4EBQH

Fab structure of anti-vaccinia virus d8l antigen mouse igg2a la5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
218
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFNFYWMHWVKQRPGQGLEWIGMIDPSESESRLNQKFKDKATLTVDRSSSTAHMQLSSPTSEDSAVYYCTRSNYRYDYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, hea
total genus 44
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH02
2ID5A 1VSCA 2V5TA 1GGIL 3LAFA 4PB9H 3PIQB 4I18C 2DM7A 3SE8L 1DDHB 1UM4H 4R8WH 2CRZA 1RZKC 4HHAA 4Y4KD 4D3CL 1FPTH 1AC0A 1SYVB 3FN9A 3MJ9A 1BWWA 3RU8H 1U42A 3HE6B 3OGCB 4NHCL 1LO2H 2Z31A 1DSFH 1IRAY 3CK0L 1CICB 3CXDH 1LO5B 3GGWB 1MY5A 4YHNB 5IKCB 2J4WL 4CJ0A 5IFJB 3L3JA 1N59A 3DVNA 3QQ3B 1U93B 4JVPA 1T66D 4QNPE 1EHXA 3RIFF 3QO0B 2R2EB 3IETB 3MLVL 3VFTB 4QRRA 3C08H 3HR5A 1KJ2H 4Y4HB 4HS3A 4RWHA 3QNXA 3UTSB 1GZQA 3Q6FB 4MSWB 1HQ4A 2OTUA 1DFBH 3DSFL 3UC0H 1ORQA 4RGOH 3VXUE 1SMOA 1H8NA 2FO4B 4HPYH 5IQ9B 3ZYJA 4JVUA 3IAPA 3DVFA 3OJDB 3CD4A 4KGJA 3O4OC 3HNSL 3MREA 3UJIH 2W1NA 5EPMB 1JZ3A 3QEQA 4QOKE 5JA9A 3BPNB 1LQSR 3PWPE 1XH3B 2QL1A 1S7XA 3WDJA 5DEFA 3VMNA 4KTDL 2ADGA 3LS4L 1KIPB 2BXZA 3ECBA 3KPRD 4Y5VB 3PHSA 2YXMA 4O02L 3B9EA 4HWEL 2GY7B 5C0CD 4LL9A 2W60A 1V05A 4GMSH 3FCTA 2I07B 4N9GA 2EIZA 2IANE 5CJBA 3BPCA 4TUJA 4ZYKA 2E8YA 5EBLA 4OF0A 3MRKB 1ONQA 1HQRA 4LCWA 43CAA 5JOPE 3MLXL 4YEFA 1EUUA 4ODBD 4AEHL 1LEGA 2ITDA 5DVOA 3DSNA 1N64H 1TVBB 3H9YA 4HWEH 4L5FL 1JL8A 2IF7A 4X98A 3QUMA 5D7KD 1IGCH 3EOBA 4HXAL 4WWKA 3MLUL 4RZCA 1RUQH 4ELMB 5KSVB 1FO0B 3LKPB 3D3VA 1HWHB 1NCBL 1YYML 5ALBH 1BZ9B 1NCNA 5FUOH 3IDIB 3O6KL 3WNOA 3O3UN 3TN0B 4GKNA 1IKFH 2J8HA 4YBQD 4I3RL 1OLZA 1ZLVH 4YO0B 2F54E 1OQXA 2J8UB 4ZXBC 4YX2H 3LKOB 1QLRB 4RFEA 4YHZH 5DQ9A 25C8H 3KPOB 4Z7WA 3ZE2F 3NGBB 5C0EA 1MJUL 1EBAA 4XTRC 3ZKXC 4K3DL 2VLKB 1JV5A 5GJTH 3P40A 3EIFA 1G6RL 2Y5TB 3TEUA 4EUPB 1R5IB 1YQ2A 5ESVB 1OTUC 3ARED 3D85A 5E8NB 2AERT 5L0QC 4OZHE 3BDXA 3BDYL 2KL6A 2H1PH 1MLCA 1CZ8L 2VLJB 2DB8A 2I5YL 4XNXH 4M5YH 5I1GH 2NXYD 2GT9A 5D2NA 2OL3H 4UMGA 4Y1AB 5JPMB 3GRWA 3F7VA 5K33A 4JG1H 5KSUB 4GKSB 5C2UB 3T0EA 3AUVA 4DQOH 4F9LC 3LEVH 1ZLSH 3MBEC 4RMUA 5BXFA 3KYNB 3SKMA 2ICEA 4MD4B 1AKJB 1A7PH 5IMKA 5FCSH 3U7YH 5IR1B 1D5ZA 2JB6B 4HUVB 1TIUA 1DBML 2BVQB 2NY2C 3TVMA 1ZTXH 2HN7B 4MJIA 3UPCA 1CTOA 3B5TA 4LLQA 4G8GB 3P11H 3EYUH 3I6LD 4HGKC 4K94H 1Q1JL 3JTSB 4J23A 3TJHD 3MODL 3CK0H 3VXQA 3IDJB 3V4VL 5EIVA 1I1AD 5FYLE 1MHCB 4HPOL 5E4IA 3PGFH 1NANI 3BIBX 5D70H 1XZ0A 4WEUD 2FD6H 5HVFB 4FQQA 1XGQB 5IBTH 1CF8L 3MV7B 1KJ2L 1CL7L 4UUJA 2W60B 1DN0B 1XIWB 4XH2B 3VRIB 3MRNB 5E8PA 4F57H 1BJMA 3T0EE 5I17A 1AGBB 3LQAC 5EU4A 2OCFD 5CJXA 3B4NA 4GT7A 4N90D 5D6DA 3ROLA 2YUVA 3EW3B 1PKQE 3RVXC 5JOFB 2O93L 5T1LB 4KZDL 2FX9L 4DUVA 4XBGA 4M61B 7FABH 1IGJA 1P4BL 4QF1A 3ZL4L 1YZZA 2A73B 2JELH 1CFTB 4JO3L 1NC2A 1LK2A 1INEH 1HHKB 1KJ2B 3SDDB 2XWJB 5GGSB 5FEBA 4GUPA 1JWUA 4C83A 3OKKB 3NACL 3L5HA 5L9DH 1N4XH 3PE9A 4JFDD 2NY2D 3C60C 2X89D 4ZPVB 1FQ9C 5IMOB 3KR3L 4GAYA 4X8JA 2HKFL 3RIFK 4NM8L 1B0RA 2MNUA 2E9JA 1PW3A 1OGAD 1LDSA 4X5XB 2GI7A 1EAPA 4G9DB 2WQRA 1T89C 1F4XL 4DTGL 2D0FA 1XIWD 4YFLI 4U1LA 5GRXG 4HKJA 3OAZK 1JGEB 2NQCA 3S3JA 3L6FB 4PLKD 3QIWD 4YHIB 5E6ID 2RR3A 2FBOJ 5AUMB 1U2CA 1N5AB 5KJRL 3SKOA 1PD6A 1ZLWK 1T21A 3MLTA 1QQDB 1FBIH 2NY0D 4JPIB 4RNRB 3OKEB 4WEBL 4EQ3A 4EOWH 5F89A 3V8CA 1INDH 1A3RH 5C0CE 2W07A 2ATPB 3L3IA 4XZUB 3FOMB 3O9WA 4MJ5A 4OZIB 4PJ8A 3ZKMC 1N7MH 2DQIL 4G43A 5C7XH 1EHLL 2XXMB 3AVEA 3ULVH 1HCFX 5FGCE 1DQLL 3MQIA 1NSNL 3QZWA 3SEPA 1MIEH 1OT2A 3RY5A 4Z0BH 4JM2C 2W9DH 5GIRB 1ZHLB 4EXPX 1GC1C 3PQYD 1U8LB 4LCCC 1I9IL 4XCEA 2H45A 1Q72H 4R4FL 1GSMA 5TQ0L 4XMLL 3VXNB 4F33B 4IMKA 5IW1B 1OF2B 4Y16C 5HHVH 2DQGH 5F3HA 5DHXB 4FQJH 3GSWA 4DUXA 2D03L 3U1SH 3STZA 4W6WB 3UBXB 4KVNH 2EEBA 4YGVB 3WL9B 2Q8AH 3C6LB 3EFFA 1WQVT 2ADIB 1P5UA 1OQOA 2QJDA 1HH9B 1QLEL 5CFHA 3QAZB 1EFQA 4OCXH 1G84A 1YY8B 5FOJA 4ENEC 1MQ8A 5I8EB 4PRIE 5KZCB 4HG4J 1KLGB 1DLFH 2EXWD 2LTQB 4D0DA 2APTA 5CWSB 4H8WC 5F3BB 1LDPL 3MBED 4YHLL 4CVWA 5BZDB 4HJ0C 1MUJA 1OARH 3ULVE 3PQYE 3MFFB 4YQXH 2WWMD 2XV6B 3PQYB 4KDTA 2VTFA 4ELMA 4D9QD 5I9QB 4F9LA 3T0EC 1I9JH 4L9DA 3BH9A 3K80A 2AI0H 3CFIC 2NY4D 3IXTA 1KN4H 1MCOH 1GGBL 4OCRH 4LQFL 4BZYA 3AS3A 3T77A 4KQ3H 1AIFA 1GZQB 1R3IH 5F7EH 1KC5H 4QRRE 4LVHC 1J87A 3VXTB 4LBEA 2BSSA 4JM2D 4M6MH 4TVPD 3O6ML 1LO5A 2V7NB 3BSZH 3L3JB 3QZWG 2AEPH 3VDAA 3X3FL 1RMFH 2CDGB 3O3BA 2KKQA 4HIIB 1KENL 4MX7A 3RKPA 4A6YH 1EK3A 2HKFH 3RJQB 2J88L 1RZ7H 4PJDE 4JZNB 1AXIB 3FRPG 4LGSB 4LAQL 3ZL4H 6CGTA 4J3UA 4NQEA 4UIMA 3VGFA 4MB3A 3QDJD 2VKWA 1QVOA 4LSRH 4MS8C 4WU7B 1XF4A 5I30H 3NCFB 4WTZA 4ODXB 4GRLC 4F15C 5I2IA 4I0PA 4OCYL 5KS9A 2PETA 2O5YL 5IMMA 5IB4B 1ZLWH 1CR9H 3H7LA 3RVTD 4QGTA 4GAGH 3THMH 5C0BD 2NY4B 1HWGB 1FLRH 1I1AB 2XY2A 4GOSA 1CQKA 4OJFL 4PY7A 3C5JA 5GHWL 1INEL 5KVEH 2Z93A 2P8PB 3HI1B 5E08H 2DD8L 3X3GL 1T04B 4LVOC 1BM3H 3QIBB 1ADQA 1IFHH 2ED8A 4HUXA 3IF1B 2DI8A 1EJOH 3BRFA 1I3GH 4MGXA 4FQ2H 1LHZA 3WS3B 4P2RD 2APBA 2CIKA 2FX7H 3DV4B 3G6AA 2AAVA 1LP9F 2AK4E 2EIEA 2J4WH 1P7QB 1R5WA 5B8CC 5EC1A 2P5WA 1JK8A 