4EBQH

Fab structure of anti-vaccinia virus d8l antigen mouse igg2a la5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
218
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFNFYWMHWVKQRPGQGLEWIGMIDPSESESRLNQKFKDKATLTVDRSSSTAHMQLSSPTSEDSAVYYCTRSNYRYDYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, hea
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH02
3WFEH 2ZP0T 3SE4C 2YPKB 4PRPA 1S5HB 5CJBA 5FHBL 5HHPB 1ZVHA 2F5BH 1G7PA 1YY9D 1YY8B 3NMEA 5HDQH 4AEIH 5MEQA 2NY6D 3F65A 4LVNB 1FZOB 2FATH 5CGMA 3VXPA 4GKNA 3UYRL 1SJXA 3KR3L 1OSZB 2UWEB 3GUTA 4H8WC 5HDBE 4R6UA 4D9QE 4X6DA 2ARWA 2G9HB 4ZTPH 3EHBD 1IGFL 3JTTB 4RFOL 3EYVA 4GLRI 2M26A 4K23H 5E6IA 5ACZB 4RMVA 1I7UB 3P9WB 4DVRH 2A2QT 3C5JA 4ZUTB 1KJ2L 1I4FA 3OGCB 5L2JA 2NY5H 4GMSL 4LRIC 1MOEA 5D7LA 1ZGLP 3V0WL 3AVEA 4G8GA 3GIVB 3T4AB 4AJ0A 1Q9LB 5HGGS 5F9OL 4JM2B 2FO1A 2B0SH 5EFIA 3RVTC 3L5HA 3QFDB 5TQ0L 1G7JA 1INEL 4NC1C 4BZ1H 1A1MB 1YQVH 1NCBH 5ESAA 2EKSB 1MWAL 3AXLA 3F12A 3D25B 1G6RH 3GSNH 2DQDL 1ZHKA 3AREC 2R0WL 1U6AH 3ECBB 4DK3A 4ISVB 4LSVL 2VLKB 4DVBB 4B53A 1JWSA 4JR9H 4TUOB 5F7EL 1TZHB 4CRPA 5GGTA 5TDOA 4KY1H 2CK2A 3NFSH 4M8QB 2WV3A 1A9EB 3O11A 4G5ZH 4AEHL 3O45B 4XPFH 3MA7A 4OZGA 4J6RL 3O6KL 2A1WH 2UYLB 2GJ6E 5D96B 3S88H 3BDBA 4IOFD 1HSAA 3M1BB 1S9YA 3A67L 3THML 2F5AL 5I17B 2X7LA 3O2DH 4D9QD 5H37G 2GTZA 2Z8WC 5LXGH 3BPNB 4OD3H 5DUML 1U3HC 5ICZB 3VD4A 1GRWA 4PJFB 1H0DB 5DZNA 5AYUL 5E5UB 2ARJB 1GPOL 5F6IB 3RUGF 2LU3A 3GJEB 4XVUC 3C8KA 5ICXB 2EZ0D 3PP3K 4LIQH 4A6YA 1GC1C 2IQ9L 3FFDA 3GBMH 5C0AB 4BH8B 3NA9H 3QDAA 1FAIL 5EUKA 5K9KA 2H3NA 3T3MF 1IAMA 2P24B 1PG7X 2R2CA 4LVHB 4KRPC 5EORH 1V3JA 3QO1B 3FZUD 4NOFA 3O6FD 5GPRA 5FDWA 1J7VR 2OTWB 1DQLH 3MRKA 4IIQC 1L7IL 2AQ1A 3IDYB 4P46C 3WHE0 4UAOC 2BVOB 4XWOD 1E4KC 4EDXA 5FK9A 1S7RB 4KFZC 5K9OB 1JHLH 2W38A 3QCVH 1NFDB 1GIGL 1ZA3A 3OB0K 1DVFA 5F1NA 4WHDA 2BSSA 4ZXBA 1GGIL 2GJ6D 3M8OL 2X41A 2X4PA 2I26N 5BO1L 5FM4A 4GG6A 4PG9B 5HDBF 5IB2A 1UEMA 4G6FB 1U91B 3GJFA 1CTOA 1AGCB 1RI8A 3GSVA 1T1XB 2E7CA 3VFWA 3VWJD 4NN6B 2A9ML 2NXZB 1XR9A 4XH2A 4JZJB 4M1DL 3WIHH 8CGTA 2VWEC 4XNUH 2AV1A 5BV7H 2X1PA 5DVNA 3GMOB 4LLMB 1FCCA 2A9NL 1NFDE 2NY4D 2HLFD 1N3NA 1XR8B 3LRSA 1PD6A 3P73A 1QTYT 4JLRB 5IK3A 1CLZH 4YHNA 3TLRA 2AXHA 3X13B 1PKQB 2I9LA 4PTTA 3KPMA 3V6ZA 3ZKXB 3VXQA 1A7NH 1C16B 3OAZH 1GZQB 4Q6IC 1EGJA 3P77A 5EO0A 5DJAB 3GMMA 3NN8B 4Z95H 4LSDA 3AY4A 4LPWA 5BVPH 3UEZA 5FKAB 4QGYA 1OP9A 3DVGB 4Q2ZA 4I0PA 1NBZA 1MJ8L 5KVMC 5E1AB 3T65B 2DJSA 2ZPKH 1INDH 4PG2C 1P4BH 1F90L 2APBA 1JK8B 4KKLC 4P2OC 2ZUQB 5I19L 4DKFH 3DV6A 4RGOL 1WEJL 3QQ3A 1JPGB 3ZYOA 2P5EB 1FNSH 1J10A 4LU5L 4M61B 2AV7A 4PTUA 4KDWA 1P1ZA 1MLBB 4LLAA 2DKUA 4ESKA 1BQUA 1Z9LA 4XT1C 1PSKH 1RIHL 1Y6KR 2VLJA 4YEFA 3QRFM 2E9BA 1X5HA 3K0WA 2LAAA 4GRLB 2O26U 5EULV 2Z8SA 1K5NA 3P4NA 4MCYB 4PRAA 3MRGA 4LF3A 3TZVC 3QNZA 3U9PH 5FECB 5IHZA 4NKDB 1S7TB 4PV9B 5C0GA 3V4PH 5E2TH 3DRQB 4ODTL 1QFHA 4FMKA 3P11L 4JVWA 1IC7L 3EO0B 2ZKHL 3G04B 4XCEB 2OS7A 5LWYL 4OLVH 5HYJB 5JDSB 4PJ9C 4RQQA 4GW4A 3C60C 4PJXE 1H8NA 4I3RH 3I50H 1MVFA 2DWDA 2FWOB 3PWUB 4L29B 4ODXB 4MA8H 4WV1A 4N0UE 3SDCB 3LPFA 5EDXA 4B41A 3VXMB 1DLFL 2CDFA 3P0VL 2O5YL 4X5LA 1WITA 3UC0H 2HMIC 5SWQB 2NX5A 1G7IA 2FH8A 3FQNA 2WBJA 3U48A 1CXKA 3ZKSD 1KJ3H 1JMZA 1FNEB 4NQDB 3W0WE 5EZLA 1MCNA 3PXJA 1VCAA 5DHVA 2PNDA 2P5WA 3W11C 3QHTC 4RISH 1I8LC 1QFWM 4Z7NE 2UZIL 1Q94A 2DKMA 3QG6A 5EU7E 4OD1H 5IVZA 1CK0H 4L9DA 2AXGA 4RBPH 3RIAF 4M62L 3KYOA 3RU8L 1YNTB 5BW7A 1HXYB 2BVQA 3QUML 4WDIA 1YQ2A 2MKLC 2VLRE 3VFGL 1XF3A 3G6JB 2HT3D 4XXCC 2P8LB 4S10A 4U6XB 1NFDF 4K94H 3MRRA 3GSQA 2FIKB 3EYOB 2IG2H 3VFMB 2DLTA 1J1XH 5BS0D 5KTEH 4NKIH 1J9CT 4KMQA 4BK5A 4LQ1A 5C92A 4FQ1H 5ACMA 5TE7L 5HI3D 1FNGB 4P9ML 4PB0H 2XTJB 2ZNWA 5CBAA 3P4MB 5HPMA 1N0XH 2VZVA 4RFNB 5JMOC 2R2EA 1F11B 1MJ7H 4U0QB 5FB8A 1UACL 1YPZB 5F9AC 2MCPH 2BMKA 2XWTA 4E0RA 2BY2A 2XKNA 2MJWA 3SGJA 4PGDB 1ACYL 3ZYIA 1JGDA 2LQRA 3KPNB 4XNXH 2DM2A 3W0WD 5JW4N 2Q6WB 5TGBA 3GMQB 2EYTA 1ZLSH 3KYKH 2FLRT 4HPOL 5ENWB 3BP7B 1NDGA 2ZWLT 3BIKB 1OL0A 5F9JA 1FLRL 2XRAL 5HYFA 4FFYL 2NW3B 2MQ0A 5DMJB 5BQ7B 2Y06L 4NP4H 1BD2A 2VXVH 4MQ7A 3QJHB 1IC4H 2Y5TB 3Q2CA 1F6AB 1WBZA 4ALAL 4L8SA 4WI9A 4LCCC 4I13B 3VXUA 5IESL 2LTQC 4IRSA 2VLRD 3TT3L 2BOCB 2JJTC 4M7ZC 4DGVH 1ZLVK 3KAAA 3AAZA 5EC1A 5F9DC 5I6XC 4KPHL 4Y5YB 3WDIA 1BFOB 3BQUA 4OGAC 3KPRB 1JNNH 1OLLA 4OLYL 4PJXF 4ZUVB 4P4RA 4PPTA 5FCUH 1DN0B 4HPYH 4GAJL 3S34H 1OGTA 3BO8A 3IXAB 5EBWA 1O5DT 2HKFL 2H26A 5JXAL 5KS9B 2DLIA 3UTSB 1F4HA 4GAYB 4HUVA 1A5FL 3B8YA 4XC3L 2YBRA 4PUBL 3TVMB 1MF2L 1FFNB 4HHAB 4JPVL 4MDIA 3ILQD 3DWTA 3JVGA 3FCTA 4OGZA 3P2TA 2ADIA 3SKOA 1KIRB 1YEHH 1SJVA 4NC0B 3V4UH 1CIDA 2H2SD 4OFDA 4R7DA 3QEQB 1GGCL 4PRHE 1P84J 4D0BA 2C7UA 3OX8A 4Z7NF 1VFAA 1DZBA 2IH3B 3T09A 1KEGH 2RHEA 1MCBA 4JFZL 5ESVA 3TIDA 1Z3GH 1OY3B 4N9GA 4HKBB 2VL5B 4Y5XB 3L3OB 1KN4L 4AIOA 3LEXA 2HT4D 1RFDH 5KS9E 1TJGL 4D0CB 5E8DH 3MV7D 2AK4E 1K8IA 3LVEA 2K7PA 3CIQA 4X83A 5B8CC 1S5IH 5IMMA 1NBYB 2ITCB 1NCDL 1XCQB 1S9KC 2BSTA 3JWNC 2VR5A 3CXHK 4XZUB 2V2XB 3VJ6B 3TIEB 1QQDB 