4EBQH

Fab structure of anti-vaccinia virus d8l antigen mouse igg2a la5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
218
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFNFYWMHWVKQRPGQGLEWIGMIDPSESESRLNQKFKDKATLTVDRSSSTAHMQLSSPTSEDSAVYYCTRSNYRYDYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, hea
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
total genus 44
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH02
1CICA 5BVPH 3REWB 2XZCL 3OV6A 4Z7WE 3VXPB 2C4FU 5DI8B 4LLAA 1U3ZA 1JHKL 5LBSH 4FMFA 3FMGH 3G5ZB 1WUNT 4F57L 4XMKL 4JRYE 3FQNA 4KZDH 1DLFL 1SY6L 3HZVB 4XGZB 1BD2B 2Y5EA 1YY8A 3O9WC 4NBYB 1FNAA 3H9SA 4ODVH 4PP2A 2R39A 4R9HA 2ATPB 1YEIH 1MRFH 2HTKD 2VDML 5ERWA 5I1KH 4Q9BA 1CD1B 1PZ5A 2NY1D 3IT8D 2X4RA 4QTHB 1S9WA 1VADB 1CXFA 3V0AC 4HUVA 3IDGB 2QR0B 2C1OB 3UTSB 1FZOA 5I1HL 4G9FD 3L9RA 4Y19B 3GSRB 4R2GB 4Q7DA 4NQCB 2Z91B 3DMMC 4MD5A 2DLGA 5FO9B 3OX8A 4AH2B 4YC2B 2HAZA 3A6OA 4LPTA 3ULVC 5FYKH 5FGCE 4BYHA 15C8L 4MDIA 1I85C 3ZDYE 4K9EC 5E6IB 4I4WB 5GGQL 25C8H 1UYWL 1TCMA 4OCRL 1QRKA 4P59H 4OZFG 3HC3L 4OZGF 5I30H 3WIFA 1I3RA 1DN0B 4MQ7B 4NFCA 3S36H 1IC7H 5E2UL 4V2CB 2G75B 2K7QA 3L95B 2EE6A 2VO5A 2VDNL 4HHAA 2VYRE 4ZOEA 3IS1X 5E8EB 3VFWA 1TETL 3QG7H 4EI5D 3ULSB 1U3JA 4X4YA 3FRPA 3QDHA 1JNJA 2SEBB 1AR1D 1TZIB 2LE9A 3T1FB 3BPOB 1ZOXA 2WUCL 1E6OH 4C55A 2XXCB 2KL6A 4FQJL 2BRQA 3KPOA 1BHGA 3IDNB 3GI9H 4K3JH 3FQXB 1QHOA 5J12B 4HXAH 1T1WB 1RUKH 1NLDL 2BVYA 1I8MB 3BEVB 2W07A 3QIWD 1RZIB 3BXNB 4AM0A 5HDBE 2ZOLA 1A9BA 5B38B 3VFVA 3PABB 4CN4A 3KXFD 3LKNA 5TJWK 5JQHC 4X9GA 3CH1B 5CIPH 4Z18A 2MQ0A 3B5TA 1FRGL 1GPOH 3QH3B 2AKRA 5HGAB 2IBGA 4IJ3B 4HAFA 2GQHA 4CGTA 5L2JB 4LSVL 4O51A 3NGBB 2GCYA 2NXZD 1B2WL 5EBMA 2ZCHL 4JPIA 4X9BA 3LN5B 5EWIH 3CSPA 4EUPH 3Q5TA 2W0LA 3Q6FA 4QCIB 4DQOL 4AENB 3E8UH 4PR5B 3CCHA 2ESVB 4MSWA 1IAKA 5FKPA 3E6HB 3MV8D 2NXYD 5DD6B 3V6ZA 4BH7B 5FM5O 2BFVL 3IRPX 5T1KD 3STZA 3B2VL 3BKYH 1RJLA 3X14A 4CMHB 5M7QA 5D93C 3QBTB 4PRHE 4M1CC 5CEXA 5CKAA 2O5YL 2LAAA 1SY6A 1JN6A 1V3MA 4O2CA 3WIHH 3VXUE 5KG9B 3R06B 3CPLB 2JK5B 3VXRA 3DNKA 3TNMA 2DQFB 1NFDF 5E99L 4ZFFA 3CFBA 3ECBA 3TIEB 5CBEB 4EOWL 4N0CD 5IMOB 1HHJB 2UZIH 4NQCE 3VFTB 1TZGH 1OF2A 5DHVH 1VEPA 2OR7A 2F8OA 5JLZB 4MLIA 3QT2A 3TYFA 1T0NA 3OGOE 4MJ6A 3MACH 1AE6H 2A6KA 5DT1H 5E8DL 1A7OH 3ZTNL 5KSAC 1CDHA 5EU7C 3REVA 1T1ZA 3MXVH 4G6MH 3HI6L 1RZJH 5HHOA 3AREC 5IM7A 3LQAH 3C08H 5DWUL 3O2DH 1JF5A 4LIQH 4XX1E 2BSRA 2V2TB 3QEGH 1L7TH 4XBGB 4BQ6A 4R0LC 1OSZA 2CLZA 4EDWL 4N9GB 4RFNB 1HSBA 2E7HA 2FJGB 4Y5YB 2ENSA 2H1PL 1SVZA 3RL1B 3T0ED 4AEHL 4QHLB 1P1ZB 3WFHB 3S35H 5DC4B 1G6VK 1CN4A 4GS7C 3CFDB 3PNWA 8FABA 4XBEH 1ZLWK 5DEGB 1IAIH 3D2UD 4IRJA 3H7LA 2VDKH 3K2MC 4OV5A 2H26B 1WLHA 4U1KB 5ECJE 3P9MA 1IM3A 3VW3L 4HJGB 1YNLL 4JFEB 4DWHA 4EUPG 3BWUC 5LXGL 3DRQB 1P7KB 4JM2C 4NZUH 2ZUWA 5IEHA 5DJYA 3BOVA 4PRIE 1IARB 3UC0L 4PREB 2BC4B 4ZAKC 1P5VA 4OD3H 3PWVA 1BBJA 1DP0A 4U6XB 3TFKD 1MOEA 2CUHA 2YPVL 2HFFA 4HULB 1MHHA 1E4KA 3O6KH 3M17A 4XPAH 4JFFD 2DYPA 4X5XA 4X7DC 5LGHL 3SOBH 5IHZB 5H35B 1NAKL 1P7QB 3OGCB 4U6VL 1LD9A 1DQTA 5AZEL 2I60H 1F3DJ 1GC1L 5CGYC 3WEXA 1I1AA 4K94C 1AHWB 4XP5H 3BO8B 1IQWH 3MCLH 3ROOB 2KQMA 2ZUTA 4BQ9A 2JJUA 2C3WA 5KBNC 1W8NA 4LBEA 3TN0D 2VE6B 5A3IC 5DZNA 4Y8AA 1ZLVH 2XXMB 1E27A 2XY1A 3MUGA 4YAQA 5DJZA 3S3SA 4HUXB 5TGBA 3QO0B 4FQ2L 3ILQD 3ARBA 4EIZC 4WW2F 5JZ7C 4FXGA 4XP6H 3PF2A 3CXHK 4IRSB 2F74A 1J9CT 3K3QA 1LEKB 4S1DD 5F1OB 3VWJD 1KCVL 2EKJA 1YECL 5IR1B 5DJ0A 1T21A 3KPNB 1T0MA 5D7JB 5EFIB 1HHKB 3UTZB 3S7GA 3B4NA 3CDYA 2AXGB 3RX8A 5TDNA 3BHBB 3GM0A 4NJ9L 3RI5K 5ANME 1UM5H 4CKVX 3QXWA 3ZDZF 1GZPA 1OOAA 1CF8H 1SBSH 2DM7A 1UWGH 3EYOB 1QQDB 4RAUA 4UIMA 3QWRA 3TYGH 3L5WB 4ZNEE 4ODTL 4OAWA 1U91A 2VLRE 4KUZH 5BZWB 1OGAB 4GRWH 4PD4J 3L3GB 1CU4H 2UY6A 4X6DB 3O6MH 2QKIB 1OL0A 1WEJL 4QHNA 4FZEL 5EU5B 3RTQD 5E00A 2EDKA 2YD6A 4UTBH 4Z95L 3NZ8A 4YDIL 1G7IA 4DN4L 4P9ML 1OW0C 4TOYH 1DBJH 4MNGA 2VXVH 4JRWA 4NNXA 2GITA 5EH1A 4ALAL 1WBZA 2IH1B 3FQUB 1BMGA 3LS5H 3MLRH 4G6JH 2D4FA 3BVNB 2C4FT 4ZSOB 1O7VA 4HWZA 3ZDXF 1BZ9B 4LNVA 5E9DB 5GS2H 2YC1B 5GHWH 1NCDH 1PD6A 3UJIL 3KLSA 4MCZA 5BVPL 3PL6D 4GBXC 2X05A 4HUKB 2A9NH 1YY9D 4YEFA 5LBSL 4LPXA 5CCKL 3FMGL 4RGND 3KJ4B 3EGSB 2JB6B 4OLVH 3J7HA 1ZSDB 2EXYC 3TM6A 4GW4A 4MQTB 5JIIA 2RCSL 4N8VA 4JRXB 4PGCA 1PW3A 4X6CE 3GNMH 4M7ZC 1AXIB 4ODVL 2Z31B 4WWID 4HZLB 1YEIL 1MRFL 3QJFB 5I1KL 1UH4A 5JORA 2D03L 2UYLA 1G9EA 3P4LA 3GIVB 1DQMH 4MA1C 4BH8A 1XR9B 1IZKA 2ITDB 3BRDA 1QA9A 5GISH 1ZT1A 1MFEL 2YXMA 5L7XL 3X3GH 2AEWA 3RPIB 5L0QC 1NFKA 2YUWA 4DOHB 5JOPD 4PJGB 5A2IH 5C09E 1GSMA 1MCCA 4QRSA 1MCPH 5CHNB 2A2QT 3QUZB 1Q1JL 2PCPB 3IGAA 3TPUA 4LCIL 1CWVA 1P9MC 4PJCB 4NWUH 5F7WC 4P59L 3RZCD 2Y06H 1YZZA 4K8RD 1AQDA 4ZFZA 4Y5XA 4PRPB 1QR1B 4QRPB 3FO2B 1IC7L 2VL4A 4ZUVA 2FX8H 3QPXH 1QEWA 1FFPB 1M7XA 3CAFA 1KTDB 3D3VA 4PLNC 1A6TA 1HWGB 2X4QA 3UEZA 3MUHL 3QG7L 3RPKA 5ICZB 4GRLD 4GG6A 2RFXA 4PJFB 1O0VA 3FTGA 1E6OL 1CGVA 1CFBA 4HIJA 4GKNB 4P9HC 4ZTPH 2OTWA 2Q6WB 3HRZB 4NQDA 1JE6A 3MYJB 3A6CH 3GI9L 4K3JL 5CUSH 5HPOA 4LK4A 1RUAH 3W5NA 