4EBQH

Fab structure of anti-vaccinia virus d8l antigen mouse igg2a la5
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
218
Chain Sequence
b'QVQLQQSGPELVKPGASVKISCKASGYSFNFYWMHWVKQRPGQGLEWIGMIDPSESESRLNQKFKDKATLTVDRSSSTAHMQLSSPTSEDSAVYYCTRSNYRYDYFDVWGAGTTVTVSSAKTTAPSVYPLAPVCGGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIEPRGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, hea
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 44
structure length 218
sequence length 221
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqH02
2YD9A 3H9SD 5JOFA 1IAKA 5IMKB 3GJFH 3BT2L 5K59E 2HTKD 4X6CF 2MNUA 3CMOH 2PO6A 3EO1A 3PP4L 5IMOB 3SGJC 1JE6A 4WHCA 2A6JA 5DO2C 1RU9L 3MV8B 5JW4N 5LXGL 4B5EA 4CMMB 2BOBB 2C1OB 2G60L 4RIRB 3IF1A 3I3DA 4ZFZB 3W9DA 3QI9D 1YQ2A 1G9NH 1BJ1H 1MFAL 1AR1D 1HNGA 3K4DA 1B2WL 1WTLA 3ZYJA 4LDOB 4I13B 1KCKA 1XZ0A 3SE3C 4F37K 3BP7A 1K8IA 5EU7C 4Q9QL 3F62A 3GSUA 3GNMH 1E28B 5TF0A 4GSDL 4WV1A 4DKEL 1XCQB 4U6YA 3L3KA 4XMKL 3DNKA 3EOTL 4GG6E 4X9IA 2NY6B 3JZ7A 3DX6B 2F54E 3DO7B 5DUBA 3UTOA 4D9LH 3P4MA 1QHPA 4NKMB 3KLAA 1KPUA 2Z31C 4ZOBA 1PY4A 2AJSL 4Y2DC 3TVMB 4PRPE 3EDEA 5T3ZL 5E24E 3B4NA 4YXLH 3TV3H 3TZVB 4E41D 1S5IH 3IDNB 2D0HA 4ONGL 2NW3A 5CAYB 5EA0L 3MV9D 5L9DL 4H20H 1Q72L 2I27N 5IT2L 4GRWE 4X4ME 2BP3A 1WVZA 2ARWA 3R4DA 4Y19E 2GQHA 5B38A 5E7BA 2AK4E 4XX1E 2PCPA 2HLFD 3A67H 1KEGL 4WENB 1D6VH 4HDIB 2VIRB 2YSSB 4OIIH 4HIXH 3FB7B 3BSZL 3BN9C 4RFNC 1NCDH 1YUHA 4I0KA 4YIQA 4OQTA 2XN9B 3G5ZB 2AV1B 4WHYG 1IAMA 2D4DA 2EIEA 4LCWB 3WUZA 2N4IA 3MRDA 2J88H 5E8EA 4K7PX 4PJXE 5TDOA 5I71C 4OCMC 4BJLA 4AENA 3RJQB 1I3GH 5C0RL 5SWZA 1BQSA 3HNVL 4LCIH 2X9WA 4LGSB 2DL2A 4LVNC 1KCSH 2DL9A 3HB3C 1SMAA 2E6QA 5SX4H 1T5WB 2Y06L 5D2NB 2UZIH 3B9KD 5E6ZA 3WKML 3QUZB 3GBMH 