4EBQH

Fab structure of anti-vaccinia virus d8l antigen mouse igg2a la5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
218
Chain Sequence
QVQLQQSGPELVKPGASVKISCKASGYSFNFYWMHWVKQRPGQGLEWIGMIDPSESESRLNQKFKDKATLTVDRSSSTAHMQLSSPTSEDSAVYYCTRSNYRYDYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIEPRGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, hea
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH02
3CCHA 1RD6A 3FT3A 4O02H 3RVXC 4MQSB 3O3DB 4F9PC 1A7NL 1ACYH 3INUL 2NY2B 1MFEL 5GJSH 3GBNL 1L7IH 2QQLH 4HXAH 3QXUA 5ALBL 4B0MM 4JO3H 4QTHA 3HB3D 1UCBH 1LO2H 1BFVH 2JB6B 4HV8A 3HFMH 5E95B 3QDMA 1JE6A 5DZLA 2RQ8A 1UZ8B 4K3EH 3MUGA 2O5XL 4FTVB 3GSOB 1FQ9C 4YJZL 3ZO0A 1JHTB 4S0SD 1GZPB 4XP5H 4PREA 3IAPA 5DD0H 3IETA 2BC4B 4UNUA 1OAKL 2D4DA 2ZPKH 4F7MB 4JVWA 4ZFFA 1HILA 4RNRB 4LHJB 4TUOB 5D93B 1FN4A 2H26B 2AEPL 5K9JL 3ZKSD 1MVFA 4JJHA 2G9HA 5D96B 5DJCB 1A9BB 5E0QA 2VAJA 1FO0B 2V17L 1E6JH 4ELME 3KYOB 4TULH 4PGBA 3KPRB 5I30H 3W5MA 4D9QE 5GPRA 1K5NA 4BQCA 2R15A 3B3IB 4H26B 5IJKC 4LSPH 5HI3D 4PJAF 4HPYL 1QRND 1N4XL 1V7NL 4PV8A 3MLWL 1PY9A 4ZPTA 5EIVA 1IM3A 1CE1L 2DTML 4H1LA 1YEHL 43CAA 4KZDL 3DSFL 1SMOA 1S9YB 1G7HA 1EGJL 3ALWA 1I1AB 5E56A 3EFDL 3HNSH 3TC9A 1MWAB 1KG0A 4LLUA 4OGXL 2I60L 1I7ZB 3SJVA 1AO7E 2R23B 2H8PB 3SKMB 3IFNH 4QOKB 4KV5E 3AROA 3C8DA 3TBTB 3PHSA 2CR6A 1INDL 4XPGL 5A3IC 3TCLA 1VFMA 1CFNA 3Q3GB 5C0BE 4BM7A 1XF5A 3BWAA 2V5MA 4JZJB 4OCYH 4NQCA 5I1IH 3IDXL 3AXLA 5D70H 4P46D 5KZCD 2V5YA 3NIFF 3CPLA 4LOUD 4R7NB 4QO1A 1B6DA 4OD1H 3H0TA 4X6DF 2IBZX 4JN2A 2ZNXA 3W0WA 1JZ5A 1MCOL 2QADB 5E5MA 1BVLB 1CTNA 1J12A 1MNUL 4HF5L 1TCMA 5KW9L 1F4XL 4PJ9B 4Z76A 2VLRE 1HQ4A 2X42A 3BPNC 2FX9L 3FT4B 1CLYL 3D1MC 1ZE3C 4OCXL 3RIFK 1FZMB 5GSVB 4LKCA 3AMLA 3TWCH 1MCHA 2OTUB 4KZEL 2PCPB 4DTGL 1DLHB 4HIHA 1IFHH 4QGTA 4NWTL 1UB6A 4ODVL 4JG1H 4M4PA 3UP1A 3SQOL 4J4PA 4G8EB 3SDAA 3DETD 3PQYA 4XHQA 2FATL 1UJ3B 3MLPA 2JJTA 4DKDC 2ICWA 2W38A 4UZGA 5FGBC 1KB5L 2VERN 4RDQG 1AXSB 4NHUB 4WDIB 3WHE1 1FGNH 3FQNB 1A7RH 3D48R 3CIQA 5DI8A 4GSDH 1UENA 3TPUB 3VWKC 3B5GA 1X5AA 4CGTA 3VFOA 2VO5A 2B5IB 4MJ2A 4KH2A 5FCUH 4BZ2L 5J6HA 1ZLVK 1UA6H 5EZOH 3LS4L 3TVMB 3BAEL 3WFBH 2NNAA 2ZCLH 2BY3A 1ZHKA 5IVNA 3RHWF 4PG2A 4Y88A 1CXLA 4ZNEE 1TJHL 1SQ2N 2IMNA 3H9HA 3MNZA 1FP5A 1IQDB 1T21A 1UM6L 4JN1L 2PR4L 5CJBA 1G9EA 1TVHB 3QUZC 1KTDA 2YPKB 25C8H 2ESVB 1RAMA 1CLOH 3IXAB 5MENE 2BXYA 2Y5TB 4P2OB 1QOKA 2APWA 3VXOB 1AO7D 4L4VD 4U05A 5CMAA 2E27L 2WP3O 3WYRA 1EDQA 3BQUC 4OFKA 2G2RA 5GRVK 2EXWD 2EDTA 1OVZA 1S7QA 2BNUB 1BJMA 1EHLH 3SKOB 4XAWH 1BGXH 4M48L 2FHBA 5T1DH 2VQUA 3BKYL 1CF8L 5I16B 3VWJC 1ZS8B 5JA8B 5DRZB 1PG7X 1I7UB 1ZANL 1JWMB 5B38G 3GUTB 5D72L 1KCLA 4P2YA 2R69H 3M1BB 2Y4SA 4Z0XB 1CGYA 3CFKA 3LEYL 1N0XL 4NP4H 1FFOA 2AABH 4LCWD 1AD0B 3EYUH 3GGWA 2YA2A 5HYFA 4Z6AT 4ETQA 5TQ0L 3ARUA 4EUPG 4PJAA 5JNYB 2FZ3A 3OAYH 4ZXBA 4LMQI 3MLTB 5IF0A 2QR0A 1A3QA 4P99A 4NWUL 4QYOA 3U6RA 3JV5A 5F97E 4I0PD 2NX5E 1YMME 4HMCA 1BHGA 2NY6B 3VFRA 2GUOA 3H7BA 5GZOD 3T2NH 5BVPL 4NUJB 4PJXE 4OZFB 4JPKH 5SWSE 3RPIA 3SGEI 1H0DB 1O0VA 3W82A 1R5WB 3ECBA 2R1WA 4ELMF 3TA3C 4U1SB 1PVHA 2OR8A 3O4OC 1YY9C 1X5YA 1G9MC 3C60D 3T77B 5C70A 3L3IA 5CGYC 5MEQB 1Z3GH 1FL6B 1MH5B 1U8KB 2Q3ZA 1H3GA 4KDTA 2LAAA 3B8YA 4P5KA 2WUCL 2HFFB 2R1XA 4HUNB 5T33L 4ODSH 4X5XB 5HHVH 5FV1L 3P77A 3PGFH 1A47A 3CUPB 1LO5A 5L7XL 3FOMA 5FOBA 4XNXL 1TZIB 3RVWD 2F5BL 3TZVD 1UQSB 4OLWL 4F9LA 4PRNB 4L1HA 1WAAA 2NCMA 5CJ8A 5IW1A 2EH7H 4MA1B 4NRXA 1OW0C 4KV5F 5IM7A 4NKMA 5J11C 4KK5D 4KGLA 2PO6A 3GI9H 4RZCA 3DUSA 1A0QH 3B4NA 3ARGD 3T0XA 4L3CA 4ZO9A 1LP9A 3BDYH 1WITA 4PUBH 2HAZA 4BFIB 5EZIL 4DEPC 2CRZA 1F11A 3AAZA 1DANU 5K33A 2Z93A 3WHE0 5HVWA 4U1KB 2VAAB 3OKLA 1ZVHA 1P9MC 4NQDA 4ZFOL 1NFDB 4LHQB 3QDAA 2I25N 1KLGA 3D25B 3PABA 4OLYL 3FO0H 4UIMB 4QXUH 1BVKB 3DV6A 2EDDA 3FRUB 1NEZA 1T66C 1WSST 2WWMD 1U8PA 4M5ZL 3V4VH 1JUFA 2D7TH 3TFKD 1U95B 2OSLA 2OK0H 2VDMH 3CH8A 4D9RD 3FZUC 3L3GB 2KDGA 5DJYB 1B4RA 3R1GH 3TNNB 4AEHL 1JMXA 2DIAA 4G6AC 5JR1H 5J56B 3C5JA 4NRYA 3IDJA 2F54E 2VH5H 3GMMA 5FDYA 4M7JL 2Y36L 3TM6A 2VDLH 4NC1C 3S4SA 2VR4A 4ZFZA 2EYSB 4S1RH 4ZD3L 4HKXA 3RTQB 3DRQB 2XN9B 3DMMD 2DM3A 2IPTL 3CFCH 4OT1L 2NX5D 3F7YA 4I18A 4U1NA 4LCCA 1LD9A 3U7YL 2EDQA 1X6NA 4NQEE 3RNQA 5FA3B 4PRPB 4F57L 2OMBA 1XIWC 5JHDB 1N8ZA 4R7DB 1IGTB 5JUEH 4TVPL 3U36B 5IVZA 2NZ9D 3I6KB 4H25A 5DC9B 4K9EC 2RFXA 3WKML 3PWPB 3CSBA 4U1GB 4NCDA 1KJ3H 5AG9A 5T3ZL 3TIDB 1JF1B 3HG1D 4LSDA 1NC4B 5MHSD 3LKQB 3DVNB 4XMPH 1CGXA 1K9TA 4JHBA 4OM1H 1DN0A 5D9SB 1WUNT 2LTQB 3LZFH 2X4PA 2XZCH 3NA9L 1JPSH 2ARWA 2ZG3A 3E6HB 4HJGB 1F97A 3HPLA 2HFEA 1ZT4B 4RRPA 1LMKA 1HYSC 4XXCC 4LSVH 3MV7A 4NJAH 2CRMA 1AD9A 5IG7B 1BBJA 4IIQA 1I3GL 4PRAB 1HQRB 3LKPA 3MCKA 3U4EA 1AR1C 1H9VA 2D4FA 3PDGA 5IMLB 1T7WA 1U93B 5B38B 1ZA3B 3IKKA 3WIFA 1LO4H 4UQ3A 2MQCA 4R8WH 5HYSA 1F6AB 5F7DB 3U2SA 1RMFL 1ITBB 5IB2A 4EIZC 5I1HL 4HS8L 1G9ML 1Z6JT 4W70A 3V7MA 4ZS6C 1B4JL 4MD5B 1I9JL 2ZKHH 1T03L 4EUPB 4Y5YB 3GSXB 3FB8A 2UWEE 4WFED 4MSWB 3EAKA 1L0XA 2HKFL 5DHXB 1YDPA 5EO0B 5AAMA 4N8CL 5DJ8A 4PJBA 1PSKL 3MRIB 