3IFLH 4BSWB 1EFQA 4M1DH 4U33A 1G9NC 2WP3O 2F53D 4HXAL 1RUKL 4LPWA 4KKAD 1CICB 3P0GB 3VGEA 4C56A 5B8CB 4CU7A 5BVJA 4FG6C 5ESAA 2NY6C 4K71C 3PP3K 1D9KC 5MEQA 1TENA 3DUUB 2Q1EA 3Q5YA 3GKWH 3R1GL 4OZFA 3S37L 1FNSH 3K46A 3OXRA 4NFDA 3FQNB 3B3IB 2NLJA 1HQRA 4Y4FC 4R90L 5D1XD 3LKQA 5IFHL 3K74B 1UACH 2H41A 2FWOB 4NM4H 5ERWB 3R8QA 3B9VA 5D1QA 2E7LC 5CBAB 2OI9B 1PZ5B 3GSWA 1IJ9A 5EWIL 4WW1A 1NC2A 1FQ9C 1G7QA 1S9WB 3DX6A 3IKKA 1S8DA 4JG1H 3WO4C 4HUVB 5D6DC 1AO7A 1RMFH 4NO2A 1LNUA 2A9MH 1I9RL 2APWA 5C0CD 4FS0A 1FZOB 3IETA 3TBYB 3RJDA 1C7TA 2HKFL 2B2XH 3BKYL 3L9RB 2EECA 5DR5H 1MJ7H 3EO1A 3FB6A 4B7IA 2EEBA 4MD5B 3BN3B 3OX8B 3W82A 1A2YA 5DVLA 3WIHL 3VA6A 3DV6A 1M05A 5KOMC 5CJBA 1KN4H 4Q6YA 2Q20A 1YMHA 5T1KB 4NN7C 3U46B 3L3JA 3MJ9H 5F3BA 1A7BA 2UZIL 3JV0A 3ES6A 2VABB 1A7PH 1TZGL 3T77A 1KN2H 2P4AB 1KT2A 4Z7NF 2JCCA 2VXSH 2IPKB 2MCPH 1F00I 5JHDE 3MACL 1EJOL 1AE6L 4HMDA 1JGUH 3U7WL 3C5ZA 3VFWB 2P5WD 7CGTA 4PJIE 4YO0A 4MLSA 4OKVA 1BF8A 5BV7H 4PUBL 1RZJL 4K7FA 3LQAL 4POZD 5EU4A 5FO8B 2E7BA 2KBGA 3O4OC 3EYUH 3BH9A 1OCWH 1BAFH 5C0BD 3UXFA 3ARSA 5CAYB 4ZXBC 5L2KA 2R0LL 3MNWB 3KWWA 1EUTA 2ARJQ 2HMIC 1NL0L 3S35L 5I71C 2ZOLB 1A9BB 1FCGA 4XBEL 3LKNB 4P46D 4HKXA 1UB5A 2AAVA 1IAIL 4PJDB 4ZO9A 2VDKL 3G08A 2VLKA 1K9TA 2AKRB 4KI5E 4BZ1H 1YC7A 3G6JB 4HKZA 3CUPB 4KK9D 1RJCA 3FN0H 2XG4A 3T0EB 4OLYH 2VOTA 1RAMA 2GCYB 2ED7A 5DVMA 4JPIB 4HAGA 4WEUD 1EUUA 4E42A 3H3BC 5KSVA 4OD3L 3Q6FB 4GKZB 5SX4H 4XVSH 3QDJA 1JPSH 2VAAA 1IAKB 5FKPB 2XA8H 3H9SE 4K3GA 3I75A 4XPAL 2CO7B 4GMSH 4ORGB 4PBVC 4RIRA 1JMXA 4ZDHA 1EERB 1N6QL 4E0RA 2B1HL 3B5HA 1RVFH 3OKKA 3X14B 5FHBH 1GXEA 3QIUD 3MRCA 3TO2B 1QKZH 3O9WA 1CFVL 1YPZA 2FYYA 4LRIC 5CIPA 1JN6B 4XP5L 4O2CB 3CDCA 3TA3D 1IQWL 3L1OL 3GBNL 5DJCA 3D6GA 1JUFB 3QUXD 3VXRB 4NJAH 3DYOA 3MRGA 1Z3GH 3QCTH 3CFBB 3ECBB 3DUHA 5LG1A 1KFAL 1JYWA 4PJ8C 3HZMA 4EUPA 1OF2B 1RZ7L 4KY1L 1KENH 3IDMA 1A64A 3S98A 3QQNA 1JMZA 5E5MA 4P23C 4JN1H 1T0NB 1TXKA 5T33L 1KLUA 2LU4A 2D3VA 1B6DA 3OB0H 4XP6L 2E6QA 4HPYH 4BM7A 2C7UB 4APQD 3ZSSA 1NMCC 4KVNH 1RZKC 4X8JA 5IM7B 5HHOB 2YZ8A 2XKSA 1CTNA 4U7KA 5HI4C 2ZJSH 4WI5A 3WFBL 5JPNA 2EYSA 1BVLA 1I85A 1YJDH 4GG8A 3WIHA 4PY8I 1OTTD 4WHTA 2CLZB 5B4MC 2AJ3A 1UM5L 1HSBB 2R56L 2IBZY 1ZGLP 9CGTA 1C16A 1CF8L 1UWGL 3VWJB 3TYGL 3ZYIA 1X5AA 5DHVA 4QO1A 3K80A 8FABB 3L3HB 1G9MH 2QTEA 3K8KA 4KUZL 4UOW1 4Q97A 2VMFA 4DVBA 4OV5B 2ICCA 1IM3B 4UTBL 4LCUB 2BNRD 2DBLH 5TFSH 4TOYL 2IADB 1DBJL 1IGCL 2DTSA 4Z7UA 1GAFH 2AVGA 1DBKH 4WUUA 3LV3A 5AUMA 3JV5A 4BSVA 1DANU 3MLRL 1KCLA 3LS5L 4G6JL 4LNRA 4XI5C 5IEHB 1BBJB 5KS9F 1KIUA 4WI4A 4XCFH 5IB4A 5C6TH 4LGRB 2HFFB 1MHHB 3RTQB 3M17B 5F7KC 4MVBD 4DAGH 3P30H 3U9UA 1FFOA 2DYPB 3H9ZA 4K7PY 1AGEA 2QBWA 1HIML 2LTQC 5EO0B 3WEXB 3GNML 1A1MA 4HMCA 4W6WB 4JGJA 3TH3T 1AP2A 3PL6B 4HS6B 1P84K 2VUYA 3AAZB 1FNGA 1H5BC 2J8UF 3V8OA 3DMMD 4LBEB 4FZ8L 3NA4A 3FCTA 5JW4M 32C2A 2NY5H 4RGNB 1OAXH 3OAYK 1DQML 3ULVD 5K9JL 1J1PH 4MNHA 3UBXI 1EMTH 1E27B 3MUGB 4YAQB 4W4NA 1IBGH 3ARBB 3W9DA 4F37K 2RB8A 5F3HB 1NANI 3CVIH 4FXGB 1MH5A 1FAIH 5CILH 2F74B 4L3EA 1MFBH 1MREH 5EIQA 2BVUA 4P5KA 5DJ0B 3ZO0A 1T21B 2FHBA 1T0MB 2FSEA 1QPPA 1K6QH 5TDNB 1NGZA 3MLTB 4NWUL 4LFHG 2BNQA 3O45A 3VFRA 2EZ0D 1FFQA 2XQYG 1JFQH 4L8SC 5F6IC 1GZPB 4KPHH 4YZFF 4RAUB 4UIMB 1MNUH 3I6KA 2FX8L 1HZHH 5HYJA 2XWTA 4LLVB 1ERNA 3FAXA 1U91B 2N1KA 3MJGX 1P4LA 1PDKA 5ESVA 1PX3A 5KSAA 3F12B 1C08A 2M1KA 2AJXH 4PJAE 4QHNB 1K3IA 4CU8A 3AY4A 3IFNL 4NNYA 2I25N 5KSBB 3F7YA 4WW2C 1QSFA 3RKDC 3NZ8B 1G7IB 2P44B 5GZOC 4CN1A 4GAGH 4MNGB 4P4KC 4NNXB 2WWMD 1YYML 4ZTPL 4U3CA 4PJXF 1RIHL 5CUSL 5GRXG 3IDUA 1RUAL 4M1DL 1S9XB 1OSPH 1WCBA 3ZKXC 3OJ2C 5E2WH 5F7LB 4GRLB 4LAQL 1HWHB 3VD5A 4OFDA 2W9LA 4CVZB 5HI5C 3GKWL 4UNTA 1FNSL 4OZIB 1WBXA 1QSEA 4HUNB 2PYEE 1NPUA 5C2BH 2VLRD 4U05A 2G60L 5GRVL 3ARTA 4N8VB 5BRZD 3MO1A 1ZLVK 4PGCB 2ZNWA 2W1NA 3MQIA 1UACL 2XZQL 3ZTJG 1MJJA 5JTWA 2XTJE 2YUXA 2KZWA 4M1CD 3BP7A 1XZ0A 1CS6A 2WAHA 4ZAKA 3MLSH 5DRWA 4N68A 4NYLB 4BH8B 4BFGA 2VAJA 2NY3B 1RMFL 2UWEA 1QA9B 1B0GB 4PY8J 3SO3C 1TZHA 4XC1H 1B9ZA 1N64H 4TVPE 1ZGLA 3QULA 5D1XB 3L5XH 4LQ1A 2ITCA 1DUYA 4IDJH 4MJ2A 3SGDI 1MJ7L 2WBJC 2LFGA 5CJ5A 1BIHA 4P2RE 1QLFA 4ZO8A 4X99A 3O0RL 4ZS6C 3IGAB 1IAOB 1QFWH 4KKLC 3D0VA 1KN4L 3MRHA 1A7QH 5MP6H 5EN2A 3ZL4H 3GHBL 5AYQA 3I6LE 3ARED 3PWNB 1AQDB 4ZFZB 3U83A 3G5VA 1EV2E 1KN2L 5CS7A 3ULUF 3WNPA 2VXSL 3AB0C 2MCPL 5HI3C 3HHRB 1FL5A 2C5DC 3S3PA 3MLPA 4TQEL 4OGYH 5TDPA 1A6TB 1JGUL 2X4QB 4I3RH 2ID5A 2IGFH 4M3KB 1T89C 3W9EA 4PV8A 2X1QA 4H25B 4F7EA 3VFGL 5BV7L 4GG6B 5C09D 4Z7VA 5HGDA 2LVCA 4CU6A 3MRQA 4LPYA 1G9NL 2OTWB 1S7UB 1A6PA 3V4UL 3T1WA 1WV7T 4BQCA 2I9LB 4Z8FL 3TPKA 2P5WB 3O11B 4JM2D 4M1GH 4C56B 5BVJB 3T3ME 1NGPH 2GJZA 5ESAB 2IQAA 5DRZA 2J2ZA 5MEQB 1I75A 3WKML 4KC3B 4OZFB 4FOMA 2BY2A 3LEYH 5C0BB 4D2NA 1BFTA 4XP4L 2NLJB 2VQ1A 1TQBC 1AC6A 3DX7A 1JYNA 3GMPA 1CDBA 3ARGD 4LCCC 1AIFB 5D1QB 5DD5L 1UENA 1NGYA 3HAEH 3O3UN 3L3IA 4TNVF 3E3QE 4WW1B 1NC2B 5E5UB 35C8H 4I2XE 4P46B 1DBBH 2ZZUT 1S8DB 5CMAA 4CJ1A 1JPSL 4KXZH 1AO7B 2C9AA 4GBXA 5I17B 1LNUB 1IKNA 3V6OA 4MHHI 1MAJA 5DHYA 