5I0ZA 1UJ3B 4U1LB 1CDBA 2ZJSL 4M6NL 1RUAL 2WUCL 4X4XA 5ADOH 1GGUA 4HIIA 4HULB 1CGUA 5BZWA 4OLUH 4QCIA 3NCMA 1P4IL 3E6HB 3O41B 4FN0A 4H1LB 3KPSE 2X4QB 3QXUA 4OM1L 3OF6A 2J6EL 2FRGP 2PCPB 3FB8B 4L4TA 1P4LB 1OT2A 3V5KA 4CL7A 3EYSL 3HC0A 1U42A 2X9WA 5JOFA 1LD9A 4YDJA 4PLJD 3MGTB 4R4FH 2GY5A 4GLRH 3L9RA 5EPMB 1JE6A 2YD1A 4PRHD 3ULSA 1U8PB 3O3EB 2BVTA 2OR9L 5C0IA 4YDIL 5IV2B 3WIIH 2OZ4A 1U2HA 1TXKA 2EDLA 1XIWC 5C0CE 1LE5A 1W8OA 1FYHB 4MZ2A 3ETBF 1DQDH 3NTCL 1ZT4A 4RAUA 2Y07L 2GJJA 3HAEB 2Y7QB 4HK3J 5D70L 2FO4B 2AK4D 4HFWA 4ZS6C 2QR0B 1BOYA 5LKNA 4PR5B 1KT2A 4YBLC 3HUJB 1WZLA 4DOHE 4OD2A 1JUFA 5F7UA 4BUHA 2XV6B 3K74B 4DEPC 4MJ4A 1TCRB 5CS7A 3TJHC 4NFCA 5ECJE 4HXBH 1DUYA 4RX4D 4M3KB 3PP4L 4HWBA 1S7SA 4LSUH 5EOTB 5K33A 4MYWB 4EBQL 3KYMA 1I1AD 3GGWB 2G5BA 3NACH 1W0YT 2A74A 2DBJA 4KVCH 2QTEA 3ZDXE 2X4SA 3RY5A 3ARFD 4FQLH 4NHCH 4GAGL 5DO2C 3BVNA 2CXGA 4QHMA 4KROD 4PJ8C 4JB9L 4ODSL 4X98B 5BMFH 4AYFA 1L9MA 4KU1A 5DC4B 3IAGC 2AP2A 4P23B 4I4WB 5SWZB 2OP4H 4NCC1 5D7JD 3GSUA 3RPIA 2CUHA 2WLZA 1VACA 3QEHB 1JGEA 1NGQL 5J4MA 1S9VB 5KSAB 3L3HB 1ES0B 3WO4C 4QRPD 3SKUD 5FO7A 1BJ1J 2K9UA 3I6GB 1RD6A 15C8L 2UZYB 4TUJB 3QUZB 4NO2B 4ZSOB 5C0CD 4DK6A 4HV8A 2PO6C 4MD5A 2OTUB 4MCZB 3PABA 5JXEC 5GS1B 5KS9F 5DK2A 1DBAH 3VFPB 1EVTC 1BJ1H 2XQBL 3HMWH 4H1LH 5IHUH 3OKLA 3UAJC 3WN5A 3IDNA 3QXWA 3PJSA 5KANI 2EXYC 3VFNB 5KW9L 1CTNA 3DTXA 1ZVSA 3MLYH 3U4BL 3OAYH 3MUZ1 1U8QA 5T5NF 1QEWA 1WBXB 3NFNA 2CDEB 1UWEL 5CINL 1VHPA 3ZKND 4M7JL 5J06A 3K4ZA 2AJSH 4S2SB 1I8MB 1KFAH 3HC3H 4Y2OA 3RGVD 2Y36L 5JOPE 5KG9A 1NMBH 4XP5H 2OR8A 4LEXL 3TT1L 1B0WA 3HAEH 3ZE1E 3ZTJH 4YE4L 2CR6A 3VXRB 5C9KA 1JZ4A 3TO4C 1CFBA 5CZVH 2OMNA 2FX8L 4RAHA 1CU4H 4ELKA 4GMTL 3MFFA 1S7XA 4XMPL 1KYOJ 5JR1L 1Z6JT 3F7YA 4DGIH 4RA3A 3N85L 1N64H 1AGEB 3VG9C 3WJJA 3RAJL 2C4XA 1JRHL 4XCCH 1HDMA 3LS4L 4QKXB 3SDAD 4C56B 4L5FL 3K3QA 3T04D 4P0DA 3HS0B 5D1QC 4U1GC 5CCKL 4LLDA 1A21A 5K9JL 1HQ4B 2JIXD 5GZNC 3SDYH 4J1UB 3ROLA 3LQMA 4X9GA 4Q9CA 3KPQA 5IJKA 3UZQA 1OTUD 4KAQH 1K6QL 2Q86B 1RMFL 1CICB 1BQHA 1B2WL 3X3GL 3GSWB 3C5ZB 4F7CB 1TZIA 2Y4SA 4KK5C 5CSGA 5D7IE 2YD6A 4OCNC 2CLRA 5I9QB 4WUUE 5HI5C 2Z31A 1F8TH 4JO3L 2Z93B 4NZJA 4Y5VC 5CJOH 2AXFB 2AJZA 1QA9A 2B4CL 4LKXA 3T0DA 3MLTB 3UJIH 1NQBA 2W65A 3JSSA 3ZDXF 4R4BB 5EBMA 4U33A 1CI5A 5GS0D 1HXMB 5FA3B 4G43A 4AQ1B 1QSVA 5FXCH 3DSFH 2HRPH 5JOPD 4TRPL 3QUXC 1E27B 1N26A 5EU3B 1MCHA 2BHZA 4HH9A 3PWJA 1QHPA 1YUHA 3EO1A 2FHFA 3WUWB 2FGWL 3MBED 1CFVH 2VQ1A 2VLME 4IIQA 1A7PH 5FGRA 1LEKA 5I1CL 3S36X 4P46A 1YYLL 3CFJB 1E4KA 5F3BB 1CGYA 3W82A 3GZKA 5L2KB 4MA3B 1WFUA 1AE6H 2RB8A 2BCKB 1B0RB 5F8QC 1PW3A 3VFRA 4ZD3H 3BUTA 1IM9A 2KQMA 5DJYB 5EU4A 1OAUH 4CNIB 4MWFA 2VDPH 2YD4A 2FR4B 1IT9L 5DJ6A 3TV3H 2GK0A 4GKSB 2EDKA 4XNYH 2AABL 1VGEL 2ESVB 2W9EH 5I1LB 2HTLD 5DD1L 3QHZL 4ZQKA 1A6ZB 4NQSB 2YUVA 1A3RL 4QRQB 4R2GB 3A6BH 1X4ZA 4QTHB 2BNUB 5KVDH 4WUUD 43CAB 2E6QA 1MFEH 3KXFA 1F58H 3FOMB 5BOPA 1WC7B 2D31B 5EO1B 5LBSH 3OKDB 3FQXA 4MNHB 4YHIA 3H9SB 2R1XB 4FFVC 4XWGL 1MHHA 5TFSH 1T7WA 2XZAL 4NUGH 3MR9B 4C55A 3ZE1F 3HI1A 4LCWE 4JFFA 5IHBA 4LOUD 1HHKB 2IANB 5C0BA 3D2UB 2VB5A 3UPAA 1FO0L 1D6VL 5I18L 1JGVH 1VGKA 5E8EB 1QLEH 2W9DH 3VCLA 1KPUB 2GAZA 5JZ7C 4RZCB 4U4BA 4BQBA 5H94B 4ODHH 1G9NH 1NC4D 3GI9H 3MYZA 3QIWD 5EC2A 3PGCB 4PG2A 4OI9A 2QQKH 3CD4A 4XAWH 5MERA 5CLTA 4P5MA 3QR2A 5A16A 1CGWA 3IDIB 4BFIB 3Q48A 1JZ3A 3DX6B 1H15A 4NPYB 4QHLB 2A6JB 4P5TC 1KLUB 4ZAKD 5IM7B 4DN3H 5D7IF 3TH2T 1MI5B 1NGPH 4ZODA 5D7SL 5J11C 3ZHLA 4HIHA 3T2QA 3EJYD 2VLLA 1SY6A 4I77H 3U36A 2EH7H 3HMXH 5IB5B 1WWWX 1OW0A 4PJ7B 1U2CA 3QI9B 3TYGH 1YY9C 3MNWA 4BKLA 1R24B 2ATKB 3CLFL 2NY6C 4PJ9A 4LCWD 5D72H 3C60A 2XNAB 5C09D 1A7OL 1WZMA 4OGYH 5B3NA 4LHUB 1CGVA 2X42A 4ERSH 3Q5TA 1CXEA 5TE4L 1JNJA 4NM4L 3IJHB 3ZHKA 1CD0A 3OXSB 2JELL 1XGQA 5D71H 2R0LH 3UJJH 4OAWA 2A73B 4YBQC 5AZ2L 1FC1A 2XPGA 4XB8A 3RIFK 1MPAL 3RWCA 4XP6L 4U1HA 1U8HA 1K2DB 1PEWA 1U8KA 5E8NA 4UT6L 5DLMH 4NSKB 2ENYA 3RX8A 3F5WA 1TJIL 4J4PD 5I8EB 3I85A 2GKIA 2EDJA 4OFKA 3UZVB 5D2NE 4PJ5B 4LLQB 1MJUL 3MODH 1RHHB 5ITFA 3HG1B 4U6HB 3IXTA 2VRAA 3S5LA 5IEHB 2P1YA 5T1LD 1WBYB 2BFVL 3GRWH 5HHME 5DA4A 3QIBD 4NZDA 5C0EB 3V6OA 4Z7QE 3L7FA 3QCTH 4FXKA 3DX8B 3VW3H 4RRPA 3G08A 4FTVA 3T2NL 2EICA 3HB3D 4XX1E 2B5IB 5GJTL 1GHFH 5F9WB 2F53E 1LE9B 1GGYA 2NY1B 5BVJB 4JHBA 3F7RA 4P99A 1PZ5A 4AG4L 5F7WC 4Z78B 4IOFC 1KB9J 2DQGH 2V17L 4WWKB 2J88L 4QRRB 2Z91A 4LPCA 3OKEA 4NQXA 3MACL 5CEZE 2XWJB 4RGNE 1D5BA 2F15A 1NDMB 2QL1A 4M9OA 2H9GB 2EKJA 5E2VH 4IJ3C 3U30C 1UWGL 5JHDB 5K93A 1BVLB 3LB6C 4Y1AA 5FV2A 4OZIA 3WNMA 3TBYA 1OSPH 2E7MA 3BD3A 4HS3B 4U0RB 5I8KH 3BGMB 4XBGB 5H37H 2EZ0C 5ESQA 5F96L 3RWGA 4YHMH 2GK2A 3NGBC 4G6AD 5DZLA 4YDVA 4YHLH 3MRLB 1KELH 3HZVA 1TPXB 3SDXA 1DLHA 1S7VA 2EC9U 3FZUC 2XZQL 3U46B 5HHMD 3O6FC 4QRRE 5L0QC 1I8KA 4LCCA 4K3EL 4JFOB 4M7KH 5K9QI 3NCJH 4GRMA 3L7EB 3IFPB 4PS4H 5KSVB 2IGFH 4G7YL 4XWOC 5D6DC 2JJTA 1R3KA 1QYGH 5KZCB 3FMGL 5JORA 2F53D 3D85B 3C6SB 2F19H 3RKDD 4C54A 1GGTA 3RVXC 1BVKA 2GT9A 3CFDA 3RNQB 2VDRH 3S35H 3GM8A 4O2FA 1KN2H 1LO5A 1MVUA 2VXUH 2XA8L 