4KJYA 4WI8A 3HZMB 3O6FB 1JWSB 1S7QB 3MLSH 4APQD 2DF3A 2IANB 2AJVH 3JWDL 3U83A 2DOCA 2CK0L 3GUTA 1DANT 5HD8C 1FDLH 4TRPL 5J0BA 3ZL4L 2YPLA 1BOYA 2NNAA 2HVJA 3QHFH 4MB5A 1OAXL 5D1QC 3QDAA 1WWWX 3LD8B 1GCFA 1INQA 2GITA 1D9KD 4WUKH 3LKQB 4JANB 4UB0L 5JUEH 4NM8H 5ID0B 1AP2A 1AI1L 5AD0A 3T0VA 4Z8FH 2EE3A 5L2KA 1UC6A 2F5AH 3CU1A 1J11A 3WNMA 5EIQA 3S6CA 4EZMA 3QCVL 4TN9A 4HWZA 3CDCA 4NQVB 3FRUB 2QSTA 4O02L 5TE6L 4PRHD 3ES6A 3NZHH 5FA3B 2CIIA 4RMVA 1P7HL 3UYRL 1W0VA 4G80A 5DYOA 4GAJL 3UXFA 5ENWA 4W81A 4S1DD 1KT2B 3O8XC 2AERT 3OSKA 3O2VH 4WW2F 4ZOCA 3LEXB 5J1SC 2JCCA 4U6VH 3ULVH 3SDXF 5GS0D 4BFBD 3D0LA 1KV3A 2F19H 5JXAL 3MJ7B 4X0KA 4Z6AT 4WIQA 5HYIA 5DMGD 1AH1A 2ADJB 5GRYA 1MIMH 1U41A 3IU4H 2A77H 3U82B 4GBXB 3ULSB 1U36A 2J4WL 2YXFA 1IGYA 4LLVA 1I1AD 5TDNA 3RQ3A 3N50A 3P40A 3ZKMC 4PB0H 2PN5A 4ORGB 3UTTE 1C5DA 3ZKNC 4WI6A 3QXVA 4PLKD 3W9EB 3DV6B 1Z0MA 3L95A 4P2RE 3ZHKA 4FTVD 3RUGB 1AGCB 1LEIA 4ZO7A 3P0YL 4OZIB 4X6EB 1S7UA 3C6SB 3VFPA 4CW1B 3FAWA 5ACMA 3O4OB 4KI5F 1E4XH 5IQ7L 3WIHH 2YD2A 3OXRB 4G8EB 4R0LB 3P0VL 4LHQB 5LJYH 2WW8A 3C08L 5DD3H 3U6RB 1G6RH 1MPAH 5IMMA 4G8IB 1XGUB 4JDTH 3WFHA 4JQIL 5DRXA 3B2UC 3MRCA 1KCVL 2Q86B 3U4EB 3MV9A 3MXWH 3MV7E 4QNPF 3RHWF 3LPGA 4JM4H 4NQCB 4HT1L 1LO5A 1M7DA 1VKXB 3RVVC 4LU5L 5DQJB 5MP6H 1NAMA 2CRMA 4JLRB 1L9MA 3ELAT 1IC7L 4HW6A 3TPKA 1MRFL 3CC5A 2R4RL 3RWHB 1OP9A 2AKRB 2W92A 3G6AB 2XKNB 3H7LA 2X4SB 1QLFA 4YHOL 4Y1AE 4PJ7B 4EVNA 1EGJH 3HCVB 15C8L 1UH3A 3C2AL 3SJVA 4YJZL 4YHZH 3V4UL 3RDTD 1G7MA 3B83A 4NKOB 5C2UB 2V5RA 2EDLA 1MRDH 5I1CH 3S98A 5D96C 3IDUA 3W39B 1W72H 4U1JB 1I9RL 4I3RL 5EIVA 5TPWH 4HZAA 4PP2B 2HT2C 3KPMB 5FYLD 5KSUA 4EDXA 4NSKB 4RISL 3B9KA 4PJ5D 3PWVA 2VXQL 1AFVH 2XOTA 1ZT7A 3QB7C 1MQKH 2VLRB 3ZT6A 5C0CA 1U8MB 5HTSA 4XP5H 3X12B 1NLBH 2J6EH 