4EDXA 1YQVL 3O6MH 4S2SB 4XNZC 4HZLB 1AQDB 2HTLC 4X0KA 3IFPB 3KPSE 4ODHL 4DGVL 2VXVH 4P23D 1M7DA 4JFHD 2A6JA 4PJ7B 5D2NA 3MRNB 1MLCA 5H8DA 3H3BC 5D6DC 3NPSB 3QHTC 5FOJA 3T3PE 1ZA6A 5L2JB 2XY1A 1LK3L 3G6DL 1LK2A 3SDYL 2BSSB 3N9GL 2EICA 2A0LC 5C7XH 5F1OB 4OB5L 2P8PB 3SO3C 1VPOH 4DK6A 4HGWA 3LEXA 4K3JL 3OR6A 3FQUB 1VSCA 3L3JA 1BZ7B 3QUYB 3T4YA 4YGAB 5L0QC 3BKJH 1CGSH 1DBML 1MFCL 4L8SC 5E2UL 5I76A 2VIRA 5IP4A 3P73B 1ZHNB 3MXWL 1ADQH 3Q5OA 3Q1SH 4LCIH 4YAQB 2YC1B 2BVOB 2R0ZH 5IBTL 2VQ1B 2VSDA 3PIQB 5J57B 5BJTB 4FQJL 3U48A 1JGDB 5JDSA 1HSAA 2BNQD 5EC2A 4Y16B 4LPXA 1E6OH 1U3JA 3S5LA 4L5FL 1OAZL 1U58B 3NABH 4Q58C 4ODBD 5CJXA 5AYUH 1N6UA 5D5ME 1P7KB 1YEJL 2X41A 4PJ5B 2F53B 2DKMA 4NBXB 5ID1B 4L8BA 1EAPA 2ZUYA 2Z31A 5JLZA 4M1DL 1WBXB 4R4FH 2ZCKL 2J3SA 5D1ZB 4G6JL 4NDMB 3HLAB 5TDPB 4HXBL 2NXZD 1HZHH 5D1XA 2BNRB 3V5HB 3NFPB 2EIEA 1JHLH 1WC7B 5CHNA 1BJ1J 1FIGL 4Y4HA 3L3HB 3MLRL 5A43C 1GC1H 5ESAA 2WSKA 4I3GA 2VNCA 1IL1B 3ARDC 5DMIL 3V52H 5DD6B 3O45A 5CGMA 5GS0C 3VH8A 3CH1B 1PDKA 4L29A 5EU4B 4O2CB 3OKNA 4ISVA 4QT5A 2DQCH 3WDIA 2XZAH 5E2VL 1RI8A 4GUPB 4N8PA 1ONQB 3WD5L 4K9EL 7CGTA 2OR9H 4OLVH 3RUGF 5C0RL 3IGAB 3I2CH 3T0DA 2GYSA 2AJVH 3LB6C 3LCYA 3RL1B 3WFCL 3TCXA 4JQXA 3AUVA 3L95A 1DUZB 3P40A 5F1NB 3EZJB 5E6ZA 1RIHH 3SDCC 3LMJL 3CSPA 5C09E 5JOPE 1J0HA 5DJ0A 1FZJB 3LS5L 5KBNC 2G75B 1UM4L 2NW3A 1MFBH 3KJ6H 2EEAA 1DANT 1OAXH 3CJJA 4YNYB 4ZNCD 3L3KB 3PWUB 4L3EE 4MA7L 4X7FC 4Z7WE 2LQRA 4F7EA 35C8H 2G60L 2C1PB 4WGWB 4Y4KD 3EOAA 4MVBD 3RZCB 2J8UE 1A6WH 1OGAA 2ATPB 1H5BA 2F58H 1A5FL 4JY5H 3FFDA 1QNZH 5F89A 4NHCH 4J3TA 2IG2H 4I77L 1KPRA 1CIDA 3EO9L 1IEBB 3T8XB 3B83A 3T04D 1N64L 5C8JA 2FGWH 2C4XA 2MQ3A 1U2CA 2YHGA 4M03A 3JUZA 4XMKL 3CFBB 1R3LB 5HI4C 2Q8AL 5E9DD 3K8KA 1DTUA 1AGDB 4TPRL 4PRIE 1FNSL 3C6SA 1FNEB 1KGCD 2OI9C 4NNXA 1N3NA 4PJFE 1G84A 2XTJC 1TFHA 3H7LA 4PJCA 4UV7L 4Z7NE 5H35A 3D87B 3K2UH 1NBZA 4Z7UF 1RK0A 5C08D 4QHNA 4KJWC 3JTTA 2N4IA 3MRGB 4KAQH 4O9HH 4K55A 1T7VA 5TF1H 1KCSH 1FJ1A 4AQOA 4Y19D 3OPZH 3U9PL 4HPOH 1KTLA 1WIUA 4OFVA 4L4TB 1D9KB 3KXFE 1P7HL 1DUYA 4FMFA 2IAMA 3D85D 3QH3B 5EC1A 1Q0XL 3BMWA 3T0EE 3EDDA 3K1DA 3VFSA 2ZSVA 3QNYB 3ALXA 5C0CE 3N85L 4OQTA 4U1MA 3VW3L 4K94C 4HBCL 3RIFF 1TJIL 3PV7A 2DJ4A 4Y0GA 5KSAA 5T5FL 2XNAA 4X83A 3U82B 1TCRB 43C9B 5MP6H 3NCYS 3WFHA 4YWGL 1ZHLB 4MAYD 4KKCD 3RI5K 1JNNL 1TTFA 1D7FA 1LO0L 4LHUG 1OPGH 3RJQB 1X9QA 2H3NA 3MROB 4YFLF 2XKSA 4YHPB 5C09D 3IB4A 3T3PF 2BP3A 3HC0B 2DQGH 2HFGH 5FYKH 4I2XA 4DKFL 3W5NA 1SBSH 1D6EA 1NCBH 1IGCL 4TNVK 2ICWI 1CD1A 2FJGA 4X6BA 3U0WL 3IU4H 4UMGA 5I1EH 4L3ED 2Z8WC 1VEPA 3GSNA 5DA0B 1KEGH 3QULA 3EJZD 4GKSB 1F2QA 4WENB 4HUXB 5DVKA 2DIJA 4P2CG 5GS0L 1FYTB 5EO1A 2XFXB 1KENL 3VGEA 4OCWL 5CZVL 1NL0L 1KNOB 3DWTA 4TQEH 4LSUL 5T1KB 3SQBA 1JL8A 3D9AL 3QQ4B 3WSQH 3P30L 3NFSL 2NY0C 4LPUA 2BOBB 1W0WA 5HHOA 3TH4T 4GXUN 4WO4B 3DGGB 1AHWA 3MGTA 5I18L 4EXPX 1MHEA 5FO8A 4UOW1 3RUGA 4O51B 2DLGA 3ZYJA 5TDNA 1W8OA 3P0VH 4PBWD 3UJIL 1P5UA 3MLYL 4GBXA 2E7LA 2FO4B 5IHZB 2VC2H 5CZKA 1TVBA 2E6PA 1NJ9B 4C56D 5TGBA 3SDXB 2YPVL 1KEML 5KANG 3Q0HA 1KPVB 4J4PC 4K3GA 3SDAC 3MV8A 5D8JH 2H32B 1AXTL 2B20A 5GRXG 2JJTC 3EGSA 5GRYA 3MCG1 1WZ1H 3L5XH 3QEHA 3GSUA 5FA4A 2R2HB 4KKAD 2D7NA 3BEWB 4TSCL 4HUUB 3IRZA 3S8WA 1MFDL 4BYHA 4F3FA 4RGNE 4YHLL 3CMGA 1FH5H 4HWEH 3OZ9L 1JNHA 4LDEB 1MUJA 2APBA 3FAXA 4POUB 3G6JF 2CMRH 4RQQB 5C0FB 1CICB 1A14L 3BPLB 4PG2C 4ZUUB 3BPOB 2M8XA 1L6ZA 1AQKL 2IH1A 1HYRC 5F1KC 1HDMB 5SWZD 3P9LA 2UZYB 1N7ML 3WN5A 1OTTC 3S35H 1I1YB 1KIRB 4GQPH 4XT1C 1HHGA 4JZOB 4IBLT 5IFHL 4FTVE 1KB5B 4GKZB 4YDLB 1S7WB 4JRYB 4Z7WF 4NKIL 15C8H 5DT1L 4P48A 3SBWA 4DGYH 4UILL 4Z7VF 4CNIB 5GGTH 4ZQKA 2M2DA 2J8UF 1IC4H 2EDLA 1NCDL 3AREB 1R3HA 4JKWA 1Z0MA 3UJTL 2P47B 1MCIA 4OSUH 5FDWA 4WNQA 4OGAD 2X4SB 4WUUA 1OOAA 2WNGA 1KT2A 3MUY1 1EEYB 3JTSA 4OF7A 5ESQA 4IEFB 5DQDL 4Z7UA 2XTLA 3RX8A 4GG6A 1X5JA 3KPRE 4NN7C 4PRHA 1ED3B 4XVTH 4EVNB 4URTB 2DWEA 1AGEB 3LQZA 3UZQA 1ACZA 5F7UA 2FB4L 1RUKL 1HHIA 4K94L 4OLEA 3TN0D 4ZG1A 3WHXA 5GGVH 2W0PA 1K4CA 3MRDB 3KYAA 1G1YA 4DJMA 2QQKH 2QHRL 2P7TA 4U1JA 1HSBB 3F62A 5AG8A 3ULVH 1A7QL 2FEDD 4PJFF 5H2BA 5KSBF 4FFVD 4WHDA 3UJJL 4OFIA 4ZXBC 1IKFL 5DUBB 4CN1A 4QOKE 2AEQH 4M6OH 3WEXA 1PZ5B 1NLDL 4N0UA 3ULUH 3HKFA 5K9OB 4EN3D 1NC2A 4MXQC 5TE7L 2BVPB 3CDYA 4HC1H 2ZUXA 3OJMB 3HS0B 5C0GA 2IALB 4ZAKA 4XPTL 2DYPA 2QEJA 4I0KA 5JA9A 4OGZA 1J88A 1T22B 3QQ9C 2KQNA 2HT4D 2Y6SD 3BKCL 3CX5K 3QP3A 3QRGL 1MQKH 1R5IA 1DL7L 2Z35A 1ZV5A 2X4UA 4LF3B 3CXDL 2L7JA 3G6AB 4TTDC 1Q1JL 4LHUB 4GMTH 4KFZC 4G7YH 3FQXA 4MXWL 4XCNA 1ND0A 4KDTC 3IDMA 2IQAB 4F8TA 3P9MB 4FZ8L 2D31B 3BOVA 5DJXA 4M6NH 3WUWA 3U1SL 2J12B 1EEUA 5A16B 1KJ2A 1R5VB 1DSFL 5GRWA 4G6FB 1TETL 4NO3B 2HVKA 3OGOE 1SJHB 3HE6D 5HDOA 3UBXB 4F9LC 4Z77B 3PWNB 3B5TA 4PLOB 1MIMH 3GK8H 4GRWB 4XP1H 4NKDB 4M7LH 4U7SA 1RJYA 4R2GC 2PO6C 3U7AA 5E2TL 3NCMA 1F2XK 2EDHA 4F33A 4LSSH 5IB5B 2HH0H 4A6YH 3S3JA 5FKPB 1LE5B 3NAAH 1NGPH 4IRSA 2AQ3A 1M05A 3C6LA 4LEOB 4F2MA 4XBEH 1C5DB 4OF0A 4ONOA 5JQHC 4Q9RL 2VN4A 5ALCH 5I1GH 3JV4A 3BPNB 3V0VA 5EULV 2EC9T 2BOCA 1A7PH 3L5WB 