4L3EE 3IF1A 4PFEA 1E4XH 1E6OL 3OPZH 4QXGL 3RTQB 4PJ8C 5HHXL 1LEIA 4PG2A 2F58H 4LSVL 3RA7L 4DVRL 2KUTA 4FFWC 3HS0A 2NZ9C 1NC4B 3ARBB 4P2RA 4HKBB 2F8OA 4LPTA 4GKNB 4Y89A 3GJFB 5LGHH 2NX5E 4ZAKC 5ICXA 3B6SA 4HPYL 1A22B 3MROA 4ELMF 5IVNA 3QDHA 1HCVA 2NY2B 4HWBA 5D7LE 5HHXH 3NABL 3QUXC 4LK4A 4RIRB 1LO4L 4HKXB 1I4FB 1RU9H 5HYQA 1DQQA 4XPFL 1HNGA 3IXTB 1M7DA 3L3GB 3OR6B 1HHHB 1U2HA 2CDEB 3MV9A 2FX8H 5DWUH 2BZDA 2D4DA 5GGQL 3T0EB 5C9KA 1F8TL 4M8VA 2FR4B 1Y6NR 3ZZ1A 3SDCA 3WIIL 1YNKH 3VFGL 2X7LA 3WUWB 2A9MH 3CFJB 3C9NB 4ODWB 1BECA 3CMOH 3L3KB 2PW1A 1WK0A 4PGDA 4N0UE 2MJWA 1S9XA 3HAEG 3MLSL 4LGRB 2AK4D 4ODHH 2YC1B 2R56H 4JFPB 4NKQB 4LCWD 4M4PA 2APWA 5DUBA 2QKIB 3QEUB 2VQ1A 4NSKA 5FUOL 4AM0B 1YMMA 2RCSL 2YWYA 1QYGH 3FOLA 1JN6B 4UTAH 3CSYA 1I1FB 5HYSA 5EO9A 3RZCA 2Z8WC 1AQDA 35C8L 4RX4A 4A2LA 3UJJL 5HPMB 2PW1B 4Y4FD 3JTTA 2EEDA 5D9SA 3BHBA 4YX2L 5F93C 4P2QB 5CD3B 2PYEB 4W70A 3VFMA 3DRTB 1I8MA 3QEQD 4KKLC 1ROWA 4GKZA 4MJ5B 4Q97A 5E2TH 4GO6B 2CDFB 4PJCA 5ETUB 3V52L 3BQUB 2W9LA 4G3YL 1NFDE 3W2DL 3V9FA 4K3EL 4Y5XA 4ETQA 2WLYA 3I3EA 4PJEF 3DETC 1YY9D 4C57C 2O61A 3CVHB 1AE6L 5T3ZH 4DZ8A 5CD3A 2VLJE 4NC2B 1PY4A 3TA3A 1TVHB 3RPKA 4ZUUA 3BD4A 4P4KD 4W6YB 3G5XA 3K46A 4KI5E 3W2DH 1DFBL 2JJUA 1HXMA 3DIFB 3DSFH 4ZD3L 1I8IA 4FFYL 2FWOB 3WLWC 1QSZA 5DQJB 5D93B 5JOPD 1CD8A 1I1YB 4U3CA 4YDIH 3W9EB 1VCAA 2C7UA 3RNKB 4PJFB 5J11C 2C3XA 1U8NA 2EDKA 4QRUB 4P2QD 5JOEA 3GBLA 2D0GA 4G8FA 3ARXA 4OZFG 1D3CA 2RFXB 5CZXC 1LO3L 2ZZUT 4HV8A 5HBBA 3BQUD 4XAWH 3SKUD 4EDWH 2FEDD 4NHUB 5C3TA 4Y2DA 5DD0H 4N0RA 5DT1H 1IC4L 5J6GB 1MEXH 1A9BA 4ZPTB 3TNNA 4LIQH 4LCYA 2OTUB 1AP2B 2Y6SD 3ME0A 5DURB 3ZDZE 2JIXB 2PKDA 1L7TH 1F00I 4L4TD 3VWKD 2IPTL 4OGXL 4HIHB 3NOIA 3KYKH 2YS4A 1RK1A 3I3BA 2A77H 1CFSA 5C0RL 4OCLC 1XFPA 2K3TA 3DVGA 3LEYL 5AUMA 3IFNH 4LIQL 3T0DA 1SEBA 1E6OH 3OPZL 4DOHB 3LHPH 4JFYB 3PDDA 4GW1A 3SGEI 1V7NL 5EC2B 3D9AL 3ULUF 1OAYL 3BPNC 1TJGL 3LQZA 5EU6B 3RVTC 2OL3B 3AB0C 4L8CA 3SDYL 1KUMA 2F74A 1FL6B 5EBLB 3MRGB 5DUML 3S37L 4JRYD 4O5LH 5BS0E 3S8WA 4JO2H 1BX2A 2JCCE 1TETL 1DBBH 1NDMA 3MRBB 3PDGA 4X9BA 3WL9A 4PRBA 2KQMA 2AK4A 1F6FB 1FC2D 2W65B 2ATKA 2XZAL 3BZDA 2L7JA 2VO5A 2ARJQ 2Y07H 3LIZL 4M02A 3K3QA 4ISVB 3P9LB 5E5UB 1N4XL 4ZFFB 2UUDH 3QHFL 2GJ6D 3FQRA 3QXDB 1LILA 4P4KA 3X11A 1JGDA 1WLHA 3OV6A 2OZ4L 4JO4L 5C9JA 3MRCB 4MNHA 5IF0A 4XP6L 4JPVH 3IDYC 3H9SB 4DCQB 3QIWC 4H8WH 5EOCJ 4JREB 4XCYA 1J88A 3P73B 1MCFA 1X44A 1J18A 4ZXBA 4DWHA 1S7WA 4MAUH 5GS3A 3FL7A 4NYLB 4KU1A 5TE4L 4OZGA 1BD2B 1GH7A 1BGXL 1I1YA 1KPUA 3EYQD 4TSAH 4V1DB 2Y5TA 2H2PD 3LN4A 2DQDH 2JK5A 4KZEH 2EDJA 1P7QA 4JN2A 1WTLA 5E8NA 3FT4A 2GCYA 4HIXH 1FYHB 3MFFA 1I7TB 5ERWA 1MELA 5FHBH 5E8OB 4MXQC 4JQVC 2PYEE 2EYSB 3CFEB 3BE1H 3GMNB 1GIGH 1B0GB 1NEZG 1RHHB 3RL2A 5F1NA 1DQJB 1ZT4A 4JFZL 2Z31C 5BXFB 1J9CT 1OAQL 4WI8A 1C16B 4PJBA 5KSUA 4ZTPL 5GGVH 1F3DH 3ESVF 1FZJB 3EUUA 4X6CF 3VWJB 5HGBB 4MD4A 4YUEH 4MQTB 5BV7L 5DJAB 4PB0L 2YEZB 4S1SH 4RGNC 4OCXL 4Q7DA 5IB4A 4WFEE 5D2NE 1FYTD 2W38A 1BVLB 4FQCH 4CJ1A 2DQJL 1KSRA 4NOBA 1CU4L 5JTWA 1FGNH 3K4AA 4HH8A 4OLXL 4HX1A 1HYRC 1WSST 2VZVA 1H0DA 1V5JA 1A7NH 3A6OA 3OJVC 1J1XL 3E6HB 4I4WA 1KYOJ 2IPTH 4OGXH 1AY1H 1T66C 3ARDB 5SWSD 2YRLA 5E2JA 2DJ4A 4JFPA 4GBXB 3TBYA 1ZA3A 3Q3GA 4RGMB 3LKNA 1FL6A 2XTJC 1JMZA 1YN6B 2E27H 4PY7B 5I1CH 3EJJX 5E99L 1S8DA 2PW2B 3MRLB 3LHPL 5C6TL 2FATL 2IALA 3VGHA 3B9KA 5C07E 2OMBA 5IROA 1HN1A 1W0WB 3PWLB 4HUXB 4J3VA 3OXRB 3P77A 4ZUWA 3MJ8B 3ROLB 1YJDL 3BP6B 5C0RH 4KRPC 1YDPA 5E70A 3OHXA 4RA0C 5ISZA 1MEXL 1MCWM 3WIFA 4PG9A 4HCRH 2WINB 4NNYA 4P4KB 2GTWB 2XWJA 3G6AB 1UGNA 1CL7I 1L7TL 3MZGB 1F3DJ 1JRHI 3SJVE 2XKSA 4OV5B 1KCRL 3BKYL 2DD8H 2R69H 2BNRA 4PJXE 3IGAB 1RJZB 1DANU 5ISZB 2C26A 1LEIB 2Z0BA 5JMOC 2R1YB 5EUOE 3D3VE 3ABZA 3I02A 3MCLL 3QNYB 2ADJA 1VEPA 2OXGA 4UU9B 3R4DA 1QHOA 2DQHL 4R4BA 5CIPA 3ARSA 1NCTA 4DW2H 4LSRL 3VU2A 3QHFH 5ICZA 5E5RB 1D9KB 4Z7NE 1KTLB 1UWGH 1L0YA 1QA9A 4LPUA 1FL5B 3UTPD 1WBYB 5HYQB 4MAYC 5DD1L 5TFSL 2AV1B 5DXWA 2CK0L 4WUKL 3K4DA 3RI5K 3MLXH 3OZ9L 2JTDA 3SGJA 2D7QA 2EDQA 3O6FA 1KT2A 4DN4L 5I1DA 2CMRL 5IT2L 3G9AB 1NGPH 3O3DB 3DUSA 5I1HL 5D72H 3G6DH 1PYWA 2OTPA 4PJ8B 5DJ6B 3V0AC 1X5HA 4X4ME 3K81A 2E9IA 4EVNA 1RU9L 3D18A 3IRZA 3SDXF 1J86A 2JCCA 3ARWA 3PL6B 4J4PC 3EOYG 2DQHH 2NW3B 3LZFL 5AG8A 4OFYA 5BO1L 1IC7L 4CMMA 1JBJA 1ZLUK 2BNQA 3WLBB 5LGHL 1SJXA 2YRZA 3NCEB 3RL1B 4FABL 1ZT7B 3MLPA 1K3ZA 3FQNB 4PGZA 3GFUA 4LSVH 3S88L 5DJYA 1FSKC 1AD9B 3G9VA 2QSTA 1NCAL 4P2QA 4ODHL 2FYYB 4XNMA 4K94C 2AJSH 4HDIA 3VXSE 4E5XB 1II4E 4ZS7L 1QSEA 1PBYA 3C8DA 4GW5A 3V4VH 1BJ1H 3RBSA 4OFKA 2H8PA 2ESVD 3MLSH 5B3JE 2ZSVB 2GEEA 4XCCL 2ILLA 4QY8A 3MRRB 5F88A 2IFGA 4ZFGH 4XXCA 2A0LD 4Y19B 3F7YB 1T3FB 1Y0LA 3OB0H 4HF5H 5TDPB 5HGAA 4OZFA 3MA7B 3GO1H 4GXUN 2P7TB 5DVNA 2Z92A 4PGEA 5C0GB 5IIEA 3RWDA 1T80A 3RNQB 2I25N 4PB0H 2GYSA 5E56A 1J12A 2IADA 4EDXB 2AQ1A 3VFOA 2YZ1A 8CGTA 4L3CB 5DJDB 4P2YA 5JNYA 5C0EB 3V6ZA 3BGFC 2VDKH 1T2XA 2A73A 3C6SB 3O4OB 3ZKMD 2NLJB 2MKWA 4MDJA 3C5ZD 3RVUD 32C2B 4ZFZA 4GW4B 4K3EH 3VXTA 2YUZA 4I2XE 4Z95H 1H3UA 1CXHA 4PV8A 3QISA 