4XI5C 3O9WC 3OKYA 3QDHA 3QNYA 2E9IA 1JL8A 2VN4A 2GSIB 1UWEH 1WWCA 5FK9B 2NLJA 5C0BA 3BKYH 2K7PA 4IJ3B 5IB1A 1UADC 1FIEA 2PTTB 4TUKH 3EO0B 2I9TB 5JNYA 5JW3L 2KL6A 4H88L 4KHXH 4U1SB 4KDWA 3CMOL 1M71B 4JFHE 2QHLA 2FEEI 5FHBL 4H25B 2AJZB 4HXAL 4TULL 4UQ3A 2GAZA 4JR9H 3HG1B 3RU8H 1OM3L 5F9JB 4PTUB 2XA8H 4PGBB 5DEGB 4D3CH 3BPOC 4PRHA 5T1MB 1G9NL 1P4IL 1EH9A 3MRNB 3NTCH 3O6KH 2DTSA 1Q9KB 3MLUL 3Q2CA 5SWQB 4WNQA 1FL6B 1LDPH 4P2YA 8CGTA 5LBSH 3BE1H 2FL5B 3IXAA 2E8YA 3HA0A 3AMLA 2DLTA 1QFPA 1MH5B 3KYOA 3K7UA 3PWJA 1JZ5A 2C4XA 2DS4A 4F3FB 4XAKE 3E3QE 2C1PB 3BP5A 2ZUQB 1GGBH 2V2WB 3X14A 1I1AA 1BQUA 4RAHA 4F57H 4PJ9D 4LHUA 2B1AH 3BQUA 3SCMB 3VCLB 2X4NB 3DSNA 4YO0B 1H3GA 3DUUA 3M17A 4MD0A 1SY6H 1P6FA 4FTVA 3W81A 1QSFD 2I60H 1CGXA 5DDHB 4YXLL 1WFOA 3IDIB 3TV3L 1OTTD 2VH5H 2Y72A 4EN3D 1WBZB 3FN3A 4OSUL 3NPZB 4H20L 2BVOB 3OJDB 4ESKA 4JN1L 3LPFA 4NKIL 5BV7C 2Y9RT 3MUJA 5EZJA 2E3VA 2JJWA 3T0ED 2ZOKB 2UZYB 1EZVY 4X9HA 1D6VL 1I9JL 4DFIA 1IGTA 2PR4H 4KROB 2JCCF 4OIIL 2EH8H 5FEBA 1QUNA 4JPKL 3SO3C 3GK8H 1RZ7H 4PD4J 4UU9A 3CVIL 4C55A 3IRZA 1M4KA 2C26A 2X09A 5MERB 1MCLA 3HPLB 4NDMB 4LMQI 2DI8A 1IILE 5IW6B 3BN3B 3FMGL 3ZHLA 2R1YA 4JJ5B 4Q74A 5EO9B 5KVMC 5EO0B 1Z9OA 2BSRB 1KCSL 4ELKB 1CYGA 4MZ3A 3NABH 3STZB 3VXNB 4Z7WE 1LE9B 4XMLH 4KDTC 1G7HB 3GBML 1IGIH 1Q9OA 3BPNB 3MLSL 5J1AA 3CSGA 1HKFA 1OGTB 2AJVL 4HIEB 4TPRL 3WUWG 1GZQB 3O41A 1LEKB 3I3EA 4AIOA 1FDLL 1BFTA 2R23A 3ALWA 4PREA 2BFVH 1JYNA 2EZ0C 4QT5B 1QSED 1MHEA 5C0AB 1D5XA 3E6FA 1UQSA 2VQTA 4WTZG 5JUEL 4RWYH 5KG9B 3PWNA 4KKCC 3G6JE 1CDBA 2F5AL 3O45A 3IFLL 3NIDF 4Y4KA 3SDCA 1YEIL 3TT3H 4LGPB 3IGAB 4R7NB 5SWSB 2C3GA 2A9NH 1VGKB 1E27A 1YMHA 1S7VB 3ARGB 4G42A 1FFQA 2WP3T 4MXVF 5HYQB 4NM4L 4Q6YA 2Y25A 1ZVSB 4JB9H 3O2VL 4M7JL 4U33A 4U6VL 3ULVL 3AXLB 1C16A 