3OKMA 3LKRA 2XG5A 1CG9A 1BFOB 3BW9A 3I6GA 4I48B 5E8OA 5HTSA 3HUJB 4YHOL 3VXQA 5J1AA 2GSIA 3DSNA 1H8NA 1SJVA 2EZ0D 3DTXA 4QXGH 1MSPA 2ESVE 5F9JB 1S7UB 5I1AB 3MO1B 3G6JA 3IJYB 3RWEA 1BREA 1UKQA 2VDOL 1A7NH 1RIUL 4ZUWA 1RU9L 3T1FA 1MFEH 2V5SA 5FF6A 4LP5A 4ZFOB 1AE6H 5ALBH 1J10A 3G08B 4NO5B 5SX4I 4M1GL 4P3CL 5DJAB 1B2WL 4UT9H 3D39A 5E7BA 3CSGA 3VWKB 3MV9A 4LCCC 3QDJD 4LLQB 5FB8B 5DRWB 5C07A 3L7EB 5DUML 1IBGH 1YY8B 4JO2L 2YPLE 4Z7VA 2XIDA 2FX8L 5IFAL 1GGUA 3HZKB 4PGCA 5D7IA 3SKJL 3U0TA 2GI7A 5KVFH 1D5IL 2E3VA 5CCKL 3EHBD 2Y06L 1EXUA 4H5SB 5JHLL 1J5OL 3QUZB 2BRRH 4WHTB 3V4UH 1WT5A 3CD4A 2FWOB 2CO7B 1RZGA 1NQBA 2RR3A 3X3FH 5TE4L 5EA0H 1CFQA 4S10A 3E6FB 3C9NA 4K8RH 2ATKA 2XWBA 1P7QD 3OX8A 4NQSA 3BQUB 3MLWH 5GGRB 5JOFB 4HDIA 4CDGC 4ZFGH 2Z4QA 4RISL 2ENSA 1CE1H 4FQQA 3BPCA 4KZDH 4AL8L 2DQFB 1YQ2A 3BKML 4LSTH 4IIQC 2XZQL 3VWJB 4EI6B 1EGJH 3DX7A 4NN6C 1FC2D 4KRLB 2EKSA 5KSBA 2AJ3B 4HMEA 2H2SD 2P5WB 4FQLL 3TYGH 1S7VA 2OCFD 4LASH 4QRQA 2NY4D 4LCYA 3BESR 3F5WB 1QEWA 2DLEA 1QA9B 1U8LA 4RMRA 2JKXA 1O5DT 2RCSH 3QFDB 4XPGH 5KVEH 1TJGL 2QSCH 3R8BB 4FNLH 4ELKB 1AGCA 2A73B 1P1ZA 5DYOB 3KDMA 4RIRA 4NNPH 5BCAA 2VZVA 4K71C 2DLFL 4MJ4A 4PTTB 1TQBC 4UOJA 4KRPC 1XF2B 4PG9A 3BX7C 4YHKL 2KQMA 2ESVD 3L5HA 1CZ8L 1OCWH 4OUUA 2MNUA 5D2NC 1D5MB 1PKQB 1LEGA 3MJ9A 4JPVH 1I7RA 4HK0B 4IMKC 1KUMA 4HKJA 1Y0LA 3TA3B 3O4OB 1A4JA 1UH4A 5EU6A 1MCCA 2XYCA 3MYZA 4ZUSA 5HGBA 4JPIA 4PP2A 5ITFB 4K7PL 1NCAL 3KR3L 3CX2A 4DQOL 1NFDE 5DD1H 4NWTH 4I1NB 4PB9L 3LIZL 4YPGA 1MCBA 3EW3B 3T2QA 5TH2B 1NUGA 3PGCB 3C5ZD 2NW2A 3DX8A 4WY7L 4QCIA 3EOTL 5JW4N 3BEVB 4BK4A 1MRCH 5GSRB 5A2JH 1TZGL 3AU1A 5H94A 1X7QB 4ONGL 4UDUA 2ITDB 3DHMA 1S9VB 4XWOD 4LGSB 4H88L 1UVQA 5CIPA 1AFVH 5CD5D 3DIFA 1A6UH 5CJXC 5J11B 1YEKH 4HJJL 5FKAA 3BAEH 4JJ5B 1QPXA 2VSCA 3HE7A 2X9XA 2YKLH 3QWQB 1F3JB 2VDNL 4YDVA 3R4DA 3GBML 4WWKC 1L4IA 1TJHH 2Z31C 5JW5A 3PP3H 4DEPB 1WK0A 2XN9E 3K4ZA 3DO7A 5D7JD 1FDLH 3JV0A 5IEHA 4NZDA 4Y4HC 1CFSB 4PRPE 2COQA 3BP6B 1T7YA 3IKCA 5JHDE 4OF3A 5EU3A 4D0CA 4WI3A 1MQ8A 3WV0A 1S5HB 2J88H 3IU3B 3GZKA 1KBGH 4LQFH 5GRUL 3PWVB 1A8JH 3ESVF 3PWPE 2R2EA 3QUKB 4IS6A 1T89C 2IAND 1A6ZB 5F3BA 4ALAH 5F7EH 1WCQA 3B9KA 4KMQA 3DYPA 3H9SD 3VXMB 2Y07H 3O6FA 4JQXC 1IC5H 2CKBH 5LGJB 1HKFA 1F58H 4MJ6A 4XX1G 2UZXB 4JFDD 5BMFH 3G5XA 4PLKC 4XC1L 1JPFA 1UXSB 2PUQT 3A6OA 5D72H 3DXAB 5HXMA 4M6AA 2XXCB 1RZ8B 4JFQB 1I9IL 1II4E 1OSZA 3NPZB 3BDBA 3LEYH 4ZUVA 4EDWL 4P49A 4AMKH 1QQDB 2HTKC 3QHZL 3BGMB 4TOYL 4LLDA 1EHXA 4XNMA 5BQ7A 1XIWB 4OM0H 3U7WL 3O3AB 4HX1B 5EBWB 5E03A 1BLNB 2Y5EA 3MOBH 3KWWA 4XCFH 3WL9B 5I8OL 1NGZB 3U46A 4OCSH 3L6FA 1R3JA 4JFPB 5L8KB 1H5BC 2DJUA 3S36X 5DRNA 4Q9QH 4EOWH 3SE9L 4XP6L 4KUZH 3LV3B 4F58H 5C9JB 3RI5F 1SEQH 4PTUA 4PJEA 4K23L 1ZT7A 1BOGB 4C58B 2OZ4A 5IBLD 4NQUA 5CP3A 1MCPH 4X7EC 4DKEL 5C3TA 1A6AB 2A9NH 2E7BA 4NJ9H 4M3JA 4PRDA 3AS2A 2GJZB 1FVCA 3EYVA 1FGVH 3QWOB 3CC5A 4KJPC 4XI5C 4DUVA 1P69B 3N06B 2MFNA 2Q86A 1N5AB 3ILQC 3MRMA 4TNVF 2DL9A 3SPVB 1X5FA 4PJ7E 5D71H 2WUCH 1UWEL 3TO2B 5I66B 4FQIL 3O3BB 5KVDL 3QNXB 2X4OB 3DHJA 5HI5C 3RTQD 3F7PC 1D5BB 1SY6A 4YDKH 1V5JA 5L7XH 5DHYB 2F5BH 3CAFA 5GGUA 5TPWH 3JWDH 1XCTA 5KTEL 4XBPA 4Y7MA 2CGRL 3VFNA 5TE6L 5JHDD 4ZSOA 4GAJH 1LDPL 4RAHA 1DEDA 2VWEE 5DK3A 1M71B 5ETUB 4GKOA 5FYKD 2YD8A 5FUZL 2IAMC 3QG7H 4Z78B 1IGJB 3QFJA 1ZAGA 5IJVA 3FB6A 5CSGA 3PWPD 4WFHD 3M17A 4XNZB 1S9WA 1YUHA 1CGUA 4FMKA 3ETBF 1U6AL 3VXPA 3MOQA 1HHKA 4X4ZA 4QY8B 3QEQD 5KSAC 2ADFL 1YJDH 4KI1A 4OLYH 1VGKA 4PJ5E 2F53E 3R06A 2ZOKA 2YR3A 4QRPA 5IHUL 4WJ5A 3FFCB 4LAJH 2IBGA 4P9ML 3FO1A 2D7PA 2XPGB 4HT1L 3WO3B 3SKNA 4ZS7H 1QO3B 1LVEA 2L0DA 3UPRB 4PLJC 3FMGH 4GOSA 3L7FA 3SO3B 4CADB 3HCVB 2BNRE 5E00B 4NBYB 4NNYA 3ROOA 4AEHH 5L0QB 2V7NA 4L8SB 3ZHDA 1FORH 4IMLA 1KELL 4JY6A 1M1SA 4L8DB 4ZO6A 4M7JH 3QB7C 4PJ8D 2WIIB 1NDGB 1NFDF 1DE4B 3F12A 1IC7H 3LKSB 1HCVA 4NM4H 1KXVC 4N90E 1DBKH 1IGML 3GM0A 3RNKA 4DW2L 3VXUD 5BRZD 3BMVA 1DQML 4OT1H 1LNUB 5EB9A 1R0AL 2B1HL 4XCEA 4JFED 1ES0B 3ZL4H 4WI2A 4MLSA 1SVCP 4TVPH 2X1PA 4CVXB 1I1CA 1HHJB 3REVB 5KS9F 1AHWC 1EJOH 3QJHB 1Z2KA 4NC2B 5LAXA 3KLHC 5DFVC 1HH6B 1B90A 3KPMB 5GHWL 2L4OA 4HFWA 3IDGA 4WEUD 3T0BA 3B9AA 3I84A 4NKOA 4G7VL 5FEBA 3ARDB 3B6SB 3J8F7 4N0FA 4GBXC 2E7LC 2P42B 4AG4H 3D3VB 3EO0A 3LQAC 3T09A 4G9DA 1S3KL 5MEPB 1ETZA 5C6TL 3KPOA 5B4MD 1T1ZB 4P2OA 3G5VA 1RZFH 2JTDA 4S0TD 5J6GB 1W0VB 3KLDA 4GS7B 5EDXA 1ZVYA 5D2LA 3MFFA 2LU4A 4QRSA 4CBPA 1GGYA 1K6QL 1NGQH 3CGTA 3KPNB 3EYSH 2VZ1A 4NO0B 4X6EA 3SDCB 4EZMA 5BS0D 2YPLA 3O8XD 1NMBL 2NYYD 3NGBC 2X89D 3UTPE 4OKVB 5JO5B 5GIRB 4GAGH 4XPBL 4IOFD 1ORQA 4J6RH 3VE0A 1RMFH 3NH7H 4HS8H 2X4TB 4UDTB 4UINH 1NCWL 4YXLH 4YBHA 4PGEB 3WFDL 1I9JH 1T03H 4PJ5D 2F53D 5EORH 4MCYA 3WN5C 1K4DA 1RURH 5I1KL 2V7HB 2XQYG 4HLZG 4P46A 2A6DB 3HI6H 3IF1B 3I75A 1YQVH 1FRGL 1EUUA 3BP5B 3SBWC 4Y1AB 1VFBA 3QDGD 2BJMH 4OJFL 1D3CA 5EU5B 4L4TE 3W9DB 2O5ZL 3WNNA 1QVOB 1XGQA 3CVHA 4CN6A 1A1NB 3ULVD 5HHMD 2C26A 3CCHB 3QG6A 4W4NA 3FT3B 4HIEA 3WDJA 5ILTL 1AY1L 4PYHA 3ULUD 1J87A 4K3JH 5E7FA 1OP5H 4OQTL 2QSQA 4QTHB 3BD4A 3DARA 4HV8B 4TUKL 2OI9B 