4NO5B 4P2QE 1HNFA 4XMLL 2NXYD 2WBWB 3GEWB 5ITBH 3QPXL 5T3XH 3OMZA 4EXKA 3RDTB 1IL1B 5FYJE 5CEZD 5EB9A 4KQ4H 1OGAA 3HCVA 4MZ3A 4K2UL 3VWJC 4RWYH 2VXQL 2FL5A 2YPLD 5FGBA 5IROC 1SMAA 4EUPB 2F74A 3S9DB 3TBWB 4WHYG 2R1YA 4KTDL 1CWVA 3BH8A 1NLBL 1KB5L 1UT9A 2FBJL 3QQ4B 5DMIL 1ZKAA 4LSTL 1FIEA 5ILTL 4W4OA 5DI8A 1T04B 2NY4C 1GXEA 1RJZA 2HLFC 4JFPB 4NKQB 3PGDB 1E4XL 3RNKB 4X5WB 3IDXL 5ALBH 3ME0A 4UMGA 1BQHG 4QHNA 1URLA 3JBG7 4WI5A 3FQWA 4Z7QF 3CLEL 3TA3D 1SBBA 4CN4A 1HZHH 3EO9L 1CGSH 3IAPA 1JTPA 4DZ8A 2YEZB 3NCYP 1UFUA 1UH2A 1X5KA 5HHOB 3DGCR 4OZHA 5F6IC 5F7MC 1T66C 3AS1A 1RZKH 4HW6A 4R97B 1ZLUH 1WJ3A 5E5RB 2JLLA 4RWHA 1WIUA 1A14H 3VXSE 4Y7MA 1YEKH 2CO7B 4P2QD 3VH8A 3HE6D 2E9IA 3PQYB 1T1YA 2X4RB 4IOSD 3PG2A 5FYJD 5HTSA 4EN3A 2ZG2A 2P45B 1NPUA 5TH2B 5I71B 4MA7H 1EHLH 5EUOE 1TJHH 3BUYB 3H3BC 4YGVB 4MVBC 2EH8L 1VFOA 4BSWA 4OCXL 1NEUA 3OKOA 3P3YA 2GW5A 4OQTA 1NMAL 3BHBA 1K85A 1Z0NA 3MREA 3JV4A 4R4ND 4GBXD 3LKQA 3BZ4A 3HE7B 3D0LA 2HFEB 2N7AA 2JJSA 2MSPA 3LKRB 4U6YA 1OP3H 4L3ED 1LGVA 4JKLA 4QOKD 3CFIC 4BFGA 1PQZB 4XNMA 3ZO0A 3BKCL 5MEQB 4Z77A 4YK4B 3P30H 3OKMB 1YDPA 4X4ZA 2FX7H 4EUPH 1CFTA 1BEYH 2HFTA 1BFSA 1LHZA 2G75B 2RFXA 4JZJC 4U31A 3V5DA 3L1OH 5IFJB 3I9GL 4G9FB 3CSPA 5IKCA 3VWKB 1NFIB 3VXSD 2FJFA 4FQPA 4IEFB 3S6CA 3VGHA 4DKDC 1MH5A 2JJVA 2W59A 5SX4H 5CGYD 4E41A 4WO4B 5L8KB 5DYOB 2RCSH 5F7LB 1LP9A 3DBXA 4M6ML 5DRXB 3MLZL 4PYHA 3CVHA 2VDOH 5ESAB 4OQ1A 5JIIA 4HG4J 2FEEI 1T21B 3IFOA 4OLEA 4QRUA 2H32B 3Q6GH 3E6FA 1WZ1L 4K3GA 4P4KD 1C12B 1EZVX 2ZUQC 4P49A 1ZEAL 4Y4HA 3SCMB 5KN5B 1YMMA 2QADC 1H3XA 3HZKB 1HWGB 1WCQA 4OZFB 2NLJA 5HI3C 4L4JA 2PO6A 1NC2A 4URTB 1QVOA 5C8JA 4YH6A 5CZXD 1CL7H 4BSVB 1MQKL 3Q3GA 3T77A 1RZJH 4GS7C 4OF3A 4Y4KD 1BFVH 1G6VK 2DQUL 2NNAA 4K3HA 3IJSA 4EQ3A 5DT1H 1KUMA 4P59L 1HH6B 3RPKA 4R26H 2HVKA 1FFQA 1B0GB 4ZS7H 4P3DB 5IVXB 1MFCH 5E9DA 3EIFA 4G9DA 4MNGE 4W81A 4KJYB 5KVGL 1AQKH 3LIZL 5E24E 2C3VA 3QG7H 4X9IA 5HGAA 3EYQC 4G6JL 2ITDA 3KPPB 4X4MA 1CF8L 2EDHA 5EU5A 4LNRB 5EU7C 4P3WA 4F15B 3FFDB 2DD8L 3X11A 5EUKB 4KK6D 5EUOF 3L5XL 3P9MA 5IFHH 3IDGA 2H3NB 2DLFH 5FO8B 1TIUA 2R56L 5C08E 3G5XB 3FO2A 4XVJH 1FGVH 3RVUD 3QWRD 5EZOH 4ZDHB 1NCAH 2E6JA 5GQBA 5CJ5A 2JB6B 5MENB 4LPYA 1AR1C 3LKOB 2YK1H 3MRFA 4LSPL 2DYPA 3IRPX 1CS6A 5DQJA 5GS0L 2CJUL 3S5LG 4UOJA 3U7WL 5JIPA 3V0AC 5DS8B 5AAWA 5A3ID 4NJAL 1G7MA 1D5XB 3QULA 4BZ2L 4PJAA 1TITA 2DI8A 4U49A 4P9HH 4RRPG 5C0AD 3ILQC 1XFPA 1DSFL 3GJFB 5FYLH 1NKOA 2QQLL 3GSXA 1ZE3C 4LQFL 5LGJA 4U1IA 2JK5B 4PB9H 2H32H 2H2SC 1EAJA 3WUZA 4O2CA 1QZ1A 3REVA 4XH2B 4FS0A 1OQOA 4XHJD 2K3TA 3QWQB 5SWSE 1A6VL 3V4VH 1HILB 3OV6A 5GGTH 2FGZA 4NO0B 3MA9H 3C6LB 3DVNA 35C8L 1OARH 3LKNA 3RJQB 4JDZA 3WKNA 4JDVB 1AY1L 3P73B 5IK3B 4QRSB 3MRQB 3AS3A 4HK0A 4MD0A 2EEAA 5C08D 5ID1B 4EDWH 1YC7A 5F7YC 4QY8A 5D9SA 2HP4A 3DSNA 3TH3T 5FGSA 4QRTA 1EEYA 2PW1A 5JQ6L 2EDQA 3DNKA 3CFKA 5EBLB 6FABL 1AJ7H 1OAYH 3HNTL 4RGMB 2WNGA 4KK9D 3VD9A 1X5FA 1PBYA 5HVHC 5GRUL 4UT9L 1SHMA 4X4YB 4A6YH 5C0RH 3DMMA 3TF7C 1FGNH 4LLUA 2E7HA 4TNVK 3FN9A 4EI6B 2VR4A 3MRBA 1KLGB 3DLQR 5J6HB 2AAVA 5EOCJ 4NQCE 1QFWL 2I24N 1PLGL 2VLJB 3MROA 2VDQH 1RIUL 3ARDA 4PLJC 1G1CA 1BIIB 4Y5YC 1EIBA 1JZ8A 3WNOA 5CHNA 3MV8B 3MOBL 5SWSD 3BZEB 4DTGL 3BYTA 4MMZC 5C07E 5EOCH 3RIAK 1FL5A 3E1F1 4MJIB 3BP6B 3OKNA 3UTPD 3O3AA 1OAQH 1UCTA 3QSKB 4JFDB 3WD5L 3RFZC 2E9WA 1OOAA 2AEPL 5DC9B 3ABZA 1Y0LA 4PY8J 3WV0A 3U2SB 1Q1JL 3LEVL 3LKPA 2B1HH 3L3JA 2Q8AL 4JQIL 1B6UA 4JG1L 3LN5A 1NJ9B 1I3RA 4HJ0D 3OAUH 3GJFH 3O3BB 4MJ2A 4PJGA 2AJUH 4PV8B 3SJVB 4HAFA 4WJ5B 4PJBE 2IJ0C 5DJ0B 3SBWC 4P2CG 1I1AC 3FT3A 1JNLH 4K7FB 3EBAA 1YNKL 2YPLA 5DJ8A 1ZOXA 3H8NA 5DJDB 3PDDA 3Q6FA 2BX5A 3ARFC 4XVTH 12E8L 4NJ9L 5HJ3B 5T1MB 4HIJB 4KROC 3LZFL 3V52L 2PUQT 4HK3N 5SV4A 1FSKC 1IEAA 3O4OB 3ILPA 5D7JC 2BXZA 3QIUB 1R0AL 4NQCD 5HYJD 2NYYC 4QF1A 4PGBA 4R7NB 4AH2A 2NTSP 2CUIA 2EXWD 1I8IA 5MEOA 2NTFA 5I1IH 1T4KB 4WDIB 1T1ZB 3MV9E 1UJ3C 4XRCB 5GSVB 5C07D 5I1KL 3DHMA 3VH8G 1D5IH 5FKPA 5KSBB 4TTGA 4G8EA 3EFDL 4QXGH 3GSQB 4GSDH 1KCVH 4OM0H 1RUKH 4OSUL 2V2TB 3R4DA 3LQAL 1AKJD 2VC2L 5E2UL 3O2WL 5CWSA 4JANB 1MLCB 2ERJB 3V2AR 3K8LA 4ZO6A 4U6VH 3HLAB 5F88B 2DI7A 3QUYA 4UUJB 4WW1B 3KLHD 3IT8D 2VABB 2CK0L 2DTML 2PXYC 3FB7A 4FQHB 4EEEA 3MXVH 4UDTB 3RWJA 1R5VA 2OI9B 5ID0A 2L0DA 3BPLC 1KJMA 3CDGA 1D9KA 2YRLA 2VSDA 4JFYA 1VEOA 3TBTA 4POZD 2R9HC 5DK3A 4UIKL 5F1OB 4V1DE 1E6OL 1QNZH 3ZKNC 3NABL 1BQSA 1QSFB 5I1JL 3RWDA 4K7PY 1SJHB 3RGVC 1HE7A 1N5YH 1SBSL 4QXUH 3SO3B 1K4CB 1FFPA 4TYUA 4NRZA 1LILA 4NFBA 2CSPA 5EIQA 5CP3H 1ETZB 3GSNA 3ULVH 2M2DA 3S4SB 1LO0H 2DQFB 3KYAA 4NGHH 1RUPL 2B1AH 4GOSA 4OJFL 2VKWA 3C2AL 3F7PC 4G8FB 3ZKQD 5CJ8A 4N0YL 4KK8D 4Z76A 2Y9RT 3MV9D 2BY1A 4FQIL 5I1DA 3HTLX 2P44B 1VB9A 3SDAC 1U95B 1YMHA 3HZYB 4YXHH 1DCLA 4OLZH 1CLCA 1UXWB 4KKAD 3NFPB 4ZUWB 1MHPH 4YBHA 1JF1A 5E56A 2O5XH 3VGGA 4P4RB 3FT4A 3BFOA 3DUHA 3BO8B 4ZFOL 5DJZA 3RZCD 4TSAL 3PUCA 7FABH 5I1EH 3O2DA 3W2DH 1J8HB 1NCUA 3QDGB 1DEDA 2BRRL 2QSCL 3KG5A 1C1EH 4QHUA 1CDIA 4PJBF 32C2B 1MUJB 5DD5L 2IALB 1JPSH 5KSAC 1Z9OA 2YPKA 1Y6NR 4CBPA 4JFEB 5FYKH 