4G3YH 3CCHA 1BAFL 1URLA 1D9KA 3ARBD 4ZUTA 4AH2B 5ANMB 3LRSA 4MA3A 3TYFB 4HUKB 4DZBB 1QFOA 3S35H 3GB7A 3KNBB 4IDLA 1TPXC 1ES0B 2D0HA 8FABB 1ADQL 1NEZB 2Z91A 4HFWA 1I3VA 3LKRB 1A4JA 1J0JA 1GGTA 3DMMB 2NW2B 4X9FA 4YDIL 4APQA 1X4XA 4PUBL 4NZUL 1RIHL 4P46A 4IHOA 3WJLC 4G5ZH 2OK0H 5TJWK 3D0LA 4JY6A 1I1AA 3UTSD 1X4ZA 4O4YH 3PV7A 5B39A 4WDIB 4LIQE 3EGSB 1XCTB 1TCRA 5LWYH 3O4LD 5J13C 1FL3A 2X89A 3QIBA 5DJXA 5C0JB 1M05A 3MRDB 1MLBB 1MCRA 1N2RA 1WZLA 4I8DA 1BEYH 3W0WB 3DXAA 3EYOA 3H9HA 4OM0L 5DYOA 3RHWF 5GS1A 1ED3A 5IJKC 5ICYA 1VFAB 2BOBB 1EPFA 4PTUA 1MWAB 3TO4A 2VLME 4NFBA 4LCWE 3AGVA 2HTLD 5E8PB 4N90E 4XNMB 3DV4A 3UTZB 5F7DB 4PBWD 3V0WL 5C3LD 2G75A 5I8CB 1MCIA 2AJZA 5CZVL 1S7XB 3DMMD 4NWUL 3QHZH 1JI2A 3MRIA 4BQ8A 2DTML 1F42A 1QFPA 1JF1A 3WFHA 5E2VH 2H32B 5IG7B 4ZFOA 4JN2B 4P59H 5MEND 5D1ZB 1H3VA 4JQXC 1NC4A 2VERN 4FXKB 3NPSC 3DX6B 3TFKC 3UZVB 4NKDB 4M9OA 5KSVA 3ILPA 5HHOA 1CGXA 1WF5A 3QG6B 4RMWA 4QXTA 3DGCR 3EO1B 1W2KT 5FK9A 1NEUA 3HCVA 1B6DA 3P4LA 5ILTL 2V17L 3WJLA 3MXVH 1AGEB 2G60H 3HE7B 4YIQB 1LDPH 4KMTL 1K6QL 4KUZL 4XT1C 4QT5B 1U3JA 4WW2F 4WO4B 1A2YB 1QRND 1E4XL 3QEGL 4WHYH 3HR6A 5TGBB 4ORGA 1CGVA 3DUUB 4J3SA 3FQTB 3S36H 5JIPA 3ALWA 4KZEL 2P8MA 4WFED 5GGSY 2Q8AL 1T03L 4RISH 4QCIA 1I9IH 2NZIA 4NSKB 1KV3A 2NXYB 1TZIB 1SJHB 1ZSDA 5F96H 2RBLA 4K7FB 1U58A 5C08A 4IRSC 5DK3A 4QRSA 1F11B 3WFDL 2A38A 2JIXD 2YPLA 1PG7X 1F2QA 1NGZB 4PJDF 4K07A 5EIIA 3UPRB 1VKXA 3UTQB 5IP4A 2AW2A 2FLBT 1FN4B 2JB6A 1X5IA 1RD6A 1CLZH 5D4QA 1PYWB 2FJGB 4HT1H 1FNSH 4G8GD 2X5PA 3MPCA 2JE8A 4CDGC 1DLHA 2A83B 1U58B 5JPNA 1GL4B 2QHRL 4OUOA 3RWJB 4X7CC 1NBYB 4MDIA 3V5KB 4DGVL 1D5MA 5F21B 4MAYA 3BO8B 1YPZA 5DYOB 3IJHB 4MNGB 4MA8L 1V3LA 1FV1B 4U1NA 3JVGC 4H26B 4YGVA 2FJHA 3QH3A 1TVHA 3ARGA 4OF6A 4U1IA 5EDXA 5IV2B 2YD7A 1ADQH 4RBPK 1VGKB 2BDNL 3RX7A 4NZRH 5HHPA 4KRLB 4NIKB 4YXKH 5BVJB 3GSUB 5C2BL 5F9OH 2CUMA 3RDTD 1SBSH 3G08B 1I1CA 3KG5A 3HPLB 5ITFA 4JB9H 2GJ6B 1MREL 2NX5B 3LS4H 4LVNB 2BVTA 2YD9A 4UDTB 2E7MA 5GRJH 1YEDA 3QWRA 4MJ6A 4X7SL 1DDHA 3OJMB 5CP3H 1T1WB 2WIIB 4NQSB 4YR6A 1NLDL 3TYGL 4IJ3C 5J8OA 2I9LA 5FYJD 4M7KH 1RUPH 5T33H 3U4EA 3GNMH 3SDDD 2PO6D 3HN3A 1P69B 4P57B 2BJMH 4Y2OA 4EI5A 3FO2A 3D25B 2J8UE 3PGFL 5F70A 5C0GA 1FZKA 5IIEB 3GMPA 2NX5A 4XXDA 5DK0B 4HUUB 4TUOA 1NMAH 3SDAA 2W91A 5F7HA 2X4RA 2HP4A 4JDZB 3QDGE 3DX9A 4P99A 1CL7H 1I3UA 1KF9B 3RX5A 2NPLX 1YEEH 3D6GA 4JFEA 4HKJB 3S3SA 2VE6A 4FQ1H 2DM4A 3FO2B 2VWEC 1ZANL 5HI5C 2D7NA 3GMQB 1A6ZA 5D8JL 5A40E 3HLAA 4JRXA 5A43C 4DGIL 4PLNC 4JLRB 3D0VB 4HH9A 4RX4D 3GHBH 1ZT7A 4EUPG 4LLMA 4OLYL 2BNQE 3MLRH 1EFXA 1UT9A 3DYPA 5FKPA 3TJEL 1T22B 2G60L 2ATPA 3L3IB 4EOWL 1K8DB 1ZGLP 3ZKND 5EUKA 2EO9A 5F1IB 3FQUA 1ZHNA 2P47B 3BP5A 3OWEA 1EFXD 2V6HA 3P3YA 4I2XB 4JLRA 1IKFL 5KJRH 4NZTH 3W0WD 2HVJB 4UT7L 3RFZC 2KH2B 4MLSA 4O2EB 4OFPA 1N5YH 2CUHA 1XCTA 4PJ5A 3VI3E 3I6GB 5C9JB 3ZHKA 3MJGX 4HIJB 5C09D 1CVRA 3MOAH 2WLZA 1WCBA 1T03H 2BVUA 2W0FA 3LMJL 4QHLA 3UDWA 2F53D 4NZTL 5C08E 3VG0L 5LJYH 2ADGB 3P0VH 4EUPH 3H9HB 2VDLL 3IDMA 4K3GA 4JG0H 1N7ML 4CADB 1XF1A 5F71A 3ZYZA 3VFOB 2Y25A 1F6AB 4X9HA 4MJ2A 5SX5K 4PGJA 4HIJA 3C6LD 4TUKL 1W72H 1OTTC 1CD9B 1TXKA 1JGLH 4NYLA 4QKXB 2HRPH 4LMQE 4KHXL 1GGCL 2HG5A 5I18L 32C2A 4G7YL 5FYKL 5IQ7H 4OLVH 2DN7A 3T0VA 4C58B 3AC0A 2M26A 1UENA 2AV7B 1S9VA 3NA9H 3OKOB 1CK0H 3BH8B 4KK6C 2A2QT 4KRPD 1FVCA 2CH8A 4X6CA 5HDBE 4XVSL 1M7IA 4PREA 2PR4H 5DFVC 5L88H 2XZCL 4RWYL 5B22A 5I18H 5DRWA 2X4QB 5IOPA 1QLFB 1ES0A 3D87B 4XPGH 4S1DC 4G6AD 4DUWA 3N85H 4NKDA 4YHOH 4M4RA 4LPCA 1MFDL 3EO0A 3H3PH 1CLYL 1F3JA 3VFRB 1KTKE 1TJHH 5BRZA 2R56L 3RWCA 4JO2L 3F62A 1UQSB 2HKHL 4AY0A 2HAZA 2QQLH 1H3WM 4AENA 1CI5A 1NUNB 4Y19E 2X4QA 3AXLA 2VDKL 3QYCA 1KC5L 3Q1SL 2DQEH 4Q74A 2VE6B 1E0OB 2FO1A 1R5IA 2Y5EA 3GMQA 4H1LA 1DEEB 2QQKH 4IIQA 3H0TA 1YEKH 1G6VK 1KN4L 2DKUA 3UTOA 4MJIB 3VGEA 3ULSA 3TV3L 2DI9A 1D5IL 1E27A 4PTUB 3NN8B 1YNLH 2R4RH 5FKAA 3BZEA 3CFDB 1HOCB 3R0NA 1BBDH 1J8HB 1G9MH 5F7YC 1BQUA 3MV8B 4RMTA 1R3LB 4X7FC 4CN1A 1ETZB 5INDB 4XP1L 4CVXA 4RMRA 4WW2C 4Q0XH 5C08D 1FZMB 4GLRH 1N3NA 1T1XB 4OT1L 3G6JA 4PRPE 4XP5L 2HVJA 4YDVB 3BYYA 2QSQA 1IC4H 1AI1H 2VISB 5DT1L 4BUHA 4P2OD 2BJML 4X6BA 5FA3B 4XX1G 4JZJB 3RU8L 4R9HA 2B0SH 3W81A 4ZMAT 2IC2A 3BI9X 5JHLH 4I18B 4OCYH 5B4MC 1EH9A 3QA3A 3ARBC 4XNXL 3P9LA 4NO2A 5JDJA 2VR4A 3L7FA 3H42L 3Q48A 1FFNA 1JVKA 2XWTA 5F44A 1A6UH 4JRWA 3MRPA 5HSFA 2A6JA 2AVGA 4S1DD 4JVWA 4JRYA 2WAHA 5FGBC 5BV7H 4NP4L 1WZKA 1LE5B 1CICD 2XQBH 2OP4L 4F7EA 3E6FB 5EZLA 4F7TA 4KQ4H 5C7XL 2FX7L 1CR9L 2QEJA 43C9A 4OZGB 2AXFB 4D94A 5AG9A 4MAUL 4JPKH 2EE9A 5ESQA 1OW0C 1CVSC 4H25A 3V4UL 4Z7VE 1AXTH 1IGYB 3O2WH 1PZUB 1IT9L 1T2QH 2NXZD 3SDAD 5TDOA 5FECB 1B6UA 4FQXC 3A0OA 5HI3C 1AKJA 1BQLL 2VDQL 3FB6A 2V5MA 1N5AA 3E6FA 4WFHE 4M43L 4OKDA 3GJEB 1KJ3L 1ZS8B 2PO6A 1I4FA 1UA6H 3PG2A 1A6PA 4XWGL 2IMNA 4Q6YA 3O9WB 1RIUH 2VABB 4WHDA 2UVEA 5KTEL 3WD5L 1V3KA 1A1NB 2VL4A 1S9XB 4IM8A 4K7FA 1I8KA 5HDBF 1UFUA 4O5LL 4CGTA 4Q9RL 3MMEB 1MCOL 1D5BA 5EO1A 3O4LA 5F1SA 2BNUB 3DTXA 5DMYA 1IAIH 5DJYB 2AXHA 5D7JD 2VZUA 3E2HC 4NNPL 1A6VH 