 1M6NA 1QKKA 1JDBB 1H2FA 4R2LA 2NU9A 2W2VA 3HDHA 4GXRA 4HJXA 4BRUA 2WQZA 3P27A 4WESA 4CETA 5GTDA 4PICA 5IBQA 1N7HA 3GZJA 2O48X 3LW8A 3SYLA 2JKYA 3J81A 4TLBA 3R8FA 2CMKA 3MTGA 1ANKA 1W0CA 4DUZB 1JSXA 2XDAA 4BJHB 1KFKB 1L7BA 3LCRA 3WIEA 3OEEA 1C4WA 1PV4A 1T9ZA 3U3JA 4LWPA 4CT0A 3EXEA 1BE0A 2QLNA 4H7DA 1GEGA 1XWFA 3URMA 4F1KA 2ZCVA 4I1OA 4DQDA 8MHTA 3KLMX 1TK2A 3UWSA 3SBOA 1KEVA 3H5WA 3QPWA 4N5IX 4RL6A 2HNAA 4OGFA 5CVEA 1XN4A 2JZNA 1U2EA 1KWGA 4GXQA 3AVWA 1E1NA 2D0DA 1KQOA 3OE7A 2X7JA 4ALMA 1J7KA 5CB4F 2OZPA 1PLLA 1XZLA 5EFOA 5BXYA 2DX7A 1ZHHA 3GIWA 4J43A 2HWYA 1NBME 1Z7EA 4UASA 3SS8A 4C0JA 1TQHA 1ADFA 4CV1A 1TF5A 3F3MA 1NF9A 1QRUA 2Q5LA 4MUHA 4HQFA 4B3FX 4BNLA 5BT8A 2CUZA 3HZRA 3IEPA 4M83A 1AV7A 4MGZR 2F4NA 3BK2A 4BTEA 5KTNA 3HNOA 4Q7EA 1HORA 2Z56A 1X80B 4JB8A 2WKPA 3A3PA 3K9GA 4IH4A 1TDJA 3VV2A 3KKLA 3SYNA 2JB9A 2WJHA 1P5ZB 2J48A 3LPAA 4MQEB 5IN5A 4ZCLA 5TF0A 2BKAA 4JEHA 4UARA 4E6EA 3W1VA 1RJ9B 3FF1A 4EY3A 1R12A 3DE1X 1YR6A 4HGOA 4OCZA 2H3HA 4MQ4A 4TT8A 3TOXA 1PGQA 2GD0A 3CN9A 4PC6A 3NTRA 1OBCA 5ICMA 1OXTA 4L8YA 4GBJA 4NZYA 5DSXA 4XJXA 1S8OA 3D2BA 4LF8B 4A1OA 3I52A 2WC1A 2FOLA 3LP6A 4MUFA 1PN3A 4PHHA 3W9BA 3KQQA 2JK1A 2VDMB 3FE2A 4L73A 2D1QA 2P65A 5LQSA 4YUWA 4HNAA 1GLGA 4C6SA 1XMQB 3ICWA 3ZE1B 3EDYA 1R4MA 4D79A 4CTJA 2PWZA 3U44A 2VPPA 1KYIA 5HOQA 4YDHB 5JCOA 1FP1D 4J4BA 4XDGA 2EATA 3R3VA 3EQ6A 1K7XB 1LV7A 5ECYA 2E37A 5IC4A 1W0JD 4L0DA 2XMGA 3GFRA 5G1PA 4I5IA 5A2QA 1X7ZA 1UH5A 1V7QA 2VUSA 1DPGA 1SBCA 4CR7A 4DMCA 4NZOA 5F5XA 3B53X 4WBSA 3PDWA 2YNMA 1K8XB 3NIWA 5CLQA 4BIMA 5INTA 3MQ2A 3FA2A 5KSWB 1T2EA 2DULA 5CHYA 2GPTA 1TZMA 3SJCA 1CWUA 3FJYA 3KHTA 4FIDA 4IEEA 2F3UA 1U8UA 5KIAA 3GUYA 3CCCA 4I8IA 3ESRA 3SD7A 4Q5IA 3QLTA 3WNVA 2P3SA 4EI2A 4TZKA 1OBHA 2W6JD 2DYKA 5J5AA 1IZYA 2ZK7A 1AVTA 1G6Q1 2YHSA 5E8JA 4KAXA 3WDLA 3N2KB 4HDRA 3WLLA 3K9WA 4L9WA 3UB2A 4UM9B 3RV3A 1VKOA 4J03A 4MVJF 1OXMA 3IPCA 4CW7A 4LIPD 4LMBA 2A0XA 2NVWA 2H52A 2H1VA 5BSEA 1NI5A 1Y63A 1FDOA 2WHXA 1BA2A 3HXLA 3BGSA 3OE1A 5CCXA 3RQSA 4EHHA 3PG5A 2PT5A 5F9FA 1Y5MA 3VI3B 3SMVA 1OJ7A 4MCJA 3WWOA 2C9YA 2FOXA 1P9LA 3I9MA 3OEWA 1E59A 3W2GA 2RK4A 1C1YA 3L04A 3FN4A 4NABA 4Z4IA 4LJYA 3B5EA 3SU8A 2HEGA 2JGEA 2W6MA 5FR1A 1JA0A 1RYYA 1KU0A 2XKJE 3S0JA 3IDZA 4EY7A 3FHTA 1T8PA 3LHIA 4X5OA 3LY8A 1KSGA 3TNFA 1QIKA 1DFGA 5ALGA 2DLNA 2O57A 3HUFA 3DL2A 5LZ5A 2PRKA 1UOQA 4L76A 3GGPA 2A3RA 4AJJA 2HL6A 5EWMA 1Y5LA 5AI6A 1DZ3A 1LK7A 1IVSA 3AHJA 2I4IA 1M1YA 2OENG 1O03A 4MWGA 1E2PA 3LQFA 4YP5A 5DMXA 4CUJA 2IS1A 2BFCA 3T5CA 3AHEA 1QH1A 3DAPA 5EPOA 1XZGA 2VPZA 3ESXA 3KQWA 4GWKA 4KUEA 3REFA 1X7WB 3RH0A 4X91A 4CR8A 2DR0A 2OCBA 4NBUA 4PSCA 4Q34A 4M0UA 2ZPTX 3KFXA 3OLQA 3NEJA 3PBKA 2ZDHA 1YFLA 