1S5HA 1GAFH 5DQ9B 5HHPA 4V1DD 4KZEH 3OJDB 3QUZC 5IEKB 1WFOA 2PYEB 1EBAA 1KENL 1B4RA 1F4YH 1YY8A 1JZ7A 1JZ5A 2VSCA 3OX8B 1FZOA 5IBLC 4LP4A 3ULUE 1OSZA 2UWEA 1C5BL 1HHIB 1PAMA 3BWAA 2RAMA 1KCUL 3PWPB 2J4WH 2G9HA 4HWUA 4TNWF 3JTTA 1K8IB 1AQDB 1R3HB 3MMEB 5ACZA 4LMQI 5T3ZH 1I7UA 3WDHA 4M6OL 4FNLL 1DBJH 4ZUTA 3OGCA 1FDLH 3RX7A 2VIRA 5CUSH 3GIVA 4XP1L 4PRDB 3G6DL 3T4AA 1Q9LA 5EZJB 2P46B 2YSSB 3CDCA 4JM2A 2BSTB 2R4SH 3QFDA 1TTFA 4G6KL 3M17B 3WFEL 1A2YA 4X7EC 1A1MA 1T7ZA 4YDKL 2HTLC 2EKSA 2X70B 4GKZB 2Z8VC 3H2WA 3D25A 1CLOH 5DR5L 5ISZD 5IROA 2COQA 3TO2B 3ECBA 4ISVA 3MNZB 4QT5B 5HDQL 2VLKA 4AEIL 4DVBA 5I15H 1P7QD 4TUOA 4I1NB 1NUDA 3O9WD 2FATL 4N8VB 3QXAB 4GW5B 1WV7T 4P2RE 4M8QA 1A9EA 3V7AE 3O45A 3D18A 4OBRA 2GHWB 4HQQH 2AEQH 4ZTPL 2UYLA 4FG6C 1CXHA 1QD0A 4K23L 4LOUC 2BVEA 4DVRL 3M1BA 5FYJL 1LE5B 2NY5L 4PGJA 3RVWC 1I9JH 1CICC 5ANMB 5I17A 2AGJH 1ACZA 4WFFE 4LGRB 4HBQA 2B0SL 1NLDH 3TPKA 5ICZA 5I9QC 4QHKI 3CGTA 4PJFA 1H0DA 3QIWC 3MJ7B 5HI4C 2ARJA 4J3VA 4BZ1L 5CKGA 4L4VE 1YQVL 2D0FA 4N0CD 4RMTA 3OXRB 1G6RL 1EXUB 3GJEA 3GSNL 5ICXA 5T5FH 1IARB 1QRNB 1Q9KB 3QXDB 4XPGL 1ZK9A 3ZT6A 1MFBL 4BH8A 1YEGH 4J3OC 4RFEB 5D1XB 1RIVH 3T0EE 1T80A 2HN7B 3SGKA 4OIBA 5T33H 4KH2A 3RWIB 4KY1L 1I9IH 3QO1A 1OTTD 3SOBH 1RU9H 2OK0H 2QQNH 3MLRH 3LN4A 2OTWA 5E2WH 1CDUA 4G5ZL 2Q20A 1W8NA 3EJYC 4XBEH 2BVOA 3PNWB 5DRZA 3S88L 3K4AA 1YJDH 5DJXB 1FZKB 1S7RA 1Z5LB 2EE6A 4MX7B 5K9OA 4P2RD 1J0JA 1I3GH 1TZGL 1NFDA 3IGAB 4YHPB 1UM4H 1FZMB 3ORJA 5LXGL 3QDMB 2XIDA 5LGHL 4OD3L 3MJ9H 2YN5A 4K8RD 2BZDA 1ITBB 3ULUF 4WI8A 4PG9A 3GMLB 2F8XC 4MD5B 1U91A 3CUPB 1LK3H 4XCYB 4FQXC 3HPLB 1AGCA 2XXMB 4WFFD 5FO9B 5L7XL 1T1XA 4R2GC 4M02A 4KQ3H 4LIQL 2HAZA 3GBML 3VD3A 4BFEA 3MLPA 3NA9L 4JZJA 2YPVL 1IQDB 1ADQA 4EI5D 4L4VD 5GJSH 4KV5E 1NBVL 1A0QH 1PDKA 1F4AA 1LO3L 4G7VH 3DX7B 5SWZD 3GMOA 4J4PC 4LLMA 1UA6H 3LV3A 4L8CB 2B20A 1DQLL 3LQAC 4GH7B 3SDDD 1XR8A 4LAQL 5EOQH 4JLRA 3EYUH 3RWEB 3T0ED 3DX9B 3X13A 2X1QA 1PKQA 3U6RB 4WTWA 1KF9B 1XGTB 3BP5B 2W0LA 1C16A 1GZQA 1EK3A 4ZPTB 3DV4B 5DJAA 1RJCA 1JHLL 3QIBC 3B3IB 2NY3B 1AXSA 3NN8A 1MCPL 3HR5B 4JDTL 3HI5L 5FKAA 1EFXB 3DVGA 4KGJA 1MCKA 4L9LC 5E1AA 2B7DT 3B43A 2HWZH 4LARH 2DMKA 3T65A 3HB3C 3AREB 3D39B 5CJXC 4ELKB 1FYTB 5DURB 1JTOA 1JK8A 3FQTB 3T0WA 1MEXH 3A6CH 4LLYB 2D7QA 1JPGA 2FJGB 2P5EA 3VFOB 5FM5M 2HH0H 3KGRA 4HWBH 5A2LH 4M61A 4ELME 5ADPH 4R3SB 4JAMB 3WIHL 4P2YA 1J05B 1MLBA 2MKWA 4MXWH 4XNUL 2C9AA 5BV7L 1I1FB 1LDSA 5IGXH 1GZPB 4ACPA 1JPFB 4GRLA 3EZ8A 1QO3B 3U9UB 3B5TA 4MCYA 1FVCB 1TQCC 2CO6B 1CLZL 5FECA 2VITB 4NKDA 1S7TA 4PV9A 1A3QA 1U3HB 4PGCB 3DRQA 1A7NL 1JP5A 3QI9C 5TE6L 4Z95L 4G6AC 3TWCH 5BVPL 4XCEA 4HWNA 4LKXB 5D2NC 5JDSA 1IGYB 4U7KA 2CGRH 1N6QL 2Z92A 1TQBC 4FQJH 2FWOA 3W39A 3PWUA 3SDCA 1I3UA 1F02I 5J1AB 2APFA 3VXMA 4JGMA 4QLRA 3ZE2E 4S1DD 5C3LD 5SWQA 1CR9H 1FNSL 2BP3A 2FHCA 4KRPB 2XWBB 1QSEB 3EO1B 4ZO8A 4H8WH 5BRZB 4LBEB 3BKYH 2VQ1B 1FNEA 3JWDC 4IIQB 4NQDA 3VE0B 3VA2C 1KTLB 4RAVB 3RKDC 1JYWA 5AWNH 3V0VB 3ZSSA 4KKNA 1F6LL 5L88H 1JJUA 2ICWI 5C70A 1JPTH 3IFNH 2V2WB 3U9PL 1DBBH 5JW5B 3QH3B 2NW2B 3CSBA 4RGNC 3V4PL 5C71A 3I3DA 5E2TL 2ICEA 3KJ6L 1YNTA 3QT2A 3U0TB 5J3HD 1HXYA 2K7QA 3CMGA 4JN2B 3KLSA 4P3CH 4KV5F 4OLVL 3B9KD 3G6JA 4N0RA 4I3RL 1OAZH 2YHGA 2P8LA 4OF6A 4MA8L 1E28B 1QFUL 4U6XA 4DN4H 3PIQB 2BNRE 2FIKA 3EYOA 3VFMA 4HS8H 3WMSA 3UC0L 4NWTL 3TJEL 2XQYG 3MUGB 1FNGA 2A6DB 3P4MA 1KJ3L 5F71A 1DR9A 4WNQB 3UXFA 25C8H 3TA3C 1F11A 4JG0L 5AEAA 2R69H 3WFCL 3FFCB 1YPZA 2BC4A 4Y19E 4CU6A 3LRHA 4Q6IB 4G8IB 3ARPA 4PGDA 4RISL 2NMSA 3KPNA 5EZIL 3QQ9D 3F7VB 2FHBA 2Q6WA 3U0WH 3GMQA 4OD1L 1I3VA 5ENWA 3BP7A 5ALCH 4ELMF 1C08B 4C83B 4LLWB 3EOTH 2FIRT 2NW3A 2VMFA 3LN9A 4P2OB 4LP5A 3QJHA 5J8OA 2Y5TA 1F6AA 4NNYB 1GC1H 3LQZB 5GS2H 2J8HA 1JI2A 1HN1A 1NAMB 5HYQB 2IG2L 1RZIB 3BN3B 2WBKA 3RA7H 1LO2H 4OCLC 4N8CH 1W72B 5EIVA 4FQ1L 1M7IB 2BOCA 4YX2H 1NCWH 1AO7E 5T1KD 2BNRD 1X3DA 3CXDH 4Y5YA 1BFOA 3KPTA 3TN0B 3KPRA 4GBXC 1MJ7L 4KHXH 3TZVB 3CH1B 4IRJB 3UTTE 1HI6B 4C4KO 4ZUVA 5CMAB 4P5KB 2XZCH 2MCPL 1DN0A 3DRTB 5J6GB 3IXAA 3X17A 4MNQE 4NDMB 4PRIE 4JFQB 3D9AH 4XNXL 3ZE2F 1YEEH 2JCCB 5KS9A 3UTSA 4TSBH 4GAYA 3O8XD 3MLWH 1ZLSL 2Q8BH 4Y19D 3TVMA 1ND0B 1FFNA 1QPXA 1UM5H 4HHAA 3BKMH 2D7TH 3KVQA 4KMTH 4HLJA 1U8MA 4NP4L 2VXVL 1KIRA 1IC4L 4NNPL 5T3XE 2N1KA 3UDWC 2R23B 3SBWA 5EU6E 3QEQA 1MI5D 4U1HB 4K9EC 3CX5K 4F9LC 2IH3A 1HOCB 4UOW1 5I1AB 1JBJA 1SVCP 3WO3B 4JZOB 3HNSH 2E7BA 4GQPH 4DGVL 4HKBA 4N1CA 2VL5A 4Y5XA 3L3OA 3NCFB 3KPSA 4XCFL 5DWUH 5C7XH 1EO8L 1HNGA 1FORH 4Z7UE 1WAAE 1X4YA 4D0CA 3D3VD 1JNNL 1ZLWK 4HMEA 3QDHA 4BJLA 2HFFB 1T83C 1NBYA 2ITCA 5E4IA 1XCQA 5IT2H 1AO7D 2PYFB 2Y6SC 5HGHB 4UI2A 4HUXA 4P4KC 3NBNA 1R6VA 1TCMA 4JFXB 3UTTD 1KPVB 1X5AA 4XZUA 2V2XA 5SX5K 3VJ6A 2WUBH 1QQDA 3TIEA 1UJ3A 2E5EA 4U1LA 1KJ2B 3G08B 5FUZH 3SE3C 5CD3B 1LNUB 2F54B 4ZG1A 2NY0D 4OLWH 4MNQD 4PRID 1M05B 3EGSB 5ERWB 1DQJB 2KKQA 1ZANH 5CZXC 5DEGB 4OCSL 3WXVH 1YEHL 3E6HA 2UZXB 3O41A 4Y4KC 2EECA 4H1LA 3V4UL 3WS6A 1JGUL 3LDBB 2X4QA 1DDHB 4WGVB 1FLTX 1MWAB 2FDBP 4QGTA 3WFHB 2PCPA 3E2HC 2IAMC 1JWMA 4OCMC 