4P2QD 3IETB 4OZHB 5I9QC 4GMSL 4GKSA 2MKLC 1UQSA 2IJ0C 3MREA 4ZYKB 5A3ID 5KW9L 1RVFL 3HE7D 4O02H 3MGTA 2CKBH 5SX5H 4YDLC 3FB6B 4JGUA 1UA6H 4HG4K 2Z8VC 4ZD3L 3HCVA 2Y5TA 3RHWK 2OBGA 2ILLA 4XHJD 3NCFB 5JR1H 1N59A 2XQBH 3VXNA 4JO2H 2P5ED 3V4PL 4G8GA 1YQ2A 4IS6A 5EORH 4XZUB 4YX2L 1Z3GL 1ZT4B 1TJIH 4X7TA 5F3BB 4JQXC 3BUTA 1V3LA 3ES6B 3QIUB 1UG9A 2ZSVA 5KVGH 4WHYG 1MQ8A 5DUMH 1KT2B 2H3NB 3GMQA 5EIVA 2JCCB 3EDEA 3SE8H 3DO7A 2XOTA 4JN1L 4KZEL 2X4TA 1M1SA 1VESA 2UUDK 5KANI 2MSPA 1AGDB 2Q3ZA 4TPRH 3FO0H 2EEAA 3GIZH 3IFPA 3QUXB 3C5ZB 4HPYL 4RMRA 1A4KB 4NRXA 5H2BA 1U9KA 3S88H 4YO0B 3HNSH 5TPWH 2D7QA 1CIDA 1SJEA 4UILL 4CADA 3QSKB 1XGPA 4UI2A 5EU4B 3DURA 1U3HC 4WEBH 3UO1H 1YJDL 1PGRB 4DKDC 4WVRA 3IU3A 2WANA 5K59F 1P9MA 3OKOA 3D3VE 4S2SB 5FIEA 2E8ZA 4FFZH 1EXUA 5FYLH 5BS0D 1CT8B 2YEZB 4L9LC 4APQB 1KV3A 3GSQA 1YUHB 5EIIA 4A2LA 4I0KA 43C9B 2VC2H 5EO1A 3I50H 4DUVA 1UXSB 4HKXB 1UB5B 4F33A 4NQDE 3GMOA 3B43A 5F97E 5JHDD 5H37H 2VLKB 5TDOA 1DANT 1T4KA 5D9SA 3HAEG 4HIXH 5TFSL 4KK6C 1PJ9A 5CP7B 1H3VA 3CX5K 4LSUH 3EO0A 3QAZC 1DBKL 1RUQH 2EXYD 1BFOA 2NMSA 2OXGA 4OLEA 4E42B 4S0TD 3X17A 4U1IA 5KSVB 3AS1A 3RGVC 2QQKL 2ORBH 2EH8H 1C12A 2VAAB 4UMGA 5B39G 1D9KA 3LSOA 4M9OA 2BNRB 4DAGL 2J4WL 4PB9H 3VJ6A 3KLHC 3OKKB 3UJJH 5CJXC 3OG4B 2AEQH 3O9WB 4ZODA 3PWLA 5BQ7A 3HS0A 4Y4FA 5CIPB 1FG2B 1EAJA 3WFZA 4JFPB 5DJCB 1G7JA 5IFJB 3VMPA 1HYRC 3N85H 1MCWW 3MRGB 5FYJL 2CLRB 1EIBA 1HNFA 1IKFH 3LPFA 5D6DA 1ORQA 1FV1A 1EMTL 5DA4A 2RGSA 2R69H 1J0JA 2F8VA 4NRYA 5E5MB 1UJTA 2OMBA 4K7PL 2DD8H 1KLUB 3QIBD 4PJ5E 3IS0X 5EU6A 1YN7B 1FAIL 1G7MA 4IEFB 3TESA 5CILL 5LAXB 3DMMB 3DVGA 1MFBL 2EDWA 3RA7L 4X8JB 5E70A 4I0PD 5JPNB 2EYSB 3MRRA 4KGLA 4GG8B 4UT7L 5DK3A 1H15A 1I1YB 1E4WH 3IVKB 3ETBF 4WHTB 1CZ8L 1HSAA 4PBXA 3SEPA 3MRMB 2AJ3B 3CFEA 4XCEA 2E6JA 1JFQL 4JLRA 4KPHL 4H8WC 1KG0A 1C16B 3CLEL 1MNUL 5FCUH 4UDTB 2NR6D 5H37G 2WSKA 4JE4B 3MRFA 3UZVB 4N1EA 1CLYH 2V2XA 3IB4A 5FYKE 5D2NE 3ARYA 3MV7A 2QJDA 3EOBA 2AJXL 4KHTH 4PY7B 1KCRH 2NY6D 5L2KE 3KLDA 1CDUA 4CN6A 1MQKL 1IAIM 1NGWA 1TNMA 3F65A 1FDLH 3FHQA 5C0JA 4XBPA 2GJ6E 1WWBX 1CD0A 3KLAA 3PGDB 5D5ME 3LV3B 5KSUB 5AUMB 4BSVB 5IF0A 1A6ZB 1HQ4A 1JZ5A 2FEEI 3DIFB 1AJ7H 3PHQB 3J8F7 1OSPL 3C6LA 3CZJA 1A22B 5ENWA 5E2WL 3SJVE 4FABL 3QEQA 4XPBL 4R3SA 4DZ8A 1U8LB 3FZUD 2V5YA 3RY4A 1AGEB 2I27N 3ESUF 1JWUA 1N8ZA 2QSQA 4ELMF 4LKXA 5HSFA 1BECA 3QDJE 2H9GA 8CGTA 4Z9KB 4TTGA 3KJ6H 4FQXC 3RVUC 3CD4A 1Z9SA 3LEVL 3OB0K 2AI0H 3MLSL 1ZAGA 4G43B 5E2VH 3PUCA 5E2JA 3SDDC 4MNHB 4L3CA 1YPZE 4UV4H 2Q7NA 4KMTL 3A6BH 1FH5H 5BRZB 1QZ1A 4XC1L 2JIXD 1T03L 4UZGA 4OD2B 5D93B 4FP8H 4IDJL 1CQKA 5AWNH 4KROC 3U30C 4LCWE 4LRIA 3VFOB 2PYFA 2FSEB 2FDBP 5GRJH 1QFWL 1BJ1H 2DWEA 1NGZB 1FGNH 4AT6A 5MP6L 1D6VH 1AXTH 3VFRB 2B1AH 4PJ8A 4KRNA 1BIIA 4XXDB 1HH6A 3P4OB 2DL9A 5IMKA 1J1OL 5HYJB 2XWTB 4GAJH 3WE6B 1P4BH 3VG0L 1P6AB 4B53A 2GTWA 4ZXBD 3MBEA 4I3RL 5ESVB 3LS4H 1MCIA 3H3KA 2IGFL 5KSAB 1SQ2N 1C08B 3CX2A 2GTZB 4NNYB 2ARJA 3AREB 2W59A 5CJOH 1LGVA 1LO2H 3IAPA 4HGMA 1MCWM 1BBDL 3WUWG 1OP3H 5DO2C 1EFXA 4FFVC 1R3LA 2VITA 1T04A 2B4CC 2HT4C 3SDAA 4NO0D 4M1GL 1NFDA 1NGPL 4XC3L 4UNVA 4OCWH 4GS7B 5IQ9A 3SCMD 4Z7UE 5CINH 3LRHA 4WUUE 1ZGLM 5DJ6A 1QSEB 2NW2A 3BH8A 4LIQE 3SDCC 2X6MA 3VRIB 2WIIA 5JUEL 1EHLH 2VSCA 1WAAF 4GRWB 5F96H 3V5KB 2H2PD 5DC9B 3SGEI 4FFYL 1WICA 3T0BA 4JM2B 1RHHA 1MJJB 5C92A 4OLZH 4JKPL 2QADC 4Y0GA 2X40A 3HUJA 4JFXB 4ZAKB 5GGRB 5DRWB 1K2DA 2IPUG 2UWEB 3G9AB 3MUY1 4WU5B 4LGSB 5LQBH 1TZHB 2VKXA 4YHKL 3QULB 1NSNL 4H26A 1H3WM 3MPCA 4KHXL 5C0NC 2ITCB 2W0FA 1R3KA 1A3RH 2DDQH 2CKBL 2P45B 4W68A 1UA6L 4P23D 1W2KT 2VNCA 4QRTB 2PYED 4QT5B 1N5YL 1KLGA 3MRKA 4U1NA 5JR1L 1ZTXH 4LSPL 4P48A 4P2QB 3D0VB 3QRFM 4LDLB 5EORL 1QO3B 3GSXA 2BXZA 5LGJA 1BPVA 4OM0L 4HUWB 1PY4A 2XTJD 4J12A 1TJIL 3BQUC 1FZKA 3MLVL 4L3EE 2C4XA 4NQUA 3RY5A 5CZVH 1IC4L 3SE8L 3MLWH 1FL5B 2CDEB 3QDGE 1QTYT 1GOFA 4J3SA 3NA9H 3D9AH 5IIEA 4Y4KC 3GIZL 1MWAH 1MFDH 2P5EB 5IBLC 3S88L 2BNQE 4QXUL 3W9EB 2BCKB 2YN5A 3RY6C 4F7EB 3QDMA 1EEYB 1OARL 5F93C 5GS0H 4MCYA 2EIZA 3UJTL 1JJUA 5HVFB 4P2RD 3BJLA 3PGFH 4AQ1B 2Y6SC 3RVTC 1KBGL 3TEUA 5FK9A 5SWZE 1VKXA 1RJYA 2DKMA 3CDGB 4FFZL 1IVLA 2APTA 3OF6A 4PJGF 2VWEE 1R3JA 2EC9U 3VGDA 1QSFE 5J56B 2IQAB 5DRZB 3B8YA 4ODUB 4U1JB 2WUBH 4PTTA 2VC2L 4NZRL 1YEJH 4WWKC 4Q6IC 4RAVB 1DQDH 4J3OC 1MJUL 4WW2A 2FLRT 4XVJH 5L8KB 5BS0B 3VGGA 5I18L 1C5BH 2VISA 4P4KA 3VGHA 3W39B 4PBWD 3MRNA 5FUZH 1NGYB 1HYSC 1RUQL 3SGKC 3MOQA 5HGBA 1K4DA 5GGTL 5F72S 2OQJB 1LVEA 4QNPE 5DJ2A 4XPTL 5CMAB 2ORBL 4PJ7F 2GW5A 3BE1H 4GBXB 5FO7B 2JJTC 3VFUA 2XG5A 1KEMH 2O26U 1WC7A 4FFWC 4FXKA 4YHPA 1CBVL 4UV7H 2EDOA 5C8JA 3C5SB 4GKSB 5JXAH 1UQSB 4ZNCD 3EZJB 4L1HA 3KYNA 5C0EA 3UJJL 3MGTB 5SWSA 1A9EA 5L9DH 3EDDA 4M7ZB 1X6LA 2Y5TB 4P57A 5EUOB 3OPZH 4M8VA 3ZT6A 1HKFA 4XNUH 3FT2B 3VXNB 1IL1B 4G8GB 3N85L 2AJZA 4IS6B 4NM8H 3QUML 3RX7A 5I76B 3WHXB 3QG6A 3HAEA 4RWYH 4X7TB 4MA1B 2NZ9C 3L6FB 2ZSVB 4LP5A 3GMQB 1I8KA 3LN9A 2X9XA 4JKKA 4RISL 3RDTA 5L0QB 1P7HL 2X4TB 3NCMA 2DD8L 4HF5L 4FXLA 4F7PB 1J5OH 2KZ1B 3QFDA 2WBJA 4NRXB 2WBKA 3V5DA 1A1OA 2AV1A 