3QDMB 4JGMA 5E2UH 3CLFL 5INCA 2XTJB 4XRCA 3IDYC 1GGBL 4LLMA 3MUGB 3SGEH 2W59A 5IBTH 4OZGF 3RGHA 4PREB 2J6EH 4QGYA 3IETB 5HVFB 3IJHA 1X5GA 5CZXD 2KH2B 4ZFFB 2VR9A 4D0BA 1HILB 1NCUA 1BFSA 1FN4B 2B4CC 2XA8L 5HHXL 1UYWL 3BZ4A 2G9HB 4YBQC 1J1OL 4AH2A 4UTBL 2ZP0T 1IKNA 3WIHA 4PR5A 1UJTA 3QIBA 3QPQD 3ZE2E 4ZAKC 3EIFA 3GSNL 1R3IH 2GJ6D 2EDYA 4PGBB 5CINL 1FYTE 4FA8A 1K5NB 1VEMA 4WRLA 4JR9L 1UKSA 4PV8B 1J0IA 1FIGH 2BY1A 4KQ4L 5M94B 5FHAH 4ZPTB 4GLRH 1IM3B 5FYLL 1B0RA 4H1LB 5DMIH 3CXHK 5TFSH 43CAB 3EFFA 2YD4A 1YEIH 1DLFH 4P9HC 1G7HB 4TNWK 1DQJA 3WFEL 3OKEA 4L4VA 1KG0B 4LLUB 3SJVB 2X1XR 3P2TA 4D0DA 3GIVA 1XCQA 1PW3A 1ZTXH 3MC0A 1HNFA 4YUEL 1X6LA 1EHAA 3WMSA 5LBSH 3GFUA 2VDQL 3OXRA 3SDXE 3TCLB 1CFNB 3ZSSA 2L7UA 5KS9A 1XF5B 4O58L 3HHRB 5C3LD 3BWAB 4HWUA 4XNUH 2R29H 4NQCB 3LQAL 4I3RH 3AXLB 3U0PA 3LS5H 4PS4L 3MBXL 4HKZA 5A40E 1UM4H 1AI1L 4KTEL 3CPLB 3BE1H 3H0TB 1B9ZA 4LCWA 1IJ9A 4JN2B 3W0WB 4LRIA 4IRSC 3C6LC 5E5MB 2NY0B 4KROC 2A1WL 4M6MH 3TV3L 1CD9B 4Z76B 3RAJL 3FHQA 1HQ4B 4ENEC 3B9VA 2P5ED 1KXQE 5DF0A 3T1WA 1BZ9A 4LKCB 1MCSA 4I0PA 3GHBH 3P11H 1WJ3A 3QT2A 4NZUH 2MPAH 1NEZG 3HR5A 1GSMA 5HY9A 4HIHB 5GZND 3UTSA 2VL5A 1WF5A 1NBYA 5I1CH 3RRQA 1B3JA 3RKDC 1AP2A 4UUJA 5CEZL 1BEYH 1G0XA 4EKXA 1UB6B 1CLZH 1TQCC 4X5LA 4XMKH 3SDAB 4JRYE 3PQYB 4GT7A 4G43A 3NACL 1HKLL 4MD0A 3O0RL 5DHVA 2ICWB 2HMIC 2Q8AH 1NAKL 3B5HA 2AP2A 4BFEA 3VXTA 4FQ2H 4LIQL 1RUAH 4XNQA 4TPRH 3K7UA 3RA7L 5CP7A 5DI8B 4XVSH 3VFOB 4JM2D 4HS3A 1HQRA 1TNNA 4K8RD 1INQA 3FQWA 5J6HB 2VXTL 3GJFH 3RWGA 2NNAB 1J18A 1FAIL 5FHBH 1L9MA 3OAZK 5ENWA 5I15L 3QYCA 3H9HB 3MNZB 1QR1A 3TZVA 3OHXA 1T21B 1CVSC 1PEWA 2ZJSL 2PYFA 2J4WL 3KHOA 4XXDA 1L0YA 2X4QA 3LY6A 2BVQA 1KTDB 3DLQR 3FCTA 5I8EA 4UT7L 2R39A 1WT5C 4KPHL 3ARGA 3ZDXF 4O2FA 4GMSH 1H3PH 3ZE1E 1Q9KA 4L9DA 3VW3H 1TITA 4NGHL 1MIEL 4Z8FL 3QIUD 1G6RH 1EFQA 5CMAB 4NM8H 5AWNL 4W4OA 2WMPA 2KL6A 2G2RB 2WBKA 1X5IA 2VDKL 1ZMYA 4QRUA 1S7QB 5KSVA 2B4CL 1L6XA 2AJUL 1LO0H 4OZGA 2BHUA 5FYJL 1U3HD 4DWHA 3KGRA 2B1AL 32C2A 4NN7B 1YEGL 3GMLA 4XPHH 3PWJA 1F3DJ 5MERA 4U1HA 5JQ6H 4Y4FD 1CR9H 5D6CA 3WLWD 4ERSH 1CI5A 3CFKB 1CFBA 5HGHA 3RBSA 4YBLC 3RVVC 1FFOB 3VFMA 5KVGH 1MRFL 3ZKMC 3GGWB 2WQ8A 4GKNA 1DBAL 1ZLSL 4DVRL 4ETQB 1MREL 4JRXA 4LVOC 4PJAB 2FZ3B 1KJVA 3VI3E 4NQVA 1DQDH 5FUCC 4P9HL 3BRDA 1J8HD 3DMMA 4ZXBB 4OCWH 5CZVH 1IZJA 3NOIA 1RK1A 5IF0B 1YYMH 2QR0B 4OLXH 4U2YA 4HIXL 4QYOB 3U6RB 1U92A 3DRTA 1A64A 1FYHB 1YNTA 3SY0A 3NFSH 3VFRB 1KJ2L 1QFWH 2GUOB 1UC6A 1VENA 3H7BB 3PWLA 4GRWE 4JRYD 2AQ1A 5MEOA 4HHAA 3RPIB 3VXRD 4N5UA 4AEIL 3ECBB 2B0SH 2R1WB 3ZE2F 2IEPA 1MHPH 4LRNL 2ZG1A 3MRHA 1KC5H 2IPUK 5EBLA 3JUYA 4B7IA 3F6IA 3HG1A 3OKDB 1XMWA 3L3IB 1BECA 1U42A 1KEMH 3X13A 4P5KB 3B2UD 4WI4A 5GS1A 4JKPL 4M00A 2R1XB 1PG7W 5FGRA 3MMEA 4FG6D 4U6XA 3QZWA 5HGGS 3AMKA 3M07A 4G9FD 4HWBH 3P77B 1LO5B 7FABH 1S78D 3DVIA 3HUJE 1NANI 4N8VG 3FOMB 1QLEL 5FOBB 4QHUA 4BFGA 5J12C 1Q94A 2EXYD 4ODTH 5IW1B 3VD7A 4NRXB 1QSZA 2FH8A 3L1OH 5IM7B 4NKMB 3OZ9H 4PY8J 4R2GB 2PO6B 4RZCB 4YR6A 4Q97A 2YUVA 3DUSB 3HE7C 3L9RA 1A14H 4MX7A 4L3CB 5EUKA 2MKLC 2EDJA 1LP9B 2YD6A 4FS0A 2GSGA 4Z5RA 1BD2D 1F11B 3AAZB 1UEMA 4X9IA 2Z93B 1Y18A 1N7MH 1KCKA 3OKLB 4NQDB 4H8WC 3S37X 2VB5A 4N5EC 1MCNA 1K8DA 1KLGB 5IFHH 3PABB 3KVQA 5C0DA 4CU8A 3C5SA 5DT1H 4BKLA 3DV6B 4UILH 1QUNA 3CLEH 1BQLH 1NEZB 4XWGL 2AK4D 5K59E 1U8PB 2OSLB 3DGCR 4P23A 5GGSA 4DGIL 4LHUD 1Q9WA 4JDTL 1ZGLM 3B9KC 3C5JB 4NRYB 4YPJA 5DQDH 3IDJB 2OJZL 4S1SL 3QJFA 3U9UA 2IGFL 5EOQL 3GMMB 4HK3N 3UC0L 3O6FC 2R0WH 4MNHA 3S4SB 3CDGA 1MF2L 3BJ91 4ZFZB 2MCG1 4HKXB 5HDQL 4K94H 1I3UA 1Y6KR 3UTOA 4I18B 3F7YB 3A6CL 4U1NB 4LCCB 1LD9B 1YZZA 8FABA 3BIAX 3RNQB 4TVPE 3VRIA 2EECA 3PHQA 4KGJA 3VDAA 1N8ZB 4X4MA 2BMKA 2XXMB 2C1OA 5HYEA 5E8EA 4KK6D 4TVSa 2P5WE 2BNQA 2Q7NA 3UJJH 5T3ZE 5IVZB 4H25B 1IKFH 2RFXB 5IR1A 5FAAA 5ICZA 1GJIA 5C86A 3LPGA 1GGTA 4HSQA 5E2JA 1HXYA 3MGOA 1TVDA 4XPTH 2YWYA 1T3FA 3AM8C 1ZK9A 3GIZL 1DN0B 3BN3B 2X4PB 2GT9A 5DC4B 5CJOH 3TLRA 3J7HA 3D0VA 3RWDA 3DUUA 3ZE1F 3I9GL 3HPLB 2HFEB 3NMEA 4EEEA 3MV7B 4QRTA 4JHZA 4HWNA 4O4YL 1NMAL 1BBJB 4IIQB 1ZHLA 2HKHL 2J1KA 4NN6B 4QRRD 3LKPB 3MCKB 3U4EB 1PKQE 5J06A 3PXHA 4FZ8H 1NAMA 4S1DD 3QEUA 1M7IA 1BIIA 4TSBH 2PXYD 3WIFB 4G6MH 5AZ2H 4Q6YA 4UQ3B 3OSKA 4GW1A 4PFEA 3ZZ1A 3AS0A 1JK8A 3UTTD 1W72H 3MJ9L 5HYSB 2BHYA 3U2SB 1PJ9A 4P5TD 5GISL 5IB2B 1EMTL 2VXUH 4FXKA 1A6TA 3OR7B 3RDTD 4FFYL 1GOFA 3FB8B 4K71B 4HULB 4KKBD 2EKJA 5E2TH 2AS5M 4NO2A 1TQBB 1YDPB 2APXA 1A1MA 3NCJH 3U83A 4M9OA 5DJ8B 4PJBB 5MI0C 5CBEA 4EDXB 3UAJD 4RX4D 2FYYA 3VI3F 3TJEL 1UXWA 3QUZD 4KHXH 4Q9RH 4X0KB 1M7DB 2A6JB 5D2NB 4UIKH 1MLCB 1GGIL 4LMQE 4Y4KA 2APFA 1ZA6B 1FLRH 5F6HI 2HJFA 3TT3L 3X3GL 5J7CC 5DD3L 2HVJA 1NLBH 1YEEH 1LK2B 3TP4A 3FN0L 1RIVL 4F80A 4HK3J 3V79C 4HGWB 3LEXB 4KJQC 3OR6B 5F8QC 3L3JB 3CU7A 3T4YB 1IAKA 4TVPD 2ZUTA 2HT2D 3LAFA 1E4XH 2VIRB 4H8WL 5I76B 4OF8A 5CSZA 1RIUH 4HLZH 2H1PH 5E9DA 2AJXL 1FZKA 2APTA 3PHOA 1YN7A 4QWWD 2RIKA 2YK1H 3WO4C 1F4WL 2B39A 1HSAB 5EC2B 5JDSB 1B2WH 5EN2A 2JELL 1F8TL 3HB3C 2N1KA 3S5LB 1WISA 2Q87A 5KOMC 2Q8BL 2APVA 3VXME 3ZKND 