1P4LA 2PXYA 1Z3GL 4PJ5D 4CADB 1BM3L 5T3XD 1OP5K 4Z0BH 5D2LE 5A43C 3MV01 4JRXB 3MGTA 3GBLA 5EU6D 5EPMA 3BE1L 2OR7A 3DXAE 1SY6H 1U8PA 3O3EA 5IV2A 3HE7C 2LU4A 2ZG1A 3TPUB 2VAJA 4X6CE 3TGXA 4ODBD 1YEJH 4HZAA 3MLXH 2MCG1 1MAKA 5E8PA 5IIEB 1CG9B 3SGEI 5BV7C 3HC4H 4KK6C 1B6DA 3H3PH 4KVNH 3HAEA 2Y7QA 3I6KB 5IUSA 1OAXH 3HZVB 4YK4C 1HIMH 3UPRB 4Q9QH 2QR0A 3MNVB 4PR5A 3OR7B 3HUJA 2OTPA 3B6SB 1HK6A 4FFWD 4RMSA 1CBVH 5ADOL 1Z9SA 1CN4A 2OQJB 3P4LA 2VZSA 1TCRA 4LCCB 5D5MB 2LTQB 5FUCE 2EE2A 1J87A 1A7QL 4JRXE 5EOTA 4HGKC 5A40E 5JW3L 3GGWA 1JYXA 4PGEB 5IQ9B 2Z4QB 4BA8A 4X80H 4M43L 1EO5A 5JHDD 5HHNB 1EEZB 1J0ZA 3ISWA 3QZWB 5JPMB 4XPAH 5A3IC 5INDB 3BSZL 4O2FB 5JW4R 2AVGA 4R4FL 4B50A 4X98A 4QHKJ 3UYRH 4P23A 4I4WA 1IKFL 4PLKD 4JKPH 1DQDL 4PJDE 3QEHA 4U1NB 3ARGD 1S9VA 5KSAA 3L3HA 4RFOH 1ES0A 5ABDE 3DXAD 2F74B 4XHJC 4MHHI 4Y2DD 3I6GA 1T89A 3RBSA 1KJ2H 4TUJA 2ZCHL 4R0LC 3QUZA 4NO2A 2YWZA 1FH5H 2D7OA 4ZSOA 3V0WH 4IOIB 1E6JH 5E94B 4MCZA 2OTUA 4JO1L 1A3LH 2VJXA 3CMOH 4ODUB 4Z7UF 1WAAF 3VI3E 1BBDH 4EZMA 3VFPA 4B5EA 1INEH 4AK1A 2XN9E 3QDJB 4G6MH 4LSUL 1S9WB 2J8UE 3VFNA 5KVEH 3NACL 3R06B 2R0WH 4NHCL 3ARBD 5DFWH 5I8OL 5B8CB 1WBXA 4JPWL 5BMFL 5F7EH 5E03A 2CDEA 5C0ND 4JM4L 5DEZA 4Z7VE 1RZ7H 2OP4L 3MBXH 3DO7B 4S2SA 1I8MA 4PP2B 1KSRA 1CD9B 4J6RH 4I8DA 3O6KH 3BW9A 4OFYD 4F15C 5H35B 3GO1H 3VXRA 3A67H 4NQUA 2OL3A 2EDNA 2F5AH 4PRPE 1IAII 1TMCB 3D6GA 4PP1C 5D2LF 5LAXB 4D2NA 3TNNB 5KSUB 4HF5L 3I02B 5D1ZB 4GXUN 1UB5B 1S8DA 1DBAL 3BZDA 4PRBB 4X6CF 1IBGH 1AGEA 5J7CC 4ZFZB 2Z8RA 4C56A 2HKHH 4JPIA 3LCYA 4WU5B 3TFKD 3IS0X 3HS0A 4YHZH 4YXLH 3LKQB 4J1UA 3OHXB 2ICWB 4FRWA 2XN9D 4X6DE 5BOZG 4U6YB 1XIWB 1X5ZA 2UUDH 2Q86A 5EA0L 1CICA 1MCQA 4HBCL 2R2HB 3CNKA 3GSWA 3C5ZA 5LCVH 4F7CA 3EAKA 4HUUB 2VDML 2AJSL 1KOAA 2RR3A 5D7LE 4G8GE 1KFAL 4YBLB 1QUNA 3RTQD 1JF6A 2Z93A 1TVHB 4XP5L 2AXFA 3K80A 3V5DB 3MLTA 4S11A 5DSCB 2W07A 4JHAH 4DEPB 3C8HA 1AFVH 1VEMA 1UM6L 5CZVL 1HXMA 3IDUA 5FA3A 1GIGH 5FYLE 5TE4H 1FBIL 2FJFB 3FTGB 1WF5A 4K8RL 1M7XA 1E27A 1V3KA 4WRLA 4DGIL 5EU3A 5I16B 1OVZA 2VOTA 4OCYL 5BO1H 5TJWK 3WUWA 1N64L 3UO1H 1CT8B 1MFDH 4PRPD 4XCCL 4PJDF 3ALXA 4PJ8B 1SYVB 3DBXB 4UT7L 3MLUH 1IGCL 2CXKA 1YN7B 3K2MC 2A9MH 3QFJB 4RMUA 3CFJA 3SDYL 1II4E 4OZGE 1MCCA 1EA9C 5L2KA 1QACA 4MA3A 2BCKA 1B0RA 1EAPB 4KAQL 3QO0B 5DJYA 4CNIA 3OSKA 3VI3F 3WO4B 2FR4A 5F1KC 1L7TL 3GSRB 2DTSA 3T2PA 4KKCD 2ESVA 3OZ9H 5CJOL 2J8UF 4Z0XB 5HD8D 5I1LA 5E6ID 1A6ZA 2XKSA 4AENB 4NQSA 4FQXA 2A0LC 1H3WM 3KLHC 4QRQA 2G60H 5D7LD 4QTHA 2BNUA 2X05A 1C5CH 5JDJA 4G8GD 1JL8A 1T1WB 4TN9A 43CAA 1H8OA 1HSBB 3QUMB 5I2IA 2C26A 3K8MA 4A2LA 2JJUA 1MJ8H 4Z7VF 2D31A 2ICWJ 5EO1A 3OKDA 2DI9A 1QLRB 1F90H 3BDYH 3CFBB 4MNHA 3H9SA 1CFVL 3FONB 1AD9A 5FYLD 1A7PL 4RGOH 4MXVE 3MR9A 2H6PB 5DEFB 4LU5H 1HHKA 2IANA 3D2UA 4CAGA 1AE6L 4X8JB 5IJVB 5E8EA 4TVSa 2X2YA 1OAUL 1KPUA 5CZKA 4UILL 2DMBA 4RZCA 2VDPL 5H94A 3TV3L 3EOBB 3TO4B 4KK8C 4XNYL 3PGCA 1K4DA 2P49B 2VAAB 5CJXA 1MCJA 2W9EL 1IZJA 1ZAGA 4O5LH 3EJZD 4LKCB 5DRNB 5J1TC 4GG6E 2CKNA 3P11H 1YEFH 4PJHB 4PJEB 4KKAC 2DDQL 2FCBA 3LD8B 4X6DF 4BFIA 3VG9B 1CDJA 4UU9A 2LAGB 3DX6A 5LWYH 3OAZK 4NPYA 1MFEL 4QHLA 2A6JA 1IKNA 1MCDA 1KLUA 4YQXL 5HGDB 3RZCC 5D1QB 4U1GB 5LBSL 5IM7A 4Z7OE 3QIUC 2O5YH 5TFSL 3SKNB 3CVHH 4ETQB 1XF2B 5IB5A 5GIRA 3QA3B 4PJ7A 3U7AA 3QI9A 3H9HB 3R8QA 1LK2B 3B8SA 5FEBA 4Y5VB 3V9FA 2YD8A 1R24A 2W9DL 4NYLB 2ATKA 5D7KE 1N6VA 2VZOA 4H1LG 1RVFL 2XNAA 4HEPG 4F7TB 2I60H 4LHUA 4CU7A 2QQKL 4K7PH 3QUXB 1RUQH 1P9MC 2EDYA 5J56B 4JDZB 4MXQD 3IJHA 4XAWL 5E2JA 3OXSA 5DDHA 4OZGF 3FN3A 4XXDB 2A73A 3RU8H 1IEBB 3PF2A 4KDTC 1DVFD 1LO4H 4ZXBD 1K2DA 2V9TA 3JWOC 2XOTA 4NSKA 5D9SB 2IPUK 3T0BA 3FOLB 4Q0XL 1AXIB 3VD7A 4NQEB 3UROR 4PJIB 1NGPL 5GSRB 5I8EA 3MTRA 3VXTB 5C1MB 3SO3C 3HAEG 3QYCA 5CSZB 4LLQA 4I77L 3KJ4B 4DKEH 1RHHA 3HMXL 3HG1A 4ZPVA 4U6HA 2IBGA 5JLZA 4P9MH 5IEHA 4ZNCD 2FNBA 2BNQB 4HUMB 3MRCB 3FQRB 4NHUB 4Y4FC 4JRWA 5C0EA 3GIZH 4I18C 3ZT7A 3DX8A 5D72L 1DQML 3O9WC 4IBLT 1M6OB 5MP6L 3GM0A 3OGOE 5MI0C 4JRYB 4OGYL 2ADJB 3PWNB 2CLZB 3L5JA 2P8MB 4HGWB 3CX5J 1AC6A 4ERSL 1P69B 1NAKH 2X10A 4KJPD 3ULVE 4MXVF 5BVJA 1TTGA 4OUUB 5D7KD 4ZOEA 1CVRA 2R0LL 1OWRM 2XRAH 4Z78A 3ULUC 4ZTOH 4WWKA 2Y06H 4I0PD 2CRZA 4QRRA 3OKNB 4RBPK 2NX5E 4JY5H 2XWJA 3AM8C 4ALAH 3IDMB 4E42B 1A6PA 2FEDD 2OCFD 3Q1SL 1NDMA 3QHFH 2H9GA 4XCNB 1VFMA 1BAFH 1BVLA 2X1WL 1OD7A 1T2JA 4XTRD 3MODL 1R5WB 2P5WE 4N0CC 4D0DA 4GG6F 4HS3A 4IRZH 1LDPH 3BGMA 4XBGA 1T6WA 3KS0J 3GRWL 2V5MA 3BRDA 1UZ8B 3O4LB 5DJ2B 3TC9A 3U1SL 3MRLA 2VLJD 1JYVA 4CVUA 3VW3L 4XGZB 3U4EB 4Z7OF 1BF2A 1U8IB 2CH8A 3KS0H 3U46A 3F8UB 5HHVH 4BQCA 3DI3B 1CYGA 1GHFL 3V6FB 3MGAA 4JFOA 1A5FH 3OQ3B 4P5TB 3NAAL 1N7MH 5ACLA 3IFPA 5KSVA 1IGJB 4PUBH 1MF2H 4DUXA 4JPVH 1FG2A 1U92B 4XPTH 2DQGL 4LCUB 4QF1B 1RULH 4O4YH 5J11B 2DJ4A 5I30H 3D85A 1JFQH 2E9JA 3NCCB 3ULVD 3BGFC 5MEOB 3C6SA 4S1QL 3B5GA 4HH8A 3BJLA 3IS1X 3RI5K 4GUPB 3RNQA 4BQ8A 1GGCH 1J12A 4K8RC 1EDQA 5AAMA 5E2VL 2BRQA 3W9EB 4BH7A 3DYPA 2ADFH 1G9ML 4NO5A 4KUZL 4JFZH 3KPOB 4X5XB 2NX5D 3RDTA 4O58L 4QTIL 4MQTB 2NY6B 1KN4H 2WBJD 3SGEH 4NNXB 