4EBGA

Crystal structure of a duf4467 family protein (sav0303) from staphylococcus aureus subsp. aureus mu50 at 1.35 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
97
structure length
97
Chain Sequence
GYQKDIDKVYKEQNQMNKIASKVQNTIKTDIKQEDSNTHVYKDGKVIVIGIQLYKDREKMYYFAYEIKDGKAEINREIDPIKYMKDHKADYEDENVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (SAV0303) from Staphylococcus aureus subsp. aureus Mu50 at 1.35 A resolution
rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Unknown function
total genus 27
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14729 DUF4467 Domain of unknown function with cystatin-like fold (DUF4467)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.560 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4ebgA00
4EBGA
chains in the Genus database with same CATH superfamily
2C11A 2D1WA 1TRPA 1FGTA 2Q07A 1O7NB 5IF6A 1MGWA 5LC6A 4ILFA 5CLKA 1BOXA 1DYUA 1UGHI 2W04A 3NQYA 3DGNA 1FZUA 1FGOA 3OWUA 5BXQA 1JV2B 2CG0A 1OPYA 1X1UA 4HZBB 1LNHA 3D79A 1B2SA 4GL6A 3KFQC 1WQLB 4J9AA 3WA2X 1BRSA 1I70A 3STDA 2CG1A 9RNTA 3JUMA 1B3SA 2C10A 3JUOA 1X1WA 3BIRA 3K5TA 3IJEB 1ASKA 3G16A 3NBRA 3I563 1TFOA 2XSOB 3EC9A 1OHOA 2F56A 2KF5A 3NBBA 1V74A 1OHPA 5M19A 2CH9A 4O2HA 3L0RA 1ROAA 1GSPA 3EBYA 2IA7A 1IDPA 3UJMA 3AHWA 3EE1A 1CEWI 3RNTA 1VQ63 4MMXB 5CF2A 1YJW3 1BRJA 3NXJA 1LOYA 2D42A 1PYLA 4FCZA 2CC3A 4X2OA 3CCM3 2OTJ3 3B7CA 1HKXA 1BSAA 1YHQ3 4PEJA 4TX4A 3N9HA 1RMSA 3EN8A 4N6UA 1MOLA 3LMLA 1MWTA 2Z7AA 3MKIA 1X1YA 1N8R4 2E2VA 3F40A 1JB5A 3E99A 3PCSA 3BU4A 1UUGB 5IEOA 1FYSA 2BT3A 2QEX3 4IIAA 3OX9A 5G1KA 1DMMA 1ZO2A 1GOYA 4AKYA 1EEJA 1B27A 1Q814 1OH0A 3Q2PA 1RGFA 3DUKA 1RTUA 1Q42A 3QK9A 4IT7A 3WR2A 3CNMA 1VQ43 3NUVA 2WOHA 2CIUA 2CFGA 3J7Yd 4CCVA 1UI8A 1W2B2 4LZIA 2F98A 1NJI4 1U5OA 1VQM3 1TRQA 4IPBA 1JZOA 1F8NA 3VSYA 3BLZA 2BIRA 2RBIA 5IEPA 2P38A 1QVF2 2E2UA 2F5MA 1ZGXA 1Q40B 3NX0A 3CD63 7GSPA 1G0TA 1BIRA 5EEOA 3VGNA 2WO0A 4WWUC 3KKGA 2LQVA 1R4CA 4LMIA 4N6MA 1VQ53 5CXOA 2A15A 3EB8A 4OK0A 1W7CA 4R80A 1CYVA 1N5HA 5D83A 3DM8A 5FW5A 2INXA 3KZTA 8RNTA 1W2ZA 1JKGA 3MSOA 3HI7A 1BNJA 3DMCA 4JF8A 3CCE3 2HMKB 3D5GA 3MYTA 3DGYA 4R9LA 1EA2A 1IQXA 1PY3A 2HMLB 1I0VA 3BB9A 4OVMA 3F7XA 5FGOA 1GMPA 2AAEA 1O7PB 1RHLA 1B2XA 1SARA 5ELUA 4EBGA 2QIYA 2YX9A 2J8XB 3Q1CA 1UI7A 3SOYA 3RGRA 1SPUA 2P09A 3HIGA 3SVAA 1AQZA 1DMQA 5AYSC 3V92A 1BSBA 1B20A 2UX0A 1OUNA 3A76A 1Q9EA 2STDA 1RN4A 2RGQA 2YFLB 3FG1A 3LTCA 3U1WA 4EYCA 1T2HA 3GWRA 1OF5B 2GU3A 2BHMA 3PCRA 1YVBI 3SLUA 3U97A 3DGLA 1AR0A 2KXGA 3RGAA 3ROBA 1AY7A 1STFI 1YVSA 2CWUA 3CCJ3 1M904 4HAAA 4N6OB 1SJWA 3NV0A 2R41A 4H61A 1IV9A 3S5CA 1RKYA 4HM4B 2XF3A 1W6CA 1RGCA 1KC84 2KAAA 3K7CA 3LT9A 5HOHA 1IYYA 4LYLB 2H0GA 4NPBA 4I4KA 2H0HA 3CCL3 5BIRA 3LXUX 2KCDA 3SX1A 3BNDA 4EXRA 3FKAA 1E97A 1IV7A 1K8A4 1Y4KA 5I97A 4HOHA 4BU4A 1DE3A 4BTYA 1RGGA 1Z1SA 2IY2A 1RN7A 3K63A 5CK6A 3F7SA 1TTOA 2GU1A 1DVDA 1GMQA 2CFDA 3DZLA 2KF6A 1MWUA 1JB4A 3GZRA 4J5GA 2XRXB 3EHCA 1BRGA 2KF3A 5AEUB 1UUVB 1V58A 1C54A 1A2KA 1EUIC 1UUWB 2BO9B 1IVXA 1I2EA 3F9SA 1JN5B 2YFJB 5EVHA 3D9RA 5JBSA 1RLSA 3VF1A 1WNHA 2F5WA 5BVBA 1IK3A 2XSHB 2OTL3 1LQGC 3AGNA 1DMNA 2CWVA 3GRDA 1VQP3 1D6UA 1TUHA 1RRLA 4HM0B 3T8NA 1NB5I 4J5KA 1UCKA 2H0IA 3ZG0A 2Y73A 2HMOB 2K54A 3G6E3 5G1LA 1W02A 3KIIA 3MPHA 4HYZA 1QAFA 1U8CB 1JBSA 1VZZA 1W00A 2GBWB 5KP1A 2L4VA 2F99A 2M7OA 1IT7A 1OACA 2W03A 1VQ73 1E3VA 1BNSA 2ML5A 1VQ83 1RGLA 1RSNA 2BMQB 2OQEC 1RNBA 3GZXB 1BUQA 4HM5B 2GSPA 5D81A 1GOUA 1JRQA 1O7WB 3T0UA 2CX1A 3WOFB 1OGXA 3Q3FA 2FNQA 2ZDJA 1A67A 2B24B 4HZ9B 1I3IA 3FG4A 2F4YA 1STDA 1RDSA 4XM4A 2CFKA 4L7KA 2C4BA 4EV2A 4EV5A 1ISKA 1MWRA 2UGIA 1G02A 3CU3A 3GZBA 