5F9OL 2WW8A 1BJ8A 4KY1L 4NC1E 4L8BB 1EAPB 3RPKA 2ARJA 3KPPA 2Z31B 1MJJA 5IFAH 2NY7L 2DDQL 5D7KE 5JLZB 5C08A 3SOBL 3LKNA 3DXAE 3SKJH 4KK9D 2VQTA 4Y19A 4HAFA 4XC3H 5D1XB 1J5OH 4KHTL 1T0NA 5CHNB 5IUSA 4N9GA 4Y4HB 5IWLA 5ESAB 1IGFL 3D85A 4YZFE 3WFZA 1C8PA 5TE4H 4X7CC 4TSAL 3F8UB 3O45B 3QAZC 5HDBE 2W0FA 3VH8B 5L6YH 1A6VH 4L29B 4M5YH 3ABZA 3OKNB 4MMXC 1EVUA 2OTWA 3DECA 4ISVB 4QT5B 5HI3C 4GQ9H 2DL2A 4LGPB 3IDNA 4DFIA 4MAYA 1ZLUH 2PYEA 1DQQA 2F5AL 4AL8H 3LHPL 4FHBD 4FXGA 2HLFD 4H20H 5E6ID 4NPYA 2X4SA 1DQLH 2NPLX 3L95B 2AV1A 1MY5A 1MY7A 1I9RH 5DJ0B 3H8NA 2OZ4L 2NW3B 2MHAA 4MXVE 3SGKA 5B39A 3UPAA 4KTDL 3CSYA 4Q6IA 1A2YA 3CZFA 3V95A 1D5ZA 4XPAH 4F7EB 3LDBC 1MI5D 4Z0BL 3ELAT 1RZKC 3EOAB 4LKXA 1LO3L 3SN6N 1J8KA 5DRXA 1OGAB 4P46C 3T08A 1H5BB 4R97C 1F90L 5HVGB 4DUWA 5J9PA 4LOUC 4Z7QE 1XEDA 3FFDB 5F89B 1EERB 5E2WL 1SY6L 2Z9TA 3MLUL 3BDXA 3O6KL 1KPRB 1KFAH 4I9WD 3ZE0E 3RVTD 5C8JB 1OSPL 2DQHH 4DN3L 4TNWF 2HWZL 2W60B 3HZYA 1B6UA 3O6LH 3TH2T 3HI1A 5K93A 1QSFD 5KG9A 1N5YH 5AD0A 5F1IA 3C6SB 4C56A 2YUXA 1EIBA 4NNXB 4CMMA 3W2DH 1KIQA 1N3NB 4WY7H 4YHZH 3FFCE 5SWQA 4AIOA 3DETC 4PJCB 3VXSD 2V6HA 1MRDL 1JWSA 5JORA 4JDZA 1ZVSA 1HK6A 5H35B 1NBZB 1RK0B 1TZGH 5HHQA 4JAMA 4QHNB 1ZWIA 3JTTB 4PD4K 5ISZD 4H88H 1FJ1B 5LQBH 2AI0L 4P5MA 3EBAA 1KTLB 3S36H 4NO3A 5DJ2A 4NCC2 5E08L 1DUYB 1MJUL 1OAQH 1JFQL 2OP4L 2IAMB 5EC1B 2BERA 3HNVL 1X4XA 3DI2B 5JIKA 1IKNC 1JVKA 5ACZA 3QIBC 3VFSB 2ZSVB 1HCFX 3PJSA 4U1MB 1NBVH 2FL5A 2JF1A 5SWZA 4Y5VA 3ZKXC 3QR2A 2BHZA 1U8NA 5KAQF 5KSAB 5L88L 5I75C 1TLKA 2XNAB 4BZ1L 2UZIH 3B2VH 3WFHB 4MZ2A 1LGVA 3JSSA 2X10A 4YEFA 4ODUA 5DDHA 1XF4A 2H3NB 1JF6A 1SHMA 2CK0H 4MDJA 3THML 4OGYL 4P2RA 4I2XB 1WVZA 1G7LA 1D6EB 3ZTJG 3S34H 1CD1B 4FQHA 2EXWC 2FJGB 4X6BB 1KB9K 5EOTB 4ZUTA 2DS4A 2QQQA 4ODWA 3GSNB 2PTUA 5IB4A 1Z9MA 3BXNA 2GITA 3QULB 3MLVH 3D18A 3D3VE 5DWUH 4P4KD 5A2IH 3VDBA 1U8QA 5DO2D 1W8NA 4K07A 3DVGA 1C5BL 1I9IH 5EO1B 2JJUA 2NQCA 1A1OA 1RZIA 3E8UL 2FRGP 3Q2CA 3V0WH 4LRIC 3E1F1 1EZVY 3MJ8A 1W0WB 2F74A 4J3WA 5HHOB 5ICXA 4G8GD 1AHWB 3MGTB 5I8OH 1MHEB 5FO8B 5F9WC 5SX4H 3RUGB 1A4KA 4JY4A 4I0PC 4CN4A 1JGLL 3QEGL 5E99L 3JBG7 4JFFA 5TDNB 5I6XC 2V2TA 5IBUG 4EN3A 4GBXB 2NXYD 1TVBB 5I1LA 2I07A 2DD8L 5TGBB 3FFCD 5GZOC 4X7SH 5D7LD 4AQ1B 4GW5A 4YZFF 3MV8B 1RZKL 4E41D 4Y1AE 3EGSB 3QCTL 1NGYA 3QEHB 3GSUB 5FA4B 2R8SH 3D5OF 1HINL 4XP9L 3MXVL 4MD4A 1PKOA 1XGPA 4PGJA 2VABA 2R0LH 4F3FB 1GCFA 2AJYH 3TIEA 1V3JA 5T3XL 1JNHB 3O3UN 5C0IA 1FZOA 1MUJB 3NGBB 3CVHL 5DVNA 3O2DH 4F7CA 1BFTA 2IH1B 1V3KA 3QCUH 5TQ2H 4BSWA 1RQ5A 4J1UA 3P9LB 1QG3A 3RVWC 3TZVC 3HE6A 1JZ6A 2WBJD 5EOCL 3PNWA 3QDME 4OD3L 4WFGE 3WN5B 3BIKA 4JZNA 2XTJE 2DQIL 5FECA 4CW1A 1RUPL 4KK5C 4X9GA 2P4AB 3LEVL 4JDVA 3ARGC 3HC3H 2IADA 4W6WB 1RHHA 1CBVL 1ZEAL 1KACB 4ZQKB 3NIGE 1R3HB 4W4OC 3PG2A 5FDWB 4WNQB 1F13A 5IHUH 4WUUB 3D3VD 1KT2B 3WIIH 4G5ZL 3JTSB 5ESQB 5F6HJ 4Z7UB 2YOCA 4GG6B 1G7PA 1N0LA 4JRWA 3ZE0F 1JPTL 4UNTA 4PRHB 6CGTA 1GYAA 3OG4B 3WIHL 4HW6A 3TFKC 2DWEB 1OGTA 1JBJA 3LQZB 2ITCA 1N6QL 3IJSA 3U79A 1HHIB 1CDJA 4KQ3L 3WHXB 4C55A 1K4CB 3IDYB 2MJWA 3CDFA 4NO0D 2Y7QA 2P7TB 1JYNA 3RGVD 1MAML 2YUZA 4U1JB 1BQHG 1QSED 4X80H 5D1QA 3SJVE 5H2BB 5BZDA 4OFYA 3DMMC 1K85A 3WEXB 3D0LA 4N0UB 1YYLH 2B1HH 4IRZL 3QDJA 5IGXH 5F96L 1NC2B 4NFDA 4HWZA 5C0GB 4K3DL 1AC6A 4ZAKB 4WIQA 2DYPB 4OZHF 2Q76A 4NQCE 5JXED 4GXUM 4NZRL 3S3SA 2IJ0C 1R5IB 2Z35B 2Z91A 2X4UB 3W0WE 3I3EA 4I3SL 4ZPVA 3MRLA 4BH8A 2E9BA 3FQXB 1HEZA 4XCNB 2VLKD 5C6TH 2XWJA 1ND0B 3S98A 2VISA 3IDMB 5GS1C 3CK0L 1UKTA 1P7QA 5C0JA 1AJ7H 4KUCD 1OWWA 5DJXB 3WUWB 2WANA 1KJ2B 3ZT6A 1K6QH 4M43L 5C1MB 3TBVA 2P45B 2HVKB 2OL3H 4WUKL 4FABL 3HMWL 1G0DA 2X9YA 4MMZC 1OAUL 2LAGB 1RJYB 2ARJQ 2FEEL 2BVEA 5JPMA 3S96A 4EJ1C 1KF9B 2R1YA 5HYJA 3KS0H 4F33B 2C9AA 4FQ1L 3JWOH 1V05A 1A3RH 2VDPL 4IRSB 2GK2A 3C6LB 1M05B 3WFDH 1QBML 2EYTA 4F2MB 3BZEA 1Z5LA 3BGMA 5I1KH 1EFXD 5EO9A 3JV4B 1I85A 4JE4B 3V0VB 3QA3A 2BOCB 1AGBA 3OKMB 3LKRB 4XTRD 4JQIL 5F70A 1CG9B 4PGDA 3BW9B 4J3OC 1FG2A 2HP4A 1UH2A 3I6GB 5IBUB 5LJYH 5E8OB 3CVIH 4YH6A 5KN5A 1ADQA 3VXQB 1FBIL 5J1AB 2GSIB 4J2XA 3ZT5A 3DTXB 3QUXD 4P23C 4MNQD 1BIHA 3G6JB 1TQCB 4JO1H 2NR6D 1Q0YL 3RWEB 2RAMA 3W9EA 3GO1H 3HRPA 1QFHA 4MDIA 5ESVA 4ZUWB 2CDEA 1ZLWH 5DUPH 3T1FB 1NSNL 4Z95L 1KULA 5FF6B 1MFNA 3VXNA 1PX4A 3QO1A 4LAQL 1Z9SA 4D94A 5C9KA 4YHIA 1LE9A 1FPTH 2EEDA 1KN2L 2CIKA 3D39B 3MREA 5E5RB 3MV9B 2DM2A 3C5ZA 1GGBH 5C07B 4LVNC 3SE8H 1CXKA 1UFUA 3EOBA 1QBLL 3P0YL 2N7AA 4Z7VB 3TO4D 1WIPA 1J1XH 4X7DC 5DEGB 4WVRA 5E8DH 2UYLA 4PGCB 5D7IB 4JQVA 3V6OC 3U0TB 1HOCA 2ID5A 3OKKA 1EXUB 4KVCH 2BSED 1GIGH 5I1JL 1IQWL 3HI5H 5F88A 3V6BR 2IPKA 1J1OH 3X11A 2X2YA 1RZGB 3GI8L 1CFQB 4PJAE 2FJFA 1Q9LA 2R4RH 3C9NB 2ATKB 4AEEA 4F7PA 2XWBB 4BUGA 2O5YL 1HH9A 4JR9H 2NXZC 4XCCH 3OX8B 4NQSB 5D7JA 2ADJA 4HDIB 5B3NA 1MPAH 1SM3L 2Z4QB 4F15C 1QFUH 2Q3AA 4MJID 4FQQB 3BPCB 1FL3A 3ARFD 3NIGF 4LSRL 4ONFL 4JGUA 3DX7B 3PQYD 2EKSB 5KSBB 3FO2A 2ADIA 2V2WA 3GMPA 4UB0H 1FL5A 1REIA 3RY5A 4XHJD 3VFGL 1S7VB 1T2QH 2IANA 3M45A 1VESA 4LEXH 4QRQB 2XA3A 4LCYB 4YUEH 1QEWB 4YBLB 1U8LB 4ONHA 4Q9BA 