5THQA 3O92A 1T8SA 4OJTA 3CVOA 2E49A 4RKFA 4RVGA 4C2BA 2UZ0A 4QM6A 5LP6C 2G4LA 3N87A 4J1TC 1J06A 1CKEA 2VWHA 3ZDBA 3E82A 1SQFA 5HG0A 1DWUA 1KZYC 4GBGA 5C2JB 1VJ1A 5AIAA 1ODSA 5ADUS 1XU9A 2GZ1A 5JS1A 4K88A 4AJ4A 3IPRA 4C7JA 4JEMA 3B9RA 2R8OA 3M0EA 4PNHA 1E6LA 2PD3A 4S1WA 2PLFA 4WADA 4WZBB 3ZI7A 4MDEA 1NONA 2IE0A 1A7JA 3JWIA 4PEVA 5IDQA 1R9NA 2C7RA 4H1VA 1FRNA 3LHDA 3V8RA 2EZ8A 1WL8A 4PSUA 4RFSB 4EJMA 4QTTB 1WMEA 2CJYA 2ZYTX 3AY3A 2XNHA 3G2NA 3EXHB 1MEEA 1EGAA 3I6ZA 5JNWA 1CQJB 1EUDA 3AETB 2DEUA 3MGGA 4REQB 4F91B 3LD9A 3PTLA 3UF0A 4LJSA 1B0AA 2CF6A 2JAOA 1G3QA 3I34X 3NHYA 4ARSA 2ZTLA 3HVUA 3WK7A 1NLYA 2QN3A 3HDTA 4YRLA 3RO7A 6GPBA 3F4BA 1KZGB 2BMAA 1GZ7A 3HB0A 4G9EA 4TS9A 3QWAA 3K9HA 1RWKA 4BMXA 1VGRA 1JUDA 3AOEA 4JEIA 2HZ7A 5J9FA 3ZLUA 3IQIX 4BNMA 4IDNA 1AHHA 3LF1A 1UPFA 3DWFA 3RVQA 1FS5A 4INZA 4QKQA 1F8XA 4KBFA 4XI9A 1Q12A 1RHJA 2W58A 4MS4A 5CA0B 5IULC 3NCHA 1J4AA 3VMMA 1QX3A 4E1BA 2YWFA 3IIJA 2Y6VA 2OQIA 4ENRA 3PX3A 4A9AA 5F1PA 4TYWA 5LP6F 4LHXA 2HCJB 1MIOB 1HFWA 1XB2A 3RU7A 4P6VF 1MQAA 3H3XA 3SXUB 2W83A 1J2EA 1YS4A 3BWVA 4ZQBA 3PXGA 1KMIY 1W1UA 5JANA 5C7OO 3IV7A 4NCNA 2DY1A 2AMYA 2I6QA 1QONA 2HMYB 2QRLA 2DMRA 3CZPA 3KSUA 4GEKA 4N47A 2XMDA 3RUDA 5CFMA 1W8IA 4M8NE 2XV1A 1CCWA 3WZ2A 1R2QA 1HA3A 1DT5A 4LVCA 2XGGA 2F1KA 2G8NA 3ROXA 1YIDA 2CEKA 1SQGA 1NYTA 4WUVA 4HY3A 3X1DA 2YX1A 3C6ZA 5KNCH 2WU3A 2LCIA 1L5GB 4DARA 6REQA 4P5EA 3QE2A 5EUQB 1SD1A 2AEFA 2HY7A 2OHXA 1SRQA 1H23A 4KXMA 4QOEA 5IYZA 1X7DA 3DJYA 2JW5A 3SEZA 3NJ4A 5I51A 1SKQA 1UAGA 5LXTF 1L8AA 3NALA 4LZPA 5C8YA 3RYIB 3T7IA 4EKNB 4Y9TA 4EG1A 2Q3JA 1KVSA 1SZJG 3LRXA 2X3FA 3WGGA 1GKYA 1P19A 2WAYA 4YV7A 2XA1A 1J23A 2R11A 2IHYA 2O0LA 4BV9A 1A4RA 1FNDA 4TQUS 1C5KA 5MGBA 3V7WA 2XSZA 4EF5A 3LWBA 4DFDA 4UZSA 1HDOA 5C1BA 2H9AA 1A4XA 4JJZA 3VR5H 3K5PA 4DA0A 1P17A 4K2AA 1HI9A 4CM9A 1R0WA 1UPUA 2VXCA 4R1NA 3HL4A 4RIFA 1QZZA 2O8BB 4N5HX 3TPZA 1MABA 4DWVA 2O8DB 1CUJA 1J2YA 1Y4UA 4UUOA 4I6EA 2E6UX 1K6EA 5FV4A 4KAFA 5IC6A 1GZ3A 4X71A 4I9FA 3T5DA 4QXQA 4B7AA 5IABA 1FTNA 1K9SA 2ZSUA 4YXWD 2P40A 4M1KA 2PZGA 2WJJA 3D4PA 5CM2Z 1EFPA 4JI4B 1RQ2A 5HFAA 4GT1A 5ALQA 2PH1A 2VHQA 4ISCA 4GX5A 2OCKA 4X00A 2VRNA 3Q8WA 4WKPA 3GR6A 2GBCA 4DKXA 1O0BA 4IUBS 2VDRB 5CU7A 1YV9A 1FXSA 4LQDA 3ROQA 4J0DA 3K8YA 1Q74A 4IUDS 4B40A 1JKMA 2HJHA 2Y1XA 3RS8A 2QROA 3J81k 5IF3A 1KMHA 2YJNA 3F5MA 3O31A 4KVZA 4UBOA 1DC6A 2FMHA 2WOOA 2GH1A 5JEDA 5T6MA 4I1PA 1DKOA 5HCUA 5E9WA 3GXOA 2XHZA 3H42B 4L9AA 4XWKA 5ES4B 5AXAA 4IRXA 1EDBA 1X92A 4JJAA 2H9YA 3SCZA 2C0QA 2CBZA 2CFOA 2UVPB 4IV5A 4M0CA 2JI6A 5IXSA 2NU7B 3T1OA 3S2YA 3WO1A 4BWFB 3WLQA 2PFKA 3IHTA 3ILXA 4ID9A 3S3TA 4EW6A 5HSGA 3QBDA 5T64A 2ZBGA 1CJCA 2HUPA 3RSQA 5D2CA 1I33A 2IS4A 