1EVUA 4XVTH 1NAML 2E9BA 3QO1B 4PJEB 5BRZE 3O2DH 3U6RA 4G43B 3PXJA 4QHNA 3ARGD 3PHOB 2UWEB 3M1BB 1LD9B 1FNAA 4ONGH 2R2BA 3RWFA 4EKXA 3W39B 3GBNL 2V17H 1NMCB 2HKHH 1KPRB 2FGWL 4G6AC 1P5VA 2ICWB 1J0HA 1J0KA 3DRTA 2Z35B 2EC9T 2DM3A 3PV6A 1LK2B 1NC2B 4NRZA 5T1KB 1O7SA 3QNZB 5ID1B 2J8UF 4TSCL 4GAJH 2VXSH 3UP1A 1QHPA 3ZKXB 2GK0B 1MVUB 5IB2B 5E24E 3NGBC 3QXVA 2OJEA 5FOBB 4OCWH 4PJXF 3WUZA 1CU4H 3WDIA 2LAGB 3QUXB 3TC9A 4KC3B 2CKNA 2R1XB 2X1WL 3GI8L 5EBWA 4G9FE 5MERB 4E42B 2PTTB 3BKJH 1EEYB 5GGVL 3T8XA 4XPHL 4X83A 3VXMA 2X4RB 1MJ8H 2FWOA 4PR5B 2C1PB 4ODUA 5MENB 2RB8A 3BP4A 5HVGB 3W9EA 2W9DL 3IJYA 3DVIA 2R29H 5I73B 5E5MB 2IQAB 3QDME 4OAWA 5TQ0H 1H3GA 1A7QH 5DMJB 3VXPA 5LVEA 3ILQD 1IEAA 3KXFD 3V0VB 3IAQA 1SQ2N 3BN9D 5GGTH 1FPTL 4LLVB 1K5NB 1XF2B 4WDIA 4L4TE 4MZ2A 4PB9L 4OD1H 5DDHA 5IJVB 2GQHA 4M7KL 3D0LB 1GAFH 1W0VA 4CU7A 4LCIH 3HTLX 2CKBB 3LH2H 5I1CL 1F90L 2HT2C 4HGMA 3H7BA 4HZLB 2AQ2A 4YXHH 3Q0HA 3QRGL 4P0DA 1NMBH 1JNNL 3HZMB 4QRQB 5IVZB 4G6MH 3HC0B 4UNTA 1I75A 2MCPH 4RAVA 4K3JH 3WMSA 4JFHD 2VQUA 5TH2A 1KJMA 1B2WL 1Y6KR 3IETA 4OZFH 4GMTL 2DBJA 5BOZG 1RI8A 3RX8A 1BD2E 4WI7A 2XICA 1XIWC 3HKFA 4NWTH 2JELL 2IH1A 1WWBX 3TO4B 3PHQA 1CLOL 4OM1L 2ADFH 1T1ZA 5FB8B 3U4BL 2FO4A 3VW3H 3O3EB 4PYHA 2X1XR 5KSBB 5AAMA 4X98B 4C4KO 2YUXA 2R2HB 2E7BA 3TBTB 5J1TC 5C6PB 2X4OB 3QDGB 5TQ2L 1UJ3B 4GJTB 1AXSA 4NM8H 1ZLUH 5BQ7A 1AD0B 4GRMB 2H6PB 5FGSA 5E8EB 4X8XA 1N3NB 3NACH 3NZ8B 4Z7WF 3CDYA 5K9KB 4JR9H 5IVOA 5M7QA 1ZWIA 5EU7C 4MCYB 3MRRA 3IDMB 3QIBD 3MJ9L 3R1GL 3WEXB 4NT6B 1UZ8A 1TCMA 5EB9A 1UKTA 3H9SD 3REWB 3ARUA 4JAMB 5DRXA 3IDNB 4P2RB 1C7TA 1JV5B 2FIKB 4JR9L 1JPSL 4UZGA 3WIHA 2ZOLA 4RCAA 1DBAL 3D5OF 1AGEA 1S9YA 1T0NA 1WCQA 2O5YH 2HJFB 1U8QA 3FQWB 2Q6WA 1P6AB 4G6KL 2R2CA 5CBAB 3PF2A 4K71C 2R9HC 1AO7D 2A6JB 4UINL 5FFLA 1I7UA 4GXUM 4NFDA 5E1AA 4X9IA 1LVEA 5E4EC 3U46B 3L1OH 1UM5L 1QLFA 1U3YA 3EKCA 4G42A 4WI5A 5D1QD 2VSCA 2VMFA 5C07B 1C5DB 1QSVA 1CBVL 3F58H 1NJ9A 5FM4A 4Z76A 1RZIB 4JG0L 4RGND 5IFAL 5B3JF 4JM2A 1QLRA 3SE4C 5DJ6A 4WFFD 1DTUA 4LP4A 4R7DB 3SCMA 3U0WL 5EUOF 4J4PD 3MR9A 3OX8A 3OKDA 1FN4A 3GMNA 5FO7B 4N8VB 5AZ2H 5C07A 1MPAH 1IM9D 1WFOA 2XQYK 3W5MA 4OTXL 3T3PF 3FOLB 5CP7A 1A4JB 4EN3D 2M2DA 3L3OA 3Q6FA 5ECJE 3S88H 3LN5B 1MCHA 4LU5L 4YHZL 5SWSE 4XAWL 4EDWL 4ZD3H 4IIQC 5DLMH 1BVKB 2LFGA 1E27B 5D7JB 3U36B 2QSCL 3HRZB 3VI4F 1UWXK 3GM0A 4HDIB 4IRSA 1MNUH 2GFBA 3IJHA 4E0RA 3TZVA 5BRZD 2H2SC 3ARDD 3BUYB 5GGRB 5D7IB 4NO2B 5MENE 2EE6A 4IMLA 4KAQH 3VRLF 3AS0A 3ECBB 4RGNB 1U3HD 1IAOB 1WC7A 1RVFH 4H88H 2V9RA 3HG1E 4IS6A 4LFHD 3RTQA 1S7QA 3BMWA 3TBYB 3HI5L 1IMHC 3UYRL 2EE3A 4NJAH 3KPSD 4U1SB 2QR0A 1A7BA 1AD0A 3VXOA 4ODVH 4J8RA 4RDQG 5C8JA 1MJJA 1RUMH 4QXWA 5GGTL 4KROB 3GKWL 5FYJU 5J1AB 4PJ7A 3BAEL 5BV7C 1OTUD 4PBXA 3ULUH 4OLYH 4Y5YA 4U31A 3BOVA 3K2UL 1W0WA 4L3CA 1BIIB 2Q7YB 5J0BA 5IWLC 2J6EL 1RMFL 1RURL 1LWRA 4QXUH 5IVXF 2WW8A 3L9RB 5CJOH 4OGYL 2WBJB 4MHHI 3VFGH 4PS4L 3REVA 1CE6B 4NNXA 3TV3H 5IMLB 3CMOL 1G7LB 1R3KB 3BN9C 2N4IA 1IL1A 4DAGL 4OF7A 4LVHB 1U8QB 1G1YA 2VDPH 3KJ4B 5J12C 3WFCL 1X6NA 3KPOA 1KB5A 5CIPB 3ZT6A 3HC3H 3CVHH 4Z9KB 3AS2A 3DBXB 4LASH 4AJ0A 1KCUH 2VLKA 3ARVA 4ALAH 1N6QH 3BJ91 5KSBE 1DUZA 1KLUA 1FSKB 3Q5OA 1HDMA 2ZG2A 4X4XB 4F7CA 1A6ZB 4MXVF 2HFEB 3KYMA 4QYOB 3CIQA 5F8QC 2X70B 2HLAA 1T83A 5ICZB 5J13B 2D31B 2VXTH 5DO2C 3UZQA 1CQYA 5JXEA 1FVEB 1L7IL 2BNRE 3FT3B 1GVIA 5GRUL 3FFCD 5TPWH 2F54A 4L4VA 1TFHA 4A6YB 1WBXB 3NCMA 4U1LB 4ZS6D 5T5NF 4WU7A 2GAZB 4QHUA 1F02I 3I84A 5JW5B 1FAIL 4JFDA 1GJIA 3V7AG 4C4KT 1KT2B 3J8F7 3BP5B 5E2WH 2AEWA 4L9LC 5AZEH 1ZVSA 4PRDA 3R06A 3TJHC 4ODTH 5C86A 3V4UH 5B8CA 4NN6B 3FT3A 1OP5H 3TM6A 1D5BB 5HD8C 5SV4A 3F7QA 5CJ8A 5I0DA 2ITCB 4K55A 4P49A 4NKOA 3X12B 2OBGA 1O5DT 5DR5L 2G75B 4J3WA 2GITB 4RMSA 4IRZL 2Y23A 3INUL 1XAUA 2NX5D 1TZHA 1SVZA 2YWZA 3C60D 4KJQC 1FG2B 3BO8A 1VA9A 3U7WH 2R23A 1XH3A 5F97E 1GXEA 4M3KB 2ESVE 2FHBA 2R4SH 4XP4H 1JNLH 3MACL 1NL0H 1CFNA 1M71A 4XP9H 5SWSA 1MUJB 2QSVA 4WHTB 3T8XB 1QBAA 1K9TA 4YLQT 3SGKC 2CJUL 3HNTH 1FVCB 5BO1H 4BSWB 4GRLA 3U9PL 5HTSA 1XCQA 4UQ3B 1A21A 4BZ2H 4P5MB 1U8MB 2AV7A 1QRNE 2BFVH 3PWUB 5DHVA 3KPSA 5DI8B 3MNVA 1JNHA 2VZTA 4NHUA 1M7IB 4XP9L 4EQ2A 4TOYL 1YC7A 2RIKA 4QF1B 4I13B 3S7GA 1KCKA 3L5XH 4U1GC 1JTTA 1OAKL 4NUGH 1OGAE 3TNMB 3W0WE 5J11B 4N8VG 5EOQL 1LP9E 2DLFL 4PLJD 5DA0B 2CK2A 3M45A 1M4KA 1C5CH 1U8MA 2Q86B 3K7UA 2QQKL 4ELKA 5K9OB 1JPST 3AMLA 2OZ4A 3F12A 4LVOB 5CLTA 1JJUA 3Q6GL 4MX7B 3TP4A 1JWSB 4PGBB 4XXCC 1BD2D 1DEEA 1WZMA 5DRZA 5KVDH 3LDBB 3E0GA 4KK5C 5F8RC 3QIUD 5FYJH 1I9JL 1T20A 5I71B 5ERWB 5ANMA 3QUZB 4XAKE 3KPPA 1JGUL 4FFVD 4O58L 4EBQH 4LLVA 2QADC 3PL6C 1KB5L 5JORA 1NMAL 4OZIF 1QFWI 1VFUA 4LVNC 3QEQB 5JUEH 3SKOB 3ZKQD 2VDPL 2LV4A 2EDEA 2KPNA 4EUPA 2JCCF 3EJYD 3MLYH 4QOKA 3HI6L 4FQHB 3SCMD 4Z76B 4KQ3L 3LS5H 1I1RA 2C5DC 3HC3L 1AQDB 1NGQL 1T0MA 1ULVA 2FJGA 2BOCA 2UYLA 5KVGH 4BYHA 1ETZA 5INDA 5CJOL 2YMXH 4LSSL 1JTOA 1SYSB 4HKZA 4KI5D 3U30C 3MR9B 2NYYD 1RVFL 4H88L 4NRXA 3CDGB 4U05A 4MYWB 1QFWL 4KHXH 1MHPH 1HI6B 3IFPA 4B0MM 4MA1B 5DJXB 1RURH 4WWKC 4G6FB 1FRGH 4RBPH 