1BQSA 3H3PL 3H9SA 4LL9A 1XR9A 3MOAL 4OZHA 4OLZL 3H42L 1XGYL 4O58H 1AGCB 5SX5K 4JFDA 4HIIA 1P1ZB 3NTCH 1MELA 3KDMB 4RIRB 5GRJL 4MHHG 1K3IA 4MA8H 4P3DA 4H0IA 3B43A 1P84K 3K2MC 1F3RB 2VXSL 4PG9B 2YMXL 4PB0H 3CX5J 2DQEL 3EJJX 1K2DA 1WAAE 4WWID 3QRFM 3Q6FA 4OUUB 5HYIA 4Y4KC 1LEGB 1Q38A 4MVBC 1WZLA 2B2XH 4Z9KB 4C54A 1LP9E 1I7RB 4NQXA 4HKJB 1Y0LB 1A4JB 3VGHA 5EU6B 4ZUSB 5HGBB 4JPIB 4PP2B 4NQDE 4IOIA 1QFPA 3WXWL 1FLTX 1VERA 1RFDH 4U7KA 4YPGB 1YNKH 1CTOA 4LPWA 1IAOA 2DQJH 1KN4H 3NACH 2NW2B 1Q72L 3DX8B 3VA2C 4EQ3A 1HKLH 4QCIB 4NYLA 2NY5H 3L3OA 2YD5A 3QUMB 2BK8A 4HUVA 3AU1B 5H94B 4G8IA 3RA7H 5J12B 4UDUB 5CIPB 1UVQB 5JW3H 4IHOA 5IVOA 3DIFB 4OI8A 4FZEH 4FQCL 1EBPA 5FKAB 2VZUA 1IGYA 3HE7B 4WCYL 3ULVF 2X70A 4YDVB 2XOTA 1SYVA 3VI4F 3QXAA 1FNHA 5I15H 3BVNA 5DGQA 4RFOH 5JW5B 3SCMD 4P59H 4U1LA 1H3XA 3HTLX 3O81A 3RWJA 3DO7B 1FFNA 1GHFL 5IEHB 4UT7H 2XZZA 4KI5F 5IWLC 4EBQH 5EWIL 5BOZG 5EU3B 4D0CB 1MIEH 2DKUA 1FAKT 3L5JA 4GAYA 1JZ4A 1OTSD 2FNBA 5GRZA 5CLWA 5BV7H 1S7RA 2R2EB 1IEAA 2ED7A 3QEQA 4IS6B 1VGEH 2YD7A 4UQ2A 1RVFL 3QCVL 1FE8L 5F3BB 3X14A 2B4CH 4MAYC 3B9KB 4KKCC 5F44A 5FM8A 3DV4A 3O6FB 4IOSD 4MJ6B 5DURD 1MOEA 3G5XB 3C2AH 1F5WA 1JPFB 5GJTL 1L0QA 1OT2A 4HQQL 5LCVL 4OLUH 1OSZB 4ZUVB 3MV7E 1JGEA 2I24N 3UTQB 3SGKC 4UT6H 5F1SA 4DN4H 1OTUD 5I2IA 3D2UD 3V8OA 3S37H 4LLDB 4XNMB 4Q6IC 5JMRA 5BQ7B 4PJ8A 3EJZC 1YNLH 3TH3T 5HDLA 4WFFD 1ZLVH 2W9DH 3FQRA 3MODL 1K8IA 5L8LB 3UBXI 2WAHA 3VXUA 3KWWB 5BRZA 2I9LA 1GAFL 3U46B 3L6FB 1R3JB 1NAML 4ORGA 3ZTJH 3GRWH 4BA8A 1A9EA 5DRNB 3V4PL 1DBJH 2JJVA 4JFEA 2EDXA 4PTUB 4PJEB 1YECL 1BX2A 1ZT7B 2VE6A 3HNTL 4AEIH 2VLME 4JVPA 2VZTA 4PJBE 3CFDA 4OZFG 4PRDB 2FX7L 1FVCB 3EYVB 1KCVL 1JV5A 3CC5B 4RGOH 2UVEA 4K2UH 2DBJA 3MRQA 2Q86B 2R56L 3MRMB 1DBBL 2AK1H 1I8KA 5D2NE 5FCSH 4Y2DD 4JKPH 5HD8D 1OAYH 1QBBA 2YA1A 4O02L 1RUQL 4R3SA 4A2MA 3MRPA 1EZVX 4I5BA 1ACYL 4OKDA 4QHLA 5C0ND 5GJSL 1J05A 4BQ9A 1L7IL 2QQLL 4HXAL 5E94A 4R96A 4D8PA 4P2QD 5FO9A 2VLJD 2CDFA 4JO3L 3TNMA 1UCBL 5GGUB 1BFVL 3HFML 3I3DA 4KKAC 1DJSA 1TDQA 1JPGA 5DFWH 1RULL 1XCTB 3BHBA 4XBPB 4PJHA 5GGTA 3VFNB 5BS0A 4ZSOB 5T1LD 3O8XA 2UY7A 1CU4L 1SVZA 2X89A 1N26A 1U91A 3QFJB 4X6CF 1L9NA 5T1MA 5IJVB 3FB6B 1EEQA 3M17B 4Y5VC 1S9WB 1YUHB 2NLJA 1S9KC 3VXPB 4OCLC 1HHKB 1UACH 1VGKB 3R06B 2ZOKB 4YXHH 1MVUA 4FFWD 4QRPB 1G9NH 4JM2F 4TULL 2EH8H 4WJ5B 1WAAF 5ERWA 3FO1B 5I30L 3SKNB 1QHOA 1XZ0A 4XWGH 1XH3A 4LSPL 3L7FB 3QDGA 4R90H 1WTLA 3MV7D 1LP9F 3HA0A 4NNYB 2CK2A 3ROOB 2JE8A 5CD3A 4JDTH 2V7NB 4OGAC 3QPXH 1WZMA 4IMLB 4JY6B 3UC0H 3UO1H 4X99A 5JIPA 3HNSL 3F12B 1GL4B 4F37K 3WO4B 3RNKB 4YGVA 3O11A 4ACPA 4RCAA 4HC1A 2QKIA 3GSWA 4L4JA 3PV6A 1GRWA 1OARL 4PY7A 2CJUL 4DK3A 1YEFH 4BQ8A 1UM5H 4XCEB 4OCYL 2IQ9H 1PFCA 5I1IL 5D70L 1DN2A 5CEXA 2FEDC 4R26L 4D9QD 3HPJA 4KDWA 4POZD 1L7TH 1JYWA 5LAXB 4L8CA 4OD1L 3ILPA 4HFWB 3IDGB 3VFVA 5J1TC 4EN3C 4NKOB 3NIDE 4N0FB 2MSPA 2QQNH 3GIZH 5IOPA 3QAZB 3EO0B 2GJ6A 2AGJH 4G9DB 1VKXA 1M6OA 1EO8H 1ETZB 3KPOB 1MCDA 3G5VB 1OGAE 2IF7A 3FN3A 1T83A 2HT4C 2Y6SC 1QRNB 5DZNA 2V5TA 2DQUL 5D2LB 2I5YL 3MFFB 4QRSB 2OM5A 2H6PA 5ADPH 3BYTA 2EC8A 4RSVA 1FV1B 2HKHH 4PYGA 1C16A 4W68A 1H8OA 5C0BD 1EK3A 2XQBL 4NT6A 4X6EB 3ORJA 4A6YA 2YPLB 3FO9A 1QSVA 1FGNL 1MFAH 2HFTA 1ORQB 1A7RL 3VE0B 3I50H 3VFPA 2GFBA 3LSOA 3GKWL 1KCRH 1U0QA 3ALPA 4GSDL 5FYKU 3GJEA 2C7UA 3HE6C 5FCUL 3LDBB 4MCYB 1UA6L 5EZOL 3GMNA 1HE7A 1K4DB 4RBPK 5H37G 2EE3A 3WFBL 3OAUH 1HI6A 2ZCLL 1TZHA 2VLRD 4PJCE 2DLTA 4P46B 1UWGH 5DQJA 1DFBH 5KZCB 2HRPH 4R97B 3I75B 3RWIA 5D1XD 3TJEH 1VFBB 4LDLB 4WI6A 4Q2ZA 1WBYA 25C8L 4D3CH 1CLOL 3TGXA 2D03H 4CU6A 5KJRL 2Q20A 1XGQB 3CVHB 5CIPH 1A3LH 4HS6A 3X3GH 2P5EA 5DD3H 5I73C 3QG6B 2FIKA 5ID0A 1FFPA 1I7TA 4HIEB 4KMTH 1RIVH 1I8IA 4N0CD 1TNMA 2VOTA 1IAIH 3T65A 2EZ0C 4PJBF 1OL0A 3OKDA 5IVXF 1EHLL 4XAWL 1IM9A 4H8WH 4DZBA 3EJYD 4PRBA 5INCB 4XRCB 4X6CA 1G7QA 2WQRA 3CU1A 4LLMB 3ARWA 1XGRA 5DD5H 5BXFA 5D1QC 4OD2A 3B9EA 3IJHB 4I2XE 3N1PC 4D0BB 4NP4L 4G8FA 2BFVH 2AABL 2Q8BH 2D0GA 3EYUL 4JM2A 4NZJA 2LVCA 3BZ4B 1U8MA 4AH2B 4NBZB 5MEND 4PR5B 3QIBB 2DDQH 3SOBH 1MEXH 1ZOXA 3EZ8A 3ZKXB 4YE4H 1QP1A 2BY2A 5LXGH 1HWGB 5FYLE 2DLIA 4XVUD 3EHBC 4KHTH 5I75B 5IEKA 3VFWA 1MCRA 2C3HA 2YWZA 1B0RB 3VJ6A 3EFFB 2FLBT 3T2NL 1T6WA 3P0GB 5HHOE 3L3DA 1I8MA 1J0ZA 3A6BH 1DQJB 3OKEB 4GW4A 3QIUA 4L4VB 3BN9D 3RUGE 4D0DB 4JB9L 4EI5D 3QZWG 1T0MA 3GIVB 2C3XA 1XCQB 1CT8A 2IFFL 2ORBH 3GM8A 5I71C 1Z3GL 3FB5A 2IH3A 1U3HA 4JM4L 1QFOA 3OXRB 5KS9B 2WWKT 3MUJA 5F7NC 3Q6GH 4ZMAT 5LVEA 4ODSL 5L9DH 1CDBA 1S8DA 1C5CL 5EUOF 1VA9A 2H2SC 1FO0H 3MV8E 3A67H 1VADA 3U0PB 4Y4FA 1U8JA 1F45A 2OZ4H 2YXMA 4HKZB 4GJTB 1EPFA 1CDGA 2NY4C 4KC3B 1IE5A 1YMMD 4LCWB 2EH7L 1PLGH 4LQ1A 2JB5H 2NY3D 3GI9L 3TT1L 2IAMD 4N1HB 3UROR 1I85C 4FP8H 1J8HA 1I1RA 3VGBA 2VYRE 1C7SA 5F9WB 5SWSD 3BDYL 1F90H 1BZ9B 4JKMA 1T80A 4I0PB 5I6XB 1MWAH 4WTZA 5IQ7H 3HR5B 4RAVA 5CEZE 5HY9B 3MLSL 3UTSB 2VL5B 2I9TA 1NBYB 2LV4A 3VCLA 1AP2B 4UUJB 4NKQB 5C0AA 3FO0L 3DROA 4JCLA 4QXUL 3VXRA 1RHFA 4XP4H 1X44A 2AJZA 3NIDF 4G43B 4LIQE 3NBNA 4MD0B 3V4VL 5DHVB 2D7TL 4XPFH 2JIXD 4E9LA 1RUMH 2VDML 