4TRPL 5B39A 4CADB 3OB8A 2CKBA 3K4DA 2Y23A 4X7EC 4WIQA 2Q8AH 3KPPB 4AIOA 1CFSB 2FECI 5E94A 4Z7OF 5DD3H 5JW5A 1NKOA 1RV6X 4PJHE 3JTSA 4HWEH 2A6DA 3OKOB 4OJFH 3HE6D 3L7FB 3D85A 2YPLD 4YHOH 3MOAH 5GZOD 3PWPA 1E28A 2AK1L 5D2LE 3B8SA 4N8CL 3WDJA 4Z7VE 5FCUL 4WTZG 3ULUH 1WWAX 3T0DA 1CLYL 1RHFA 4N0YL 3GMOB 1T89A 4D3CL 4U1HB 4KHTL 1A3QA 5TDOB 1KCRL 2X4NB 1T4KB 4MJIE 4KTEH 2OTUA 3WUZA 3K1KC 1AD9B 1N6UA 1FDLL 2HA1A 1KTLB 5BV7B 1IM9D 4FQIH 4LCYB 5BOZG 3EO0B 4NKDA 4Z7QF 3KYOB 1BFOB 1WCQA 1F4HA 3DO3A 3KYKL 1ACZA 2ATKA 4U1IB 3WD5L 4MJ5A 3HTLX 4OFIA 2R8SH 5T3ZH 1C12B 1B4JL 3QO1A 4ACPA 4BK5A 4K71B 1D9KB 3LSOB 3MCKB 2A73A 4CVXA 5HY9A 4XCYA 4JDZA 1KOAA 5JOFB 4HJ0D 3ALXA 4MWFA 3DVNA 3PWLB 4QOKD 3HS0B 4Y4FB 4YUEH 3QUYA 3V6OE 1G7JB 5JQ6H 2ZKHL 2Z8SA 4RMUA 2EDRA 5JXEC 5HHNA 2D31B 4AEIH 2IANE 4LEOA 3MJ7A 3JV6A 3WO4B 3MR9A 5E2VL 1J05B 2APXA 5A16B 3AMKA 1FV1B 5GGTA 2MPAH 4KKLD 4UV4L 4Z76A 4CMMA 1T1XA 4K2UH 5CLWA 4ESKA 1ES0A 4GXUN 4YHYC 3QJHB 4KKBC 2JF1A 5BW7C 3WNMA 4FP8L 4Y16A 5HI3D 2WQ8A 2G2RA 2YD3A 3F6LA 4NKMA 5DMJB 3TVMA 4ODHH 2Y7QB 1U41A 1YMMA 4JAMB 4BFBD 1H15B 2JIXB 2A38A 4O9HL 4NN7B 4K3DL 4YFDB 3F62A 4NWTL 3CFEB 3QUMA 4PGBA 5FM8A 1T7ZA 4XCEB 3W0WD 2XN9E 3LQMA 5E1AA 1KG0B 2MTPA 4KDTC 3TV3L 1UM4H 2VLJE 2JELH 4GAJL 1L0XA 1GJIA 1P4BL 3MRFB 2ZUUA 1DBAH 4MZ2A 3LS4L 3MV7B 5HHME 4PJ5D 1MCLA 1OD9A 3BWAA 1JRHI 1FL6A 5C08D 3DXAE 1J87A 3O4OB 3W2DL 1Y6KR 1U3HA 5CEZH 1JGVH 2VLMD 2EIBA 5HHVH 5IW1A 3KPTA 3KLAB 1F3DH 1NDGA 5IF0B 4F9LA 1DVFC 5JW3H 4ZXBB 1QYGH 3O3BA 4L9LA 5DSCA 4NNPH 3P4NA 3JZ7A 1MCQA 4TUJA 4A6YL 4OCXL 3V5HA 2EKSA 3U0PA 4MB3A 4WI2A 5I71B 1GIGL 4OCWL 4PRDA 2VZOA 2ZG1A 4OZGB 4HT1H 4R3SB 5FGBC 4DZ8B 4EI6A 1GOGA 3GEWB 3UTQA 2Q76B 4U2ZA 5TE4L 3B9KC 5JPMA 4HPOH 5IFAH 5FYKD 1DE4A 1UEMA 2KPNA 4OCMC 3T2QA 1H3TA 4NO0B 4OLZL 1I8LA 3EIFA 1E4JA 5EOQH 2GJ6D 4M62H 3RGVA 3BIKA 1QRNA 1V7NH 1NBYA 5IV2A 2YR3A 3O3EA 5EG6C 4L3CB 1VFOA 3BW9B 5DMGD 2WINB 3WNOA 4F8TA 5LQBL 3U9PH 3WUWA 1JYVA 1M6OB 3SKJL 3UZEA 1K8IA 2CJUH 1LQSR 3SJVD 3EZ8A 3QXDA 1LP9A 5BZDA 2DDQL 1K5NB 3OAZK 4M6MH 5K33A 5F1KC 4BUHA 4WI3A 1UC6A 4PJEF 1VACA 2DWEB 4F7MA 4H88H 4AT6B 4PB0H 5EU6E 3JWOC 4Q2ZB 1T5WB 4PJ8B 3KPRA 4PG2C 5FA4A 1OGTA 1BIIB 5IEKA 1UKQA 1FZMB 5CZVL 4Y4HC 1XR8A 2QQNH 1H3XA 2LABA 4P23B 5IMKB 3U6RB 3MFFA 3C60C 3D9AL 5IOPB 2NX5A 3ARPA 5EO9A 5GRUH 1MFDL 4LHJB 5DEFA 4DKFL 1MI5E 1C8PA 2IALA 2ZP0T 3VXSA 2ARJB 5LGKA 1T20A 4KJQC 4ZUSA 1DLHA 5GS0L 3MODL 4LCWD 3T08A 2IBBA 2O5ZL 3RAJL 4HJJL 1RUPH 4UT9H 1WITA 2EC9T 3VMNA 2B4CL 2XRAH 2YA0A 1N6VA 3O6LH 2W0KA 4KK6D 1R3LB 3H9YA 3MA7A 2VITB 1T04B 4CVWA 3DETC 2GK0A 4S10A 3SDAB 1DUZA 4DN3L 1NFIA 4YHML 1NFDB 4L8DA 5IWLC 4MB4A 4JCLA 5T5NF 5IQ9B 4I0CC 1VGEH 2BVEA 2WUBL 4EQ3A 4LRNL 5DJ6B 2NW2B 1YEJL 2I9TA 1OAYH 1T83C 2WIIB 1N4XH 1D3CA 4TNWK 4XVJL 2GI7A 3KLHD 3QEQE 1RHHB 1EX0A 1GGIL 2ED8A 3V6FA 1KEGH 4F9PC 3TO4A 4D9LH 3T2OA 3V6BR 4G6AD 3ZE0F 3MZGB 3HFML 4WHCA 1VGKA 5I1JH 2DQGL 1Q9LB 1CL7I 1VEOA 1N5AB 4RMVA 3AROA 4ELKA 5EZJA 2VDQL 1JWSB 1MVFA 4A6YA 1Q0XL 5KSBF 4YIQA 3SKOA 4MXVF 4OFPA 4YGAB 2W0FB 4ERSL 2LTQB 5CZXC 5D4QA 3S37X 1KXQE 4DGIH 2WZPD 3VG9C 3MRKB 4U1NB 4Z0XA 1Q9WA 1BQHG 4MNQA 2H2SD 4MAYD 1H5BB 4L4TA 4NM8L 1TVBA 3GSXB 5E6ZA 4LKCA 5KN5A 4W81A 2W9DH 4EDXB 5C7XH 4RWYL 1QFWM 3NIFF 3LKPB 5KVFL 3B9EA 4X83A 1G1YA 3L3DA 3NBNA 1HH9A 2FR4B 5KS9A 4TSCL 3GSUA 4QHMB 1KIQA 4QRUA 1OP3K 4PJBB 5IIEB 3P3YA 1J5OL 2HFEA 3H6JA 1YN6A 1NMBL 1OAUH 1ZWIA 4LVOC 4RMTA 4P5TA 4WFEE 3QDMB 4KDVA 4MXQC 3L5HA 4MCYB 4RX4D 1AR2A 2EIZB 4B0MM 3W5MA 2K3TA 1Q72H 4HWEL 1U8HA 1WFOA 3HNVH 2BSTA 4PRAA 1WFNA 4V1DA 3BUYA 1KSRA 2UVFA 5EZOL 1VKXB 1RJYB 1JWMB 4LVHC 3MOAL 4ZFOL 5F6IB 1C1EH 3SE3C 5ITBL 2J8UA 4WI9A 1JGLH 1UVQB 3ULUL 4FTVE 2I5YH 4PTTB 2CDFB 1IFHH 2PTTA 5JDJA 4DFIA 3QDGD 2H6PA 5C9JB 1ZHNA 1UXWA 4WW2B 1QPXA 2R2EB 3RWFA 4KTEL 2YPLB 5HYSB 2E5EA 4NP4L 4HH9B 4P4KB 1YEEH 4FQIL 1Z6JT 4JO4H 1UCBH 2DIJA 2EE2A 1K4DB 3BD3A 1U8IA 2QL1A 2XA3A 1UJ3A 3ZKXB 5D7IE 2R8SL 2D0GA 4FQXD 5SWZD 5C07A 4PJ9D 3VFUB 4FXKB 1ROWA 5C8JB 1V7ML 3MX0A 1F4XL 4PV9A 4XWGH 3F7QA 2ADJA 5HHQA 2HTKC 1IM9B 2VXUH 3SDDD 4P3CH 1FGVH 3HUJE 2NY1C 5C0IB 5SWSB 3DSFH 3S35X 1I7RA 3G04B 3KG5A 1A9EB 1LO4L 3STLB 2OJZL 4WTZA 4P57B 2V5MA 1TTFA 2VDPH 5IVOA 1JK8A 5JQ6L 5MENA 5ITFB 4QRRA 3S8WA 1NC4D 5IHUH 1JNLH 3QG6B 4F2MA 3ARFA 4G8EA 1F3JA 3O4LA 2FBJL 4PJXA 2MPAL 4GH7B 4JVUA 1J0KA 4QOKB 4K2UL 3U4EA 1I8KB 3UPRA 5HVHC 4NO3B 4HMEA 4JHBA 3ZDYF 2IH3A 4L5FH 1TPXC 2EXWC 3S5LA 3QFDB 2WBJB 2X44D 3V5DB 5DEZA 3GKZA 1RSFA 3F6IA 2AV1B 5B39B 4JVWA 2R23A 1PG7H 2F15A 2VH5H 4QYOA 3LDBC 4HUUA 3QWOA 5E94B 4ODHL 2YUZA 1HILB 2EIEA 4V2BA 3WJLC 5JW5B 1OTUD 2A6DB 1H3GA 3BGFC 2XZAH 4O4YH 2FIRT 4OZHF 3BQUA 3D85B 3CXHJ 4WY7H 3NCBB 5DMIH 4NO5A 3CFKA 4YH6A 3AB0B 4U6YA 3JWDL 5DO2D 3JSSA 3QA3B 4YGVB 1INQA 4FFVD 2GY5A 4Y4KA 1Q94A 1KIRB 1NAML 3PWUA 3QB7C 4J4PD 1K4CB 3U2SA 2HT4D 5DZOA 3RY6A 3ZLQC 2AK4A 5IG7A 1AC0A 2CQVA 3QFJA 4NIKB 3QYCA 4XXCC 3W0WB 4Q74A 1IC1A 3CFCH 4UQ2A 3DGGA 3SDCD 1FYHB 3BIAX 3QIWC 3P4MB 1F4WL 5I1EH 5FHAH 1RIVH 2ATKB 3BP4A 2DQDH 1HEZA 4NNPL 1K85A 