1IT8A 1PU4A 3CPW2 1TP6A 1GMRA 3G4S3 2OQEA 4KFFA 2CHCA 3OV4A 2XEPA 3IMAB 1CQSA 1FGQA 3EF8A 2CKFB 4XBYA 2P0MA 3HK4A 3X40A 3CC73 4H3UA 1M1K4 3N8BA 1YGWA 3DXOA 1BANA 3EBTA 3ER7A 5A0OB 5KP4A 4BIRA 3G713 3UL5A 1D6ZA 1K41A 5KP3A 2SBLA 5GSPA 2XR8B 3TDGA 1BNEA 1X1XA 3EN1B 4R1KA 4R4KA 3H51A 2RSXA 3FF2A 1V57A 3PZWA 1S723 1TFKA 3F14A 1M9GA 3RDEA 1LNIA 3QRDA 3CCR3 6RNTA 4HBRA 1FGRA 1R4YA 4WYKB 3SEDA 1UCLA 4ZM8A 2W9QA 3ECFA 5M1AA 1TIJA 1JBTA 3FSDA 4FR9A 1EKMA 1OHSA 3FH1A 2KRTA 1Q40A 1BNFA 1S5AA 2YFIB 3CCV3 1O7HB 2QGUA 2QA43 1K9M4 4KZ1A 1BSDA 4EW5A 1RRHA 3GZYB 4N6LA 2W9PA 2MF7A 1BNRA 2ML6A 4U13A 3LYGA 3WMDA 3MG3A 1GD3A 5IG4A 5STDA 2P0XA 3AHSA 1UDII 1BSEA 3SYUA 2CWTA 1OGZA 4MMZB 4NREA 5D82A 3S28A 1A90A 1CH0A 1BAOA 1NB3I 2B1XB 1BRIA 2RCDA 5AYRB 3CMA3 1RCKA 3OWSA 3DH2A 3PYJA 3WODG 1BU4A 3ZG5A 1O7MB 2BU4A 4AEQA 2HMNB 3PS8A 3LTDA 2GEXA 4J8TA 2XH9A 3URPA 1TU5A 3D5IA 4HM3B 4BL3A 4KFEA 2HMJB 4FMCA 4RNZA 5JPUA 4O8SA 3B8LA 1B21A 1AVKA 1KSIA 1UW1A 2OOVC 2W56B 1PFPA 4FMAA 4EC6A 1TJDA 2Z77A 1LOXA 3I0YA 2XFTA 3EX9A 4RNYA 3S29A 8CHOA 3CCU3 4O02B 1C7HA 2OCTA 1RCLA 3ALAA 1Q824 2K3DA 1QJGA 3FGYA 2BMRB 2RNTA 3M8CA 3X42A 1NO3A 1Q7HA 1SQWA 2BNGA 2K0MA 2XGLA 3AMOB 1W6YA 3G8ZA 1W5ZA 4NHFA 2XFSA 4GSPA 5IW9A 3HOHA 3CME3 5AIIA 1JJ22 3EJVA 1A2VA 1OF5A 1ZX2A 3A5EA 4Q53A 4CDLA 3GSPA 1KQS2 3PGBA 1VQK3 1Q7Y4 4KT3B 1FUSA 1GS3A 1WMNA 3WOEB 4MEIA 3HZPA 1YNVX 4XBXA 2OOVA 5G2GA 1ZS7A 5IERA 3HIIA 1QVG2 2V1LA 2WGOA 3CXC2 2XGNA 2ZHXB 2AADA 2HOHA 1RGEA 3X41A 2JQ5A 1WMPA 2RFRA 3LZAA 1SIHA 1LQMB 1ULJB 2IUKA 3BNEA 1BGSA 3Q90A 2PZVA 1FA3A 4KVHA 1MGRA 1Q864 2CFWA 2PNCA 2FXTA 3EQQB 3D3LA 3FLJA 3WHOA 2W0QA 5BU4A 1KD14 4O3VA 4HM7B 4KFDA 3UB1A 3X3XA 3IPTA 2GXFA 4RBNA 1FW7A 3K0ZA 4HM6B 5AIFA 3OWYA 1N5PA 1IVVA 3V98A 4N3VA 1A2PA 1RJOA 4HVNA 4FCJA 1BNGA 1BRNL 1VQO3 1GY7A 3DGOA 5IG3A 3KCHA 1NNVA 1JN5A 1RGHA 3BNBA 1IVWA 1I8VA 1DETA 1US1A 1I0XA 1IVUA 1E3RA 3SXXA 1QAKA 4XBTA 4GB5A 4HM2B 4K61A 3V99A 1I3FA 3CPOA 6GSPA 1VQ93 1JBRA 3LH4A 3NM2A 4LEHA 1B2UA 2BMOB 2WGQA 3CNXA 4JRFA 7STDA 1G96A 1NDOB 3G0KA 3B4PA 3CC43 1JNQA 2F86B 3FF0A 1KWIA 4CPKA 3HX8A 5IG5A 1AVLA 2CX0A 3UNLA 3I553 1UCIA 3F8XA 3OXAA 1WMOA 1FUTA 1MNLA 1YGEA 3NM7A 1YIT3 3X3YA 2IMJA 2SARA 2IUJA 4RZMA 1B2ZA 3KSPA 3LTBA 5ELJA 1QMAA 3FG3A 3CCS3 3SOAA 1OCVA 1GY5A 3KN4A 3CC23 2O9UX 1FUWA 1W6GA 4XB5A 4CJNA 1BVIA 3H3HA 3JUQA 2WOFA 4K1UA 3T8UA 1K734 1ULIB 1L5GB 3WDGB 5AIHA 1BUJA 1HU9A 2I9WA 4WFOA 1WTHA 4K90B 1HYFA 5JPPA 5IENA 4HM1B 2ZL8A 2CFLA 1O7GB 4MMYB 1T2IA 4L8OA 5DREA 3AGOA 2Z6BA 1LVNA 2FGTA 4FMDA 4MJDA 1JKGB 1W01A 2CK3H 1N8QA 1UCJA 4ORLA 3MHEA 1QALA 3LT8A 1I2GA 2GBXB 4HJLB 4K1VA 5IG0A 1T5YA 2P05A 4RNTA 4BL2A 1VQN3 7RNTA 1EQKA 2LYXA 1RNTA 3LTAA 5AI1A 1JB2A 3FCSB 1DVCA 3DGMA 5TGNA 1YJ93 4HM8B 3N54B 1M1XB 3JUPA 1JZDA 1GY6A 1FGMA 1RN1A 4LGQA 1LXEA 6STDA 1VQL3 4X2HA 1BRKA 1N9JA 4BTWA 4XDWA 3ZFZA 4N6NB 3CCQ3 4GHOA 3UL6A 1LOWA 2L1SA 1AV4A 1NWWA 1GD4A 1SIIA 1W4NA 3JVCA 3K9MC 4WYKA 2OWPA 3F8HA 4R9KA 1I2FA 2KF4A 5LC7A 1UGIA 4LSOA 3NBJA 5M18A 4WHAA 3D4AA 3NV0B 1RGKA 2IYJA 1BNIA 1YI23 3LOYA 3KE7A 5EQLA 5DRVA 3S27A 3PXMA 3MG2A 1D6YA 2MC8A 1B2MA 4FCMA 1CYUA 2R4IA 4QWTA 4WP5A 1GOVA 1LOVA 1IU7A 3MWZA 2E2TA 4FMBA 2CW9A 1RGAA 1YIJ3 5RNTA 3GAXA 2W6JH 2UUGC 1IQ8A 2HMMB 4HKVB 2Z76A 4N6V0 1N9EA 3MG1A 1BSCA 3BNCA 1VQQA 3WA3A 2GEYA 2Y74A 3NQZA 1LRAA 4I5QA 1J2BA 3S67A 3FZWA 4OUQA 5AIGA 5CF1A 3DY5A 4XDVA 2ZA4A 1MWSA 4N6TA 1NU3A 1IQYA 3NHXA 1GYBA 1K28A 4L8PA 3X3ZA 2W56A 4BTXA 1YJN3 3B4OA 2JDIH 5HGRA 2O3OA 3KSED 3O8YA 4AKZA 5AEWB 4G1MB 3OW22 1EG9B 1ROVA 1T3BA 2W2CA 4STDA 1BRHA 4DKIA 1HZ1A 3AMOA 3JUNA
chains in the Genus database with same CATH topology