2CR3A 4MA1C 1UJ3C 2F19L 4HUVB 2R0KL 3IS0X 4KQ4L 3IU4L 1MCPL 2DIAA 4JHAL 3DX7A 4BFGA 5F3BA 3SE4A 4JVUA 1JPFA 5F88A 2F9BT 2AXJA 4ZPVA 2BNRD 4ZFOB 3KPPB 1I1CA 2ATPB 4LEXL 2IMNA 1JGUH 5JZ7C 4JZNB 5AWNL 3MO1B 1LVEA 2LU4A 1YEKL 1T21A 2GK0A 3IXTA 3TBTA 1FBIL 1XR9A 4O58L 4PJIF 4NGHH 2FLBT 2ZUSA 4PJ9A 2GUOB 1E4XL 1FCGA 5EORH 4K3DL 1F58H 3GSWB 4J4PD 3WIHL 5EBMA 1BMGA 4NO5B 2I25N 1P5VA 1BQHA 3U0TB 2ARJB 1G6RL 1MPAL 2FRGP 3IDYB 4S11A 3FRPA 5D71H 2DKMA 2XKSA 5I18H 4YBLC 4PJHE 3WDJA 4EN3A 1DE4B 3DARA 5IB5B 5DK0B 4DTGL 1X5ZA 4JM4L 4NRZA 3T2NH 2WWMD 1XFPA 3MRKB 2XFXB 1KJ3H 4P23C 3RX8A 4WGVB 5MP6L 2JB6B 1BD2D 1HKLL 5C6TL 2WBWB 5K9QG 1KJ2H 5DD6B 1JN6B 3GSRB 4YGVB 1DBMH 4JHWL 4NKDB 4OZGE 4Z7VB 3QIWC 5J12B 2GJ6A 3CUPB 4ZUTA 3MCKA 3HLAB 2X70A 5C8JB 3IFNL 3OKOB 4KK5C 1CK0H 5C2BH 3KDMB 4MA7H 2XZAL 1U8JB 4MB3A 4U0QB 1XEDA 1WBYB 5JA9A 2X4PA 1KELL 3PGDB 2YS4A 5AG8A 1DBJL 5MENB 4NJ9H 5DR5L 4QTHA 1ZLSL 1OP5K 3HZYB 4GAFB 3MV8D 3RVXD 1ED3B 2MHAA 1A6ZB 5TPWL 1CD9B 4X6CE 3SKOA 1PG7H 2W38A 4LBEA 4P2OB 1ZT4B 2ZPKL 1AFVL 1SEQH 4X80H 3TA3B 1U3ZA 4TVPE 3MQIA 3OKEA 1MQKL 4GUPB 1LGVA 3GMRB 5HYJE 3MBEC 5HPMA 1NGQL 2OP4H 1NLBL 2J6EL 5F1IA 3QEHA 2BRRH 3I6KA 4I18A 2ZG3A 4JM2A 1CFTB 4X4XA 1XGQB 1UWEL 1DQMH 4QHUB 1MCBA 4OZ4B 5DD0L 3GSQA 2Y36H 5GJTL 4JFDE 1TVDA 1ADQA 4MJ4A 5C0DB 2NY6D 1BJMA 3PV7A 5DT1H 3R8BB 3TYFA 3GMMB 2FJHA 1FNAA 3NVQA 2X9YA 4JFOB 1UB5A 4N9GA 3TLRA 4WFED 4L4TB 3H42H 3FN0H 5JTWA 5HVHC 3QDME 3TVMD 2D7MA 3VMNA 5BVJB 3RU8L 2FIKA 4ODVL 4M48H 3TZVD 2XA8L 4D3CL 1FN4B 1A9BA 3WO3B 4UNUA 3CLEL 3NTCL 2BVTA 3TO4C 4P3CL 3GMPB 1OAUH 4O2FA 3VGHA 4E5XA 5LBSL 5B3NA 4XC3H 4MJ2A 3QFJB 3RZCB 4BZ1L 1ZGLM 5C0GA 4UBDC 2FWOA 1X9QA 4L29B 1J8HE 4JFEE 4PY8I 1F11B 1U92A 4I48A 4ZUWB 4LCWD 1QBAA 2B1AL 1SM3H 4OFKA 3PQYB 1S7XB 4KK8D 