5I8CB 4EUPA 4YHLL 2CD0A 3TBWA 3UYPA 4EI5C 2E6PA 1UQSB 2P5WD 3K4DA 4YUEH 4K3JL 3BXNB 1OF2B 1IC5H 1I7TB 1WIPA 3S98A 1BD2E 2ZUVA 4J12A 4JFYB 3REWB 1JHKL 1ODAA 3SDDC 4F9LA 3PGDA 4M7KL 3RNKA 1S7UB 4X5WA 3T0EC 3BEWB 3RUGB 1GL4B 1RUAH 2OJZH 2WUCH 3TM6A 3LPGA 1QYGL 2MHAB 4AY0A 3ZE0E 5FUOL 2M8XA 5FYKD 4XC1L 4ZFFB 3B9EA 1DQTA 1RZ8B 3KHOA 2F19L 4LHJB 4OM1H 2VDRL 3S35L 2YEZA 1KN2L 5FOJA 2J6EH 2VXUL 5HHOA 5DD3L 2AK1H 3EYSH 5ITBL 3ULVF 5T3XL 1MJJB 1BZ9B 3TP4A 5E6YA 1G7QB 3V5HB 3SE3A 1R5IB 3VXNB 5IB1B 2OR9H 4YDIH 2I07B 5JIHA 5B3JE 1IE5A 4DWHA 4TNWK 1D5ZB 3QQNA 3PQYA 3WUWG 2X4RA 4YEEA 1P84K 2GQHA 1X5XA 4O02H 4KXZI 1L6XA 3SQOH 4PLNC 3ZKMC 1KTKE 3WLWC 2OYPA 2PTTB 2KDGA 2ZUTA 5TH2A 5D70H 4GO6B 5JO5B 4KRMB 2FYYB 4YGVA 5JPNB 2IAMA 3H0TB 1V3LA 3VFUB 3H7BB 5AYQA 3VRIB 5DTFA 3MV11 1BD2D 4IJ3B 3U30B 1XEDA 4YGAB 1VFBB 3LH2L 2YD2A 5DFTA 3HE7A 1A6WH 1KIQA 1E4XI 2HFEA 4MQXD 3LKRA 1LQSR 4ZOCA 1NSNL 3VXUD 2BK8A 1FVDB 4UV7L 2XFXB 3PL6C 4IRSD 4D9RE 1PQZA 3NGBB 4TVPE 1RZKL 5A1AA 2XZZA 1B4JL 3X12B 4S1DC 4ODVH 3OKMA 4ODSH 3JZ7A 1DUZB 1U8OB 3BQUD 3AB0C 1A4KB 3AC0A 2OM5A 3RY6C 2G75A 1YEKL 3O6FB 5L0QB 3BWAB 3UTOA 1D3CA 1IAIH 1IM3B 4N5ED 5IFJA 4GT7A 4G9FA 4NN7B 5C0FB 3VWKA 1AHWB 3DIFB 3RKPA 1NFIA 3MRIB 5JIKA 1IGMH 3JV0A 1G7LB 4MA7L 1EHLL 2VIRB 5B4MD 3TESA 2HLAB 4LAJH 4WO4A 2BHYA 2EDXA 5DYOA 2GJ6B 3LMJL 4L4TE 4APQC 2NY3C 5DRXA 1A2YB 1DBKL 2XQBH 5JW4M 2ICES 1JGLH 1NUNB 5EO9B 2C4FU 1DEEB 1F00I 43C9B 1T21A 3VWJB 5F1IB 2FBOJ 2GJZB 1VDGA 2H32A 3AU1A 1AGBB 4L3AA 2DF3A 1KCSL 4OLXH 1JNHB 4HZLB 3TNMB 1C12A 4FABH 1UKQA 1C7TA 3P30L 3SCMA 5KN5A 4UQ3B 3ZE0F 3HZKA 3SKJL 3E8UH 1UWEH 2FX7L 1EJ6A 3ARUA 3X3FL 2H8PB 4OZFA 1IAKB 5CINH 1BEYL 3CU1A 1FNAA 4M7JH 4D9RD 2NY4B 3D18B 4TVPD 3HZMB 3IKCB 4BSVA 3P9LA 4NKOB 4LEXH 4M48H 1MRDL 1UYWL 3BRGC 1R3IH 4YE4H 4RA0C 3ROOB 1HH6A 5M94B 2FX8H 1B0GA 3QNYB 1Y18B 4P3DA 1DFBH 5IVXA 2YA2A 1BGXL 2RCSL 4Z7WE 2Q7YA 3ESUF 4KJYA 2OBGA 5B3JF 3GKZA 1Q9WA 3ESVF 5KOMC 2VDOL 3UYOD 3KPPA 4JQVC 3LS4H 4LHUG 4LNRA 3OF6D 4L5FH 2D7PA 1PY4A 1N59B 2F8VA 3Q6GL 4L4TD 5CCKH 5K9JH 4JREC 5C0JB 5DXWA 4CW1B 5FO8A 1K6QH 3OAYK 4KKBD 2ZUXA 1FO0B 1B2WH 3N1QC 3G5XA 3VGAC 1T2QL 2ENSA 1AC0A 3LN4B 4ZDHA 1MREH 1CL7L 1N4XH 5FF6B 1RZJL 5DRZB 3IFLH 2JB6A 5MENA 3RL1B 5HVGB 1UJTA 3LKOA 4G3YL 3O81A 3DETC 3MOQA 5DD0L 2VISB 4R26L 5BCAA 4JCLA 2NZ9D 1FRGL 2AI0L 5DS8A 1QBMH 3WIFA 5JUEL 1D5XA 2WQ8A 1AQKL 4WY7L 3QG7L 1QRKA 2P7TB 3DYMA 2JB5H 3TCXA 1XAUA 2FGWH 5F72S 3L5IA 4U1SB 4IMKA 2JK5A 1NKRA 5I1CH 1JWUB 1GSMA 3CX2A 1YYLH 1I1YB 1NUGA 2A83B 1KYOK 3VFVB 5IFHL 1S78D 2DLFL 1HILA 2VXSL 1B88A 1G9MC 3SE9H 4NO0A 4WCYH 2AKRB 3C6LA 2DQEL 2HJLB 3KHQA 3C5SB 3LV3B 1QBAA 1FGVL 4JDVA 5EZOL 4QRSA 3MRQA 4F57L 1BWMA 1UEYA 5DD1H 1K9TA 5ID1A 2YK1L 4IDJL 3MRPB 1AXSB 3MUY1 4JEGB 4Z6AT 1RAMA 4PYGA 1XZ0B 4JO2H 4GQ9H 5EBLA 4CGTA 3NCBB 3U83A 4I3GA 1I9RH 4TSCL 5FYLL 5BS0B 4X4YA 2QADB 4PJXB 3R0MA 4JKMA 2YUWA 5C0DB 4HAGA 4EI6A 5HYSB 5KANG 4N0UB 1KLGA 4YC2C 4OT1L 1CLYH 3V4VL 3WNKA 5J6HA 5GGTL 4D3CH 1FO0H 1D6VH 1YN6B 4GS7B 3MA9L 4YAQB 4Z7WF 1BZQK 1U8JB 1BIIA 1F4WL 3S36L 3TN0C 3MV8A 4IRJC 3MZTA 1HHHB 3BZEA 3W0WB 3PWVA 1NBQA 2MFNA 2W91A 1UCBL 3BP6A 1WFNA 4MJIA 5I75C 4JFDA 2CRYA 2J2ZA 4LSQL 2J12B 2IFGA 1TTUA 3WKMH 5BS0E 1W0WB 3U2SA 4X7FC 4KRLB 4EUPG 1AJ7L 1X5YA 2Z92B 4MAUH 5CP3A 3ZDZE 4FFWC 4WFEE 5FA4B 5E08L 1NJ9A 3OL2A 4ZOBA 4I2XB 3MSPA 4EOWH 3O3BA 5LQBL 5CILH 1A6TB 4PV8A 3SJVA 3RZWA 2VLRB 4A6YL 4WJ5A 2EDWA 5DJ0A 3FO0L 5CIPB 1FGNL 4K7FA 5F21B 1ADQH 5EWIH 5CGTA 5DJDA 1A6UL 2QSVA 2V5RA 2DAVA 4TNVF 1ZHLB 5HJ3A 2VDQL 1B3JA 5T1MA 4HIJA 3BEVB 3CLFH 1KV3A 2V5SA 1A1OB 2YS4A 1U41A 5CD5C 2Z31D 5JW4Q 3AGVA 4UTAL 5FOBB 3KXFE 5HPOA 1FAKT 3QIUA 2FD6L 3FN0H 4PLKC 2ICEB 1ZT7A 4NM4H 2VWEE 1U3YA 4R7NA 4I2XE 2R2BB 2MQCA 3ARGC 1OAQL 5IF0B 4XVUD 1T4KA 5F93C 3QPQC 4JVUA 5AZ2H 5GS2D 4NBXB 1T1ZA 2GTWB 4Y2DC 1KLFA 4FQCH 2NPLX 3SE8H 4XRCA 3CPLA 5GSVA 5HYEA 5KSBA 2AERT 2B1HL 1J0YA 4JQXC 4JFFE 4RIRA 4UT6H 4JJHA 1ULVA 3O2VL 1X6NA 5C0BE 5A2KH 4LDEB 2V2TA 1K8DB 2M1KA 1TJIH 4S0TD 1VKXB 3HI6L 4HUWB 4P46D 1F3JA 3LDBC 4JANA 1MLCA 3L3KB 2JE8A 4WFED 4R9HA 1JNLL 3LOWA 3HLAA 5F88A 5JA8B 4UUJA 4WW1A 4I5BB 2VABA 4FQHA 5FUCC 4UDTA 1IM9D 3ARBC 3WLBA 2BC4B 4TOYL 3R1GL 4F8QA 2C3HA 1KB5B 3T2NH 3GKWL 3UJTH 3ARZA 3LS5H 1JN6B 1QSFA 1WT5C 1QBLH 2DLHA 2PR4L 2X4OB 1SJHA 1EGJL 5A2IH 2BSRB 5B21A 4PIRF 3JV6B 3QUKB 5I1IL 4AG4H 1K4CA 5AD0A 4EJ1C 1T0NB 2OJEB 1I85C 5HVHB 3KXFD 1ETZA 3S4SA 3BX7C 2DQFA 2YC1A 4Y4FA 4QXGL 2IFFL 2Q7NA 4G8FA 4OM0L 1RUKL 3ZHDA 3MV7E 1ZVYA 2X4TB 4WUKH 5IMKB 4F7EB 4JFFD 4YPGB 1U95A 3OPZL 3HZYA 4U6VL 5C0BD 5F96H 4PRHB 3BP4B 4XPBL 5GISH 4ONFH 1UXWA 1JZ6A 3NFPA 4ZUWA 3MXVL 2V7HB 3ZDZF 4R90H 3QXVA 2R1WB 2XY2A 3CK0H 4FHBD 3OG6B 2H2PD 5IMLB 1NGXB 3OKKB 3AM8A 1QNZL 1J8HA 3QDGA 2AK4B 3S35X 1FL6B 2F58L 1MUJA 32C2A 4KI5C 1N5YL 3RTQC 2IALA 4GXVH 4F33B 4JFEA 5HGBB 1U8MB 4TQEH 5DQ9A 1L4IA 2H1PH 4OZFG 1YNLH 3ULVL 3OJDA 3FMGH 1MIEL 5IEKA 2PYEA 2JTDA 4LSSL 4X0KB 1SVZA 1I1AB 4F3FB 2YA0A 3B83A 4ZFGL 1A47A 5JA9A 1TVDA 3V6OE 1MFAH 3ARFB 1HHIA 4WEUD 4KXZH 1IVLA 