1QK4A 2YWDA 2VAPA 1JSZA 1M6EX 2QSZA 4UDXX 1QGUB 4NAVA 2DOKA 3V3KA 1JH9A 3F67A 3IP8A 1ZK4A 3UMFA 5F7JA 1A98A 4BN0A 3AVPA 3ZU5A 3A1DA 1EQAA 4P81A 1GZDA 3IQHX 3DUFB 2BMFA 2DFVA 5D00A 2ZQYA 1XE3A 2EBFX 3HGMA 5CT6A 3GWGA 2XT6A 3HXOA 5H3HA 3EZ7A 1QIDA 2BGRA 3BREA 1RJEA 4JAVC 5ALYA 3UV6A 4LI3X 5HVNA 5ALSA 1YJQA 2VBFA 3R7LA 1K8ZB 3HDGA 3A2LA 3CUSA 4KSCA 4RJLA 5FO1A 2O8EA 1HLPA 5EY5B 5BYKA 3BQMB 1FQKA 3ZV7A 1XWIA 3FW1A 2PZKA 1P31A 3AIMA 2UUBB 2Z1NA 3HY6A 2HWXA 1UR5A 2AJCA 2Q46A 3GNSA 1UC8A 1VG9B 1TYDE 5DV9A 2FE1A 1CQWA 3ZDEA 4RTLA 1H5QA 1ZGHA 4JI2B 2ZAYA 4RPGA 4PHTA 5E4FA 3ZY2A 3EXIA 1EYZA 3IVRA 2XRFA 3PKIA 4ZEVA 4BRWA 4YPVA 3ILSA 4FR2A 2IFTA 1CR0A 3AOGA 3AF5A 4TKUB 3OQMA 1AOXA 1XN1A 2JGRA 4RHCA 4UE6A 4BWYA 2BDEA 4C76A 1EK6A 4B6RA 3COZA 3W3AA 3B5IA 4UE2A 5EESA 5AKEA 1DADA 4YXFA 2X0JA 3WXBA 2C4VA 1VLJA 5JIBA 3LXXA 2HLDA 3QLJA 4WD3A 3KQUA 4YMLA 4ZAVA 5J2TB 3CLTC 5C5IA 4YC7A 3G59A 3RIGA 2A67A 2EJWA 4ECEA 2NUAB 1G2PA 3N58A 3ONDA 1SC6A 4EIWA 2EL7A 2PT7A 1XQ6A 2UVDA 4LQ4A 3CUEF 2JVKA 3UPTA 5EJAA 4FSHA 1OWNA 3GA5A 5CLIA 3EDMA 1E6EA 4ENPA 1VGVA 4PRYA 5F7ZA 2WHPA 3IUJA 4W7IA 3UWDA 2CW5A 4CEJB 3BD6A 5HCNA 1E5VA 3KQSA 4MRPA 3IBCA 4ZK6A 1ISGA 2ID9A 2YOHA 3Q7QA 3VO2A 3RYHA 3ZX5A 4C6TA 2C03A 3KD2A 4D44A 3LUAA 1N2CA 1KFCB 2CHFA 2GGSA 3H2HA 2DHQA 1NV9A 5I01A 1R6VA 3QU4A 5LLDA 5DKFA 3P52A 1P2GA 4OHBA 4CM4B 2PKCA 4XVUA 4WASA 2Q21A 5AKGA 3H2SA 1IY1A 4GYWA 1A2OA 1T2VA 1Y1PA 3HBAA 1P61B 3STTA 4URWR 2WWHA 3TI9A 3ZZ0A 1J56A 2LW7A 1OQAA 4E7OA 1HDYA 2B6NA 3P2JA 1UQRA 4FBLA 3VZCA 1TTTA 1FU7A 3ZY6A 4DJFC 1U2RA 4HLCA 5A6SB 5I8WA 3F78A 3KVRA 3V4PB 1RRCA 5FPSA 1ISMA 1T5BA 4NG5A 1ZA1A 2WTAA 3OX4A 1U8ZA 4PS0A 4ZGBA 2NIPA 4OHCA 1KH2A 2J30A 3D5TA 4AL4A 4FDUA 4U63A 3QEMB 3GP8A 1Y6JA 2D0OB 4GYKA 3RUAA 1J21A 2FB9A 3LTEA 3RJMA 1PR1A 2GKOA 3INRA 1XRMA 2FV8A 4OX9Y 1L5QA 1JWLA 3SZUA 2Z4SA 3PI7A 4L9SA 4BNHA 1A88A 1EPUA 3JAKB 3UOWA 4UPDA 2IS6A 1C80A 1W52X 4A6EA 4KAAA 2IUSA 3G5LA 5EZ6B 3TW8B 2REQB 2D1RA 2NZJA 3B9QA 1EA7A 1YJCA 1X19A 4X7MA 5I45A 4WVLA 1KAHA 1VJDA 3DZCA 4MHSA 4TSFD 4UHHA 5JNLA 1HE8B 4HSGA 4CNQA 1HZZA 4RHFA 3PC3A 4NJEA 4U7GA 2XCUA 2MU1A 4B8YA 4JC8A 5E6RB 2VWQA 4LYDA 4BNKA 4P3XA 4LA4A 4RZIA 3SAJA 4PGFA 2R65A 3JAMA 1QR2A 4D97A 3NP7A 2CDNA 4FFBB 2XMBA 2IHUA 2ADMA 3VOBA 4UTPA 2GZSA 3U13A 2R1TB 4I2VA 5F3WB 4HLDA 2A1TS 4UJ5A 2FRVA 3GLHA 2OO7A 5IJ0A 3PHHA 2Q8QA 1GR1A 1TUIA 5ALJA 1PLJA 1DMRA 3T7SA 1IY9A 1MG0A 1H66A 1NT4A 1VJCA 2BBTA 1ZUHA 3PRJA 3TLKA 8AT1A 3TXXA 4XB6B 1KRWA 5AVKA 1LDNA 3AF4A 4O4LA 1L5HB 4PYJA 1TLFA 2P9JA 4GMGA 4MWEA 1A2KC 4R9UC 5LQRA 2RGNC 5DTIA 2ON6A 3WWPA 3PLRA 3U56A 3B6KA 1GG9A 2O2YA 4FYPA 4JLJA 4CMIA 4LJ6A 4HAWA 1V3QE 2PK3A 4N6OA 4OEHA 4IHJA 4D45A 