2C11A 2D1WA 1FGTA 2Q07A 1O7NB 5IF6A 5LC6A 5CLKA 1DYUA 2W04A 3NQYA 3DGNA 1FGOA 3OWUA 5BXQA 1JV2B 2CG0A 1OPYA 4HZBB 1LNHA 4GL6A 3KFQC 1WQLB 4J9AA 3WA2X 3STDA 2CG1A 3JUMA 2C10A 3JUOA 3K5TA 3IJEB 1ASKA 3G16A 3NBRA 3I563 1TFOA 2XSOB 3EC9A 1OHOA 3NBBA 1V74A 1OHPA 2CH9A 4O2HA 3L0RA 1ROAA 3EBYA 2IA7A 1IDPA 3UJMA 3EE1A 1CEWI 1VQ63 4MMXB 5CF2A 1YJW3 3NXJA 2D42A 4FCZA 2CC3A 4X2OA 3CCM3 2OTJ3 3B7CA 1HKXA 1YHQ3 4PEJA 4TX4A 3N9HA 3EN8A 4N6UA 1MOLA 3LMLA 2Z7AA 3MKIA 1N8R4 2E2VA 3F40A 1JB5A 3E99A 3PCSA 5IEOA 2BT3A 2QEX3 4IIAA 3OX9A 1DMMA 1ZO2A 4AKYA 1Q814 1OH0A 3Q2PA 3QK9A 3DUKA 4IT7A 1Q42A 3CNMA 1VQ43 3NUVA 2WOHA 2CIUA 2CFGA 3J7Yd 4CCVA 1UI8A 1W2B2 4LZIA 2F98A 1NJI4 1U5OA 1VQM3 4IPBA 1F8NA 3VSYA 3BLZA 5IEPA 1QVF2 2P38A 2E2UA 1Q40B 3NX0A 3CD63 5EEOA 3VGNA 2WO0A 4WWUC 3KKGA 2LQVA 1R4CA 4LMIA 4N6MA 1VQ53 5CXOA 2A15A 3EB8A 4OK0A 1W7CA 4R80A 1CYVA 1N5HA 5D83A 3DM8A 5FW5A 2INXA 3KZTA 1W2ZA 1JKGA 3MSOA 3HI7A 3DMCA 4JF8A 3CCE3 2HMKB 4R9LA 3MYTA 1EA2A 1IQXA 2HMLB 3BB9A 4OVMA 3F7XA 5FGOA 1O7PB 5ELUA 4EBGA 2QIYA 2YX9A 3Q1CA 1UI7A 3SOYA 3RGRA 1SPUA 2P09A 3HIGA 3SVAA 1DMQA 5AYSC 3V92A 2UX0A 1OUNA 3A76A 2STDA 3FG1A 2RGQA 2YFLB 3LTCA 3U1WA 4EYCA 3GWRA 1OF5B 2GU3A 2BHMA 3PCRA 1YVBI 3SLUA 3U97A 3DGLA 1AR0A 2KXGA 3RGAA 3ROBA 1STFI 2CWUA 3CCJ3 1M904 4N6OB 1SJWA 3NV0A 4H61A 1IV9A 3S5CA 1RKYA 4HM4B 2XF3A 1W6CA 1KC84 3LT9A 3K7CA 4I4KA 3CCL3 3LXUX 2KCDA 3SX1A 3BNDA 4EXRA 3FKAA 1E97A 1IV7A 1K8A4 1Y4KA 5I97A 4BTYA 1Z1SA 1RN7A 3K63A 5CK6A 3F7SA 1DVDA 2GU1A 2CFDA 3DZLA 1JB4A 3GZRA 2XRXB 3EHCA 5AEUB 1UUVB 1A2KA 1UUWB 2BO9B 1IVXA 3F9SA 1JN5B 2YFJB 5EVHA 3D9RA 5JBSA 3VF1A 1WNHA 5BVBA 1IK3A 2XSHB 2OTL3 1DMNA 2CWVA 3GRDA 1VQP3 1D6UA 1TUHA 1RRLA 4HM0B 3T8NA 1NB5I 2Y73A 2HMOB 2K54A 3G6E3 1W02A 3KIIA 3MPHA 4HYZA 1QAFA 1U8CB 1VZZA 1W00A 2GBWB 5KP1A 2L4VA 2F99A 2M7OA 1IT7A 1OACA 2W03A 1VQ73 1E3VA 2ML5A 1VQ83 2BMQB 2OQEC 3GZXB 1BUQA 4HM5B 5D81A 1JRQA 1O7WB 3T0UA 3WOFB 1OGXA 2FNQA 2ZDJA 1A67A 2B24B 4HZ9B 3FG4A 1STDA 4XM4A 2CFKA 4L7KA 4EV2A 4EV5A 1ISKA 3CU3A 3GZBA 1IT8A 1PU4A 3CPW2 1TP6A 3G4S3 2OQEA 4KFFA 2CHCA 3OV4A 2XEPA 3IMAB 1CQSA 1FGQA 3EF8A 2CKFB 4XBYA 2P0MA 3HK4A 3X40A 3CC73 4H3UA 1M1K4 3N8BA 3DXOA 3EBTA 3ER7A 5A0OB 5KP4A 3G713 3UL5A 1D6ZA 1K41A 5KP3A 2SBLA 2XR8B 3TDGA 3EN1B 4R4KA 4R1KA 3H51A 2RSXA 3FF2A 3PZWA 1S723 1TFKA 3F14A 1M9GA 3RDEA 3QRDA 3CCR3 4HBRA 1FGRA 3SEDA 4WYKB 4ZM8A 2W9QA 3ECFA 1TIJA 3FSDA 4FR9A 1EKMA 1OHSA 3FH1A 2KRTA 1Q40A 1S5AA 2YFIB 3CCV3 1O7HB 2QGUA 2QA43 1K9M4 4KZ1A 1RRHA 3GZYB 4N6LA 2W9PA 2MF7A 2ML6A 4U13A 3LYGA 3WMDA 3MG3A 1GD3A 5IG4A 5STDA 2P0XA 2CWTA 1OGZA 4MMZB 4NREA 5D82A 3S28A 1A90A 2B1XB 1NB3I 2RCDA 5AYRB 3CMA3 3OWSA 3PYJA 3WODG 4AEQA 1O7MB 2HMNB 3PS8A 3LTDA 2GEXA 4J8TA 2XH9A 1TU5A 4HM3B 4KFEA 2HMJB 4FMCA 4RNZA 5JPUA 4O8SA 3B8LA 2OOVC 1AVKA 1KSIA 1UW1A 4FMAA 2W56B 1PFPA 4EC6A 2Z77A 1LOXA 3I0YA 2XFTA 3EX9A 4RNYA 3S29A 8CHOA 3CCU3 4O02B 1C7HA 2OCTA 1Q824 3ALAA 1QJGA 3FGYA 2BMRB 3X42A 3M8CA 1NO3A 1SQWA 2BNGA 2K0MA 2XGLA 3AMOB 3G8ZA 1W6YA 4NHFA 1W5ZA 2XFSA 5IW9A 3CME3 1JJ22 5AIIA 3EJVA 1A2VA 1OF5A 1ZX2A 4Q53A 4CDLA 1KQS2 3PGBA 1VQK3 1Q7Y4 1GS3A 1WMNA 3WOEB 4MEIA 3HZPA 4XBXA 2OOVA 5G2GA 5IERA 3HIIA 1QVG2 2V1LA 2WGOA 3CXC2 2XGNA 3X41A 2JQ5A 1WMPA 2RFRA 3LZAA 1SIHA 1ULJB 3BNEA 2IUKA 3Q90A 2PZVA 1FA3A 4KVHA 1Q864 2CFWA 2PNCA 2FXTA 3EQQB 3D3LA 3FLJA 2W0QA 1KD14 4O3VA 4HM7B 4KFDA 3UB1A 3X3XA 3IPTA 2GXFA 4RBNA 3K0ZA 4HM6B 5AIFA 3OWYA 1N5PA 1IVVA 3V98A 4N3VA 1RJOA 4HVNA 4FCJA 1VQO3 1GY7A 3DGOA 5IG3A 1JN5A 3BNBA 1IVWA 1US1A 1IVUA 1E3RA 3SXXA 1QAKA 4XBTA 4GB5A 4HM2B 4K61A 3V99A 3CPOA 1VQ93 3LH4A 3NM2A 4LEHA 2BMOB 2WGQA 3CNXA 4JRFA 7STDA 1G96A 1NDOB 3G0KA 3B4PA 3CC43 1JNQA 2F86B 