1EXUB 2J88H 3QA3B 3G5ZA 1KCLA 5T5NG 3IJSA 4YXHL 4O2FB 2V2XB 2C4FT 1OM3H 3UCRA 3DXAB 3EYOB 5FF6A 4POZC 1OWWA 3UTPE 1JZ2A 4DAGH 3LEYH 3SGJC 3MRDA 4LHUA 4Q6IA 2X4OA 4WW1A 4GG8A 2VLLA 5ACZB 1AQKL 2EDNA 4X0KB 4HG4K 5GS0C 3UMTA 4PJDB 4A2MA 4NQCA 4I48B 4PTTB 2CXKA 4JE4B 4LRIC 3QRGH 1EV2E 4FMKA 1MFDH 2CRYA 3O2VH 5FYKD 5KZCD 4TYUA 3ARRA 3CUPB 1FFRA 1ZHKA 3A67L 5GISH 1GC1H 3GMRB 4O02H 5GXBB 3ZO0A 3MBEB 3PWNA 4U33A 1M6OA 3D69B 1D6VH 2J6EA 1DZBA 1F4AA 2AXGB 3FO9B 3VXSA 2P48B 1OY3B 1DQMH 2ZUXA 1C1EH 5M95B 4NN7B 2BVPA 5D2LA 1Z5LB 1F58L 1KACB 2X7LB 1UJ3C 5L0QB 3FB7A 3RGVD 1D6VL 1BHGA 2GUOA 3N9GH 1WBZA 5CBAA 5FECA 3WSQL 2R8SL 3FB6B 1EO8H 2FHFA 2AV1A 4F2MB 5MEOB 4CAGA 1K2DA 3L9RA 1HK6A 3BP7A 2AJ3A 3TO4C 1XGRB 2FBJL 3BUTA 3TBVB 4NQCE 2LE9A 4WO4D 1W8NA 5IMLA 5IJKA 1S5HB 2EYTB 4JFFA 4PJHF 3NVQA 5IMOA 3CXHJ 3SBWC 2AJVL 5L2KB 5AZEL 3FQTA 1FL5A 2VAJA 2QQQA 3RHWK 4U2ZA 5D2NB 2NY6D 1GZPA 5H8DA 4KKBD 5A2LH 4GBXA 4ZO7A 4PP1C 5T1LD 4HWZB 3VXQB 4LKXA 1FFPB 5C0BA 4IRSB 2FR4A 5E8DL 5J06A 4JEGB 1P9MA 4N0CD 3KYMB 4QYOA 2XKUA 4LHQB 2X41A 3P30L 3EDFA 1KIQB 3EFDL 1FJ1A 5JR1L 4HWUA 3BEWA 4FZEL 1ZAGA 2OZ4H 4G6KH 5C0ND 1GIGL 5KVMC 4P5TA 1FNEA 5IMMB 4JQXA 1NPUA 2VC2L 4UOJA 1CXKA 1OGAB 3SE9L 5I73C 2UY6A 2JB5H 3FAWA 4RFNC 4WGVB 4OCSL 1DEDA 4JREC 2ICWA 2EKSB 4PLJC 5GZOD 3MTRA 3AFLA 4FZEH 4I3SL 4UINH 5D7LA 1KOAA 2J5LB 2XPGA 3I9GL 4IMLB 3C5ZA 4S2SB 4XGZB 4TSAL 3Q2CA 1NGXA 2PR4L 4R3SB 1CFVH 1UACH 1AFVH 4P4RB 3WJJA 3PABA 1BF8A 4LF3A 5I75C 4TOYH 5GGQH 5BZWA 4P2OC 4NCC1 4YK4B 1ZHBB 1E6JL 3REVB 1UB6B 1NBQA 4X5LA 3DRQB 3T0BA 3VA6A 5E9DA 1JK8B 4DZ8B 4HXBL 5DJDA 3S4SA 4DQOL 1T3FA 3MBEA 5E5MA 1HKLH 1Q8MA 1AGCA 4P5TD 5E2UH 1YEGL 3JWDL 3V6BR 1ZGLB 4MA8H 4U6YA 5C0AE 1HDMB 2IEPA 4F7CB 3OKLB 3PNWB 1K5NA 4L3ED 5JDSB 3MRMB 3GMMA 3VWJD 2DIJA 4I5BB 2QHRH 1CGSL 1FC1A 3WLWD 5I8OL 1IAKB 2C7UB 3S4SB 3GEWB 4A6YL 3U2SB 2GJZA 4P4KC 2V9TA 1U3ZA 3QWQB 3MLZL 3HZVB 2C1OB 2ED7A 2OI9C 4NZRL 1U6AH 4JN1L 3WHXA 3QUZD 4M6OH 4MSWA 4X4XA 3NBNA 1CF8H 5SWZD 4P46B 3OMZA 3LQZB 3QPXH 2BNQD 5HYJB 5EPMA 3BRDA 5C07D 4KPHH 1AI1L 3RUGB 1UXWA 3OJDA 1MJ7H 4HCRA 3PHQB 3QWOB 5KOMC 4AG4H 3PXHA 2FZ3A 1SBBA 1WITA 2DRUA 3KPRB 3ZT5A 3KHOA 4XCEB 5A2IH 2Q8BH 3JBG7 5DEZA 5C0CB 2DIAA 1ZVSB 4PRDB 1IQWL 4POZD 2G5BB 2EH8L 5I6XB 1IJ9A 3O0RL 3S96A 1SEBB 1U8OA 4FQXB 5KSAD 4HC1L 1ZMYA 4OD2B 3GO1L 1UM5H 3OG6B 1Y0LB 3VFMB 4WHTA 1AO7A 1TQBC 4W4NA 4IOIB 4R96A 2P44B 4YHYB 3T0AA 1X4YA 4HULB 4ERSL 1MIMH 5SWZB 3BPOB 1IM3B 5TPWL 4TSBH 4H20L 3UJIL 3WNPA 1NFDF 3CZFA 1PKQB 4HZAA 2VXTL 4JFQA 4P9MH 2X4TA 1P7KB 2BC4A 1KCUL 2AK4B 4YEEA 3V6ZB 4YDJB 1GOFA 3MUGA 1S9YB 1T0NB 1A02N 2E6PA 4R26L 2FGWH 3EOTH 3GKZA 1JHKH 2F5AL 1DL7L 1P9MC 5EZIH 4LPYA 3MUY1 5FO8B 3FQRB 4NO5A 5C1MB 1PGRB 2CIKB 4X0KA 2G9HA 4UV7L 2IGFH 1WUNT 2GK0A 3KPSB 5DI8A 4JDTL 3JUYA 2Q20A 1HINH 1G9NC 2WM0A 3ULVL 4K3HA 4TN9A 5F3BA 5ADOH 1Z0MA 3C08L 4LEOA 4NNPH 1QPPA 1PQZB 4BH8B 4PGCB 1YNKL 5FYKH 5IQ7L 1FZJA 2VLJD 2ARJA 4WU5B 1R3HA 2VLJA 3PWNB 1EMTL 3GRWL 1X3DA 4P23D 5IROC 4FQPA 4P5KA 2CGRH 5JDSA 4PJ9B 3VXSB 5ANME 3TA3C 5KAQG 4L4TB 3GUTA 3BP4B 4JY6B 1XEDA 1BBJB 3GJFA 2GT9B 4R7DA 1G7QB 1AIFB 2C3VB 3HA0A 4PY8I 1HHIA 1NGWB 4DKFH 5I6XC 2CJUH 1MF2L 3HNTL 3GSQB 4LSPH 1AP2A 1ODAA 1QBML 3LQAL 1S7TA 1JWMA 3QI9B 1H5BC 1OAKH 3MACH 3E6HA 4YPJA 4X7DC 3LQMA 3QUZA 4KV5E 1ZT1B 3ULUL 4ONHB 2LU3A 2Q76A 4TUKH 5HY9B 1B0GA 2CDGA 2Z4QA 4NQXA 3ARFA 4K2UH 5GS1B 1NL0L 5C0AA 2DICA 3OAUL 1WAAA 4JZNA 5CHNA 4XP6H 3ARFC 5EU7E 3HI5H 5EOQH 2YK1H 1CK0L 4MJID 5HDLA 4QCIB 1QVOB 3VWJA 4GG6F 2GTZB 1H3PL 4BK4A 4NBXB 1ZVYA 1FDLL 4C56E 5DJ0B 1G0YR 5EOTB 3T65A 3ISWA 1J05A 3UO1H 3G5YA 3P4MB 4MXWH 1MPAL 2YKLH 1GHFL 1CN4A 1NLBH 4POUB 1J5OH 5DMKA 4Y5YB 4D0BB 1OB1B 5I17B 1EHNA 5I9QC 3V8OA 4M8QA 4YWGH 2DS4A 3T2PA 2R2HA 1IGJB 1YNLL 2R4RL 2HFFA 3B9KC 5CSBA 4EZMA 3EJZC 3BPCB 4TUJB 1MVUA 5IB2A 4G9FD 3GI8H 4HKBA 4H26A 1ZV5A 5FDWA 5GRVL 1JGVH 1VADB 2X05A 2IALB 3OAZH 1HHGA 4PJ9C 2X4SB 3FT2A 2J12B 4XP1H 1C08A 4R90H 1WBZB 2AJXH 4HMCA 1U95B 3HUJE 2K7PA 2IG2L 2F53A 2AK1H 3TPUA 1BZ9A 4AL8L 1FH5H 2I5YH 1Z9SA 2NYYC 1WZ1H 3WN5B 2B0SL 2FIKA 2BXYA 1MAJA 4RDQF 3VFVB 2PYED 1FCGA 4JRYB 4O51B 3WIHH 1C5BL 3T3PE 5E08L 3WUWA 4DGYL 5DVMA 1J1OL 4FTVA 2PXYC 5I66B 3CDFA 4UIKL 5BJTA 4CNIA 5D7SL 2ORBL 4G6JH 5JIKA 4PD4J 3VFTA 4G8FB 4Q6IC 1CFQB 3QQ4A 3UTTD 4V2BA 5DUBB 1DQJA 1RZGB 4P9ML 2BDNH 4OGYH 2IFFH 4XNZC 3GSOB 4U3HA 3MV11 2R0WL 4D9LH 1WIPA 1RY7B 4MD0A 5E94B 4WUKH 3D39D 3DX9B 1HHJB 2Q76B 1DQDH 5KW9H 1J1PH 3JWNC 3GJEA 4OB5L 1CLOH 4OM1H 4K8RC 2GSGA 2MHAB 3PGDA 3QT2A 1W72L 5C0AB 4P2CG 1H15B 2FRGP 3CLEH 3TVMB 3MNWA 3EAKA 4PV9A 4RSVA 4WFHD 2MOVA 3MX0A 3FO1B 1NGXB 5DS8A 4Y19A 2AXJA 1NCBH 2HRLA 4JKPL 5ALBL 1DANT 5KVFH 3JV4A 1CFNB 3WCYA 4K9EL 3PL6A 1K8DA 4WFGD 5HDQL 1T5WB 1X5KA 3DIFA 4NQDD 4DW2L 5I1HH 3BQUA 2UWEF 4X6DB 3WSQH 2R8SH 4UB0L 3S4SG 3DRQA 1ZOXA 4HMEA 2A6DB 2E6QA 1U8HA 5E6IC 1RUAH 3K0WA 3QUMB 2WV3A 4NN7C 3PWPD 1BFTA 1UWXH 2ZUVA 4NPYB 3SJVD 3CVHA 5KANG 3N1PC 1IGIL 2HFFB 1P84K 5C09E 4OB5H 3RDTA 4BQCA 2WNGA 4LF3B 2O5ZL 3IDIA 5C09B 1FYTB 2FBJH 4J12A 2I26N 