3ANNA 3IR5A 3OEED 3CLSD 5DM4A 1YR2A 3LS2A 4KGVA 2ZLBA 4MLZA 2PQ2A 2PKQO 2PSDA 2HU8A 4F9EA 5LQAA 1IBLB 4CEIA 1A4UA 1JF8A 3C87A 5EIHA 1OD6A 2WB4A 2QVLA 4GSYA 3IIIA 3HCOA 2HK7A 3GLGE 1XAGA 4I9HA 4D3ZA 1T5TA 1B43A 3TRKA 1WB5A 3QVVA 3FPLA 4WESB 1YDFA 2QG4A 1YZFA 4GS5A 1FDWA 2X7HA 1W44A 4QUKA 4IINA 1TUGA 2FXVA 1VKHA 1Y3CE 1LTQA 2HHHB 5ALPA 1PKEA 4AO6A 3I64A 1JI3A 1DBWA 3SYMA 4OUKX 1NVVQ 1YS9A 3KZXA 1B3BA 4LRXA 5DW3A 1RABA 1QRTA 1DJOA 1DSSG 3DKVA 3DFUA 2I2XB 2IK8A 4MV4A 2PKEA 2Y2VA 2XWSA 3FB4A 2Q8PA 3ZGNA 1RYBA 1QOZA 1EVEA 2IYEA 5HZMA 1TW3A 4L74A 2VDNB 4PYQA 5JR3A 5DW0A 5A3RA 2JEYA 4NHEA 4QFDA 4WNAA 5AH0A 4EP1A 1F6BA 1SPBS 3BH0A 5CM8B 4MYSA 1VHJA 2H29A 4EG5A 2IGTA 4R8KA 2V5VA 3A1VA 1JPVA 4PO9A 4P4SA 1G8HA 2Q3MA 4CCWA 4LZWA 1NMXA 2YXEA 3HWX1 3ZWYA 4R84A 5HIAA 3T1TA 1GXSA 2ZTSA 1NX9A 3KALA 3CLVA 1SN7A 3SC6A 4MRSA 1HXHA 1XCGB 2ODBA 3KEOA 4O4JB 3DPUA 1WPRA 2R9VA 5DDIP 5FPQA 4DJTA 4X66B 1K9VF 3AV0B 1N0VC 3JVDA 4BLUA 4D8YA 4F86A 3NAQA 5DLPA 4CT5A 2JFYA 3KCQA 4N49A 4E09A 1SQ0A 1K5GA 2EP8A 3Q3JB 4LZOA 1EFLA 1GWNA 1W5EA 4KXLA 1CYDA 1ZU4A 3FRJA 2H4ZA 1I7DA 3ZWAA 1AO0A 1Z6QA 4PSAA 2WG2A 5JH7B 2HDWA 2VG8A 3CRRA 4J9VA 1A71A 1GPWB 3C1TA 3O9MA 1I2AA 3VDMA 3ZDYB 1OX4A 2RAVA 2IY9A 1L8XA 3L0CA 2WNSA 1MH9A 3PQ3A 4ZGWA 3ND5A 3TSZA 4DEXA 2VIIA 3WA7A 1KY2A 2HFKA 2J09A 5CYFA 2X6RA 3ST7A 4C5BA 4OP1A 4OM8A 2AFRA 4ZRDA 4M0PA 3F1LA 3P2OA 2GVZC 3W8RA 1A2QA 3MJDA 4P34A 2CLIB 4XYMA 2H2DA 4V0SA 3P9PA 4C0BA 1I01A 1V96A 2HLPA 5EA2A 4DTIA 5BN5A 4DV0B 4BGUA 4KQ9A 2DZDA 3LXMA 3EODA 3Q9SA 2F1OA 4H3HB 4K9RA 1YR9A 1SUCA 2OHOA 4C04A 2V1UA 2AH5A 2ZS9A 4HB0A 4XB2A 1I4DD 2I2WA 3IQXA 4HVLA 2F9LA 3HV2A 3L8YA 2Q3DA 3E9EA 3ENVA 3EPHA 3LX8A 4DG5A 2Q6VA 1NRJB 1GLNA 1YVRA 4HC4A 2NVUB 3R7AA 2AYYA 2QUIA 3M5CA 3PUWA 3Q1KA 1KY3A 3R6DA 4TRMA 5B2ZA 4HDRB 3R8CA 3OCXA 4MVJH 4BGDA 1CJKC 2EBWA 4C0SA 5KQSA 3GFTA 4LF6B 2J9FB 1IIBA 2Q6TA 4HB4A 3VDNB 2H4HA 3R8XA 5F9MA 3TQQA 4GGOA 3EH1A 1JIKA 1GG2A 3WTBA 4TSKA 4XM1A 4XFDA 5KU7A 3X1MA 4J3NA 2RHOA 2ROQA 1CE8B 3KAPA 3PDUA 3O3NB 1I8TA 3E15A 2F3QA 1GZ5A 1QUFA 3V4LA 5KYWA 3G89A 1QIMA 2XNKA 4ARIA 4PWZA 2A0YA 1U5CA 3QH4A 5C80A 1TT5A 3FPHA 3PFNA 3FIJA 3FNIA 2CXXA 3AEUB 3SR3A 3LT5A 3LY9A 1K3FA 3CZ4A 5EWMB 1ZQ1A 2FSVC 3O2SB 4G0NA 2Z8XA 3U39A 4FYJA 4TS4A 3R2JA 4H35A 1Q0HA 3N86A 5IFKA 3D8NA 2XUDA 4BN5A 3OT1A 1AS0A 5EIWA 3MQFA 3ZVLA 1UM9A 1DRKA 3QIAA 4YRDA 3JWEA 3FHJA 4BO7A 1QPGA 5JJ5A 2CF5A 3ZWOA 3G0IA 1Q84A 1M5RA 4ACAA 1FTWA 2J85A 1O77A 5EMKA 3DMFA 3Q7RA 4CLOA 5IAOA 4I3GA 4YALA 4GPTA 5TDHA 2NNWB 1JX6A 1L3BA 4LSZA 3VYTB 1Y5NA 4TWJA 4DR2B 2F1JA 4TUYF 1T8YA 4YIKA 1Z8HA 3RC3A 2WSLA 1T9HA 3ZHTA 4Z49A 2ODAA 4G97A 1GQRA 4FZRA 2F2TA 3A9RA 2AQKA 2B4KA 1LDGA 3HNPA 