3FF0A 1KWIA 3HX8A 5IG5A 1AVLA 3UNLA 3I553 3F8XA 3OXAA 1WMOA 1MNLA 3NM7A 1YGEA 1YIT3 3X3YA 2IMJA 2IUJA 4RZMA 3KSPA 3LTBA 5ELJA 1QMAA 3FG3A 3CCS3 3SOAA 1OCVA 1GY5A 3KN4A 3CC23 2O9UX 1FUWA 1W6GA 4XB5A 3H3HA 3JUQA 2WOFA 4K1UA 3T8UA 1K734 1ULIB 1L5GB 3WDGB 5AIHA 1HU9A 2I9WA 4WFOA 1WTHA 4K90B 5JPPA 5IENA 4HM1B 2ZL8A 2CFLA 1O7GB 4MMYB 4L8OA 5DREA 2Z6BA 1LVNA 2FGTA 4FMDA 4MJDA 1JKGB 1W01A 2CK3H 1N8QA 4ORLA 3MHEA 1QALA 3LT8A 2GBXB 4HJLB 4K1VA 5IG0A 1T5YA 2P05A 1VQN3 1EQKA 2LYXA 3LTAA 5AI1A 1JB2A 3FCSB 1DVCA 3DGMA 5TGNA 1YJ93 4HM8B 3N54B 1M1XB 3JUPA 1GY6A 1FGMA 4LGQA 1LXEA 6STDA 1VQL3 4X2HA 1N9JA 4BTWA 4XDWA 4N6NB 3CCQ3 3UL6A 1AV4A 1NWWA 1GD4A 1SIIA 1W4NA 3JVCA 3K9MC 4WYKA 2OWPA 3F8HA 4R9KA 5LC7A 4LSOA 3NBJA 4WHAA 3NV0B 1YI23 3LOYA 3KE7A 5EQLA 5DRVA 3S27A 3PXMA 3MG2A 1D6YA 2MC8A 1CYUA 4FCMA 2R4IA 4QWTA 4WP5A 1IU7A 3MWZA 2E2TA 4FMBA 2CW9A 1YIJ3 3GAXA 2W6JH 1IQ8A 2HMMB 4HKVB 2Z76A 4N6V0 1N9EA 3MG1A 3BNCA 3WA3A 2GEYA 2Y74A 3NQZA 1J2BA 3S67A 3FZWA 4OUQA 5AIGA 5CF1A 3DY5A 4XDVA 4N6TA 1NU3A 1IQYA 3NHXA 1GYBA 1K28A 4L8PA 3X3ZA 2W56A 4BTXA 1YJN3 3B4OA 2JDIH 5HGRA 2O3OA 3KSED 3O8YA 4AKZA 5AEWB 4G1MB 3OW22 1EG9B 1ROVA 2W2CA 4STDA 3AMOA 3JUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBG A; 
#chains in the Genus database with same CATH topology
 2C11 A;  2D1W A;  1TRP A;  1FGT A;  2Q07 A;  1O7N B;  5IF6 A;  1MGW A;  5LC6 A;  4ILF A;  5CLK A;  1BOX A;  1DYU A;  1UGH I;  2W04 A;  3NQY A;  3DGN A;  1FZU A;  1FGO A;  3OWU A;  5BXQ A;  1JV2 B;  2CG0 A;  1OPY A;  1X1U A;  4HZB B;  1LNH A;  3D79 A;  1B2S A;  4GL6 A;  3KFQ C;  1WQL B;  4J9A A;  3WA2 X;  1BRS A;  1I70 A;  3STD A;  2CG1 A;  9RNT A;  3JUM A;  1B3S A;  2C10 A;  3JUO A;  1X1W A;  3BIR A;  3K5T A;  3IJE B;  1ASK A;  3G16 A;  3NBR A;  3I56 3;  1TFO A;  2XSO B;  3EC9 A;  1OHO A;  2F56 A;  2KF5 A;  3NBB A;  1V74 A;  1OHP A;  5M19 A;  2CH9 A;  4O2H A;  3L0R A;  1ROA A;  1GSP A;  3EBY A;  2IA7 A;  1IDP A;  3UJM A;  3AHW A;  3EE1 A;  1CEW I;  3RNT A;  1VQ6 3;  4MMX B;  5CF2 A;  1YJW 3;  1BRJ A;  3NXJ A;  1LOY A;  2D42 A;  1PYL A;  4FCZ A;  2CC3 A;  4X2O A;  3CCM 3;  2OTJ 3;  3B7C A;  1HKX A;  1BSA A;  1YHQ 3;  4PEJ A;  4TX4 A;  3N9H A;  1RMS A;  3EN8 A;  4N6U A;  1MOL A;  3LML A;  1MWT A;  2Z7A A;  3MKI A;  1X1Y A;  1N8R 4;  2E2V A;  3F40 A;  1JB5 A;  3E99 A;  3PCS A;  3BU4 A;  1UUG B;  5IEO A;  1FYS A;  2BT3 A;  2QEX 3;  4IIA A;  3OX9 A;  5G1K A;  1DMM A;  1ZO2 A;  1GOY A;  4AKY A;  1EEJ A;  1B27 A;  1Q81 4;  1OH0 A;  3Q2P A;  1RGF A;  3DUK A;  1RTU A;  1Q42 A;  3QK9 A;  4IT7 A;  3WR2 A;  3CNM A;  1VQ4 3;  3NUV A;  2WOH A;  2CIU A;  2CFG A;  3J7Y d;  4CCV A;  1UI8 A;  1W2B 2;  4LZI A;  2F98 A;  1NJI 4;  1U5O A;  1VQM 3;  1TRQ A;  4IPB A;  1JZO A;  1F8N A;  3VSY A;  3BLZ A;  2BIR A;  2RBI A;  5IEP A;  2P38 A;  1QVF 2;  2E2U A;  2F5M A;  1ZGX A;  1Q40 B;  3NX0 A;  3CD6 3;  7GSP A;  1G0T A;  1BIR A;  5EEO A;  3VGN A;  2WO0 A;  4WWU C;  3KKG A;  2LQV A;  1R4C A;  4LMI A;  4N6M A;  1VQ5 3;  5CXO A;  2A15 A;  3EB8 A;  4OK0 A;  1W7C A;  4R80 A;  1CYV A;  1N5H A;  5D83 A;  3DM8 A;  5FW5 A;  2INX A;  3KZT A;  8RNT A;  1W2Z A;  1JKG A;  3MSO A;  3HI7 A;  1BNJ A;  3DMC A;  4JF8 A;  3CCE 3;  2HMK B;  3D5G A;  3MYT A;  3DGY A;  4R9L A;  1EA2 A;  1IQX A;  1PY3 A;  2HML B;  1I0V A;  3BB9 A;  4OVM A;  3F7X A;  5FGO A;  1GMP A;  2AAE A;  1O7P B;  1RHL A;  1B2X A;  1SAR A;  5ELU A;  4EBG A;  2QIY A;  2YX9 A;  2J8X B;  3Q1C A;  1UI7 A;  3SOY A;  3RGR A;  1SPU A;  2P09 A;  3HIG A;  3SVA A;  1AQZ A;  1DMQ A;  5AYS C;  3V92 A;  1BSB A;  1B20 A;  2UX0 A;  1OUN A;  3A76 A;  1Q9E A;  2STD A;  1RN4 A;  2RGQ A;  2YFL