3QO1B 2AERT 4G5ZH 1JGEA 2QADD 5I1DA 4GUPB 4ZFOA 1DDHB 5C08B 2NYYC 2A73B 2B20A 3K0WA 4CVXB 1FLTX 4D94A 2D9QB 5D72H 4JDTH 4XCYB 5D70H 4JDZB 2NXZC 4Q6IA 1X4ZA 3GUTA 4YXHH 1J8KA 1TQBB 3ZE1E 3D39A 2D9CA 4JPVH 2IPTH 4LCCB 3GMRB 4Y1AE 5C0ND 1FZJB 5J6GA 2NXYC 4MJID 4Y2DC 3VI4F 1T6VN 1J88A 3ZDZE 3OL2A 5ALCH 5HHNB 4S11A 3HC0A 4J3TA 2RHEA 3A67L 1XF3A 2Z93A 1QFUL 2JJTA 4G80B 4Z76B 5I9QB 4MD4A 4AMKH 4JKWA 1DQLH 2Y36L 2CJUL 3SDXE 5I2IB 5KVEH 1UZ8A 2QHLA 3QP3A 2EYTA 3THMH 3MRDA 4JDVA 4YDLB 2EO1A 1EO5A 1PY9A 4QGYA 4M6ML 2PW2B 2CR6A 5IVXE 4Y16B 2G2RB 1ZLSH 4HBCH 2DQCL 4NKMB 5CKGA 1CLOH 4YHNB 2YSSA 1YMMB 4H88L 5E8OA 5IROC 4X4XA 4S1QL 4IBLT 4H1LB 3QUMB 4PGBB 2ERJB 1CDYA 2IAND 5E1AB 2VZVA 3LEXA 2QQNL 2Y6SD 2WLZA 3VWKA 4XCCH 1SYSA 5FFLA 5J89A 2IWGA 3NCCB 3ZZ1A 1ACYL 2EDTA 1PKQA 1T3FB 3MV9D 4TSAH 3U79A 4M43H 4ONGH 3BWAB 4NRZA 3PWPE 3U4AA 1CFNA 3D0LB 1U3HB 4RRPG 4CJ0A 1F02I 4EQ2A 4WWKD 1WZ1H 3IXTA 5D1ZC 5GZND 5IW1B 4PRBA 1NDGB 1YQVH 3RWDB 4WTXA 1BZQK 3O6LL 3S96A 3O3BB 4L9LB 1VA9A 3P4NB 3REWA 1XGTA 3V5HB 1HYSD 1YC8A 4LLDB 4FN0A 3VCLA 3VXPA 5L8LB 2P8LA 2XN9D 4PRDB 1II4E 3ULVF 1JZ7A 1BOYA 4EI6B 3IDXL 3HZVA 5TE7L 2VLJD 1OAYL 4XGZA 1D5BA 1NAMA 4HS8L 4FFWD 3RL2A 1LE9B 1L7IL 1DE4B 4M5ZH 4P2OD 1BEYH 5TQ0H 5HHMD 2ATPA 5FYLE 3TFKC 3GGWA 3T0XA 3QAZB 3DXAD 4M7KL 1KEGL 4D9LL 4QLRA 1OQXA 5MERA 1X5GA 3RGVB 3LKRB 1QRNB 2IAMC 3O3EB 3KHOA 3NTCH 4HLJA 5H8DA 3UTSA 5ID0A 3OR7B 4YHLH 2JLLA 1Q0YH 5T3XD 2DQJH 1K8IB 4Y19A 3GSRA 4DKAA 3QXDB 3HLAA 5CJ8A 3VH8G 3HZKB 3EYSH 1G7LA 2Z91A 3TN0C 5KAQF 5FO9A 4AH2A 4LPUA 4EN3D 2GAZB 2J7LA 5FYKU 4H0HB 2BDNL 5GS1C 5JXEA 4WV1C 4WCYH 4QY8A 3VXME 1RULH 2N7BA 2ZNXA 4N0UA 4OGXH 3T65A 4OQTL 3FB5B 5T1DL 4JN2A 5IEKB 4UINL 5CGTA 3OKMB 5EOCJ 2BRRH 1BF2A 3L95A 2G75A 1V3JA 1A47A 1XR8B 4UDUB 4UT6H 1E0OB 3MJ6A 3MFFB 5BW7A 5E8EA 2NX5B 4LLUA 4YBLC 4XTRD 2L0DA 5EO9B 4J7RA 3ULSA 4XNQA 3VU2A 5FV2A 2IALB 4BZYA 1QLEH 2SEBA 1TZIA 3VXSB 5F9JA 3T1FA 1T20B 4ZUSB 1DLHB 1IMHC 2A83A 4JY5H 4XNMA 5BMFL 3B6SA 3HNVL 2EH7L 3FQXA 2F9BT 2HVKB 2N7AA 3OXSA 5IGXH 2JJVA 1C1EL 1IEHA 2VZ1A 4KDTA 1BQHA 3GSOA 2GK0B 1DUZB 1WFTA 2XZCH 1QFHA 3IYLW 3K1DA 4L8DB 3BXNA 2DB8A 2K1MA 5GJSH 4XMPL 3PABA 1MCRA 1EK3A 4F57H 4LOUC 4XMKH 3CH1A 1NLBL 2EDDA 1NUFA 3QZWG 1SY6H 2I9TB 1WVZA 3QH3A 5HGAA 4JPKH 1DEEB 2QSTA 3UX9B 3DLQR 3O3AB 4ZOBA 1MI5D 5L2JA 2VDMH 3ARDD 1YEEL 1D5IH 1EDQA 3V6FB 3V7AG 3N1QC 5DHXB 1X4YA 4Z7NE 2ADIB 3MTRA 2ESVA 1VGKB 4NPYA 4BH7A 4NQED 3WFDL 5I1HH 5GJTL 4ELKB 4A6YB 1IAMA 3JV4A 5FGBA 4YIQB 1FJ1B 5I8KH 4JO3L 1OT1A 4DVRH 4P3CL 1VPOL 3C09C 2ADGA 3FO9A 4Z0XB 4KKBD 2VDPL 5T1LA 4FQXB 1MCKA 2JK5A 4LMQE 3O41A 5GGQH 3IJHB 2VIRB 5KVMC 2DQFA 3T4YA 4LKCB 3TIEA 1LP9E 5KN5B 5CBEA 3V8CA 3HC3H 4D0CB 1JNLL 1A0QL 1HHJA 2R9HC 4AK1A 5EC2A 2B0SL 5K9KA 1UM6L 5E2UH 3E6FA 4M6AA 5JLZA 3L3DB 3D5OF 1F8TH 1HH9B 2VDNH 3WDIA 1JI2A 5KS9B 1OAKL 3GSUB 5KOVC 2NNAA 2E8YA 2HFEB 4KROB 4JM2F 2YK1L 3U30B 3AUVA 2ZG3A 1YN6B 1ZWIB 3KPRE 5D7LE 3RZCC 1PG7L 4K8RC 1A6UL 2WUCH 1H0DA 1X5XA 3KPQB 4XRCA 4LHUD 4FQJH 4ELMA 1KJVA 1DCLA 5JIHA 4CBPA 2BSTB 2VDLH 4O4YL 4PRAB 4V1DB 4N9GA 1NANH 2XWJA 4NHUB 4PPTA 1ZA6B 1FPTL 4JKLA 4Y5YA 2R2BA 1NLDH 4QHLA 1P1ZA 3CNKA 5AZ2H 4OIAA 2J8UB 5DMIL 4OQTA 2F5AL 1CLZL 4QXTA 1DVFD 3T8XB 5IJKC 1A21A 2VR4A 4L8BA 5DEGA 3VRJB 1O7SA 2PTTB 1VFBA 2MWCA 4I5BA 2H6PB 2H26A 5GGSB 1UXWB 2V5TA 4RBPH 1HCVA 3RWFB 4DUWA 4JFEA 4LSVH 3UDWA 4KKAC 3CFCL 4WFED 1P7KA 2G5RA 1B2WH 2ZCHH 1G7PA 4R4FH 4IMKA 3B9KD 1ZHLB 4PREA 5FHAL 5I1EL 1F97A 4XVTL 1RIVL 4LLWA 2O5XH 1U8IB 4EIGB 2NW3A 4U6XA 2DQDL 1TJHL 1U95A 1HOCA 2BFVH 1DL7L 4JFYB 1A5FL 1N7ML 2ADJB 5D72L 5IB1A 3PDDA 3SDCB 3QUKA 3OGCA 4L4VA 4FTVD 1I7RB 1U8QB 1HHHA 4DUXA 1JCKA 1KNOB 2EDLA 2ZOKA 3HPLB 3ROOA 1BGXL 5MENB 4QRRB 4KTYA 1I3VA 3G6AA 2HFTA 4KFZC 5FXCH 3DROB 5CJQH 4FNLL 4EOWH 1BWMA 1X5FA 2ZUSA 1CDCA 1V8HA 4G8EB 2OTPA 3QNXA 3MC0A 3O4LB 2M26A 2PO6C 4OCYL 4XNXH 1XCQA 3IJYB 1N26A 4HUXA 1Z5LB 3U4EB 4AMKL 4ZS7H 5JHLL 2BVQA 5D96C 1DQLL 4MNQE 1P84J 4L4TE 1R5VA 5KVEL 3THML 5I8OL 1KXTB 3UBXG 4Y4HD 3BIBX 4NCC2 5IR1A 3HI6H 3KPNA 2R23B 3C60D 4HW6A 5ICYB 5EFIA 3UTZA 1LHZA 1NBQA 4ONHB 2AXGA 4HUUB 1YEHH 4TUKH 5DQ9B 1WAAA 3P9LA 5KS9E 1AKJD 3VGBA 4EDWH 1J8HD 4MD0A 1J1XL 1ND0A 3BQUB 4PJIF 4YDVA 2H1PH 4AEHH 4X6EA 3O6FC 3CFKB 4J6RL 4P3WA 1FE8H 1MFAL 4POZC 2YA1A 1INQB 4Y4KB 1OGAA 2H32B 5EUOF 5DUPL 4ZO6A 3L3GA 1EEQA 2QKIA 4TSAL 4XB7A 3NOIA 3RUGF 5EU5A 4K7PX 5ISZA 2BK8A 4ONGL 3HG1A 3AVEA 5IG7B 3VW3H 3QFJB 3IDJA 4UUJA 1U8NB 4G3YH 1YNLH 4PTUB 5CWSB 1D5XB 2VXQH 1LK2B 2F54E 3DGGB 4BK4A 2CIKA 1T5XB 3FQUA 3UC0H 1YQVL 3FFCE 4ZSOA 4J3WA 1U58B 5F89A 1XT5A 1BZ9A 2PXYC 3BP4B 3UTTA 3KPSA 3TJHD 2YC1A 4KJWD 4OLXL 1D6EB 3MV9B 1NCWL 5T5NG 5I1DB 4ZFOB 2PN5A 5GRZA 5DTFA 1CXIA 3OAUL 5IKCA 3EGSA 4WWKB 1I7TB 1NAKH 4Q6IB 3OKDA 4DK3A 4NDMB 2J88H 3GUTB 1JIBA 4JRXA 3HKFA 1GC1H 3D39B 1FIGL 5TQ0L 5C07E 3JVGA 4MA8H 4OD1L 5J6GB 5CZXD 2X4SA 3GIVA 5EZIL 3VFSB 3OTTA 4NQXA 3HC0B 1XR9A 2ITDA 5D7KE 4UU9A 3NTCL 1ZHKB 4YHLL 2LU7A 3S3JA 4FQ2H 4NZJA 4MD4B 4XB8A 3BMVA 3RPIA 4PLJD 3TA3C 4PJGA 3D48R 1YEFL 4HXBL 4OCSH 1UZ8B 