1E5QA 2Y66A 5BQ5A 1M0WA 3B1VA 3HEMA 3LU1A 1A4IA 2UDPA 3T5BA 3IFSA 5KHLB 4DEVA 5JD3A 1YVEI 2GBGA 3CFYA 3DNMA 2ABWA 4MHTA 1Q1BA 3PXEA 3PJEA 1JDPA 2CNDA 1NHGA 2D4HA 1BCSA 2R7AA 1W5BA 5ERYA 4BZZA 1L7QA 1GA1A 4MW9A 2YJGA 3FMPB 3M7IA 5HK9A 2RHTA 1NJ1A 2UZIR 2FY8A 3IV6A 4ZVNA 1P33A 2PM8A 3WICA 3GLGA 3GJZA 2GMWA 3HNRA 2VF2A 4UU8A 3SR0A 3KXDA 3STVA 2HWUA 3GDOA 1O89A 2JIBA 3ETHA 4I3FA 4UHFA 1NBMD 4U39A 3K0HA 4LDZA 1QV6A 3QKTA 4OQ4A 4UTOA 1VC2A 3U7QA 4MS4B 1ZBQA 1QTNA 2OG1A 3SK0A 3P2KA 2JDIA 1L5FA 4HNHA 1G9TA 1CQPA 4AXXA 3S7ZA 5ENDA 4XM2A 5F3RA 4V38A 4V1CB 1E58A 3H2YA 5D8DA 5DHTA 2FH5B 2WVGA 2CDBA 3CLRD 3LDGA 4EVRA 1HDCA 3PRYA 2E9SA 3PNSA 2FFQA 2X0FA 1VJ5A 3U7JA 1NSTA 1BKDR 4R98A 1L1RA 1PBTA 2ZZKA 2Z2JA 4N5DA 5C51B 4ROSA 1Z2NX 3VR5A 1V26A 3ITNA 2DCMA 1RMYA 4YDQA 1TAUA 3RVMA 1C7EA 2XYGA 3GFSA 5JQGB 1M8FA 4TPKA 3SF8A 4EGFA 5EJFA 2E82A 5AP9A 2OBXA 3ZC3A 2XSZD 3UG7A 5CB8A 1AN9A 4B3MB 4PN3A 2VJNA 2C3PA 1IHPA 1BVRA 4W1PA 2XKKA 2I29A 1JHVA 3AUFA 5JSFA 3ESZA 4FFWA 4N0MA 4RMIA 1W4ZA 2QRGA 1S01A 3GAFA 4MIOA 1TUEA 4AULA 4FVTA 4WE3A 3NTOA 4N8DA 5DE3A 1HEIA 1Y37A 2X77A 1MDBA 1BMTA 3A3YA 3SLGA 2A35A 4GQBA 1KDYA 3ES9A 1A72A 1DPFA 4BGVA 5LLTA 4NJMB 2JLRA 1C9EA 4ARUA 1E7WA 4DXHA 1V9SA 4EB6A 5JAUA 5LDHA 3NRCA 1DRUA 3IJEB 4YCDA 4URYR 1LKZA 1SOWA 3IUEA 1LWOA 3DMRA 3MJTA 5EQFA 3T1VA 3IUPA 3V1UA 3PFGA 1VI5A 1YQEA 2C3UA 3BL6A 1YRWA 5AMXA 1YH3A 1U65A 3PDIA 5LCXA 3L82B 3VTKA 1KZ7B 5TPZA 4BFCA 4D9EA 4DV6B 2E55A 2O3RA 4L5AA 1D8TA 1STOA 3BOSA 4FMDB 8ABPA 4YNBA 2PO7A 1SBIA 2Q0QA 5SZKB 5JFGA 5LZ4A 2FZVA 2QLLA 3A58B 2GS9A 4KEAA 3NBMA 2GLXA 2P9GA 3BMCB 2P9YA 5AVRA 5IM4F 2YJ5A 1J0CA 4GUDA 4BNFA 5JQGA 4RK1A 1N36B 2Z4TA 2LKCA 5F51A 1M66A 3VHQA 3S81A 2VQFB 1VB3A 1NC1A 2QE6A 1YRAA 2XYHA 3MWKA 4H4DA 4JZYA 2BMVA 3KPYA 2Z9BA 4GR9A 3RUIA 5EHZA 3T5AA 4MEBA 4LOIA 4R54A 2JJ1A 3ZJVA 2QMUA 2BM1A 1JFFA 3AP2A 2I62A 2YBEA 3MMNA 4FGUA 5FJJA 5M3BA 1WWKA 5ICSA 3NFRA 1EJ6A 3WB1A 1QQTA 3OZVA 4KSBA 2AI3A 4FJ1A 5SY4A 2OT3B 5KKCA 4YBZA 4RF4A 3BXXA 2BJVA 3QEKA 2V0GA 1PZNA 4IXTA 1I7QB 4NLLA 5KKNB 1OIWA 2AZXA 3ZCQA 2GN1A 2CKDA 4I50B 4IWXA 1XTVA 1UXKA 4DYHA 4AJOA 2JI8A 1E66A 1H69A 2PD6A 4AROA 3VSCA 4E70A 2P75A 1WX1A 1XMPA 2N47A 2VBIA 2BEWB 4HNRA 2HA4A 3W5HA 3ZI4A 4YUVA 2AUMA 1KPIA 2AZTA 3X1ZA 1HQYE 4OQXA 2ILTA 1E3QA 3P94A 4U8HA 3UV7A 3C1AA 4FR5A 4KYUA 3T4UA 1PFVA 3TBHA 3QU2A 1Z13A 3T7EA 4G8JA 4GSKA 1TQ6A 4I4CA 3IBYA 1AQNA 2VDQB 1QVAA 5KU1A 1K06A 3L7BA 1EWRA 3V2UA 3IERA 1UXIA 1H0KA 4KFUA 4OPMA 1OFIA 4WDQA 3UJ9A 2CL6X 2OWEA 1VL5A 4G24A 4HSEA 4JP5A 3IKTA 1TD1A 3IJRA 2OOSA 2IZOA 2O05A 3COWA 1IHOA 3K0EA 1X6VA 4XGRA 3U0BA 1WNTA 1KZ9A 1W87A 2EJTA 1PR2A 3NXSA 5C3UA 2J4DA 1HE3A 4FGJA 3FYDA 4RADA 2BUCA 4CTKA 