B;  3FG1 A;  3LTC A;  3U1W A;  4EYC A;  1T2H A;  3GWR A;  1OF5 B;  2GU3 A;  2BHM A;  3PCR A;  1YVB I;  3SLU A;  3U97 A;  3DGL A;  1AR0 A;  2KXG A;  3RGA A;  3ROB A;  1AY7 A;  1STF I;  1YVS A;  2CWU A;  3CCJ 3;  1M90 4;  4HAA A;  4N6O B;  1SJW A;  3NV0 A;  2R41 A;  4H61 A;  1IV9 A;  3S5C A;  1RKY A;  4HM4 B;  2XF3 A;  1W6C A;  1RGC A;  1KC8 4;  2KAA A;  3K7C A;  3LT9 A;  5HOH A;  1IYY A;  4LYL B;  2H0G A;  4NPB A;  4I4K A;  2H0H A;  3CCL 3;  5BIR A;  3LXU X;  2KCD A;  3SX1 A;  3BND A;  4EXR A;  3FKA A;  1E97 A;  1IV7 A;  1K8A 4;  1Y4K A;  5I97 A;  4HOH A;  4BU4 A;  1DE3 A;  4BTY A;  1RGG A;  1Z1S A;  2IY2 A;  1RN7 A;  3K63 A;  5CK6 A;  3F7S A;  1TTO A;  2GU1 A;  1DVD A;  1GMQ A;  2CFD A;  3DZL A;  2KF6 A;  1MWU A;  1JB4 A;  3GZR A;  4J5G A;  2XRX B;  3EHC A;  1BRG A;  2KF3 A;  5AEU B;  1UUV B;  1V58 A;  1C54 A;  1A2K A;  1EUI C;  1UUW B;  2BO9 B;  1IVX A;  1I2E A;  3F9S A;  1JN5 B;  2YFJ B;  5EVH A;  3D9R A;  5JBS A;  1RLS A;  3VF1 A;  1WNH A;  2F5W A;  5BVB A;  1IK3 A;  2XSH B;  2OTL 3;  1LQG C;  3AGN A;  1DMN A;  2CWV A;  3GRD A;  1VQP 3;  1D6U A;  1TUH A;  1RRL A;  4HM0 B;  3T8N A;  1NB5 I;  4J5K A;  1UCK A;  2H0I A;  3ZG0 A;  2Y73 A;  2HMO B;  2K54 A;  3G6E 3;  5G1L A;  1W02 A;  3KII A;  3MPH A;  4HYZ A;  1QAF A;  1U8C B;  1JBS A;  1VZZ A;  1W00 A;  2GBW B;  5KP1 A;  2L4V A;  2F99 A;  2M7O A;  1IT7 A;  1OAC A;  2W03 A;  1VQ7 3;  1E3V A;  1BNS A;  2ML5 A;  1VQ8 3;  1RGL A;  1RSN A;  2BMQ B;  2OQE C;  1RNB A;  3GZX B;  1BUQ A;  4HM5 B;  2GSP A;  5D81 A;  1GOU A;  1JRQ A;  1O7W B;  3T0U A;  2CX1 A;  3WOF B;  1OGX A;  3Q3F A;  2FNQ A;  2ZDJ A;  1A67 A;  2B24 B;  4HZ9 B;  1I3I A;  3FG4 A;  2F4Y A;  1STD A;  1RDS A;  4XM4 A;  2CFK A;  4L7K A;  2C4B A;  4EV2 A;  4EV5 A;  1ISK A;  1MWR A;  2UGI A;  1G02 A;  3CU3 A;  3GZB A;  1IT8 A;  1PU4 A;  3CPW 2;  1TP6 A;  1GMR A;  3G4S 3;  2OQE A;  4KFF A;  2CHC A;  3OV4 A;  2XEP A;  3IMA B;  1CQS A;  1FGQ A;  3EF8 A;  2CKF B;  4XBY A;  2P0M A;  3HK4 A;  3X40 A;  3CC7 3;  4H3U A;  1M1K 4;  3N8B A;  1YGW A;  3DXO A;  1BAN A;  3EBT A;  3ER7 A;  5A0O B;  5KP4 A;  4BIR A;  3G71 3;  3UL5 A;  1D6Z A;  1K41 A;  5KP3 A;  2SBL A;  5GSP A;  2XR8 B;  3TDG A;  1BNE A;  1X1X A;  3EN1 B;  4R1K A;  4R4K A;  3H51 A;  2RSX A;  3FF2 A;  1V57 A;  3PZW A;  1S72 3;  1TFK A;  3F14 A;  1M9G A;  3RDE A;  1LNI A;  3QRD A;  3CCR 3;  6RNT A;  4HBR A;  1FGR A;  1R4Y A;  4WYK B;  3SED A;  1UCL A;  4ZM8 A;  2W9Q A;  3ECF A;  5M1A A;  1TIJ A;  1JBT A;  3FSD A;  4FR9 A;  1EKM A;  1OHS A;  3FH1 A;  2KRT A;  1Q40 A;  1BNF A;  1S5A A;  2YFI B;  3CCV 3;  1O7H B;  2QGU A;  2QA4 3;  1K9M 4;  4KZ1 A;  1BSD A;  4EW5 A;  1RRH A;  3GZY B;  4N6L A;  2W9P A;  2MF7 A;  1BNR A;  2ML6 A;  4U13 A;  3LYG A;  3WMD A;  3MG3 A;  1GD3 A;  5IG4 A;  5STD A;  2P0X A;  3AHS A;  1UDI I;  1BSE A;  3SYU A;  2CWT A;  1OGZ A;  4MMZ B;  4NRE A;  5D82 A;  3S28 A;  1A90 A;  1CH0 A;  1BAO A;  1NB3 I;  2B1X B;  1BRI A;  2RCD A;  5AYR B;  3CMA 3;  1RCK A;  3OWS A;  3DH2 A;  3PYJ A;  3WOD G;  1BU4 A;  3ZG5 A;  1O7M B;  2BU4 A;  4AEQ A;  2HMN B;  3PS8 A;  3LTD A;  2GEX A;  4J8T A;  2XH9 A;  3URP A;  1TU5 A;  3D5I A;  4HM3 B;  4BL3 A;  4KFE A;  2HMJ B;  4FMC A;  4RNZ A;  5JPU A;  4O8S A;  3B8L A;  1B21 A;  1AVK A;  1KSI A;  1UW1 A;  2OOV C;  2W56 B;  1PFP A;  4FMA A;  4EC6 A;  1TJD A;  2Z77 A;  1LOX A;  3I0Y A;  2XFT A;  3EX9 A;  4RNY A;  3S29 A;  8CHO A;  3CCU 3;  4O02 B;  1C7H A;  2OCT A;  1RCL A;  3ALA A;  1Q82 4;  2K3D A;  1QJG A;  3FGY A;  2BMR B;  2RNT A;  3M8C A;  3X42 A;  1NO3 A;  1Q7H A;  1SQW A;  2BNG A;  2K0M A;  2XGL A;  3AMO B;  1W6Y A;  3G8Z A;  1W5Z