1T0PB 4RGOL 1X9QA 5DR5H 3LCYA 4QWWC 2ZCHH 4RISL 3CFCH 5DFTA 3VE0B 3BDBA 2L0DA 2VITB 1UVQA 2MWCA 4PV8B 3HMXA 5LXGH 5IEHB 2EDHA 1PKQA 4LLAA 3F7YA 3D2UA 3GSNA 4Z7UE 5B21A 1HZHH 4LBEB 4W4OC 3KNBA 4GRWE 2B4CC 5K59E 3T1FA 1NH6A 3I02B 1LMKA 3QDMA 2ZCKH 5CP3A 1CD1B 5F96L 5GGSA 1XGUB 1CE6A 2CIIB 5E2TL 2YN3A 2YD1A 2VXSL 2XTLA 2DQCH 2F9BT 3OG4B 4PRHA 1WICA 3DOSA 4X5WA 4KDVA 1NUGA 3RUGA 5IK3B 4ZTOL 5DJCB 1FGVL 2VC2H 2RAMA 5BOPA 1MRCL 4YHKL 3IFOB 1FH5L 1WFNA 5GZOC 5E6YA 5FAAA 1NBVH 5J9PB 2HFGH 3HUJA 1V3JA 3IDGB 5BW7A 1G7HB 1CICA 5HHVL 2FEDC 5EU6A 1IAII 3WHE0 3WXWH 15C8H 5D1ZC 5DC0A 5F1NB 4O9HL 2D2OA 1IAIM 3MGAA 4P2RE 5C2BH 3E8UH 3NN8A 3DWTA 4PRNA 1U9KA 4MHHG 3MA9H 4V2CB 3PWJB 3WIHL 4I77H 1VDGA 3C60B 3AY4A 3VRJB 1I7RA 1ITBB 1MHCA 3ZKNC 5FYJL 4HQQL 4YHMH 4X4ZA 5FV2A 2G2RB 5D1XB 4GAFB 3T0XA 4YNYB 3I6KB 3CSGA 4X7SH 3R06B 2QV2A 4X6DF 4K7PL 3H3BC 1SBSL 1MQKL 3P9MA 2VLMD 3CZFB 4P2OA 1Q9KB 4YXLL 5AD0B 4XBPA 4U0RC 1K4CA 2IMMA 3OL2A 4HS6B 2ESVB 2DLFH 2A6KA 2UWEE 3U0PA 3MRFB 4HBCH 3OAYK 4ZG1A 4L8SB 3ILPB 3T2NL 1P6FA 3G6JB 1GAFL 1I9RH 1NC4D 3FO9A 1ITCA 2C4FU 4Z7VF 3X17A 4AIXA 1K4CB 3KJ6H 2R1WA 1P2CA 3C6LA 3GSNL 4LAQH 1OTTD 3U7YL 4Q9BA 5E8EA 1TJGH 3ZTJG 3AB0B 2BCKA 4NNYB 1JF1B 2H3NB 3I6LE 4YDKL 1EDQA 5IVXA 2HT3C 1OSZA 3S5LB 2YHGA 4RZCB 2VWEE 2XTJE 3D2UD 2R1WB 5FHAH 3SGEH 4LEOB 4JAMA 5DRXB 3QCUH 3HHRB 1TETH 4HUWB 3AREC 1CYGA 1YN7A 1FAIH 2V2TA 3SPVB 2P5ED 4LNVA 3TBVA 4UT9H 1EVTC 4HGWB 5HJ3A 4AYFA 3SBWA 1UJTA 1F4HA 3CFJA 4XI5C 1UADC 3VH8A 3F12B 3N1FC 4C56D 4ZUTB 1FRGL 1OP3K 3UTTA 2HMID 2QKIA 3QEUA 3U4AA 1NJ9B 1G7QA 2C3VA 3GMLB 5DSCB 4LEXH 1QUNA 1C16A 3B2UC 4NBZB 2AQ3A 5JXED 3B9VA 1MCEA 2BHZA 8FABA 4I3RH 4YBQC 1RQ5A 1A6UL 4OT1H 2V7HA 4KK5D 1LO4H 2O5XL 5F9JA 3GRWH 5JPNB 1AGDB 2J8OA 3HE7C 4NQED 2R0KL 3O4LB 3HB3C 5DD3L 4D8PA 4Z0XB 3SDXA 3O6FB 3O3AB 4AEIL 1KLFA 3STLA 1MCCA 5DSCA 4P59L 4E41E 3JWDH 3DX8A 3SO3C 1HINL 4PG2C 5E9DD 4IBLT 3DO3A 3SKMB 1XR9B 4KMLB 3VD7A 3ZE1E 5JW4Q 4Z7OF 3QEGH 6FABH 3DURB 3S34H 4KI5F 1WCBB 4HLZG 4OGZA 4YNYA 5EOTA 3GSWB 1FFNB 2GSGB 4LRIA 3T04D 2XKNA 1YNTA 1PSKH 5GJSL 4YPGB 4LDLB 3RGHA 4CW1B 3R8BB 3NIFE 3B9AA 3G6DL 3HRZA 3RGVC 2AABH 4HIEB 1G6RA 3HAEB 3EYFA 1SY6L 3G5XB 3KPQB 1NANH 1PAMA 1ZHBA 4ZTPH 5FYJE 5H37H 3BXNA 3MV7A 5ID1A 4O58H 3KLAA 1CXFA 4FFZL 3WS3A 1CLYH 3P0YL 5DD1H 3PJSA 1QNZH 4FZ8L 4F7TB 2E8ZA 5IB5B 3WO3B 3DV6A 5DEGA 2J1KA 2OJZL 3NCYS 4HMDA 4X6DA 5I74C 5HVHB 2DLIA 5IW6B 1I9EA 1T2QL 3P4NA 4I0KA 1A1OB 2ZCKL 4FABH 1VGKA 1RUML 3MCG1 3ZHDA 4FTVD 3HMXL 4U6YB 4NPYA 5J56B 3OKYA 5F7MC 5IM7B 2L7UA 1VENA 1PX4A 3L3HA 4NN6C 4DVBA 3HE7D 2VR9A 1FCCA 3WN5A 3BKMH 2XA8L 2HWZH 2L4OA 2VQTA 1IE5A 3B8YA 3HLAB 2IBZX 4AK1A 3ZDXE 3ZE0F 1JZ4A 3HNVH 4P3CL 5JW3H 1YN7B 3RY4A 2V2TB 1XF2A 3DI2B 1T6WA 3DUHA 3OKKA 3GMOB 4WO4A 5BMFL 3BN3B 3QULB 3STBA 3U4EB 4CMHC 4IDJL 3O0RH 1HKLL 1CFQA 2H26A 3B2VH 4FA8A 1KB5B 5GSRB 5E00B 2XZZA 4IIQB 3GMPB 4FP8H 1T0MB 1X5AA 1ORSB 3PGCA 2CLVA 5DVKA 3V6OC 2IH3A 2FJFA 1CGSH 1SYSA 1TNMA 1N0XH 2HFEA 3NIGE 1OAUL 5CMAB 5F89B 3CC5A 3OB0K 4FG6C 1NAKL 3D1MC 3QCUL 2W65A 1Y6MR 1QZ1A 5HI4D 4HS3B 2CKBA 4Z0XA 1U3HA 5JHLL 1WZ1L 1BX2B 4M6OL 2H9GA 4JM2F 2OX5A 2H8PB 4HBCL 4Y16D 3TZVD 3MNWB 2ARWA 4IRJA 3TJEH 1XGYL 1F6AA 3KDMB 4JZOA 4PP1D 4RGMC 4GG8B 4NRYA 1KGCD 5ACZA 4YDJA 1IEBA 3O2DA 1I7RB 4FQ1L 1OGAA 1UXSB 2H2SD 3ARDC 4IRJD 2VAAB 4Q9CA 4N0YL 4XNYL 3FMGH 4RGNE 2FJHB 4NKOB 3CXDL 4U1IB 2H1PL 2XPGB 3VGAC 1VPOH 3P2TA 3V7MA 4F3FB 4KI1A 1ND0A 4QRPE 3UAJC 3IXAA 3KDMA 5TE7L 2LTQC 4WI9A 4DOHE 3TA3B 3OKNB 5IW1A 3QEQE 4HJGA 4J3OC 2ADIA 3S3PA 1TQCB 5TF1H 5D2LE 1KTDB 4MVBC 5K59F 2NY0B 4N0CC 1NGPL 1JE6A 1KYOK 4K7PX 2YPVL 5AYUL 1KEGL 4XHJD 3NZ8A 3K8MA 1IC7H 3IRPX 1EHLH 2DIBA 1I3GL 4EXKA 3BGFB 1RZFL 3CFKA 4X99A 2K9UA 4X5WB 3QUYD 4F37K 2ZKHL 4FQIH 1QEWA 4GAGL 2VXQH 1ZA6B 4FXGB 3D2UB 3GSNB 3LB6D 1KLGA 4Q9RH 2R2EA 2J5LC 1UM6L 3MNZB 1NCUA 1FORL 5KVEL 1MWAH 4P57A 3RTQC 4HBQA 5KTEH 2YA1A 4Y4HA 2BVEA 3QDMB 3V5DA 2ZJSL 3JV0A 1GGCH 3FQWA 5MEPA 5IHLB 4G7VH 3W5NA 3VXUA 1QR1A 3MLWL 1I7UB 3U0TB 4MNQB 4B5EA 3PP3H 3VFNB 2EXWC 5DUPL 2ZUQB 2V7NA 5KSAB 1AGFB 4HK3J 4HGWA 1CXEA 5C0JA 5H37G 3U4BH 4L1HA 1GHFH 1NLBL 4HK3N 2C3HA 1RUQL 1TQCC 4BZ2L 3IKKA 2DQCL 1X5FA 2GTZA 2FJFB 5T3XH 3EZJB 3UTTB 1LP9A 5L88L 3SCMB 4OLUL 4NM4H 4YFEA 2NY4C 5CMAA 3VGAB 2PW2A 3MRLA 1T7VA 4AEHH 2P46B 4IDJH 2A9ML 1HZHL 2A6KB 4Y8AA 2V5RA 4EIGB 3AS1A 3VCLB 4PJHE 4U1JB 2P5WD 1F5WA 3KYOB 1HYSD 3ULUD 1CTNA 4OSUH 1BLNB 2LVEA 1L4IA 4MQ7A 3S5LG 3L7FB 2R0LH 3WE6A 5CJXC 1D5XA 5ICYB 3EOBB 4U1KA 4JKWA 4KGLA 3MRNA 4Y8DC 4NDMA 4XBPB 1BOGB 3D39A 4X4YB 3FKUS 3BEVA 4YE4H 3UTZA 1MJJB 4U49A 5TE6H 1JIBA 4M6NL 1O7VA 1OOAA 4YO0A 3SO5A 2XKNB 4WFGE 5F9DC 3X11B 3QXTA 3MLRL 1A8JH 1TZGH 4CBPA 5E1HB 3QP3A 1FNGA 2HWZL 1OM3L 2Z8SA 2DQTL 5GGVY 5CBEA 3VFUA 1UZ6E 4GUPB 3TWCH 3RY6A 3PWPB 3DMMC 1U41A 2WIMA 4TTDD 5HGDB 4XCNA 1KIUA 3TVMC 4CNIB 3V79C 1QFWH 5DJZB 1J11A 5CILH 4BFBD 2X9XA 4OQTA 4XBGB 1BIIA 4QO1A 4OQ1A 4PP2B 2DOCA 5ICXB 3GMLA 5E99H 3V0VA 5CBEB 4HUWA 1VACA 4JGUA 4R2GB 5IHZA 1LE5A 4M6NH 2EIBA 3L3HB 1S78D 2ZUYA 4PRIA 