2N9UA 2VDLB 1T2DA 1VMKA 3UKDA 3VJRA 5MN6A 2DHEA 4IG4A 4LHEA 4YLEA 2X2EA 1G8KA 1ULZA 3MWYW 3W3AD 1G5IA 5B55A 5KTPA 1A5ZA 2ZBVA 3MN1A 2E3JA 2O8EB 4I36A 1EBBA 3N0RA 2CUNA 2CSXA 5JC1A 1W1IA 2OSVA 3A11A 3X44A 2AYXA 4TV9F 3PQ7A 4L5IA 2GSDA 5IARA 1WZNA 3IAEA 4H3VA 4RY2A 3T94A 3D3KA 3D02A 1SIBE 4ERNA 1RI4A 4NMWA 4Q3DA 4JELA 4JLNA 4UPVA 2Y0PA 1LLDA 3O4IA 1QTRA 2J32A 1SGWA 1PFYA 2YV4A 3IXMA 3HN2A 3LUDA 1BXGB 3OOEA 1PSWA 5KYYA 3TQSA 4FLFA 4E33A 1A8IA 4PLCA 2IWHA 5FTWA 1J90A 2XE8A 2ZUCA 3D0KA 3U7FB 4HCJA 2I1WA 2PIAA 3P2YA 4X24A 1W6UA 3RS0A 2YY7A 4QGAA 1WXQA 1MGOA 1VGQA 1IK4A 3PF8A 3EIHA 3B9PA 3I76A 4KN9S 1MEJA 1IN6A 3OQNA 4CGZA 1GFZA 1WMAA 1TLLA 3L0BA 2XODA 3LWNA 2W4IA 4OK3A 1KDZA 1R64A 1ZRNA 3EAGA 3O3OB 4MVJE 1AGNA 1D1SA 1LCIA 1J39A 3G8DA 4KQMA 4QLOA 4YACA 3KD3A 5EKDA 4ZHQF 1EZ4A 1SU4A 2ZRKA 3IAHA 1JIXA 3PT9A 1EGVB 4UJ3A 5EKSA 4FB4A 4Z4CA 2ZANA 1CHDA 1SU7A 4W9RA 3HGTA 3PHJA 3WAKA 3URKA 4UMFA 3SBDA 4YR7A 5JD6A 1I9GA 2DQ4A 3CKLA 5KVAA 1B76A 3E9YA 2HXYA 2ZAOA 3VGJA 4C6TB 1C3VA 4H9GA 3GLQA 4P1ZA 4DLLA 1IY2A 4GZ3A 3D3WB 3ORSA 2WLSA 4FYKA 5E0OA 1JEJA 1W25A 3SX0A 3TNDA 5IK2D 4V24A 4DSAA 3GRZA 3OSUA 2JIZA 5AJZA 3D6AA 1SIUA 4WCFC 4NXNB 3H4MA 3II6X 1VYVA 1X1SA 2XMCA 1KEKA 1GFSA 3CS3A 2LBPA 3F5DA 3P2IA 2CJPA 4DMGA 1JMKC 4UCXA 1SKUA 1R8YA 3EJWA 1AUOA 3SS7X 1ODCA 1CETA 2V7WA 5MFPA 1FUKA 1NW5A 1WE2A 1MN6A 2XAUA 4L6AA 4QEKA 4BCCA 3U6BA 4RQBA 3KKEA 2FPPB 4AS3A 4P86A 2CD9A 1XEFA 5KEIA 1RBZA 4LHYA 1DUIA 3KT3A 1PR0A 3E9NA 4FYYA 3DZIA 3OZSA 5EJ2A 1SY7A 4G8DA 1ULTA 2FZ5A 1DCMA 1MTZA 1DX9A 4GECA 5BSTA 2REOA 3ELUA 1N2JA 1Y3BE 4X62B 3IAM1 3CT4A 1OU4A 5DTRA 4TWIA 4JB3A 1GIAA 3UC5A 4F3KA 4H2DA 3BKXA 1CUGA 2DU8A 5DYIA 5JDIC 2DM6A 3F6PA 5EXDA 1KI4A 3CONA 2RBGA 4MH0R 5CVUA 5DI3A 4O25A 2GESA 3UJ3X 1K66A 3GN1A 4HQOA 4JP1A 4DS3A 4E46A 4FGZA 4F8YA 5B2EA 5JV5A 1ONSA 2FE4A 1VLVA 3SDBA 5AQ1A 2QQFA 4ZYUA 2I3DA 4IHKA 4KUHA 3EZGA 5B6JA 3BE8A 2VZ8A 4FSDA 2VYQA 3BCUA 3L46A 4XA8A 2XKAA 2ZQ5A 2QV0A 1Y7TA 3QPBA 2Q3FA 4BNDB 1K5PA 1KJZA 1ZM7A 2O0KA 4CKWB 3QM1A 4NJEB 2XIJA 1L7OA 1ST3A 1U7UA 2GSWA 3BTOA 2GEFA 4R6XA 3RHFA 5L40A 2CXQA 5C5EA 2JBWA 2RAUA 4LHSA 4FMCB 4DG8A 3EGIA 3COVA 3CZ5A 4XWWA 3H11A 4R2KA 2OD2A 1FY2A 1K7EB 2FZEA 1HY3A 2OORA 2VI5A 2OYSA 3SOZA 1USIA 1XTZA 2BGUA 2UAGA 4ILKA 4J7CA 5H9WA 5CH5A 5JPCA 1EE2A 1WY7A 5IS2A 1FFGA 5IJ0B 3H8JA 2RGEA 3DLPX 3R7SA 3QVGB 4IFEA 3U40A 3TNYA 1PNQA 3EC1A 2UYHA 2G77B 2B36A 3ID6C 2QG6A 3HCCA 1LPMA 1G0NA 3Q85A 1KC3A 4BECA 5ICCA 3NHAA 1GGEA 4UXIA 4EJFA 2J7PA 3W5IA 4UVEA 3F6SA 1JJFA 1WXEA 3E70C 4JL5A 3WZMA 3D1LA 4CLXA 1GQSA 3I37X 4RZ3A 1YOVA 5DNUA 5CIYA 5FTMA 3T6KA 1U6KA 2YXNA 3QYFA 5IZCA 5IAKA 1GAWA 3B7GA 4IHJB 4A0SA 3CXUA 4ZHSA 1GGNA 1VBMA 