A;  4NHF A;  2XFS A;  4GSP A;  5IW9 A;  3HOH A;  3CME 3;  5AII A;  1JJ2 2;  3EJV A;  1A2V A;  1OF5 A;  1ZX2 A;  3A5E A;  4Q53 A;  4CDL A;  3GSP A;  1KQS 2;  3PGB A;  1VQK 3;  1Q7Y 4;  4KT3 B;  1FUS A;  1GS3 A;  1WMN A;  3WOE B;  4MEI A;  3HZP A;  1YNV X;  4XBX A;  2OOV A;  5G2G A;  1ZS7 A;  5IER A;  3HII A;  1QVG 2;  2V1L A;  2WGO A;  3CXC 2;  2XGN A;  2ZHX B;  2AAD A;  2HOH A;  1RGE A;  3X41 A;  2JQ5 A;  1WMP A;  2RFR A;  3LZA A;  1SIH A;  1LQM B;  1ULJ B;  2IUK A;  3BNE A;  1BGS A;  3Q90 A;  2PZV A;  1FA3 A;  4KVH A;  1MGR A;  1Q86 4;  2CFW A;  2PNC A;  2FXT A;  3EQQ B;  3D3L A;  3FLJ A;  3WHO A;  2W0Q A;  5BU4 A;  1KD1 4;  4O3V A;  4HM7 B;  4KFD A;  3UB1 A;  3X3X A;  3IPT A;  2GXF A;  4RBN A;  1FW7 A;  3K0Z A;  4HM6 B;  5AIF A;  3OWY A;  1N5P A;  1IVV A;  3V98 A;  4N3V A;  1A2P A;  1RJO A;  4HVN A;  4FCJ A;  1BNG A;  1BRN L;  1VQO 3;  1GY7 A;  3DGO A;  5IG3 A;  3KCH A;  1NNV A;  1JN5 A;  1RGH A;  3BNB A;  1IVW A;  1I8V A;  1DET A;  1US1 A;  1I0X A;  1IVU A;  1E3R A;  3SXX A;  1QAK A;  4XBT A;  4GB5 A;  4HM2 B;  4K61 A;  3V99 A;  1I3F A;  3CPO A;  6GSP A;  1VQ9 3;  1JBR A;  3LH4 A;  3NM2 A;  4LEH A;  1B2U A;  2BMO B;  2WGQ A;  3CNX A;  4JRF A;  7STD A;  1G96 A;  1NDO B;  3G0K A;  3B4P A;  3CC4 3;  1JNQ A;  2F86 B;  3FF0 A;  1KWI A;  4CPK A;  3HX8 A;  5IG5 A;  1AVL A;  2CX0 A;  3UNL A;  3I55 3;  1UCI A;  3F8X A;  3OXA A;  1WMO A;  1FUT A;  1MNL A;  1YGE A;  3NM7 A;  1YIT 3;  3X3Y A;  2IMJ A;  2SAR A;  2IUJ A;  4RZM A;  1B2Z A;  3KSP A;  3LTB A;  5ELJ A;  1QMA A;  3FG3 A;  3CCS 3;  3SOA A;  1OCV A;  1GY5 A;  3KN4 A;  3CC2 3;  2O9U X;  1FUW A;  1W6G A;  4XB5 A;  4CJN A;  1BVI A;  3H3H A;  3JUQ A;  2WOF A;  4K1U A;  3T8U A;  1K73 4;  1ULI B;  1L5G B;  3WDG B;  5AIH A;  1BUJ A;  1HU9 A;  2I9W A;  4WFO A;  1WTH A;  4K90 B;  1HYF A;  5JPP A;  5IEN A;  4HM1 B;  2ZL8 A;  2CFL A;  1O7G B;  4MMY B;  1T2I A;  4L8O A;  5DRE A;  3AGO A;  2Z6B A;  1LVN A;  2FGT A;  4FMD A;  4MJD A;  1JKG B;  1W01 A;  2CK3 H;  1N8Q A;  1UCJ A;  4ORL A;  3MHE A;  1QAL A;  3LT8 A;  1I2G A;  2GBX B;  4HJL B;  4K1V A;  5IG0 A;  1T5Y A;  2P05 A;  4RNT A;  4BL2 A;  1VQN 3;  7RNT A;  1EQK A;  2LYX A;  1RNT A;  3LTA A;  5AI1 A;  1JB2 A;  3FCS B;  1DVC A;  3DGM A;  5TGN A;  1YJ9 3;  4HM8 B;  3N54 B;  1M1X B;  3JUP A;  1JZD A;  1GY6 A;  1FGM A;  1RN1 A;  4LGQ A;  1LXE A;  6STD A;  1VQL 3;  4X2H A;  1BRK A;  1N9J A;  4BTW A;  4XDW A;  3ZFZ A;  4N6N B;  3CCQ 3;  4GHO A;  3UL6 A;  1LOW A;  2L1S A;  1AV4 A;  1NWW A;  1GD4 A;  1SII A;  1W4N A;  3JVC A;  3K9M C;  4WYK A;  2OWP A;  3F8H A;  4R9K A;  1I2F A;  2KF4 A;  5LC7 A;  1UGI A;  4LSO A;  3NBJ A;  5M18 A;  4WHA A;  3D4A A;  3NV0 B;  1RGK A;  2IYJ A;  1BNI A;  1YI2 3;  3LOY A;  3KE7 A;  5EQL A;  5DRV A;  3S27 A;  3PXM A;  3MG2 A;  1D6Y A;  2MC8 A;  1B2M A;  4FCM A;  1CYU A;  2R4I A;  4QWT A;  4WP5 A;  1GOV A;  1LOV A;  1IU7 A;  3MWZ A;  2E2T A;  4FMB A;  2CW9 A;  1RGA A;  1YIJ 3;  5RNT A;  3GAX A;  2W6J H;  2UUG C;  1IQ8 A;  2HMM B;  4HKV B;  2Z76 A;  4N6V 0;  1N9E A;  3MG1 A;  1BSC A;  3BNC A;  1VQQ A;  3WA3 A;  2GEY A;  2Y74 A;  3NQZ A;  1LRA A;  4I5Q A;  1J2B A;  3S67 A;  3FZW A;  4OUQ A;  5AIG A;  5CF1 A;  3DY5 A;  4XDV A;  2ZA4 A;  1MWS A;  4N6T A;  1NU3 A;  1IQY A;  3NHX A;  1GYB A;  1K28 A;  4L8P A;  3X3Z A;  2W56 A;  4BTX A;  1YJN 3;  3B4O A;  2JDI H;  5HGR A;  2O3O A;  3KSE D;  3O8Y A;  4AKZ A;  5AEW B;  4G1M B;  3OW2 2;  1EG9 B;  1ROV A;  1T3B A;  2W2C A;  4STD A;  1BRH A;  4DKI A;  1HZ1 A;  3AMO A;  3JUN A; 
#chains in the Genus database with same CATH homology