5EU7C 3VXTB 4RMTA 1KCUH 2ZCHH 3ZYZA 4XNQB 3R1GL 4C4KT 5JR1L 1J1PH 5CP7B 1IZKA 3L5IA 2VH5L 4WUUE 3REWA 3GNMH 4HS3B 1INQB 3C5ZC 3FQWB 2VDLL 4Z7UE 1MRDH 4OIIL 3RWGB 4GG6E 4G9FA 4S1RL 2DWDA 4PRHE 1LWRA 3CMOH 5ENWB 3TBSA 4MNGA 4CJ1A 2PNDA 1GC1C 3CFCL 4JQVC 4POYA 1QR1B 3TZVB 3OHXB 2AI0H 3DX6A 2PYFB 4XWOC 4XXDB 5GGQH 1RY7B 3X17A 3GSQA 2DQDH 5DR5L 5CD5C 5AYQA 2X4QB 2BVQB 3FCTB 1OQXA 5I8EB 4CL7A 3BYYA 3HNVH 3NFNA 3OR7A 5JUEL 2VDRL 3ARGB 4O2FB 1Q9KB 2CUMA 5M95B 3MRFA 1BD2A 1KJ3L 4PJCF 3DYOA 5IVXA 1ZGLA 2CKBA 5FYJE 1CFVH 4N0UE 5D7JC 2FD6H 3C08H 5DLMH 4QRUB 5AZEH 4GXVH 5KSVB 4XMPL 2VLLA 4OZGB 4OM1L 2F54D 2J5LC 3LZFL 4JLRA 3LRHA 2XZCL 1JPSL 1S5IH 3K4DA 32C2B 3GMLB 3MV8D 3RWHA 2AK4A 3PWJB 1EO7A 4IMKA 2GKIA 3FQTA 1PGRB 1JYXA 5MERB 4U1HB 3JV6A 5JIHA 4LSVL 4NJAL 1KOAA 2Y23A 5D6CB 5HGHB 1N59A 1JZ8A 2DJSA 4XH2A 3SO5A 1J9CT 2HN7A 4NQED 4U2ZA 3VFMB 1GGCH 4OCRH 2ADGA 4GKNB 1HNGA 4JRXB 3V6FA 1KJVB 4NQVB 1LO4L 3ARBD 3DMMB 4R8WL 1JTPA 1WBZA 2P8LA 1RK1B 4APQD 3E8UH 1X4YA 3A0OA 2AERT 2B7DT 1U92B 3UMTA 2E7CA 2ENYA 4J3VA 4OV5A 3KPQA 3DRTB 1IMHC 3GSVA 1YNTB 3SY0B 4X98A 4MAUH 1UGNA 3PWLB 3CXHJ 2DI7A 4WWKA 5MEOB 4HHAB 5C2BH 1JNLL 4OCMC 3O6ML 2A6IA 1MJ7H 4TRPH 3AY4A 4X8XA 3QEGH 3I6LE 3MRHB 4U49A 5EBLB 4HCRA 2VXVL 3HG1B 5I0DA 3VGDA 2DBLH 5EUOA 4KVNH 3X13B 5BW7C 3OJDA 5GS1B 4U0RC 5IBLC 3MMEB 4U6XB 4PP1D 4K7FA 4PRHD 2EDRA 3QZWB 1KXTB 5LWYL 1VPOL 3QCTH 4WV1A 1T89A 4MWFA 3AS1A 4QHUB 1QYGH 3BKJL 1Q94B 4QRRA 6FABH 2X4RA 1ADQL 2OJEA 3G6JE 3Q1SL 4LCIL 5T3XH 5JIIA 1YN6A 2CDGA 5ADOL 5IKCA 5E4EC 5B8CA 4YR6B 2R0ZL 3VFUA 4UBDD 2PXYA 4O5LH 3BT2H 4LPTA 3GBLA 4U6VL 3L9RB 1DEEA 4MX7B 2V2XA 3RTQC 5EUKB 1E4WH 4OZFH 3UTTA 1WFOA 2GSGB 1CQKA 3P9WB 1CS6A 1E6OL 1MHCA 4B50A 4P5TA 1MAJA 2A74A 4Z5RB 3NABL 1KLUA 1Y18B 3D39E 3O2VL 4OD3H 5AYUL 3FKUS 3W11D 5F7YC 4IDJH 3KPSD 1NC2D 3MV9E 5ANMA 3UZVB 3PDOA 3O4LA 1K8DB 2A77H 2GHWB 3RDTA 4MS8D 3MNWA 5C07E 5JZ7D 4NOBA 2W1NA 5C0DB 5ACLA 4C57C 1F6LL 2G5BA 3BD3A 3P4MA 4N1EA 4R4FL 4Z7VE 3C5SB 5J4MA 1CBVH 3UTZA 5CUSL 4BKLB 3LH2H 1WEJL 3QIWD 2AJSH 5D7IE 4RX4A 5HHPA 4KKLD 3D69A 2O93L 1JHLL 2P8MA 3MLXH 3CFEA 1GC1L 4P23B 2BCKA 1BPVA 5GGSB 2CD0A 1Q9WB 3V52L 1MLBA 1WWCA 2PF6A 4NUGL 1YC8A 3U9UB 3QJFB 4X4XA 1WQVT 1YC7A 5JXAH 4FOMA 4O2EA 3BSZH 3BGAA 4GFTB 1P4LA 2DQCL 3CDGB 4JHAL 4MNHB 2XZAL 3NZHL 5HPOA 3OF6D 2W60A 2F9BT 2IBZY 1N6QH 4OLVL 3I2CL 3E2HC 3QSKB 2AJVL 5J1SC 1GPOL 4YDJA 4TTGA 8FABB 1GXEA 1OP3K 4LVNB 3VRIB 1CDIA 4FN0A 4PJ8C 4BH7A 3PHQB 5KSBE 2BMKB 1BM3H 2C1OB 3EYOA 4LDOB 3IDIA 5E8EB 2FR4A 3WDHA 2BNQB 3O9WD 1MFBL 3KJ6L 4FQXD 4GG6F 3VU2A 5IR1B 1OAXL 4PJDA 5ICZB 1P4IL 2XRAH 5F96H 4I0CC 1HXYB 3MGOB 1BF8A 1INEH 35C8L 3S9DB 2E9WA 2D2OA 3UXFA 1SYSA 1T3FB 1A6WL 1E4KA 3DOSA 4L3AA 5FUCE 3QI9D 2GT9B 2F58L 3MA9H 4GRLD 1FSKC 2NXZB 3D0VB 3RWDB 4JY5L 1QNZL 4YHMH 3DUUB 4NHCL 3WS3A 4F15B 4K7PY 2IG2L 3HRZA 1Z9OA 1CK0H 3IVKA 4QRTB 5FUOH 4TYUA 2Q6WA 2FGWL 5IW6A 5DVMA 2M1KA 2EC9U 2ZUQB 4GAFB 4NCC1 5B4MC 1NAMB 3QEUB 1M7IB 1BIIB 5JOPD 3CZJA 4F37F 5BO1H 5EU6E 4GW1B 1JK8B 5JTWA 3D39D 4M43H 3FN9A 4WI5A 4PJGA 5E6IA 5EOTA 4CMHC 3WNOA 4FXKB 1A6TB 2YRZA 3G5YA 3WCYA 3BZFA 1T1WA 1FG9C 3HR6A 2D3VA 4IRJD 5D7SH 3UBXG 3K2UL 3O8XC 4NO2B 3NA4A 2NYYC 3WJLA 1A1MB 1RZJH 5CBEB 4KAQL 4O9HL 4IOFC 5TF1L 1KCSL 3OPZL 4YIQA 2FYYB 4QHKI 4LSQH 1UXWB 4HPOL 3H2WA 4OBSA 4WI9A 2O61A 3UYPA 4X6FA 1MI5A 4Y4KB 2GQHA 3G9AB 4LLVA 4LPCA 2HJFB 2IFGA 4JQIH 2HVJB 1B0GA 2E8ZA 3QBTB 1FBIH 1AKJD 4YHNA 4LLAA 5MP6L 5CEYA 2AKRA 4PRID 4OZIF 2J6EA 1IAKB 3K8LA 3IRPX 2VMFA 2BVYA 2DQTH 4LNVA 1OD7A 3ULVC 1OPGL 3TYFA 4DUXA 2P24A 1DVFD 5CSZB 3FT2A 1KTRL 4X9BA 2SEBA 4Z95H 3HZMA 4EUPH 2DQGL 2HFGL 3ES6A 5E9DB 3ULUC 1FZKB 1SBSL 3PHOB 1YN7B 1NCBL 4LAQH 4HZAA 1QSFA 3SDDD 5EN2B 4YQXH 3RVVD 3IU4L 5I1EL 4KI5C 5DJDA 5IROA 2W91A 4NZTL 3KXFD 3VXSA 4JO4H 3T0ED 3BP4A 2ARJB 3KPPB 1MJJB 5A2FA 5C0CD 3LKOA 5C08B 3LKNB 5FXCH 4YHYC 5CZXC 5ISZA 3DBXA 4Y19B 4RWYH 4QHMA 4C59B 4TQEL 5I1JH 5C6PB 1T0NB 4N9GB 3O2WH 1JRHI 3H3KA 3WSQL 3HC4H 3TBWA 4P4RA 4ZTPL 1D5XA 3MBED 3D85B 5KSUA 3QPQC 2AXGA 4BELD 2W0FB 1U8HA 2O5YH 1BP3B 3ZYOA 2OTWB 3VGFA 1T83C 2XY2A 5EU6D 1OLZA 1A6PA 3P0VL 2OXHA 3IDNB 5DMYA 5D7IF 4MAYB 2PYEB 2VC2L 1DQQB 3ARTA 4LSRH 4ONFH 4FXGB 4NPYB 4ZODA 4PJEE 2AV1B 5D8JL 3LD8C 3VFGH 3KYKH 3GMOA 1WZ1L 1ORSB 3L5XL 4U3CA 1V7MH 3WUZA 2MHAB 1IC1A 3IFLH 1OHQA 5B39B 4HGMA 3CSYB 2E7HA 3IXTA 4Q6IB 1A2YB 1YPZA 3CZFB 4P4KA 1D5ZB 1FH5L 4HWEL 2QLVB 2OLDA 4WU7A 4UTAH 2CMRL 4LKXB 3ZTNL 5DRXB 3BH8A 3PDDA 4OBRA 5J9PB 3STZA 1QLFA 5IT2L 3S35L 3JZ7A 2LVEA 4M8VA 3U4BH 5IESH 3ARRA 3UYRH 1NH6A 4G8GA 4ZSOE 15C8L 1F4YL 3GB7A 4LU5H 3QFJE 3PL6A 5GGTL 2IMMA 3HZYB 1IC4L 1IAIM 3M8OH 4F7TA 5T5NF 5EG6C 3HI1B 1WFUA 3GJFA 4OSUL 1OM3H 5KG9B 1E4JA 4AEFA 3WXWH 2EIDA 5F1IB 5AD0B 5GZNC 4C56B 2EE6A 2P48B 5D7LA 2W0LA 4QRPE 4CMMB 4RGND 1KIQB 4MQ7A 2D0FA 4V1DA 5SWQB 1MCQA 3Q48A 1WIOA 3MFGB 1JWSB 5JORB 4JDZB 4XVTL 1ZVSB 4E41A 2NY2D 5HHQB 4JAMB 4LCUA 5IK3A 5IMKA 1ZWIB 4UOW0 5ITBH 5KAQG 5GGVL 3T2PA 4UV4H 4P5MB 1IT9H 2QQKL 3EYQD 3RU8L 4JM2C 3GHEH 2HJKA 1G6RA 5DJ2B 4K8RC 2FBJH 4FTVD 