4MR9B 5LDGA 3H1PA 4Q7MB 3O9ZA 1EDZA 2G88A 1QFZA 1VZ3A 1R50A 3QVMA 3A7EA 3C3MA 5EIOA 4CEIB 1QU2A 1LLCA 3MJCA 2DY0A 3E8XA 3KSDO 1RDFA 1E20A 3DSRA 3WO0A 4EG0A 3E3NA 1BD4A 5T3UA 4AI6A 2JIMA 5B57C 1KIMA 4PC7A 3MS7A 4UAUA 4GPBA 1QC5A 2YFHA 4B3HA 1TMKA 3PXXA 1H85A 4PZYA 4DZTA 5F7XA 2NPFA 2WWYA 2HQBA 3TIXB 1KDTA 4V2IA 3ETDA 3HCAA 2Q9BA 4BY9E 1XTKA 3U4HA 3ZWBA 1VKNA 4B3CA 4WW0A 2ZRHA 5BR4A 3CT6A 3DDOA 2H1FA 3WIOA 2D5BA 1RXEA 3PPWA 3AGPA 2HMTA 1KXJA 4DR5B 1IZ9A 3MBKA 4ITVA 1VCMA 1I3CA 5LMNB 3BFPA 3L7MA 3TNJA 3RSSA 4PN7A 4HNTA 4N3CA 4WNAB 1FLAA 5BSUA 2W93A 5EHNA 2P90A 2FEWB 5DTQA 1PQUA 3KPJA 4NENA 1XF9A 2NUPB 1T1EA 1U80A 1WUYA 2R1ZA 1AB6A 1QK5A 3OA2A 3OLZA 3ZGLA 3GFQA 3CTPA 2Q2NA 5D85A 3VSBA 4I14A 3JARA 4ZANA 4YAWA 4HAXA 4YAKA 4XFKA 5EHXA 2RFLA 2BR5A 1QMGA 4YAEA 3IVGA 4G6ZA 4UU1A 4AT1A 2VOEA 1NWCA 2B4YA 1WBBA 2PSFA 2AG8A 2N42A 1TJ4A 3OKAA 1LNQA 3ORQA 4KMRA 3TLJA 5C46F 1TZ2A 4L4RA 4ZT3A 4FEYA 2YICA 4LGYA 1XT6A 4FZ5A 4TMKA 4G01B 4I46A 5K99A 1WKVA 4WK0B 2BKXA 4NBSA 5E4YA 3CLKA 3DEYX 2IYNA 2O20A 3HA5A 3AESB 2ZQZA 3PUYA 3TM4A 3W2HA 4FFVA 1OLSB 3WBBA 3EAQA 1T9CA 4IIJB 1QWSA 2OV1A 1E1RA 3K9NA 3L79A 2R6GA 4ZVKA 3WI7A 4YUAA 1DBRA 1I3MA 4NJOA 4MI9A 2ATCA 4EEKA 3KBOA 4MVJA 1E89A 5AW8A 6ADHA 1KI8A 1USWA 1ZEJA 2RHMA 2E4WA 3BC1A 3KEQA 3OM9A 1SCAA 1D4ZA 2VDPB 4D6YA 3RAFC 3RU2A 4YS6A 5IJ9B 2E7ZA 1DU4A 3ZVRA 4LCBA 3IDOA 3M6FA 4IQ4A 2FEAA 1BGXT 1UZMA 1AIPA 5M29A 2Q2OA 1MH1A 3L1KA 2ZJ3A 3I01M 1MFPA 2IIQA 3V1TC 3GQVA 2F4VB 3ASYA 3CLUD 4GC5A 4G0OA 5AM5A 2RB5A 4NICA 1Q1QA 1KETA 1WQ4A 3F74A 3M6IA 3NH6A 3SKVA 2CXRA 4DLKA 4B6SA 3N7TA 1EHIA 4XDYA 1BKYA 2A8YA 2B4RO 1G2QA 3N3AC 1OROA 4J94A 2ZITA 1AHIA 1CFJA 1XXLA 4KQKA 3U81A 4KIWA 2NW6A 3GXBA 1TADA 1GPDG 4XLTA 1KQGA 5L3SA 4D25A 2FWPA 2PBRA 2VR1A 3C3JA 4LHVA 4YP1A 3VAZA 4EEXA 4ZI5A 3LW7A 4MWCA 3M9LA 4RMNA 2ZT7A 3MIIA 4KJZA 3RBVA 3W7AA 5M04A 4G3XA 1UK6A 3BSWA 3P96A 4NBWA 2QTMA 1LJ8A 1OY1A 4GUAA 1XZDA 2RHBA 4Q9IA 4YP7A 4CKXA 1OGJA 3F98A 1K68A 1WCXA 5GJCA 3RWOA 1E3JA 2HU2A 3DNPA 1DOHA 1XZHA 2QJTA 1G1MA 3L7IA 2J07A 5HFNA 5BN4B 3RUFA 4YP9A 4AO7A 1EBUA 4IIYA 4OHOA 2EZTA 2XA2A 1P6QA 3QBVA 5TVGA 1VA5A 2LTAA 5A7GA 2BGMA 1Z56C 3V4SA 2JCYA 1ENYA 1ESDA 1M73E 4NX2A 5HKLA 4OI0A 5TR9A 4TLAA 1JAXA 5G0VA 3VHXB 1E63A 5DZSA 3NIGB 5G40A 4MPPA 4R68A 5ED0A 4JFRA 1T2FA 4D1YA 3VU8A 1AZWA 3WLHA 3A2NA 4OIMA 2IPXA 5GV7A 4KLAA 2WHEA 2YR0A 1GA4A 1BWQA 2VRBA 1TCUA 2JI9A 4OBWA 2SKDA 4M9RA 4CDNA 4QNRA 2RGXA 1R3DA 1UM9B 3LXRA 2Z2ZA 3FLEA 3T9EA 1E18A 1YKGA 1KYQA 3G2IA 3HE3A 4E94A 3DCNA 3BAFA 4LZAA 2HDOA 1KAOA 3H5NA 4YMIA 3V8BA 4F46A 1PYOA 4U3JA 4BMDA 1LEHA 3VOAA 2FZGA 4MGKR 3I8OA 1KAEA 3I1YA 3BWBA 4M1TA 3EZYA 4G07A 1JXQA 1DQRA 1ZGJA 1VB5A 3AU8A 