 2C11 A;  2D1W A;  1FGT A;  2Q07 A;  1O7N B;  5IF6 A;  5LC6 A;  5CLK A;  1DYU A;  2W04 A;  3NQY A;  3DGN A;  1FGO A;  3OWU A;  5BXQ A;  1JV2 B;  2CG0 A;  1OPY A;  4HZB B;  1LNH A;  4GL6 A;  3KFQ C;  1WQL B;  4J9A A;  3WA2 X;  3STD A;  2CG1 A;  3JUM A;  2C10 A;  3JUO A;  3K5T A;  3IJE B;  1ASK A;  3G16 A;  3NBR A;  3I56 3;  1TFO A;  2XSO B;  3EC9 A;  1OHO A;  3NBB A;  1V74 A;  1OHP A;  2CH9 A;  4O2H A;  3L0R A;  1ROA A;  3EBY A;  2IA7 A;  1IDP A;  3UJM A;  3EE1 A;  1CEW I;  1VQ6 3;  4MMX B;  5CF2 A;  1YJW 3;  3NXJ A;  2D42 A;  4FCZ A;  2CC3 A;  4X2O A;  3CCM 3;  2OTJ 3;  3B7C A;  1HKX A;  1YHQ 3;  4PEJ A;  4TX4 A;  3N9H A;  3EN8 A;  4N6U A;  1MOL A;  3LML A;  2Z7A A;  3MKI A;  1N8R 4;  2E2V A;  3F40 A;  1JB5 A;  3E99 A;  3PCS A;  5IEO A;  2BT3 A;  2QEX 3;  4IIA A;  3OX9 A;  1DMM A;  1ZO2 A;  4AKY A;  1Q81 4;  1OH0 A;  3Q2P A;  3QK9 A;  3DUK A;  4IT7 A;  1Q42 A;  3CNM A;  1VQ4 3;  3NUV A;  2WOH A;  2CIU A;  2CFG A;  3J7Y d;  4CCV A;  1UI8 A;  1W2B 2;  4LZI A;  2F98 A;  1NJI 4;  1U5O A;  1VQM 3;  4IPB A;  1F8N A;  3VSY A;  3BLZ A;  5IEP A;  1QVF 2;  2P38 A;  2E2U A;  1Q40 B;  3NX0 A;  3CD6 3;  5EEO A;  3VGN A;  2WO0 A;  4WWU C;  3KKG A;  2LQV A;  1R4C A;  4LMI A;  4N6M A;  1VQ5 3;  5CXO A;  2A15 A;  3EB8 A;  4OK0 A;  1W7C A;  4R80 A;  1CYV A;  1N5H A;  5D83 A;  3DM8 A;  5FW5 A;  2INX A;  3KZT A;  1W2Z A;  1JKG A;  3MSO A;  3HI7 A;  3DMC A;  4JF8 A;  3CCE 3;  2HMK B;  4R9L A;  3MYT A;  1EA2 A;  1IQX A;  2HML B;  3BB9 A;  4OVM A;  3F7X A;  5FGO A;  1O7P B;  5ELU A;  4EBG A;  2QIY A;  2YX9 A;  3Q1C A;  1UI7 A;  3SOY A;  3RGR A;  1SPU A;  2P09 A;  3HIG A;  3SVA A;  1DMQ A;  5AYS C;  3V92 A;  2UX0 A;  1OUN A;  3A76 A;  2STD A;  3FG1 A;  2RGQ A;  2YFL B;  3LTC A;  3U1W A;  4EYC A;  3GWR A;  1OF5 B;  2GU3 A;  2BHM A;  3PCR A;  1YVB I;  3SLU A;  3U97 A;  3DGL A;  1AR0 A;  2KXG A;  3RGA A;  3ROB A;  1STF I;  2CWU A;  3CCJ 3;  1M90 4;  4N6O B;  1SJW A;  3NV0 A;  4H61 A;  1IV9 A;  3S5C A;  1RKY A;  4HM4 B;  2XF3 A;  1W6C A;  1KC8 4;  3LT9 A;  3K7C A;  4I4K A;  3CCL 3;  3LXU X;  2KCD A;  3SX1 A;  3BND A;  4EXR A;  3FKA A;  1E97 A;  1IV7 A;  1K8A 4;  1Y4K A;  5I97 A;  4BTY A;  1Z1S A;  1RN7 A;  3K63 A;  5CK6 A;  3F7S A;  1DVD A;  2GU1 A;  2CFD A;  3DZL A;  1JB4 A;  3GZR A;  2XRX B;  3EHC A;  5AEU B;  1UUV B;  1A2K A;  1UUW B;  2BO9 B;  1IVX A;  3F9S A;  1JN5 B;  2YFJ B;  5EVH A;  3D9R A;  5JBS A;  3VF1 A;  1WNH A;  5BVB A;  1IK3 A;  2XSH B;  2OTL 3;  1DMN A;  2CWV A;  3GRD A;  1VQP 3;  1D6U A;  1TUH A;  1RRL A;  4HM0 B;  3T8N A;  1NB5 I;  2Y73 A;  2HMO B;  2K54 A;  3G6E 3;  1W02 A;  3KII A;  3MPH A;  4HYZ A;  1QAF A;  1U8C B;  1VZZ A;  1W00 A;  2GBW B;  5KP1 A;  2L4V A;  2F99 A;  2M7O A;  1IT7 A;  1OAC A;  2W03 A;  1VQ7 3;  1E3V A;  2ML5 A;  1VQ8 3;  2BMQ B;  2OQE C;  3GZX B;  1BUQ A;  4HM5 B;  5D81 A;  1JRQ A;  1O7W B;  3T0U A;  3WOF B;  1OGX A;  2FNQ A;  2ZDJ A;  1A67 A;  2B24 B;  4HZ9 B;  3FG4 A;  1STD A;  4XM4 A;  2CFK A;  4L7K A;  4EV2 A;  4EV5 A;  1ISK A;  3CU3 A;  3GZB A;  1IT8 A;  1PU4 A;  3CPW 2;  1TP6 A;  3G4S 3;  2OQE A;  4KFF A;  2CHC A;  3OV4 A;  2XEP A;  3IMA B;  1CQS A;  1FGQ A;  3EF8 A;  2CKF B;  4XBY A;  2P0M A;  3HK4 A;  3X40 A;  3CC7 3;  4H3U A;  1M1K 4;  3N8B A;  3DXO A;  3EBT A;  3ER7 A;  5A0O B;  5KP4 A;  3G71 3;  3UL5 A;  1D6Z A;  1K41 A;  5KP3 A;  2SBL A;  2XR8 B;  3TDG A;  3EN1 B;  4R4K A;  4R1K A;  3H51 A;  2RSX A;  3FF2 A;  3PZW A;  1S72 3;  1TFK A;  3F14 A;  1M9G A;  3RDE A;  3QRD A;  3CCR 3;  4HBR A;  1FGR A;  3SED A;  4WYK B;  4ZM8 A;  2W9Q A;  3ECF A;  1TIJ A;  3FSD A;  4FR9 A;  1EKM A;  1OHS A;  3FH1 A;  2KRT A;  1Q40 A;  1S5A A;  2YFI B;  3CCV 3;  1O7H B;  