4KROB 4FTVE 5I74B 3KPSB 2AEWA 1KB9K 3PWPA 4E5XB 4K2UH 2HG5B 2VXQH 5T1DH 5GGQH 4YXHL 5I1HL 1FSKB 1AQDA 1R3HA 3MMEA 2YR3A 5D7JB 2O5XL 4ZUSB 4PJ9D 4KTDH 3GBNL 4XI5D 4L3CB 1KB5H 3C60D 1FN4B 3RBGA 3EDEA 4HUXB 4PRDA 5ILTH 3EOYG 2O61B 4QRPB 5EZJA 2YSSA 2JF1A 1N6UA 3W2DL 3KNBB 4X9BA 3MJ9A 3ZYZA 1C1EL 2WZPD 3M17A 4KKCC 3WFZA 1E4XH 1L0YA 3IDXH 4W6YB 1JPSL 1L6ZA 5C0CB 2HMID 5HD8C 2MWCA 3BISA 3QRGH 2X70A 4GKZA 5FYKL 1I1CA 4K71C 1GAFL 4H26B 5E99H 4Y1AE 2MNUA 3B4NA 1Q0XH 4OZIE 4KMLB 3TO2A 5C2UB 5CBEB 2A6KB 3MNZA 1F4YL 3OJ2C 4AL8H 4DOHB 3CSYB 4Q58C 3DPBA 4QT5A 5D1ZC 5GGUA 1OPGH 3B2UD 1CFQB 1ZXQA 4X9HA 4N8VA 1JWMB 2J8OA 4Y16C 3W11D 5FGCE 5GZOD 3QXAA 1KCKA 2PXYB 4GW5A 4JKKA 5MEPB 3H3KA 4U1KB 1ZWIB 3SDXE 1RZFH 2VDNH 3BPLB 4H5SB 3MJGX 1SYSB 2DQHH 4JZNB 3V8OA 2IBZY 4QRPE 5DUPH 3WHE1 4V2CB 1YZZA 4LPXA 1KCRH 4M1GL 1CE6B 2X9XA 3WSQL 4KZDH 3ARTA 1FDLL 4X7SH 2WK2A 3RGVB 3LPWA 4HC1A 5E8PB 5CUSL 5GRVL 4FTVD 5ANMA 1RJLA 1OB1B 4M7LH 2R4SL 4JHWH 4MSWB 4DKAA 3MJ7A 3DOSA 4OCXH 4WEBH 3S8WA 1AXTH 4HSQA 3OXRA 4GJTB 1CLOL 1EXUA 3WJLA 1HKLH 1QRNA 1Q9KA 3QXDA 2EIBA 1A8JH 1OGAE 1U9KA 5D1XA 4RFEA 5J9PB 2FB4L 3SDAB 2HN7A 2NY2D 1PG7W 5M7QA 2D9QB 1KNOB 3RWIA 4Y1AD 2JIXB 4OKVB 3KYNB 3UTZB 2BVYA 4K3DH 1K3IA 2BJMH 1S7WB 1AGDA 4B7IA 2AEQL 2WP3O 3PNWA 1ZLUK 3H9YA 1IAIM 1UH3A 5DJXA 1FZKA 1Z5LA 4LVOC 4MX7A 1LMKA 3I9GH 3IGAA 1R3JB 4YHPA 3SE4A 2LVEA 1CFSB 1R3LB 1FZMA 4OF7A 5E6ZA 3QDMA 4HLZH 1V8HA 3K2UH 1T2XA 3PL6A 1P5VA 3GMLA 4M4RA 2FEEL 4TTDC 5BJTB 3CUPA 4XCYA 1W0VB 3HPLA 4K55A 4MXQC 5FO9A 5K9QG 4M6MH 4OZHE 5T5FL 4PY7B 1F4XH 1WZKA 3MLZH 4AEEA 4OGAD 3CFCH 2R0ZH 1DVFC 1YEGL 2L7UA 2WWKO 4ZXBC 3MBEB 4Y0GA 5CEXA 4N1HB 1IQDA 5F6HI 2V9QA 4GAFB 4CN1A 3MCKB 3DX7A 1RU9L 1WZ1H 3MLRL 5TDNB 2QHRL 1QR4A 1OP3K 4L8CA 5E2WL 1OGAD 1DTUA 4LRIA 2X4UA 3LRGA 3RWEA 3DX9A 3U6RA 1QKZL 1MRCH 1XGTA 1FV1A 3BP5A 2F9BT 4KTYA 4OZIF 1YJDL 4TVPL 4ZPTA 4APQA 3DV4A 3GK8H 3B3IA 3BW9B 1G9EA 1YEDB 3HR5A 3WXWL 5CFHA 1UM4L 4G80B 1CXIA 1KJVB 1EFXA 3VG0H 2DQUH 4MDJA 1T5WB 2N56A 2ORBH 2OL3B 5D7IB 3SDXF 3AREA 3D39A 1IEHA 1FYTA 3OWEA 5DGRA 4WUUB 4DQOL 4KJPC 3FQTA 1LK3L 1P2CB 1XGYH 3DHJA 2K1MA 1S8DB 4LLYA 4YXKH 3EFFA 2FJGA 3EW3B 3BIAX 4KQ3L 3VFOA 3LD8C 4BK4A 3AY4C 5KVFH 4I0PC 4FFZH 3KLAB 4R3SA 4JAMA 2XTLA 4JPIB 3LEYH 4OIIH 1J05A 5GJSL 1WGOA 1A0QL 1I1FA 2DD8H 4G7VL 3FB5B 2Z9TA 1GZPA 4KTEH 3T1FB 1JPFA 3AMLA 1OLZA 4U3HA 1QO3A 3U9UA 4OV5B 2YD9A 5AUMB 1FVCA 5HHQB 1Z2KA 2VITA 2OZ4L 1PGRB 4YFLF 2UVEA 1U3HA 4PGCA 5H2BB 4UIMB 1NC4B 4HG4K 2AJYL 4E41E 5LG1A 3QIWB 3K8KA 4EN3D 3WHXB 2ZCKH 1IGYA 2CKBA 4JQVA 1U0QA 4JHZA 1FG9C 4LSPH 3CFEB 2HWZL 5J1AA 4U05A 1AD0A 4IMLB 1IQWH 1QFOA 1VSCA 1MEXL 5DD6B 3A6CL 4ZAKB 4JGJA 1XH3B 3MOAL 1MCLA 2XWBA 1QSEA 2HH0L 4HWBL 4Y8DC 3HPJB 3VI4E 5BRZA 4LBEA 1YMME 3LHPL 3VE0A 1JF5A 4MXWL 2X1OA 1KTLA 4RAVA 4WV1C 1F3RB 5GGSY 5IGXL 1PX3A 1EPFA 1G7HA 1T5XB 1O0VA 4O00A 2ED8A 2YZ8A 4IHOB 3V0VA 1A6VH 3W39B 4XP4H 3N9GH 3C09C 4N1EA 2V2WA 1CDYA 3KJ4C 1F13A 3S4SG 5JW5A 3QH3A 35C8H 2NW2A 4OZHF 4GW1B 4LCWB 3TJHD 1AY1H 5F7KC 3JXAA 3TWCL 5L6YH 5E9DE 3U0TA 4JN2A 4M8VA 5IW3A 3CSGA 4FQXB 4YR6B 2P4AB 2CGRL 2OL3H 1PZUB 4MAYC 4KGLA 1E28A 4X4ME 5KOVC 3DUSB 3PIQA 4E41D 4F58H 1SEQH 5F1SA 5I2IB 5JQ6H 4L1DA 4X99B 4J3XA 3HNTH 3U7YL 1EO7A 2HT2D 1CR9L 4XNZC 1DBML 4HXAH 3LKSB 3MUGA 4H8WL 5L8JB 2BVPB 2A6DA 3BKYL 1AD9B 4UT9H 2XICA 4WNQA 4BZYA 3GMPB 2HJKB 1VPOL 4B0MM 1KBGH 3FFCA 2VN7A 4DCQB 5C09E 1F6FB 2CMRL 2YN3A 3HN3A 2FH6A 5AWNL 3BJ91 1HEZB 2EDFA 2VZ3A 4G8IA 4Q6IA 3D48R 4Y4HD 2XXCB 3QIBB 4UNTA 4F37K 1YMMD 2C1OB 1RURL 1DBBL 3F7VA 5FM5O 3PDOB 2PO6D 1WTLA 1NC2D 4L9LB 1C08A 4C83A 4LLWA 1K4DB 3MOBH 2EIZB 2YA1A 3H9ZA 3DROB 4DTGH 1UWXH 4P3CL 4PJAE 4P2OA 2KZ1B 4WGWB 4NNYA 5FM8A 2R4RH 3LQZA 1OAZL 4U1JB 3S37H 5GGVY 3RL2A 2X89A 1NAMA 2AEPH 5HYQA 4NO3A 4UU9B 1RZIA 5IW6B 1AP2A 4R8WH 5E9DD 3EJJX 3LEVH 4HS8L 2ED9A 2Q8AH 1MCIA 3BZFB 1W72A 1INQB 1M7IA 4F80A 4H20L 1KULA 2W60B 1MIML 1P53A 2XACC 1DN2A 25C8L 1HHJB 3TN0A 3TZVA 4ZUUB 1TQCB 3CH1A 4IRJA 4CMHC 2R69L 1AIFB 1HI6A 3T08A 2ZUUA 4MQXC 5CMAA 1N0LA 3MCLH 5GIRB 4P5KA 4J7RA 3F7QA 3DRTA 4XMKH 5J6GA 2VQTA 4IRSC 4ORGB 2Q76B 4NDMA 4JFQA 3ZYJA 4ONHB 4OCRH 2Q87A 2JCCA 4Z7UA 3U0WL 3W9DA 3OJMB 5D2NB 3D0VB 4Y8AA 3LZFH 1TQBB 5ALCL 3RHWF 3BQUC 5KAQF 1ND0A 3VI4F 3EOTL 5HHMB 5C86A 4N8VG 3H7LA 2X4NB 4UV4H 5IB4A 4S1SL 5C2BH 2FX9L 2DYPD 5DDHB 3EHBC 1CDHA 2QQQA 1GC1L 2R23A 4Y89A 3DYOA 1ZA6B 4AQOA 3QP3A 3WL9B 4EKXA 1HOCA 1VA9A 3RA7L 2F53B 5I1AA 1LO2L 3CH8A 1P7KB 1QLFB 4PJCE 4JZOA 3VDCA 4XPHH 1TVBB 4YX2L 1NCWL 5IG7B 3JVGC 3LQAH 2ATPA 4OKDA 3CXDL 3CU7A 2VC2H 1I8LA 5E2UH 4NM8H 1KC5L 2NXYB 2F8OA 3O2WH 1TNMA 3GJFK 4ZPVB 4OCWL 4NRXB 5JLZB 2HFFA 4RGNB 5DC0A 5KJRH 2CQVA 4HS6A 3TBVB 4WWID 1CIUA 2PYFA 4TULH 5HGHA 3RP1A 3D9AL 2CK0H 1YEEL 3L95B 4JFXA 5CJQL 1KPVA 2Q8BL 5J12B 1KJ2A 3HR6A 5CD3A 1KTDB 1LNUA 4XXCA 5HY9B 4LCIH 2F54A 2FSEA 4UIKH 1UM5L 3WNPA 1E6OH 2DWEB 2VL4A 2Q1EA 1M05A 3EGSA 5ERWA 1DQJA 2BDNL 5DVMA 3BD4A 4GRWE 5DEGA 1MFNA 1SBSH 3IETB 4ENED 5E8OB 1XF4B 2YWYA 4PJGE 1DDHA 4MD4B 2IPTL 3DVFA 1IFHL 1MWAA 3WFHA 