4JUCA 4JI7B 5AVOA 4RLQA 5K05A 1FRFS 2VH5R 3KJGA 1NIPA 2EKDA 4ZCIA 2FSPA 2J0EA 5HIKA 2FNAA 1DQNA 2AXQA 3FFBA 1AV6A 1LDBA 3CH5A 1GYPA 4DMMA 3P0JA 4PO8A 1Z2CA 1V25A 2VSXA 5KSPA 4IP0A 5EI5A 5KNCD 4PAWA 1FMLA 2ZWOA 1RAGA 2H0RA 3Q0EA 5LP6A 2Z0MA 4J1TA 9LDBA 3FNRA 3QSYA 4M0KA 5FP0A 4Q4JB 1K6MA 2QL7A 1OX6A 2YRXA 3WLOA 4EO9A 3QKSA 1A5TA 2G9RA 2JDID 3A6JA 3JD4A 1G16A 2XHEA 3FPFA 3MOGA 1NHWA 2IHKA 1MV5A 2BM9A 2R7LA 3JYQA 4MGIR 5CCEA 1YB1A 5JYDA 1EUYA 1N3IA 3WC4A 3I2HA 1V3TA 2A0KA 3TX2A 3TWOA 2W48A 3U3KA 4JNCA 2B9EA 3FKJA 3CW9A 1L6RA 1T1RA 2GB4A 1HEUA 3A05A 1GZSA 3PD1A 2JL1A 3JQ6A 1JT2A 4O5AA 3W5VA 2FZCA 2IHNA 2IXAA 4JH0A 1GNRA 3DTTA 5F12A 3VR5D 4D9KA 4OJQA 2HSGA 4BBJA 3DCYA 3N2LA 4HV4A 4W5NA 3KR9A 4ZWNA 4D9MA 4KE9A 3V55A 2IUYA 1KA9H 2W2XA 1BFDA 2XDQA 7REQB 5ECWA 3WK8A 2J41A 2JJMA 5LXTA 1LRLA 2LKDA 1PFUA 4LJ9A 3R0ZA 1ESCA 4YI5A 1CRPA 3C8UA 4TQ9A 4EQ6A 3GBVA 4LJ5A 3LQKA 3S2IA 4F3CA 2GNPA 2J5XA 3GLSA 5TT1A 3W2EA 4DV5B 2Q29A 3W79A 2JGMA 3DV2A 3PKZA 2XXAA 3DAHA 4US1R 4EMBA 1I1QB 2QL9A 4FFMA 2QN9A 1DFIA 4N8SA 2IEYA 4JGGA 5AM0A 2BKLA 5HEKA 3ABQB 5A7FA 1NP3A 3L7CA 3FRHA 5J4KA 3COPA 2R68A 3TRIA 3KWFA 5ALMA 1U2QA 2IYWA 3ADPA 4BB0A 3NR2A 4U9UA 3TQTA 1S2GA 3BA6A 4EUEA 1JJ7A 5TPZD 4B4DA 1LWNA 1C0EA 4XM0A 3FSRA 4ZO9A 2JFVA 4PFQA 2GEDA 3SSNA 4UNQA 4O3MA 4L8LA 1PZGA 1IK6A 3ZQ4A 1EXDA 2JFFA 2NQTA 4JJ4A 3WYBA 2D1TA 4IS3A 3O1JC 3UKOA 5JYBA 4RF5A 3QVSA 1OLUA 4ZDJA 2YFQA 3KB6A 2JJ1D 2NYUA 4OTZA 2UXDB 3DOOA 3DEIA 4RTSA 1A2BA 4PG7A 2X0NA 5K3BA 1QZXA 4KZKA 4W1RA 1B00A 2XCOA 1KKMA 1URPA 1T36A 3L4BC 5ENZA 1ZITA 3CVXA 1K6XA 3LV8A 3I12A 4EA8A 4RPCA 4A92A 1VSTA 1CDZA 3G82C 4MULA 3KYCA 2VTDA 4OUDA 4HDMA 5JSUA 3D7RA 2YS6A 3JQAA 2O5VA 5L51A 3F7MA 2HJGA 4ER3A 3KS9A 2FPSA 1Q1GA 1WAMA 3UJAA 4OMUA 3K3PA 1E77A 1N9GA 1J0DA 1DV2A 1U0FA 4DBZA 3IB6A 3S4YA 1DC4A 4AP6A 3U26A 3OZBA 1M2GA 4U4AA 1SJ9A 4ZK2A 2XCLA 1L4EA 3QGMA 5DWVA 4BVEA 2N75A 2RCYA 4AJLA 1WG8A 5A5GA 2ZW9A 3DE7X 4C87A 3I5XA 4DLAA 3THXA 1MW8X 4JI5B 3K8OE 3Q0IA 4JSRA 2WP8J 4ZQFA 2EU8A 4QOIA 4BP1A 4TZ6A 3CUVA 4CKCB 2M2IA 1C7RA 4IEFB 3FAKA 4BZXA 5CDSA 2FSIA 1QQ5A 2A57A 3R4VA 1ZH4A 3HGQA 1W46A 4HQRA 4JLUA 3ZYZA 4F56A 4A0RA 1RSZA 4MOWA 3MB5A 4ZARA 4NNPA 3SPXA 4DV4B 2JLWA 2OO5C 4A36A 5ALNA 4LWZA 3PJFA 2NTJA 4HDSB 1N6OA 2H4WA 2YW2A 3K4HA 3ICPA 3QVOA 1WUHS 1R0SA 4GZLA 4XB1A 3AVUA 1DHTA 4Q1DA 1SZDA 4IQGA 2H2AA 1T9AA 5JXGA 2EP5A 1JNXX 3LQ1A 2O7NA 4GNRA 4WMLA 3ZKAA 3IMFA 3PNPA 3CE6A 3BM5A 3QX7A 4EZBA 4YV0A 5HBGA 4YRMA 1ZEMA 3RC1A 5IDXA 3B6ZA 4MWBA 2SECE 3H75A 3V4VB 4WH0A 2O8CB 2HU7A 1IN4A 2PX2A 2IUTA 2QUHA 4MB2A 1OUMA 5DM0A 3V1MA 1YHNA 1TM3E 2B8EA 3DZDA 4ICIA 3TDKA 4CQJA 4G26A 1N4AA 2BC9A 3OZCA 1DHRA 5B6PA 1YKSA 3UM9A 2HT1A 2ZJZA