4KVCH 2EYTB 4WO4C 2Q7YA 3EYSL 3MRDB 4JDVB 4BZ2H 4PGEA 2HKHH 1YECH 5CHNA 3N9GH 4Z6AT 3DBXB 3FAWA 4PJXE 2DS4A 2PCPA 4I48A 2YSSB 2YWZA 4N8PA 4CAGA 1I8IB 2BHZA 4G9FA 1U8OB 4PJCA 1WQVT 1RULL 2PTVA 4Y1AD 1TVHA 2VXTL 3SN6N 4WFGE 4OGXL 1HK6A 4MXQD 2FD6L 3TWCL 3FO2A 4AEEA 1LE5A 4OZFH 2BRRL 1KIPA 4UT6L 2QQLH 4ODTH 2OJEB 3QEHA 4PJ7A 2DQEL 1Q8MA 1MHPL 1JHTB 1PKQB 2A6IA 4HKBA 1S3KH 2XICA 5ICZA 5FB8A 1QLEL 4HFWA 3L3KA 4DN4H 2AV7B 3ARWA 4P9MH 4WU7B 2HG5A 4BKLB 4Z77B 4GKNA 3IXTB 4RMSA 4KMLB 4ALAH 1EO8L 3VH8A 3HRZA 4PRBB 3MYJA 1W72B 2A1WH 3S96B 3KR3L 4DEPC 5IGXL 1HINH 3UJIH 4EI5A 2AK4E 2XKNA 5F1SA 5B8CA 1XGTB 4W4OC 2A74A 4M03A 5E6IC 3VCLB 5GJSL 3DUUA 4NUJB 3UAJD 2P8LB 4ODWA 5CCKH 4LASH 1QSVA 7FABH 4FQPA 5C0GA 1XGUA 3B3IA 1MCNA 2YD4A 1D5BB 1NAMB 2RCSH 1WF5A 5FM4A 1VENA 3RL2B 1B6UA 4JPKL 4M7JL 2CO6B 2DICA 3IFOA 2FWOA 1DTUA 3GGWB 1D5IL 4OF5A 5CBAA 2D03H 3QIWA 5MEPB 4ENEC 5INDB 1FO0L 4N90E 5C86A 4MVBC 2OZ4H 3KXFA 5MERB 3DV4A 4NSKB 2VUOA 2LV4A 1D7FA 5C0AD 2DLFL 4MAUL 3K4AA 1QHPA 5F7EH 5ID0B 1MFEH 3TBYA 5L7XH 1G0DA 4WHDA 3FONA 3C2AH 2Y07H 5I8KL 2XI9A 3F7PC 4DVRL 1ZT7A 5DMKB 1TITA 3HLAB 4Y89A 4GW1B 3MRBB 3BP6A 5ACMA 1G7LB 4MHHG 3GMLB 3EBAA 4ONFH 2EDNA 1EPFA 4O5LL 4NUGL 3UTPE 1Q1JH 3MV8A 4MA3B 5SX4I 4RGOH 4KJPD 3R0NA 2EXWD 4NQEB 1F4AA 4LCIH 3QZWA 4AG4L 5T3ZE 4QY8B 3WDHA 4RGMB 5T1KA 2N4IA 1JTPA 2Y4SA 4N0UB 3U46A 1FSKC 3HB3C 2QSVA 4X7FC 3VI3F 2VABA 1B3JA 1SEBB 4PFEA 3T65B 4JN2B 4HG4J 1M7IA 4S1SH 3BI9X 2IPKA 2AJSL 4MQSB 5LVEA 1F8TL 4WJ5B 5BOPA 4LLUB 3T0AA 3JWNC 3I3EA 3LCYA 4XNQB 4HCRL 4G7YH 2QLVB 5HJ3B 5F9JB 5CSGA 5FO8A 2EZ0C 1FORL 3LMJL 4O2EB 2GT9A 5KANG 2A83B 4XNMB 3C5JB 4FQQB 4RZCA 3B6SB 3F7RA 3EYVA 5IROA 2VDLL 5AAWA 5FUOH 3VXMD 3OXSB 4PJAF 3MNWA 5K9QI 1SEQH 4ORZC 1BQHB 3GSOB 5AZ2L 2M2DA 1J86A 3VGAC 3PHOA 3GSVA 1EHAA 3S37H 3R1GH 4JQVC 1FYTD 5EZLA 4PJDA 2VR5A 3ORJA 3KAAA 2WWMC 2VZ3A 3TH2T 2YS4A 2NYYD 3G6JA 3CUPA 1O5DT 1A7RH 4R90H 4ZPTB 3T0EA 5IFHH 2G9HA 4OUOA 3WIIH 3D25A 3QCVH 3PV6A 4YBQC 4R4FL 5MHSD 1PG7W 1DVFB 4GKZA 2O5XL 3LKOB 3N1PC 3D2UA 1BD2E 4NPYB 1KJ2B 1RURH 5E4IA 5CSZA 4Y2DD 1I9RH 3RNQA 3LPGA 2IG2H 5ALBH 4ORGA 5I66B 2HKFH 4LU5H 3CX5J 3NZHH 3JV4B 4X7CC 5CEZE 2X2YA 3TO2A 3ULVH 1OVZA 3B9KB 4KI1A 4ZOCA 2JKXA 2HN7B 5TE6L 3S6CA 3Q48A 4K9EH 2ADGB 3G6DH 1R5WA 3QI9C 3RI5F 3C87A 3FO9B 3UTSE 1SYVB 2FIKA 5T1LB 5AEAA 1JUFA 3O41B 2AP2A 2D0HA 4JFFA 4Y19E 3RKPA 3T4YB 5CJQL 4NFBA 1XGYH 1FO0A 5EC2B 1C5CH 5K9KB 1MVUA 1PLGL 3O8XC 4LL9A 1ZXQA 3E6FB 3FN9A 4XNXL 3OJDB 4ODSL 1F2QA 3UPAA 4ZS7L 3QRGL 5JIPA 1TCRA 1EJOH 4ZMAT 3U7WH 5J11C 2NNAB 1GL4B 3IRZA 2C7UA 3SBWC 4K8RL 3TN0A 2HJLA 4L29A 4WUKL 1M71B 4PUBH 1RK1B 2RIKA 5GS1A 3M8OH 4AIXA 2DLEA 1H0DB 4KGJA 1MEXL 4XRCB 4XMLH 1YEHL 4TUKL 3RWJA 4ELMB 1KJVB 2X89D 5I16A 5DFVC 1FP5A 2XWJB 1AHWC 1IGIH 2R0LH 2R2BB 1S5IL 4JHZA 1WT5C 2KQNA 5D1ZD 4Y4HB 3EHBC 4K3EL 4XX1G 3VWJA 1NL0H 3T4AA 5F88B 1FE8L 5SV3A 3C60B 1AXSA 5GXBB 3L3HA 2Q86A 4QXTB 1YA5A 4L8BB 4N1HB 1OWRM 3PQYD 1VFBB 4WTWA 1AKJB 4I5BB 3DYPA 5AAMA 4JZJA 1WZLA 1J8HB 3CSGA 4JJHA 3WFCL 4LCUA 2B5IC 1I3GH 4M6NH 4HCRA 4G3YL 2IADA 3T3MF 4LP4A 2VXQL 1YNTB 5TQ2H 5D7LD 4NC0B 1BQUA 4IRSC 1G7PB 5IBUG 3UBXA 2CK2A 1NUDA 3KYMB 4KDWA 4LLWB 3V95A 2NW3B 4KV5F 1P6FA 4PJEA 4PJBF 3RTQA 1U95B 1HOCB 4G6KH 4WFHD 1UB6A 5J9PA 2UZYB 4P4RB 5IW6A 1N6QH 2B1HH 3ARGC 4HX1B 3S34H 6FABL 5IB1B 2YKLH 1KPVB 2IAMD 3QUKB 4L4VB 1KGCD 2J88L 4ETQA 5EO0A 5FUCE 1CFVH 1HHHB 3OKNB 5HVWA 2ESVE 5I1IL 4J3UA 1RI8A 1BQLL 3LRSB 2ZOKB 3L1OH 4PRNB 3GBNH 1KELL 4UOJA 4KAQL 3PL6A 4HS6A 4R7DB 4ZFGH 4MA8L 2HJFA 3AAZA 3PGCA 2VLLB 3G6AB 1T2XA 2YN3A 3CSBA 1KFAH 2PR4H 3H3PL 3HE7C 3EW3B 4KY1H 1RZ7H 3QNXB 1RU9L 4H5SA 4HWBL 1XCQB 2CRMA 5GGUA 3ARQA 5T33H 2BVQB 1JTTA 4X6FB 4XHJC 5F3HA 2X41A 2DTML 3Q6GH 3TZVC 3CGTA 1ZANH 5KAQG 1R5VB 4OCSL 3U36B 4KVCL 3WS6C 3GZKA 3OHXB 4BZ2L 2HKHL 3N9GL 5DRNA 3ARRA 4DW2H 2P48B 2OP4H 4M7LT 4N0FB 3WFBH 5J7CC 1A1NB 3BKCH 2HH0H 1G7HB 2CDGA 3P9LB 3MLTA 2XNAB 5GGRY 3OKLA 1TQCC 4MD0B 2R56H 1ND0B 4YDVB 1BZ7A 1F6AB 3ABZA 4RBPK 2UY7A 4X6EB 2P8PA 1VCAA 3ELAT 2QQLL 4YLQT 4LLVA 5JW4N 1JPTL 2J1KA 1GGBL 4PGJA 4KK5D 3TCXA 3F12A 1S3KL 4LVOB 5ISZB 1QFWI 2MMXA 3HG1B 3RZCA 5KSBA 3IDJB 1E4XI 4UUJB 4JFDD 2VZUA 3SO5A 1IGCH 3GB7A 4LOUD 5ESQA 1ITBB 1ZS8A 3B83A 3I2CL 3PDOB 4HGWA 2CIKB 1IEBA 3WNNA 3MRJA 2A1WL 3Q3GB 4UTAL 5F89B 3UTTB 1J11A 1RK0B 4LVHB 1S9XA 3KPSB 1HINL 1FN4A 1S7RA 4JO1L 2OR9H 4LDEB 4GRLA 3GJFA 4JFEE 5HYIA 1CXEA 4CVZA 3BZDA 2WMPA 3WXWL 5DTFB 4OZIA 4LASL 7FABL 5IKCB 4OGZA 3T3PF 4K94H 1QUNA 3OKDB 1HIMH 3M07A 1N2RA 3CC5B 1QBBA 2MCG1 4BELD 2F53A 3QQ3A 3ZYOA 3K81A 5CGMA 3VD7A 3FOLB 5DD1H 1S5HB 3BISA 2BXYA 3QXAA 1XF4B 4FZ8H 2X4SB 1BVKA 2OZ4L 2F54D 3QXVA 1V3KA 4NQXB 4HS3B 4NYLA 2Y9RT 5K9JH 1GGYA 3FFCD 1XF2B 1B0GA 4R26H 4UU9B 3WS3A 1WTGT 5F7EL 5D1XA 1FCCA 3C2AL 2R9HD 2Y07L 3AC0A 3UCRA 4LQFH 1IQDA 3MOBL 2GKIA 4ONOA 4KI5C 5LKNA 2NY1B 1JPGA 2Q7YB 4PGEB 4ONFL 1C5DA 4OFVA 4GMTL 5C0AB 4I48B 1IAOA 1X3DA 4RGOL 5C0CA 3TT3L 4QHUA 4G9FB 5JNYA 1YEKH 1W0WA 5A43C 1TVHB 5GS3A 3IAQA 3QIBC 3PWNA 3BDXA 1LE5B 4S1SL 4MX7A 2VSDA 1KIPB 