2QGU A;  2QA4 3;  1K9M 4;  4KZ1 A;  1RRH A;  3GZY B;  4N6L A;  2W9P A;  2MF7 A;  2ML6 A;  4U13 A;  3LYG A;  3WMD A;  3MG3 A;  1GD3 A;  5IG4 A;  5STD A;  2P0X A;  2CWT A;  1OGZ A;  4MMZ B;  4NRE A;  5D82 A;  3S28 A;  1A90 A;  2B1X B;  1NB3 I;  2RCD A;  5AYR B;  3CMA 3;  3OWS A;  3PYJ A;  3WOD G;  4AEQ A;  1O7M B;  2HMN B;  3PS8 A;  3LTD A;  2GEX A;  4J8T A;  2XH9 A;  1TU5 A;  4HM3 B;  4KFE A;  2HMJ B;  4FMC A;  4RNZ A;  5JPU A;  4O8S A;  3B8L A;  2OOV C;  1AVK A;  1KSI A;  1UW1 A;  4FMA A;  2W56 B;  1PFP A;  4EC6 A;  2Z77 A;  1LOX A;  3I0Y A;  2XFT A;  3EX9 A;  4RNY A;  3S29 A;  8CHO A;  3CCU 3;  4O02 B;  1C7H A;  2OCT A;  1Q82 4;  3ALA A;  1QJG A;  3FGY A;  2BMR B;  3X42 A;  3M8C A;  1NO3 A;  1SQW A;  2BNG A;  2K0M A;  2XGL A;  3AMO B;  3G8Z A;  1W6Y A;  4NHF A;  1W5Z A;  2XFS A;  5IW9 A;  3CME 3;  1JJ2 2;  5AII A;  3EJV A;  1A2V A;  1OF5 A;  1ZX2 A;  4Q53 A;  4CDL A;  1KQS 2;  3PGB A;  1VQK 3;  1Q7Y 4;  1GS3 A;  1WMN A;  3WOE B;  4MEI A;  3HZP A;  4XBX A;  2OOV A;  5G2G A;  5IER A;  3HII A;  1QVG 2;  2V1L A;  2WGO A;  3CXC 2;  2XGN A;  3X41 A;  2JQ5 A;  1WMP A;  2RFR A;  3LZA A;  1SIH A;  1ULJ B;  3BNE A;  2IUK A;  3Q90 A;  2PZV A;  1FA3 A;  4KVH A;  1Q86 4;  2CFW A;  2PNC A;  2FXT A;  3EQQ B;  3D3L A;  3FLJ A;  2W0Q A;  1KD1 4;  4O3V A;  4HM7 B;  4KFD A;  3UB1 A;  3X3X A;  3IPT A;  2GXF A;  4RBN A;  3K0Z A;  4HM6 B;  5AIF A;  3OWY A;  1N5P A;  1IVV A;  3V98 A;  4N3V A;  1RJO A;  4HVN A;  4FCJ A;  1VQO 3;  1GY7 A;  3DGO A;  5IG3 A;  1JN5 A;  3BNB A;  1IVW A;  1US1 A;  1IVU A;  1E3R A;  3SXX A;  1QAK A;  4XBT A;  4GB5 A;  4HM2 B;  4K61 A;  3V99 A;  3CPO A;  1VQ9 3;  3LH4 A;  3NM2 A;  4LEH A;  2BMO B;  2WGQ A;  3CNX A;  4JRF A;  7STD A;  1G96 A;  1NDO B;  3G0K A;  3B4P A;  3CC4 3;  1JNQ A;  2F86 B;  3FF0 A;  1KWI A;  3HX8 A;  5IG5 A;  1AVL A;  3UNL A;  3I55 3;  3F8X A;  3OXA A;  1WMO A;  1MNL A;  3NM7 A;  1YGE A;  1YIT 3;  3X3Y A;  2IMJ A;  2IUJ A;  4RZM A;  3KSP A;  3LTB A;  5ELJ A;  1QMA A;  3FG3 A;  3CCS 3;  3SOA A;  1OCV A;  1GY5 A;  3KN4 A;  3CC2 3;  2O9U X;  1FUW A;  1W6G A;  4XB5 A;  3H3H A;  3JUQ A;  2WOF A;  4K1U A;  3T8U A;  1K73 4;  1ULI B;  1L5G B;  3WDG B;  5AIH A;  1HU9 A;  2I9W A;  4WFO A;  1WTH A;  4K90 B;  5JPP A;  5IEN A;  4HM1 B;  2ZL8 A;  2CFL A;  1O7G B;  4MMY B;  4L8O A;  5DRE A;  2Z6B A;  1LVN A;  2FGT A;  4FMD A;  4MJD A;  1JKG B;  1W01 A;  2CK3 H;  1N8Q A;  4ORL A;  3MHE A;  1QAL A;  3LT8 A;  2GBX B;  4HJL B;  4K1V A;  5IG0 A;  1T5Y A;  2P05 A;  1VQN 3;  1EQK A;  2LYX A;  3LTA A;  5AI1 A;  1JB2 A;  3FCS B;  1DVC A;  3DGM A;  5TGN A;  1YJ9 3;  4HM8 B;  3N54 B;  1M1X B;  3JUP A;  1GY6 A;  1FGM A;  4LGQ A;  1LXE A;  6STD A;  1VQL 3;  4X2H A;  1N9J A;  4BTW A;  4XDW A;  4N6N B;  3CCQ 3;  3UL6 A;  1AV4 A;  1NWW A;  1GD4 A;  1SII A;  1W4N A;  3JVC A;  3K9M C;  4WYK A;  2OWP A;  3F8H A;  4R9K A;  5LC7 A;  4LSO A;  3NBJ A;  4WHA A;  3NV0 B;  1YI2 3;  3LOY A;  3KE7 A;  5EQL A;  5DRV A;  3S27 A;  3PXM A;  3MG2 A;  1D6Y A;  2MC8 A;  1CYU A;  4FCM A;  2R4I A;  4QWT A;  4WP5 A;  1IU7 A;  3MWZ A;  2E2T A;  4FMB A;  2CW9 A;  1YIJ 3;  3GAX A;  2W6J H;  1IQ8 A;  2HMM B;  4HKV B;  2Z76 A;  4N6V 0;  1N9E A;  3MG1 A;  3BNC A;  3WA3 A;  2GEY A;  2Y74 A;  3NQZ A;  1J2B A;  3S67 A;  3FZW A;  4OUQ A;  5AIG A;  5CF1 A;  3DY5 A;  4XDV A;  4N6T A;  1NU3 A;  1IQY A;  3NHX A;  1GYB A;  1K28 A;  4L8P A;  3X3Z A;  2W56 A;  4BTX A;  1YJN 3;  3B4O A;  2JDI H;  5HGR A;  2O3O A;  3KSE D;  3O8Y A;  4AKZ A;  5AEW B;  4G1M B;  3OW2 2;  1EG9 B;  1ROV A;  2W2C A;  4STD A;  3AMO A;  3JUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...