5CZVH 4X6FB 1AY1L 4NWUH 4H20H 1MRFL 2LU4A 4PJFF 4UAOB 4Y1AD 3K8KA 3BZ4B 4QTIL 1K2DB 5HPOA 3RL1A 5IQ9A 5IHZB 1RIVH 1DL7H 2OSLA 4NJ9L 1JHKL 4PV9B 4JDZA 1VERA 1A1MB 2ZUQC 3DURA 2ERJB 1LO0H 4JO1H 4Z77B 2P8LB 4BQ9A 1T7XA 2LQRA 1BVLA 4CU6A 1BF2A 3RWGB 2EDWA 1GYAA 3M8OL 3RPIB 4MCZB 3UYRH 1J0IA 3O6KH 2DL9A 3BPOC 1HOCA 5LAXB 5ENWA 4G9FB 4BSVA 2R39A 3OBAA 3I75A 1OTSD 3VMOA 3LKQB 1LO0L 5DVLA 2P42B 2IWGA 1DP0A 1U8IB 3CMGA 3ARDA 3G5VB 3FO0L 4L8DB 3KYOA 4ENED 1OSPL 3A6CL 4Z78B 2VXQL 5D7IE 1KJ3H 4QY8B 3KR3H 4UAOC 2VOTA 2BK8A 3S98A 4JO3H 4NQEE 4L29B 1JZ5A 4PJEA 3MJ7A 3SE3C 3I75B 4XPTH 5SWQA 3DYOA 1EEYA 1KEGH 1FNSL 3UZEA 3ALPA 1MI5B 4X80H 5HHPB 5FO8A 3SOBL 5E9DE 3REWA 4DN3L 4UI2A 4JY4B 3EOAB 3CU1A 4D0DB 5E4EB 1S5IL 1CDGA 1H3XA 2WINA 3JUZA 4NBYB 3S9DB 2XZAH 3DV6B 1UM6H 4N1CA 2WUCL 3PABB 4PJGB 2J8UA 2HJFA 2Q6WB 1QBLL 35C8H 1HILA 2XZQL 3V6OA 3VXUD 2VDNH 3D9AH 2QQNH 4HQQH 1GOGA 4XPBH 1CLZL 4ODTL 3DGGA 4M7JH 3EFDH 5JR1H 3CFBB 4BM7A 5CGTA 1PEZA 1E4XI 4PJ9A 3WUWG 2EXYC 4QOKD 5DJZA 4DKFL 1PKOA 2A6IA 4MB5A 1KTRL 3C8KB 4Z7QE 3HR5B 2F53E 4OCWL 1G7HA 3IDXH 2WP3O 4HPOH 3MRHB 3QHTC 1NEZA 5H94B 4ZO8A 4PREB 1RZ8A 3F6LA 3T2NH 5GRZA 3F7VB 1YMMD 3OX8B 1TCRB 3U1SL 2I9TA 2ZUWA 4UBDD 1I8LA 2CO6B 2DQTH 3NCCB 3HC4H 3ZE2E 3PWJA 4QHKI 4GS7C 5D1XA 5LCVH 3GSOA 1IEAB 5EZJA 4Q0XL 1FL3B 5C71A 3HRPA 2VYRE 3VRJA 3VXUB 1AC6A 1A7RH 1QR1B 5EU6E 1XF5A 3BAEH 4HKZB 3EDKA 1RZ8B 3GKWH 4JANB 3U36A 5J1SC 1JHLH 1EERB 1RUPL 5T33L 3RA7H 3Q3GB 1TZHB 1QOKA 4WUUB 1YUHB 2DJSA 3QDJE 4E0RB 4P9HC 5HD8D 4QOKB 1OD7A 1MFCH 3DECA 1H15A 2ZUTA 3WS6C 1A5FL 2UV3A 1T5XA 5IB1A 2F74B 3Q5YA 1WC7B 5SX5H 1EO7A 4FQXA 2IANB 5LQBL 1YQVH 1WVZA 4JG1L 1PVHA 4TRPL 3PWUA 2CSPA 5L7XH 4PJDA 4QRPA 4Z7QF 1IEBB 3QFDB 1FZMA 1HNFA 3BSZL 2W9EL 1OCWL 1KCVH 1IQWH 4JPWH 4F37F 2OP4H 3QBTB 4QRTA 1RIHH 1JTPA 1OGTB 2CXGA 3U82B 3WD5H 5JMRA 4U1KB 4LDEB 1DVFA 4N9GB 4KPHL 4WW1B 2QTEA 5E1AB 1BAFH 4HWNA 2AEPL 4JZJA 3THML 3HE7A 1KXTB 3VI4E 5C09A 2OJEB 3UROR 5FK9B 2DM2A 3VXRD 5H35A 3IVKA 2ZG3A 3O6MH 4PGEB 1LEKB 1R5WB 1E28A 4L3EA 5ESVA 4ONOA 4YIQA 1MSPA 4R0LB 1KBGL 4MCYA 3PIQA 4JY5H 5LWYL 2JK5B 5BJTB 3D3VB 4MNQA 1TQBB 3AROA 3B43A 4LARL 1EIBA 2CDEA 3MV9B 4LOUC 5DRWB 1KCRH 5FO7A 3TN0A 3W11C 3QXWA 5H35B 3IVKB 5HGDA 2F5BH 3QR2A 1N6UA 3P0VL 4GRLD 4JPWL 4LNRB 1N5YL 3AREA 4KWUA 4ERSH 1F3JB 2Q3ZA 4PLKC 5ESQB 2B2XH 1EGJH 4PP2A 1BBJA 3ARPA 2YD2A 4YDKH 1OAZL 2ZCLL 2CRIA 3D18B 1MCPL 3QG7L 4UILH 5CGYD 3GIZH 5I1JL 5I76A 5L6YH 5IJVA 5EBMA 3MV8A 3VFNA 2HT4D 3QPQC 4CL7A 3TH4T 3UPRA 4XC1L 1QO3B 2NY5C 5CEXA 3A67H 5GISL 4BFIA 3CSYB 4KUZH 3VCLA 5D7LD 1MCSA 3D85B 1QRKA 1S7RB 3GSQA 3BZFA 3IDXL 4X6FA 2BY0A 3C6LC 1MH5A 5EU5A 1CIDA 4FQ2L 2VL5B 2V2WA 4Y1AA 4MWFA 1KELL 1CZ8H 1GZPB 4NQDE 5TH2B 1H0DB 3VRIA 2PTVA 1DSFL 4WI3A 3IYLW 5FM5M 1YNTB 4JFZH 4PJEE 5HI3D 4KK6D 4N0FA 2DI7A 3RVWD 3ARTA 1Z0NA 4NQVA 4Y5XB 4QXGH 5T3XE 2DF3A 3E1F1 2PUQT 4Z7WE 4RQQA 1D5XB 1HSBB 4OZFB 3SHSA 4TNVF 4GKZB 4D0BA 3TZVB 3CX5K 1MFBL 4Y4KB 2Z92B 3VXRE 5SWZE 1I8IB 5KVDL 4HS8H 1FFQA 1F3RB 5DHVB 4OZHA 1ZGLM 4NQVB 5JHDA 4WY7H 1UVQB 4FQQB 3UPAA 1PZ5A 3X3FH 4DGVH 1A6WL 3RAJH 5DMIL 3RNKA 3E8UL 3MRPB 4KTEH 1DQLH 1E4JA 4FRWA 3Q1SH 1G1CA 4C56A 2EECA 4PY8J 4F9PA 1MFEH 4AT6B 1AO7E 3IS1X 2OM5A 3QJHB 1MI5A 4JJHA 3JV6B 5B4MD 2HFGL 3EDDA 4KKCD 2DWEA 4LSUL 3SGDH 5T3XL 1MY7A 3BWUC 4K9EC 5F7WC 1L0QA 5GGTA 5HHOB 3HPJB 5FUZH 1FGVH 4ODWA 1V7MH 5D1QB 1K3IA 4QRPD 2CLZB 4O4YL 2AXFA 3TT1L 1ZS8A 4PJFA 5L2JA 4JKLA 5IK3A 4XMPH 1JGVL 5I8KH 2HT3D 3LH2L 4JFEB 4U1MB 3WJJC 2MKLC 1BZ7B 1INQB 1QACA 4XZUA 2VZ3A 4DK6A 1RK1B 4Z7NF 4CKVX 5EFIA 4XB7A 3I50L 4BQ6A 3CZJA 3QDAA 4G6ML 3AAZB 2MPAH 1YECL 3N1QC 5IBLC 5HHMD 1B0RB 5I8KL 5FO9B 1WAAF 4TNWK 2OS7A 3NAAL 2YD4A 1QSEE 4JDVA 2DBLH 1EFXB 3WO4B 5AAWA 2DYPA 1RJCA 4GH7B 1T22A 4DEPB 3LV3B 4IOSD 2OSLB 4MD0B 5L8LB 2CDFA 4PJ7E 4DKDC 1IEHA 4BZ1H 3X14A 2ICCA 2OL3A 2HLAB 1N2RB 3N9GL 3PHOA 1E4WH 5GS0D 1HI6A 3IFPB 3ZSTA 4Z78A 4XNZB 4NO3B 4OF3A 3ZYIA 5EO0B 1ZVHA 4S2SA 4XGZA 1NMCC 2IGFL 3V7AE 3G5ZB 5B38B 1WBXA 4N9OB 1TJIL 3ZDYE 3KXFE 2IBBA 3J7HA 5SWQB 4YGAB 3BQUC 3HG1D 5JO5B 1CBVH 1CDCA 1H3TA 3MFGB 1DLHB 2A83A 3F7PC 3QNZA 1AD9A 1DLFL 4Y5VC 2AJVH 5D6CB 3O11B 2NTFB 2FGZA 5B3NA 5CS7A 3V5KA 3KYAA 4JGJA 4K23H 5HHMB 2VZSA 5IF0B 2EYRA 1FV1A 1KPRA 1ZANH 1S7QB 1NSNH 1HSBA 1CIUA 2GJJA 1T5XB 4M1GL 4AIOA 5IB1B 4G8IA 4KY1H 4JHWH 2ICWJ 1DBAH 4NZJA 3OF6D 1QSFE 2QR0B 2IANA 4S1SL 4EN3B 1Q72L 4R4FH 5EU3B 1W72B 1UJ3A 1OAZH 1EO5A 1FG2A 1E4KA 3DX7B 1JGDB 3PJSB 2OR9H 5GRUH 4XWGH 5D71H 5D8JH 2EYRB 4L4VE 4M1GH 3UJTH 5HYFA 1A9BB 4PJAF 4CN4A 4RAUB 2DWDA 4MB4A 3VXPB 3B5GA 2ZCHL 1WIOA 1TLKA 4EDXA 3HG1A 5DTFB 1X6LA 4M7ZC 1U93A 4F2MA 5HGHB 4PLOB 1M7DB 3AXLB 3MV9D 2J2ZA 3LPFA 2VR5A 3GBNH 2GSIB 1XGRA 3ZTNH 1IGMH 1UQSA 3HE6A 3OGCA 3SDCB 3GSXA 1EAPB 4N5UA 4Z0BL 3SJVA 5ACLA 3K1DA 1X5JA 2PXYD 4UDUA 4L5FH 3VFSB 4UB0H 5JHDD 4KK9C 4UQ2B 1JHTB 12E8H 2EDTA 3NIFF 2B1AL 4BSJA 3BH9B 3HNVL 4MLIA 4P3CH 5JW3L 4KZDH 2XN9E 4QHMA 1ZXQA 2AKRB 4HXBH 1B3JA 3QJFB 2EDBA 1WIUA 4Y19D 4MA3B 3TYFA 3MJ6A 3TH3T 4XMPL 2NY1D 2F54B 2NW2A 4LSUH 