3WNLA 4HCRH 3TA3B 1HCFX 1JZ2A 3HNSL 4CADA 1FZJB 2WWMD 1J8KA 2YPLE 3C2AH 4JRXA 5DWUL 5C7XL 2AXJA 3W81A 3F58H 1FORL 4N0YH 1RK1B 3LAFA 2YOCA 3TPUA 4PJAF 4FQIH 3DMMD 3H6JA 2LABA 4U7SA 4D0DB 2XI9A 1WT5A 2AJVH 2ICCA 5IIEA 1CG9A 1FE8L 3ZDYE 3K46A 3BMVA 4P2QB 3I6KA 3ARDD 2LU7A 2YMXH 3ZLQC 4RDQG 3UPRA 3MNVA 5TQ2H 1CVSC 3OR7A 3B6SA 5FUZL 1N2RB 1UGNA 4KKBC 4TSAH 5TPWH 1ED3B 4AMKH 2IBBA 4OLWL 2OQJA 2EO1A 5D5MA 1ZANL 4FZEH 4FFVD 4NN7C 3WXVL 1AHWC 2JKXA 1WCBB 5L9DH 1FG2B 2B4CC 2ZOKB 1CE1H 2FECL 2IQAB 4WHCA 3JWDH 4PGEA 5IQ9A 2Z4QA 3DI2B 3BT2L 5LJYH 5HHNA 1EEZA 4GBXB 1C5DB 1WICA 1BWWA 1I7ZB 3QZWA 5JPMA 1RV6X 5INDA 4FA8A 4N90E 1OCWL 1TFHA 3D1MC 3PV6B 4BH7B 1UG9A 1SY6L 5I73C 4LFHG 5C9JB 4OB5L 5CEZH 5GHWH 1IGTB 1YEJL 3MLXL 1ZHNA 3MFGB 4U1NA 2IEPA 3PHQB 2HYMA 3BYYA 2VYRE 3HC4L 3H3PL 4KVNL 1OAXL 5TF0A 4HJGB 2ARJQ 1HIML 4PJCF 1MAMH 1U58B 2QV2A 3FRPA 4IOIA 4NT6B 1CBVL 5E94A 3IDJB 3VXSB 3QXTA 1UXSB 3EDKA 3JTSB 4ODUA 1NANI 1T0MA 4G6KH 4IS6A 4YDKH 3QDJA 4L3EE 1X4XA 1S9WA 4PRNB 3NH7H 4QOKE 1BLNB 5DR5H 2WW8A 5ETUA 4X80L 4D8PB 2RQ8A 1QP1A 1H3VA 3R06A 5EUOB 1KEML 4XPAL 3HFMH 1TDQA 5B8CA 5DK0B 5DVLA 1V3MA 2DLEA 2APWA 3MRDB 3T3PE 4XVSH 3WN5C 4P4KB 2EIEA 4GRWF 3DO7A 4PP2A 4WI7A 5I76B 3DUUB 4JKPL 3QUYD 1EX0A 4PJGF 3ZTNH 2DB8A 4N90D 4NIKB 1CDGA 4YBQD 5H35A 4DUVA 2GCYB 2ID5A 4Z9KB 1D9KD 5HHXH 5FYJH 5F6HJ 5CAYB 1FH5L 4Y4KB 5LAXA 1E6JL 1H5BC 3TNNA 5KSUA 1A3LL 1M7DA 3I02A 5D1ZA 2I5YH 3CMOL 4LIQE 1BBDL 5F7HA 1UB5A 5GRVK 2C3WA 2HJFB 4OI8A 3E2HB 2IAMB 4KWUA 4PRBA 4Y16A 4O9HH 4HUKB 4EXPX 2W1NA 4NZUL 4G6ML 2EEBA 4ZFZA 2I9TB 2VN4A 3BOVA 1XF5B 3G5YB 1E4WH 5KVEL 5DTFB 3ZDYF 4WU5A 2UWEE 3IKKA 4XPGH 4UINL 1MFBH 1KIQB 2SEBB 4U3CA 3BAEH 3OHXA 2ICWA 5I66B 1T7VA 4ZO7A 1HHGB 1X44A 1XIWA 3MJ8B 4FOMA 3TYFB 3QEGH 3B2VH 3FO9B 1MCWM 2R2HA 5BV7B 4D9LH 1DL7L 3WJJC 2MPAH 1RZ7L 3MBXL 4HUUA 3E3QE 2XG4A 3EYFB 2N4IA 5IBUB 3N1FC 5JOEA 3QCUL 2FJHB 1TVHA 3ARRA 4I3SL 4LL9A 1LVEA 2AJXL 5DSCA 3ET9F 3GO1L 3Q0HA 1CXFA 5IJKC 1TZGH 2O5ZH 2Y5EA 4Z5RB 3Q5YA 3FTGA 5LGHH 1QBBA 4DZBB 4K9EH 1KIPB 2A38A 1HWHB 3QWOB 4C57C 5I16A 4F2MB 2LVCA 4HJJH 2X1XR 2Z31C 4NZTH 2QKIB 3LB6D 2VLKE 1IBGL 4HIEA 1CT8A 4H25A 2KBGA 2J5LC 5GRZA 4YHKH 4PJ8A 2HKHL 5C6WH 1SYVA 5L7XH 3MLVL 3V95A 5F8RC 2VZUA 1AGFB 4I48B 1YN7A 4YFDB 4YHZL 3QFJA 4YXLL 1CDCA 5J0BA 4H0IA 2YPVH 2PN5A 2HT3C 1CFNB 1EAPA 5A2FA 1NBVH 1KXQE 3AU1B 1F42A 3QO0A 5FDYA 4MNGB 1LO3H 1RY7B 4LDLB 4ONGL 5LCVL 4MJ6B 4HKJB 3QAZB 1NGZB 3GSRA 4LAQH 2MOVA 4LDOB 4POUB 4R0LB 1CD1B 4Z0XA 5L8LB 3QEUA 4PJFE 5F89A 4AENA 5JXEA 4JHAL 1AFVL 2D03H 3P9LB 2D0GA 1MCPH 3P4OB 1T1WA 4JDTH 3HI5H 1HSBA 3RVXD 3QUMA 4JM2D 5C08B 4B7LA 4N5UA 2CUMA 5C0AE 3T3PF 3F6LA 3OR6B 4WIQA 1QLRA 2QJDA 3UO1L 3BD5A 3CFBA 1MFDL 3FONA 2Q7YB 2APXA 2VH5H 3MLUL 2H6PA 5DEFA 1Q9WB 1KPRA 3EKCA 3ZZ1A 2VLKD 4X8JA 5IJVA 4OZ4A 2YZ1A 2R0KL 3I84A 3EOBA 2G2RB 5DMYA 3TO4A 3NZHH 2EDRA 9CGTA 3SHSA 2QBWA 2VAAA 3OZ9L 1YEIL 1YA5A 4JN1H 4XP9L 4KHTH 3C8DA 4J8RB 2UWEF 1GOFA 4LKCA 5DRNA 4PD4J 3WBDA 1J18A 4XAKE 5TE6H 3KWWB 4PJHA 4PJEA 2G60L 5SWSB 1C5CL 3N1MC 2Z35B 2VUYA 3K81A 4WI6A 3RWFB 1ZHBB 2GITB 2H2PC 5HGDA 1I75A 1N6QH 5D1QA 2BSED 4CVXB 3DO3A 3BDYL 1T66D 4JJ5B 4OQTL 3WIFB 5EG6C 3V79C 4JM2F 3ES6B 3SKNA 1C8PA 4NKMB 4ETQA 1XF2A 3D5OF 3O3DB 4Z18A 3QA3A 1BIHA 2FZ3B 5IBTH 2WIMA 3H9HA 1LK2A 1PKQE 1MHCA 4Y5VA 1A6AB 1VADB 4NYLA 5DHYB 3KPLB 5IR1B 4O2EB 2OX5A 3MRMB 4DGYL 4F7TA 1JV5B 4MVBD 4OZFH 4YJZL 3UTPE 4X8XA 5B38A 3L3DB 3QUXA 4J3UA 5F7DB 1OW0C 2IPKB 4O5LL 5IQ7H 2HT4C 3WEXA 2W0PA 2WP3T 1S9XB 4XXDA 1YEFL 4AT6B 1IEBA 3KJ6H 4LRNH 1ZGLB 4FZ8L 1E4JA 4NQCB 4XI5C 2P5EE 4I0CC 4NFDA 3G5ZB 3HRZB 4XAKD 5E5MB 3FOLA 3VGDA 1QFUH 3FO1B 4NQEA 4QNPE 4PJIA 4G6FD 5GSRA 3UMTA 3VU2A 3I2CL 3VXTA 5C07B 4PFEA 5CSZA 2YKLH 4NWTH 3TJEH 3CVHL 4PJFF 1G1YA 2NXZD 1VERA 1J1PH 2BNQA 1AKJB 3WS3B 3MRCA 1BBJB 3FQRA 3MXWH 4NHUA 4F7MB 2WWKT 4JG0H 1H9VA 3MO1B 1KXVC 3WFCH 2A6IB 3N1PC 5MHSE 3B2UC 5J89A 2X9YA 1HINH 1M6OA 5GZOC 4YHOH 4JRYA 4Q9RH 4MAYA 5HYJE 2ADJA 5EZIH 2I60L 3PWNA 2CLZA 2P8MA 4HGWA 1V7NL 4K7PL 4PJBB 1RUQL 1RK0B 3QZWG 4OUUA 4HDIB 3VGFA 1V5JA 3T4YB 3VXME 3AS2A 4MB5A 1RSFA 3PWVB 3FL7A 3V6OC 1F3DJ 1LO4L 3QJFB 1IAOB 5IWLC 3PGFL 1FJ1B 4HFUH 5DUBA 4OTXL 2HVJB 4MA1C 3IDMA 4E42A 4LLVB 4NQDE 1AI1H 3IF1B 4XCNA 2J6EA 1SJEB 1F3DH 3P0YL 2P5ED 2QADD 1XCTB 1H3PL 4DKEL 1R5WA 5DRWB 1OM3H 1DANT 5J13C 3FRPG 3WE6B 1J88A 4HT1H 3MV9B 1UZ8A 4WW2B 3O4LA 1SEBB 5DJ2A 1NEZB 3GIZL 3PWLB 1DQQB 3FT2B 5FYJU 2NY2C 4GRLD 4WFGE 4XGZA 4ODWB 3U4EA 1U8IA 1OHQA 1NGWB 5E00B 2IH1B 2OSLB 3V6FA 1RUMH 3G6JE 1NAKL 5I74C 5D6CB 4DJMA 4QYOB 3RVVD 4P5TA 3GI8L 4X7TA 5MHSD 1PFCA 3RZCB 1IGJA 4HIXL 3EYQD 4NBZB 1U92A 4OF5A 4MB4A 4S1RH 4LCUA 4ZTOL 1ZT7B 3J8F7 4NWUL 4NNPH 4JY5L 4AIXA 2XTJE 3SDCD 4GUPA 2W92A 2R8SL 3VXMD 2PW2B 2WINB 4V1DB 4NN5C 3QHFL 1Q0YH 3CPLB 2EE9A 3W9EA 5TDPB 1BAFL 1XF1A 4RIRB 1J11A 3KPOA 1YPZE 2RJMA 2EDDA 4X5XA 1T20B 4IRZL 4ONOA 1LDPL 1U8NB 4XCFH 4NNXA 1EO8H 4OV6F 1ZTXH 3G9VA 4NQDD 4X7DC 3AUVA 1F3JB 4TPRL 5I8CA 4PBXA 2YXFA 1UQSA 1AR1D 2BHUA 2E7LC 1MCOH 1RZGB 4QNPF 1A7RH 1OF2A 3BXNA