2MNUA 5HVHB 1CFQB 3V9FA 4GXUM 3QEHB 5D7KD 4HWBA 3BT2L 3C2SA 4PJ7B 4HEPG 2ICWI 4I0PC 4YHZL 1TPXB 1HI6B 4NZTL 2A6IB 4D9RE 4M5YH 1ZEAL 4HKBB 3IFNH 2EYRA 3C8DA 4G7YL 1PKOA 4G8IA 4H25A 4OQ1A 4MZ3A 5FB8B 4HFWB 4ISVB 5C9KA 3L3KB 3LDBB 2HG5B 3BESR 1MLBA 5F7NC 3RIFK 3WHE1 1YYMH 1R3HA 3BGAA 1S7UA 1RIHH 2W9EL 3VH8B 1T7XA 3BGFB 1OGAE 2NR6C 5FUOL 2I9LA 1AY1L 4X6DE 5FGRA 2HWZH 1MHEA 3T0VA 4HEME 3KPLA 2P5WA 3KNBA 2NY2C 4JY4A 1KB5L 1SEQL 3O11A 4EI5B 2XKNB 2A74B 4LAQH 1MCEA 4FMKA 4E41D 5I75B 4ODWB 5D5MF 2R0ZL 5HDQL 1JGDA 1BQSA 4PG9B 5C0BA 5C0GB 1XGUB 4ZSOE 2G60H 5ICXB 1K8DB 3B9DA 5E9DE 3CMOL 4KK8C 2AEIT 1LO0L 1A7RL 5J06A 3IFOB 1JPST 1AIFA 2XZQH 3WIIL 3QCVL 3RGHA 3QIWB 3KXFB 1F11B 3DV4B 1KB9K 4P46A 3TBSA 2YD1A 1FYTB 3H42H 4D0DA 3FZUC 4JRXE 1RURL 5I17A 5E56A 1EEZA 2BHYA 1HXYA 3MGOA 2DQHL 4OZHA 2IG2L 5ALBL 3PIQA 4LU5L 3FONB 3NZHL 4ZYKA 2NXZB 5IUSA 3LAFA 1ZT7B 2PO6D 3BP6B 3ULVL 1BJ8A 5GPRA 3RWHA 3RWEA 4JRYD 2IEPA 4K9EL 3SE4C 1YPZF 3G6DL 3O0RH 3MV8B 2CUMA 2NXYB 2Z4QA 4XHQA 5HXMA 4R7NA 3QZWB 3BZEA 4XZUA 5BO1L 4DOHE 3NFNA 3GHBH 1ZT4A 4PJGE 4YK4C 3B9AA 1X6NA 1XGYL 1S7TB 2DN7A 1G84A 4KRPC 3QIUA 4N90D 5D7SH 1C5CL 2OZ4A 1M7IB 2H3NA 3TJEH 2L7JA 1I4FB 3PWJA 3TA3A 4TQEH 1AGDA 4TTDC 2C3VB 3QUXA 4PJCE 1A4KA 3QHFL 5SWQB 3O6FD 1KLFA 1A8JH 3A0OA 1CCZA 2W91A 2N56A 5GRWA 3VFGH 3X3FL 4PRPE 4QRPE 4P9HH 5KVDH 4HIIB 2NY7L 3M8OL 2BZDA 2FO4B 2GT9B 1G9NH 4XMLL 3UTPD 4RZCB 3O3DB 4S2SA 1EZVY 3PG2A 3EYVB 3V4UH 1A4JA 5T3ZD 4Z8FH 1LO5B 3GM8A 1IGIL 1CT8A 2YEZA 3BN9C 4APQA 2CRYA 5L88L 4DCQA 5E4EC 4NKIL 4PJFE 1YUHA 4FQ1L 5J4MA 2OK0H 3PHOB 1HCFX 3GSVB 3WKMH 5D6CB 2PXYD 43C9A 1W0VB 1XIWD 1UXSA 3TGXA 5I73C 5EOTB 5J3HC 5EZLB 2HTLC 4XP4H 2WV3A 4XNZC 3DARA 4F58L 4GJTB 3SKNA 1I3GL 4M6NL 5CP7A 3U0WH 2G9HB 3U0TB 3KHQA 4XWOD 5DD5H 3D25B 3PV6B 5TQ2L 2A77L 4M48H 3MUZ1 4ODBD 3SCMC 2AXHA 4F37F 3PQYB 3D2UB 1J18A 2RQ8A 4ODXA 1L0QA 5CD3B 5CSZB 2H8PB 4OFYD 3RNQB 4G6KL 2CMRH 2X4UB 4P99A 2BNRA 2H2PC 1U0QA 5E0QA 3PHSA 3S34L 2AEPH 5KW9H 2YKLL 4EEEA 2P8MB 3DECA 3FQTA 1WJ3A 3IU4H 4ZD3H 4Z7OE 1FG2A 4X5WA 1KACB 2VZSA 1R5WB 4LF3B 4DJMA 4JFPA 1A6VH 2ICWJ 2FIKB 4ZFGL 3ALPA 4LMQI 5IFJA 1GHFL 3V4PH 5JW4Q 4WO4D 4IRJC 1ZVSA 4YX2H 2CLRA 4JFFB 2FEDC 3I84A 5BJTB 2QHRL 3T09A 2V5RA 2J3SA 3GSNL 5DC0A 1FO0B 4LLMB 2PR4L 2FJHB 2IAMB 1MVUB 1ETZB 5GSVB 3M1BA 3FFDA 4MDJB 1BD2D 4KZEH 4UOW0 2BOCA 2I07A 1TCRB 1VFMA 2XKUA 3OR6B 3Q6GL 3PP4L 2FJFA 4JHAH 1YN7A 1ZANL 1R0AH 2R0WH 5LAXA 3DMMA 3TN0B 1F90L 2HJLB 1E4KC 4L29B 4UILH 5CEZD 1TTGA 2XTJC 4DW2L 4PRHD 4Z7QE 2CUIA 5GS1B 2OP4L 3E0GA 3MRIA 4WV1B 3BKCL 2CPCA 3RWJB 2HH0L 3VXUD 5I16B 1I1YA 3IVKA 1XAUA 4NGHL 1EAPA 3MRMA 3EOYG 3SE9L 1I1AC 1RQ5A 1KCSL 1HE7A 2JE8A 2YZ1A 1F58H 1ZLWH 2CH8A 5E7BA 4JHWH 4NQCD 5F1NA 4HWUA 1NBZB 4UAOB 4UDTA 3T4AB 2OYPA 1AXSB 2Q86B 1LILA 4L9DA 3VE0A 4YBLB 1S7SB 5JW4R 5K9OB 4PY7A 1QACA 3SKUD 5E6ID 2ICEA 4JZJB 4NC1E 3G5YB 2H45A 1OAQH 2D2OA 2D7NA 2PUQT 3PGDA 5CFHA 2PKDA 5KSUA 2F58H 3LIZL 2PW1B 4GQPH 3UBXB 1A6ZA 3X13B 5ACZA 1IEAA 3DIFA 3PHQA 4PJDE 2QQKH 4KUCD 4PJEB 2BVOA 5INCB 6CGTA 1QR4A 3G6JE 1IC5H 2OR9L 4ENED 4CUCA 3T0EE 1UB6B 4JFDB 4JQVA 5J9PB 2J4WH 5IW6B 1UT9A 1U8LA 1MUJA 5E6YA 4K94L 4S1RH 3BPCA 4QNPF 4ETQB 1TDQA 4J1UA 3SDYH 4UB0L 3SPVB 3FQRA 2PF6A 5HTSA 2GSIA 3WSQL 1CGWA 1S9VA 1G1CA 2HJFB 5DD1L 5KTEL 5FYJH 3PGCB 1IZJA 3AXLA 3ZTJH 4G43A 4JB9L 2JJSC 3NIGE 4YXLH 4ZNEA 4PRID 1TVDA 2BSED 2VLRA 4R26L 4H5SB 5BRZA 5E8PA 5GGUB 4K7PH 4D9QE 1T66C 2OLDA 1RZKH 3HB3D 4OD2A 5EBGA 3VXRE 4LQFL 3TBTB 1WZMA 2E9BA 3C09B 4YE4H 3NCYS 3RA7H 3VFOA 5DRNB 3VDAA 1F2XK 3E3QC 4UT7H 4OV6F 1ZHBB 3MLYL 2CDGB 1YEKL 3LKSA 3GBMH 3OKLB 1CZ8H 1DN2A 2MQ3A 5LCVL 4JKMA 4XXDA 1BZ7B 3P4OA 4JQIH 2YRPA 1T7WA 3VA2C 5HHOE 3CLEH 2P8PB 4Z0BH 5DJAA 1T2JA 3NH7H 1SMAA 3WE6A 1INDL 3EYFA 4PJHF 3SBWA 2NY3C 3DWTA 4M5YL 3O2VH 2GTZA 2BOBB 1FVEA 3AREA 3HE6C 3RZCB 3S4SG 2L4OA 1MQKH 5D2LF 2QSCL 3GB7B 2YMXL 4Z7VF 5ESQB 3KYAA 1ZS8B 3CDFA 2XY2A 4R0LA 4HGWB 2ZUVA 1IEBB 3MRJB 1DFBH 2HWZL 1EBAA 1FN4B 1S7RB 2P1YA 1AD0B 4FABH 4YBQD 4XPBH 4JFQA 3GJFB 5C09A 2FECL 4I9WE 4Q9RH 3RHWF 1I1CA 1OPGH 4Y5XC 1AGCA 3VRIA 2DQIH 1G0YR 2GEEA 3V5KA 1N2RB 3N06B 5J1AB 2F53B 3QQ3B 3VXOB 4JM2A 4OIIH 3GRWH 4AQOA 3LEVH 4E41B 3QXAB 4JFXA 5GGRA 1BVKB 1CGSH 3QI9D 3H42L 3QQ9D 3EJYD 4HJ0C 4WU5A 4KMTH 3WS3B 4NBZB 3ZKNC 2AW2A 1T03H 3ARGA 2FL5B 4B7LA 5GRYA 4DTGL 1IQDB 1JV5A 2Z92A 4N5ED 1JPGB 3O8XD 5J1TC 3BPNC 4RGNE 3T2NH 4QRTA 2EDHA 5E24E 2COQA 1C5DB 4QT5A 1BM3L 5CEYB 2R29H 4M61A 3DI2B 4P2QA 5C0CB 4R96A 2J6EH 4QHUB 1QO3A 5JNYB 1W0WB 1BJ1J 3IAGC 4HUWA 3QNZA 2NY4C 3HE7A 2NTFB 3V0WH 1WTLA 4Z7WB 3RIAK 5D7SL 1HNGA 2PO6B 3BD5A 3P0VL 1P7QD 5DK2A 3TJEL 1X5JA 4MX7B 4JRYB 1J1OH 5D96B 2CDEA 4TVSa 1BP3B 3QR2A 5DFVD 4WHYH 3VG0H 1OP9A 2P5EA 2CSPA 5HYEA 3GHEH 3EHBD 1HHIA 2HLFD 2BCKA 2EYRB 4G8IB 2XT1B 1EEYA 4PGZA 1INEH 4P9HL 3HI1A 5KVDL 1WISA 1QLRA 2DI8A 5HDLA 1MLBB 1BBDH 2YD2A 3LOWA 2AJYL 1R3HB 5BCAA 3FRUB 3CDGA 2I26N 4IRZH 3QXUA 1MHEB 1KXVC 3U48A 2X5PA 3KPLB 3PP3H 3EJJX 3KNBB 2X1XR 4JY4B 3O6FB 5KSBE 4IRSD 4XC3H 3FT3B 4MXVE 2OK0L 3NPSC 3EKCA 3OQ3B 4JVPA 