1FZOA 4OD2A 1HKFA 2ZJSH 3H9SE 4JPVL 2Y06L 3MV7D 4XVUD 5D1XC 3QFJA 5L9DL 4LLMB 4NZUH 3BPLC 1U8PA 5E95B 2AKRA 3OAYH 4NQTA 4KTEL 1YEHH 5FKPB 2Z4QB 1B0WA 4JCLA 1V8HA 5CLWA 3O81A 4GRMA 1NFDA 4LKCA 1S8DB 1IARB 3WV0A 4X6BB 1OD9A 2HRPL 1RZKL 1XF4B 4TULL 5DMKB 3W0WA 3SGDI 3C5ZB 2XRAL 1QFUH 4RFOH 2QADD 1JGUH 2LU7A 3GZKA 2XWBB 1Q9KA 5JQ6L 3S35L 4PUBH 3CDGA 3FCTB 1EHAA 3MLVH 4U1GB 5MHSD 3H8NA 1BBDL 1MRCH 2VN4A 4YHKH 4ZNCD 4F7PA 3UXFA 1WEJH 1CLCA 2P24A 4I9WD 3FTGB 4S1RH 2GJ6A 4L3EB 1S7SB 3LEVL 4EIZC 2ESVA 2AEIT 1V3MA 1NQBA 15C8L 1Q94B 3U0PB 1I7TA 3MODH 2DMBA 2OL3L 3TPKA 3L5JA 3OKNA 1W72A 2MQ0A 1HHHA 3FFCA 4M1DH 5EIQA 1JNHB 2H32A 4PJ7B 1I3RB 1V7NH 3BKCH 3SE3A 1A7NL 4P48A 1GCFA 5AYUH 4KJWD 4YHYC 3MBXH 2CRMA 4JHBA 1RK0A 2OQJA 1YEKL 3DHJA 3I85A 4P9HL 4FQCL 3RVXD 3CPLB 4OIIL 2ZSWB 2P5EE 4LOUD 4ELKB 5K9OA 5EWIL 3B2VL 3FN3A 1HHKA 1KJ2A 3SDDA 4GLRI 4JFED 2X4NB 3MNZA 4WTXA 4M7ZB 4PPTA 2FHCA 4UU9A 4HFUH 1NCDH 1YEFH 5HJ3B 3IDUA 1Q0YH 4XPTL 4BFGA 4OI8A 2MQCA 3GDBA 2C4XA 2DLTA 2COQA 1LGVA 5B38G 2DTMH 2BSSB 4X8JB 3LOWA 3VFRA 2GUOB 4L9LB 4GG6A 4KROD 5EZOH 1KIRB 3QRFM 1JPTH 1DQQB 4HAGA 3OR7B 2YZ8A 4EI5D 4QXUL 4MVBD 2BERA 4G9FA 4BSVB 2PTUA 2V5YA 1M7XA 3IDJA 5CJQH 2AJYH 1KCVL 3MRQA 4V1DE 4OF5A 3AMKA 2DMCA 1YEJH 4OUUB 2UY7A 4I2XA 1TTUA 3L3OB 4ZQKB 4R0LC 2CLRB 3QIWA 4P46C 4S1QL 4KV5F 2WBJD 1FP5A 1NLDH 3TYGH 2MFNA 3OKMB 4JDVB 3LRHA 4MZ3A 4J6RL 4XCFL 2V7HB 1UCBL 4G6FD 4KRNA 5DS8B 3TCXA 5KN5A 3HE6D 3L3DA 4UUJB 1SJVA 4ZUVB 3GBML 2B20A 1R3IL 3OQ3B 1B4JL 2VUYA 1OHQA 1F97A 3ZTNL 3VA2C 4Y4KA 2PN5A 1D9KC 2V9QA 1T83C 1KFAH 3U48A 4JY5L 2OR7A 2X4PA 4ZNEE 3VXRA 5J3HC 1ACYH 2YA2A 4MNGA 1NBZA 3NCJH 4KQ4L 4Q6IB 4UTBL 5EBWB 1DR9A 3GJFH 2QSCH 4X4YA 4MAYD 5C6WH 1CD0A 1RJYA 2FSEB 4U4BA 4JKKA 1YEJL 5HHNB 4KK9D 4LRNL 4C59B 2IAND 3OKLA 6FABL 3ARGB 4OTXH 2NTFA 4R7NB 1MI5E 3FRPA 2OK0L 1XMWA 2A6DA 3R8QA 1U0QA 3GSRA 1ZHKB 1MFAL 3WKML 4P3DA 3GHEH 3DGGB 3RKDD 3C8KA 1PZ5B 4G8GE 4LPXA 4PD4K 3D69A 3HNSH 2ZUUA 4OAWB 4WTZG 1MVFA 1RJYB 1MFCL 3G08A 4JFDE 1DUZB 1KLUB 3QJHA 3L6FA 4XB8A 1S3KH 2NR6D 3KLHD 3VFWB 4OZHF 5LCVL 5GS2H 4N5ED 4L1DA 2YUWA 1Q9OA 3RVWC 5KVFL 5D1QA 3T0WA 5GS0L 3P0YH 1FZKB 4XRCA 3WBDA 2DYPB 2E27L 2APXA 3TNMA 3VI3F 4Z7OE 3V2AR 1QBLH 4KVNL 5L2KD 1JGEA 4MDJB 1OT1A 3CLEL 5TE6L 1T1YB 1DUYB 4F58L 5HGHA 1FNFA 2NY3D 2YMXL 4GRWH 4PRIB 2AJXL 5ELIA 1JWSA 4FQJL 2Y72A 4QLRA 2F58L 4S11A 2YKLL 4M62L 5GSRA 4XRCB 5MP6H 1JCKA 3V5HA 3V6FA 1K4DB 4ZS7H 4CVZA 3IFOA 5EUOB 4HF5L 4HIXL 1Z9OA 3L7EA 3LKRA 3DMMA 3NPZB 3HUJB 3NTCL 1S78C 1H8OA 1WWWX 4XCCH 4N1EA 3HB3D 2WQ8A 1P7HL 3RZCB 3MRKA 5BQ7B 1U8JA 2Y1VA 2BSTA 5F88B 1P7QD 3O6FC 5TF0A 4RRPA 1NKOA 3UEZA 5FA3A 3VD4A 3SQOL 1KEMH 4JM4H 1LO2L 5A2FA 4L3AA 1OB1A 1VFBA 3X12A 5F6HI 1N26A 2AJZB 2BVOA 4I0CC 2VN7A 3MJ8A 4Y4HC 1PG7H 2IQ9H 2RHEA 1HH6A 3MGTA 4WV1C 4L8CB 1B88A 3SE8H 2DQDL 3CH8A 2VSDA 3KPNA 5MHSE 1YECH 4IRJB 3TO4D 3LKPA 2C3GA 3UBXA 3HZKA 1G7IA 3NFNA 1C08B 3L5WA 4IOIA 4R96B 3JV5A 1IC5L 4F3FA 1UYWL 1GGUA 4LHUB 4D9RD 3FZUD 3BE1L 4UQ3A 2OMNA 2NMSA 4X80L 3T0ED 4KKBC 1K8IB 2X44D 3RWHA 3MNVB 2GSIA 5D7JC 3GSRB 4J6RH 4XCFH 2HG5B 2NTSP 4TQEL 3FTGA 1KN2L 4JO4H 1RZIA 4QRUA 1J1PL 4LNRA 3SKNB 2W59A 3QI9A 4UNVA 2JB5L 2XY1A 3MOQA 1M6OB 4ETYA 4F8QA 4NQDA 5C0IA 4PR5A 2Q86A 3FO0H 3LD8C 4JO1L 4JJ5B 3OKDB 3GIVA 3TIEB 4FQIL 3SQBA 4KJYA 2B7DT 5DUMH 3S37H 4QTIH 4CDHA 1DCLA 2AJUH 2P8MB 2XN9D 5CHNB 4X6DE 5E6ZA 5EBMB 1OWRM 5T3XD 1EEQA 5LBSL 2GCYB 4XNYH 1BPVA 2OQJB 2AEQH 5E94A 4HIHA 1FFOB 5E8OA 3G04A 1U8PB 3R0MA 4K23L 3ULVD 1MLBA 1F6LL 4L4TA 4N5EC 4O2CB 1MHEA 1N8ZB 3T65B 2BNUA 1U36A 2ZKHH 3C5JB 1EXUA 4PJ5D 4G80A 4WJ5B 4M7LT 4JHWL 1FZOB 1FNLA 2HTKD 3ELAT 3MO1A 1NGYB 4ZAKD 3ULSB 2IPKB 4PGDB 5IVZA 1CDBA 1CFBA 1UH4A 3NCYP 1U8IA 5M94B 2OLDA 2UVFA 1TTFA 3H0TB 3T3MF 5J3HD 2R2BB 1X5LA 2OR9L 4NQXB 1EEUA 3MRQB 2VQ1B 4WO4C 2YPKB 5I1AB 4F7PB 4E41D 4YHPA 3CFCL 5FV1L 3KYKL 1S3KL 4JFFD 4O2FA 5JOFA 1EEZB 1FO0H 5FGRA 3DPBA 3KLAB 4M7JL 3BRGC 1YY9C 1PG7W 4NM4L 4PRAA 4ISVA 5E7FA 2YSSB 2I07A 2YD6A 3TT3H 3GHEL 2ED9A 2YN5A 4LGPB 5T1LA 4FN0A 4M03A 3BEVB 1DVFD 3S5LA 5CD5C 4WEBH 4HSQA 2HJLA 1A3LH 3LS5L 2NR6C 3VXMB 1T1WA 4NQSA 4Z5RB 5JXAL 5CGYC 3V4PH 5DURD 1G7LA 3FRUB 4OLUH 4ACPA 2MPAL 4ZSOE 2G9HB 4U6VL 4DTGH 4H1LH 4WHYG 5DEGB 3X13A 3QUYA 4FQXD 4XC3L 5EFIB 3DLQR 4R7NA 3T08A 1F45A 1I3RA 5J7CC 3O3DA 1LK3H 3D39E 4RRPG 3LEXB 3RGVA 4AH2A 1YEDB 4R4NC 5DMGC 5EULV 3FJTA 1VFOA 1IGCL 1TZIA 5DJCA 1UYWH 4F7EB 2X2YA 1A6WH 1P53A 3RAJL 3FRUA 5KSAC 1JFQH 2I60L 4K7PH 5EZLB 4QRRB 2VDOH 4P5KB 4EEEA 2VH5L 4ZO6A 2AJ3B 2X40A 2PCPB 2XACC 4JKMA 4BH7B 4KMQA 5I0ZA 2CLVB 5EZJB 3U7AA 2HH0H 3VFPA 3OJ2C 4XI5D 2OR8A 2JLLA 1RZFH 5IB3A 1J1OH 4FZ8H 3SDCD 4YXLH 5F6IC 1A7OL 4OBSA 4P9HH 5JPMA 1YQVL 7FABL 4AQ1B 1CT8B 2C1OA 5BV7B 1YPZB 3KPRE 3BKCL 4KUCD 3QZWB 1J8HE 1T5WA 5IMKB 4JQIH 5EU6D 5DD5H 4S0TD 4G80B 4NCDA 4WJ5A 1I8KB 4H5SA 1ZHLA 2FCBA 4O00A 3TCLA 5GRJL 2FEEL 5IEKA 3VXNA 4F33A 2NCMA 4Z77A 4YBLC 5C0FB 4P23B 1I8MB 3UC0L 4NHCH 2CPCA 1OAXH 2FX8L 5DWUL 1SY6A 4HUNB 2NW3A 5EUKB 5F1IA 4DFHA 1CXIA 3STZB 5CEYA 1A7PL 4N0FB 3U83A 5LAXA