2GIYA 3AB0C 4DCQA 4W6YB 3NN8A 3ULVL 4MA3A 5ACZB 3PJSB 2FL5B 5SWZB 4Y5VB 3OQ3B 2AEQL 4M6OL 3BZDA 1D6VH 1JGVH 4OZIA 3ULUL 1U8NB 4M8QA 2WBJA 4MYWB 3ZT7A 1EUTA 3FB7A 2X7LA 1KIUA 4HC1L 4AT6A 4G6KH 5I8CA 4ODUB 5DDHB 1NUNB 1XF4B 3KPRD 4G3YH 4N0RA 3QIUC 4OUOA 1MQKL 2IBBA 4MDJB 4P2RB 1RVFH 4QF1A 1LHZA 1XR8A 4FFZH 1G7LB 3QISA 2CLZA 4PJIA 1JJUA 3GMQA 4U1IA 4FQHB 5CILH 4GMTL 4ZUTB 2BSTA 2YD3A 4G7YL 1IVLA 4ODWB 4RMUA 5IB4B 3BXNB 1U3HC 2GITB 1RJCA 3D18B 1RJLA 2EYRA 5C92A 1U8QB 5DTFA 1I1AD 3DVGB 1T5XA 4XB7A 4M6NL 3INUH 1QRNE 4GRMA 1KJMA 1G6VK 1A1OB 3GBNH 5D2LE 4Y4FC 1T7XA 4QOKD 5I1DA 3WLWC 1NFIA 1RZIB 4PBVC 3AFLA 3RGVA 5C71A 4R4ND 2PTVA 4R0LA 1IAMA 1MIML 4XP1L 2LU7A 4M7LL 1QSEA 2O5XH 3MJ8B 1JTOA 2F74B 4HFUL 5ICXB 3LN9A 2BX5A 4LSSL 1OAKH 1KLFA 5DEGA 4TUJA 2P1YA 1SMAA 4A6YL 3MR9A 3NAAL 1A4KB 1T2XA 1NGPL 1JYVA 2AW2A 4JY4B 4V2BA 4XBEL 4JFFB 2V2TB 2AEPH 2O26U 4EN3B 5K9JH 2QADD 5ALCL 5I1GL 1U9KA 4HWBA 4MQXD 5I1LB 2I07B 2V17H 4PJ9D 1A7PL 1JZ2A 2HA1A 3HNTH 2FCBA 4HUMB 5JXEA 4GW5B 4WW2F 4PLNC 2FX7H 2NZIA 4HPYH 4KJQD 3SGJA 1N4XH 1V7NH 3K8MA 1NGYB 2R56H 5GS3A 4LARL 4QXGL 5T3XE 2DTMH 1JRHL 1YEHH 1T20A 4MD4B 5HJ3A 2VLKA 3DSFH 1XGPB 4OFPA 3T0WA 1RUQH 2VABB 3B2UC 3TIEB 1MHHA 1XGTA 4FG6C 3EFDH 3STBA 5FGSA 1FZOB 5C0IB 4OGXH 2I60H 2YD1A 1BWMA 1AE6L 4PJEF 4F7CB 3VG0L 1S78C 4LLWA 4M9PA 4BSWB 4UT9L 5AUMA 4J1UB 1T04A 4PBXA 4OZ4A 2ICWJ 2IPUG 3HE6B 5ELIA 1RULH 2EXYC 3LPFA 3PNWB 1INDH 5CFHA 5L2KA 3BIKB 4JZNB 2X05A 2CLVA 5K9KA 1IBGL 1WICA 5FECB 5KVMC 1RJZA 4CW1B 4WW1A 1CU4H 3TVMD 5IIEA 4JDVB 3EO1A 1VCAA 2IADB 1RHHB 3IDXH 2VZOA 3RY6A 5KVFL 4MJ5A 2ED9A 4QHKJ 3QHFL 2EDNA 2BRRL 3MPCA 2H32H 2UUDH 1MCOH 1EFXA 2BZDA 3V4UL 3SEPA 2E5EA 1MNUH 4HF5H 3PP4L 5KW9H 1F4XH 3X3FL 5I73B 5EA0L 2X1QA 2D7MA 3OKYA 2FX9H 1CLYH 4P2OD 4K8RL 1G7PB 4OCXH 4ZFGL 3B8SA 5J3HD 1OGTB 1PAMA 4LK4A 5F7WC 2ITCB 3IJSB 4KZEH 3QUXA 4DTGH 4UNVA 4MNQA 4PD4J 4LSTL 3QNZA 1QR4A 2Y7QB 4ODVH 5KANI 5AAWA 3P4OA 3SQOH 2YEZA 2FATH 3V8CA 2YPLD 5ABDE 3TYGL 4L4VE 5D1QB 4LASL 1KB5H 5BZDB 2WLZA 3QUMA 4CVUA 4ZOCA 2RCSL 1OARH 3D0LB 2CJUH 5KVEL 3FRPA 4XCYA 2QSCL 3QDJB 4CVZA 4FNLL 4BZ2H 5KS9E 4HWZB 2C3VA 4NNPL 4WU5A 3LS4H 3TO4A 4CJ0A 2AXJA 3TPKA 1H3WM 2Q76B 4KK6C 2DMKA 4R26H 4GG8A 1P4BL 4KTYA 2WINA 2WUBL 1UM6H 3AY4C 2PR4H 4JN1H 2CIIA 2Z91B 5T3XD 5TDOA 4LCWE 1PBYA 2JCCF 5E8NA 2NY6D 4ZPVB 3MRLB 1OCWL 4OFDA 4BH8B 4LGRB 1KB9J 1ZGLP 1HEZB 2XWJB 1W72A 2VISB 1PG7L 4JPVL 1GZQA 5IV2A 3C09C 1P7QB 1CCZA 3JWDC 5C0JB 1FNGA 2DQUH 2E27H 2YBRA 2I5YH 1JGUL 4MJIA 4WV1C 5I71B 4ZO7A 3ARFA 5DD1L 3UTSE 3TBVB 4RMQA 2XQBH 4M48H 3BKYH 1Q9OA 1CF8H 2K7QA 2PW1A 5LGKA 4E0RA 3DI3B 3OXSA 4S1DC 5FK9A 5B8CC 1CXEA 2Z92A 5JPMB 1ZANH 2N7BA 3S96B 1MRCL 2PXYC 4GH7B 2R1YB 5HYJB 2NY4B 1YJDC 2XWTA 3GKWH 4K7PX 1S9XA 1AFVL 4P5TC 1N0XH 1A6UL 1FNAA 2EYTB 5E6YA 3UTQA 1YEKL 5D2LF 3BZEB 1Z5LB 5E70A 5I19L 2YKLL 5EO9B 2W65A 5IHLB 4WW2A 3RDTC 3QIBD 3QA3B 4ZOBA 5TQ0H 3KYNA 4KKBC 1AGBB 1WFNA 4M7KL 2C3GA 2RJMA 3O3EA 3CFJA 4PGDB 3UAJC 3K46A 1FG2B 4NWUH 5KN5B 1FDLL 3MZTA 4LVHC 2Z8VC 5KJRH 4MCZA 1OP9A 3MNVA 3AM8A 3QQ3A 5BVPH 2J88L 3W9EB 2X40A 4MDIB 1KBGL 4LQFL 5ESVB 4CDHA 1JPST 2CDEB 1G7MA 4KKNA 5IB1A 4GRWH 3VXNB 3QO1B 2R9HD 3S97C 1LE9B 4YHIB 5F7EL 4ALAL 2CIKB 3MREB 2HT2C 2Y07L 1IC5L 2CKBL 3C5ZB 4OZGE 3WS6A 1F58L 5BMFL 2PW2A 5T33H 2P49B 3EOBB 3BJLA 4QWWC 2UYLB 5E5UB 4D9RE 2XN9D 1HOCB 1A22B 4XNXH 4AMKL 3OKKB 4KDVA 4OLWH 4BZYA 4OM0L 3TBYA 5F88B 1QKZL 4PRPD 3ZKNC 2IPKB 3X11B 2C4FU 3IT8D 5DC0A 4JRXE 4JKLA 3MOBL 4XCFL 2FJFB 3SCMA 1Q9LB 1T5WA 1E4KC 4OCSL 2FSEA 4KK9C 1OWRM 4F7PB 2QBWA 5EZIH 1HH9B 2YN3A 3GMRA 5D7JB 2ADJB 3VA6A 4Q9QL 4EOWL 3UTSD 4KUZL 4F58L 1FL3B 2QV2A 1NC4D 2J5LB 4J12A 1SEQL 3KPTA 2MOVA 4H1LG 5HGAA 1MCPL 2ADIB 3F7VA 3FO2B 2V2WB 3GMPB 2A9NL 4NJ9L 1FL5B 4JB9H 1FGVL 4M5ZH 5E8PA 2IANB 4XMLL 2IFFH 4RGMC 1T1XA 2QJDA 1BWWA 5IFJA 4WI8A 2XACC 3HG1E 4ONHB 4JM4H 5MHSE 5D71L 3MJGX 2HJLA 3H9SB 2HLFC 1F42A 3D6GA 1XR9B 5E6IC 4OZHB 4HCRL 4HIIB 1TTGA 4JFDB 1Z9LA 1HXMA 1C5CH 2Y36H 2BVTA 1NBQA 4YO0A 3RWFA 4X6DA 1G7JA 4YDKL 3ME0A 4P3DB 4ZD3H 5INDA 3WJLC 3MTRA 3V5DA 5TPWL 2JCCA 3JWDL 2IPTH 1A02N 4GLRI 3D2UA 3RVUD 3RY4A 3U7YH 2DKSA 1K2DB 2V9QA 3V6ZA 3TT1H 4GAJL 4F57H 4EXKA 2ZUSA 1C12A 2VXQL 3Q6FB 3QG7L 3W39A 2VITA 2DI8A 3WLBA 4J3SA 4NQXB 3WKMH 2H2PD 1CXIA 1ZT1A 3MLSH 3EDFA 5T3ZH 5BOPA 1YJDL 4IOIB 1F4HA 2GAZA 3OV6A 5I17A 3RVTC 4WFEE 1XF3A 4U0RB 1IAOB 3OWEA 4ZS7L 3NA9H 3N1MC 3FMGL 4NYLB 5FV2A 1KIPA 4HKBA 1QRNA 2EDWA 1QLRA 3L3OB 4HUVB 2YRPA 4JFXA 4G8IB 2DRUA 1BJ1H 4G80A 3VDCA 4JFHE 1FORL 2ICEA 2HYMA 3QUYD 4Y2DA 5CAYB 1FV1A 4IHOB 1I3GH 3CDCA 3ARPA 5IROC 1FCCA 5E4EB 3ZHKA 1T6VN 4OIIH 1IC7L 4JRXD 1IGYB 4NM4L 2X70B 1DBKL 1SYVB 3QXAB 3ARQA 3V7AG 4P2QA 3BVNB 2UV3A 2VLJA 3H9YA 4U1LB 4Y16D 5DEZA 5F72S 5HHNA 3F7QA 3FONA 3RWJB 5DR5H 3DURA 5I1HH 1FFNB 1G9MH 3ZDXE 4DZ8A 1B4JH 2W9LA 4HGKC 5T1LA 3ZL4L 2EO9A 2VDRH 3OAYK 1R24A 3RIAK 4X4ME 1NGXA 2R0KL 2HKFH 1C08A 1EJOL 3UX9B 2BNQE 4N8CH 5ICYA 2DB8A 5D1ZD 3V6OE 1PSKH 1S7XA 4GAYB 4X8JA 3KNBA 3MJ7A 3NVQA 1S7RB 1IEAB 2BNRD 2ZSWA 3QEQB 4UQ2B 2FJHA 2HT3C