4MNGE 1P4IL 4ODUA 4QWWD 4U1JA 4ZOAA 3OG6B 3AU1A 4OI7A 1JGDB 2IF7A 5D7JD 1MF2H 3L5JA 4RAVA 5JUEH 3VXTA 5F21B 5FGCB 3BD4A 3X12A 4G9DA 1TMCB 4PP1D 4FFYH 1OW0A 1TJGH 4D9RD 5BS0A 3W39A 3WL9A 3U0WL 1TLKA 1X44A 3C5ZC 4JKPH 3IXAB 2HFGL 2MHAA 1GYAA 1F6LL 1BVZA 4U0RB 5HGHB 4M48L 4OZIE 4GAYB 4XP9H 2PXYB 2OQJA 2D7TH 3TBSB 3MLZL 3U1SL 5JHDA 2BJML 4D0DB 5FO7A 1U6AH 3VFNB 5EUKA 1EEZB 1JRHL 3MLXL 1HXYB 3MGOB 2CMRL 5IVNA 3C5SA 3PIQB 4YHKH 4PJIA 4KKNA 5D2NC 3RVWC 4NKOB 1NSNH 5JIKA 4KHXH 2AEPL 4F3FB 5EBLA 1NCCH 2CXKA 2BVPA 3IU4L 3RWHB 3RWEB 2OCFD 1N5YH 3IF1B 5EUOA 4OM1L 3R0MA 3TZVD 1A6VL 3HMWH 3FT2A 1IL1A 5E9DD 4LSPH 3RUGA 2Z4QB 5DMGC 4R7NB 5IMMB 2P46B 3BZEB 4WDIB 5I76A 3HRPA 3LHPH 3T2PA 4OM0H 3NFNB 3WHXA 1V5JA 3O81A 3MLVH 3QEUA 3L6FA 4POUB 3KDMB 5EPMB 2D7PA 1IC4H 4XPGH 2APFA 3OZ9H 3HR5B 4M93C 4HC1H 3PWJB 5HYSG 3TA3B 1BFVH 2Y25A 4F7PA 4RA3A 3BPLC 4JHAL 4MMZC 2Z31D 4WO4B 1R0AL 2R0WL 4QXUH 2WP3T 1MHCB 1OARH 4KU1A 3KPPA 1CFSA 2V9TA 3DX9A 3LQZB 3UJTH 3LZFH 2OX5A 5K93A 1KBGH 1U36A 3L7FA 3QIBA 1A4JB 4WFFE 5GRVK 3TT1L 4DCQB 5FF6B 1F58L 4M6OH 5ADOH 4GG6E 4JHWL 1RZGA 4PRHB 3GK8H 2AJVH 3L5IA 4I0PA 1U8JB 5IJVA 4NZRH 3QUZD 3TBVA 3VXUB 4U1HA 1MJUH 2X4NA 2PTUA 2P5WE 1AD9A 3SKNB 1BX2B 5I18H 1KTLA 1AI1L 3PV7A 4C56E 3FJTA 1OAQL 4PRPD 3QHZH 4QRPD 5EA0H 1L9NA 1NEUA 4LCYA 4XPHH 4Y2OA 2F19H 2F58L 3KYOA 5DYOB 1PG7X 2E27H 2V7HA 3FKUS 5GGTH 5IT2H 3BP5A 4DEPB 5C0BE 4XPTH 3AM8C 5I8CB 4OF0A 1WWWX 5AG8A 4B5EA 3LN4B 4ODXB 1FFNA 3NABL 2DIAA 1IC5L 1EEUA 3MCKA 2YPKB 1CBVH 1YNKH 3BKMH 3DVFA 3TNNB 2X7LA 1KB5B 3CH8A 3I6GA 3CJJA 4EXPX 5JOFA 3G9VA 5FKAB 4U6HA 3SQOH 2KUTA 4S1RL 1ZVHA 3S9DB 3FQTB 4HQQL 3WJJC 1KPRA 1MPAH 2Z35B 1CGYA 3SDYL 1AO7E 1B4RA 4G6AC 4X5WB 2E7LA 2EC8A 1AFVL 4KI5D 4OZHE 1CE1L 3N50A 1CICD 4H1LH 1ZVSB 3QUMH 3ROLB 2D31A 1RPQA 3EJZC 1MIML 4RQQB 1J05A 4KQ3L 4YXLL 5A16A 1Z0NA 3TH4T 1RZJC 3M1BB 3LQAC 3FFDB 4Q9CA 5DVKA 5IBUB 4RISH 3QJHA 4HF5H 2BOCB 1I3UA 2I07B 3NFSH 1RZKL 3H9SD 2FJFB 2YBRB 2H2SC 2HVJA 1QOKA 4MAYC 4YE4L 1S7XA 4EKXA 3ARZA 4OF6A 1U93B 4TRPH 1YEGL 3SE4A 4TULL 4C83A 5E8NB 4PRIB 2JCCE 3F5WB 1CL7L 2VDRL 1X5ZA 2Y7QA 3MRIB 3EOAB 1T1YB 3MXWL 4JAMA 1LK3H 2LAGB 2JIXA 5TH2A 4BFEA 3GBML 2OM5A 4TVPL 1EAPB 1FSKB 4KRMB 1UADC 2GY7B 5ILTH 1NUNB 1NGQH 2AK1H 4JQIL 2CR3A 2ZCLH 1ITCA 4N8CH 4R97C 3WNLA 4Z0BL 1UWEH 5F1NB 4F15C 1IILE 3NH7L 4QRQB 3FO1B 3NIDE 2CRIA 3W11C 3PXHA 3VE0B 4NHCL 4N0YH 2NY2D 4D3CH 4GXVH 1CR9L 3MBXH 2R1XA 3O2VL 4OF7A 2VR9A 4GSDH 2ICEB 4QF1B 3VI4E 1NJ9B 1A6WL 4G7VL 3KYKH 5ACZB 3WD5H 4KK8D 1IEAB 4ZXBA 1DFBL 4UBDD 1S7QB 4CL7A 2VLKE 5A2FA 1B4JH 2BVOB 3V4VL 3LB6D 3VGAB 3NCYP 3UP1A 3CIQA 3W81A 2O93L 4OZGA 1W0YT 4O58H 4Q9RL 4GOSA 1MUJB 5HDOA 1OPGL 1G0XA 2Q76A 3BPCB 3MNVB 2HRLA 2FZ3B 2DQIL 5D7IF 4HKJA 4J1UB 4H1LG 3FQRB 2GSIB 4NO0A 4OBRA 4R4BB 4X98A 5ANMB 1CVRA 2ZKHH 4OIIL 3LD8C 4M9PA 4PJ9C 3GRWL 1S9VB 2BNRE 2X10A 2OL3B 3OAYH 1E6JL 1X4XA 2HT2D 1FG9C 3SCMA 3AY4C 3AXLB 3SGJC 1CGSL 2VWEC 2XFXA 3HUJF 3QCUL 3S4SA 1NCBH 5L6YH 3NFPB 1OQOA 2C3XA 4JY6A 4UNUA 4HZAA 3BW9A 2VLRB 3ZE2F 2WINA 2Y1VA 3RWIA 1M6OA 4BUGA 5E8PB 4OFKA 4P49A 1RZFH 4PJAA 1PQZA 3JUYA 1I9IL 3BJ91 4XCNB 4KRPD 1Y6MR 2DLTA 2QEJA 4PS4L 4RWHA 1K5NA 2GFBB 3C6SA 3F7VA 2JB5H 3X11B 3T2NL 3QI9B 3BAEL 1H8NA 4TTDD 4X6BA 5SV4A 2R29L 2XQYK 4AIZA 4OTXH 2J6EL 1ZVYA 2E7CA 5ADPL 4H8WH 3LKSB 4O9HH 4Q2ZA 4K3DH 2Z8WC 3NACL 3G5XA 4M02A 2BSSB 4NWTH 5B3JF 1T5WA 5DVNA 3V0WL 5FOBA 2X70B 3O8XB 1FZMA 3GSNB 4HDIB 3TV3H 4P23A 3ULVE 4HD9A 5DJAB 2PYEA 3H7BB 3U6RA 4Q58C 4RFEA 1QG3A 1J12A 2DLIA 5IOPA 5J11B 3EYFB 3P73A 5JOEA 3BN9D 4X6CB 1LO3L 4D9QD 1AGFA 1VHPA 3GHEL 4TSBH 1OTUC 3VXRD 5DZLA 4GRMB 1F5WA 1FVEB 1DR9A 1INEL 1RUML 2MQCA 3W2DH 4CW1B 5C2UB 2P43B 5J3HD 4R0LB 2HTLD 3Q0HA 4MB5A 3V0VB 4N9OB 2Q87A 4IRZL 5JDSB 3EFFB 1CXHA 1H9VA 4TUOA 4J4PC 2K7PA 3HZYA 4A6YH 4OCXH 4JJ5B 4JFQB 1GIGH 5C09B 3D18A 5KJRL 3INUL 2AGJL 4DGYL 5HHOD 4P2RA 1MF2L 1AGCB 1U3YA 1LEIB 5EC1A 5TE4H 1H8OA 2ZCKH 1T7VA 2B5IB 4M8QA 3MROB 1CXLA 1TJGL 1X5KA 5HD8C 4LSQH 2V9RA 2EDYA 1RY7B 3KS0J 4XP9L 1V05A 1GGUA 2D7TL 5C0DB 4GLRH 2EE3A 4IIQC 3ZE1F 4FQHB 1Q9LA 1GGCH 1U6AL 1N5AA 4IRJD 5ID1A 4YXKL 5C6PB 1JWSA 2FEDD 3SKJH 1RFDH 3ARGB 2EEDA 1JV5B 2Z92B 3BSZH 5EOCL 4I9WD 1NCCL 5GGSY 1I9JL 3NCJH 4Q0XH 1REIA 1G6RB 3HMWL 5BRZE 5H94A 1KF9B 3IKCA 4M61B 1AH1A 1H5BA 3FT4B 4R96B 3SDXF 3BGMA 3LHPL 4EDXA 3GRWA 1Z9OA 2JJSA 4U1LA 3QNZB 3HE7B 3LKPA 1IT9H 5IVXF 2DYPD 5DK2B 2FATL 5I1AB 4XPGL 3OZ9L 2FR4A 1DQQA 4HC1L 4IOFC 5DFTA 3TZVB 1BFVL 1I1AD 4QHMA 3HC4H 4PJBA 5DS8A 1XCTB 2R1WB 5CSBA 4DKFH 2DMBA 4TVPD 1HHIB 1IKNC 3V6OC 3MZTA 3HPJB 4J2XA 3HI1B 4MYWB 3MODH 3BDYH 2X4OA 1QLRB 1JI1A 2O5ZH 3RAJH 3LZFL 4I2XA 4FQLH 4HJJH 4KZDL 1Z9LA 5HYJE 2B4CH 1I9EA 1TQCB 3ARBD 1JWMA 2J6EA 2YOCA 4L8SA 1I1FA 5EU7E 3I6LD 4LPCA 4DN3H 4M6OL 4YHMH 1UVQA 3ZSTA 5ADOL 3DUSB 4GFTB 3GK8L 2AJVL 4H20H 4NCC1 4RA0C 2CDFA 3AU1B 2CIIB 4LRNH 5GZNC 2W60B 3ARXA 3VXTB 5C9JA 3HE6A 5AD0B 1XFPA 2R2EA 4HIEA 3X12B 4G9DB 2YPLA 5HYSA 4HH9A 3WL9B 1WIPA 1NGXB 5ETUB 3BZFA 3QHZL 5EA0L 4XPHL 1GGIH 1F42A 2F19L 2MHAB 3QXTA 1T2QH 2MFNA 3QWRD 3V2AR