1FG9C 4XTRC 4KY1L 2IALA 3G08B 2ESVB 2X4OA 3ARXA 5C0EB 4XCCH 2YUWA 3TIEB 3WN5A 2I60L 1OAZH 4OKVA 2VH5L 2A6KA 2OK0L 4JZOA 3UYPA 5E9DB 4N8CL 2YPVL 1XGRB 1UWXK 4M3JA 3D2UB 2UYLA 2NZ9C 3O6FD 3PHQA 1XGPB 5DS8B 3VFNA 5DJ6A 5DUML 4NC0B 2IAND 2IQAA 4OFDA 1W8NA 2VXUH 1NL0H 2PR4L 4LSUH 5ISZE 1NBYA 1PZ5A 1ORQA 2DKUA 2EH8L 2CDFA 3VFWB 2XT1B 1CCZA 4FFWD 4ZFOL 5DMJB 5I76A 3GK8L 1RZ7L 3ALXA 4N90E 3RIFF 1ONQB 1BBJA 1UXSB 4OD3L 5SX5K 2IADA 1QFWI 1F4AA 3MUZ1 3SDAC 1GH7A 4YNYB 3LQAC 1RJZB 1EO5A 3QAZB 4HKBB 5CHNA 1F8TL 5L8JB 3DHMA 3NA9L 3VD9A 3ZYZA 4PRIE 2NZIA 2GT9B 4XMLL 5IMKA 1DQQB 5JIKA 5IMOA 1A64A 4NZRH 4KZEH 4C56B 1WT5C 3MV8A 4XT1C 1FAKT 5CILL 1XIWC 3KHOA 4Y4HB 4CMMA 2BOBA 4PJBA 5FYJD 1T6WA 2C1OA 4RIRA 4OCWL 1GIGL 1YDPB 3LPWA 1QQDB 4ZFZA 2AVGA 4RFOH 4JG1H 5L88L 4GBXD 4ODTH 2IPKA 1G7LA 2YEZB 3SDXE 4UMGA 1VFBA 2CMRL 4LCYB 3WFEH 4G6FD 4L8SC 5HI4C 5C07A 1CL7I 4F7MA 4XP6L 4G3YL 3VXME 3LQMA 1E28A 2XI9A 2M26A 4MJIB 4D0BA 3GDBA 1I8IB 3U46A 3MRBB 4I9WD 3DX6A 3RWGB 1RK1B 4WI5A 3DO7A 3BZEB 3ESUF 1UM4L 3RVTC 3K2UL 4OZFG 3CFBB 4U6TA 2FBJH 4DK6A 3MRMA 2X10A 2VLJB 5ALCL 4JB9L 4MAYB 2DQCL 1YMMB 4YK4B 2R8SH 4KI5E 3BEWB 2R0WL 3IDNA 1MJ7L 4U31A 2X05A 2YHGA 1S7TB 2D7TH 1ZS8B 4I77L 5KTEL 2AJUH 1F2QA 5JQHC 4KZDL 1XAUA 4WJ5B 5TGBB 3CSYA 5D72H 5IK3B 1MJUH 1L7IL 4HDIA 2VIRA 4QNPE 5IOPB 5IKCB 1Z5LB 3FB7A 4KFZC 4JM2F 1AHWB 2XN9A 1JUFB 4OCLC 3C87A 2X1QA 1D3CA 4LCWA 1F58L 3JV4B 3WL9A 1MI5E 4OD1H 4TNVF 4YBHA 4OM1H 4YPJA 1XMWA 1KC5L 3GJFA 4F7EB 5I18L 1I7TB 4GT7A 4K3GA 1V7NL 1UM5L 2Y07H 5DFTA 4YHNB 3N85H 3LIZL 4HC1H 1W0YT 1C5CL 3AS1A 4EEEA 4NN7C 5D2NA 3QUZA 4X9FA 1A7PL 1BVZA 3FCTB 2VLRD 4PRAB 5T1DH 4L9LB 4NQXB 3AREB 4EQ2A 1DBML 1UCBH 3P4NB 2P24A 5GRUL 2VN7A 4LPWA 1Q0XL 1H3WM 3VFOA 5MI0C 2R0ZL 4BSVB 4LOUC 3NAAH 3SBWC 5C2BL 1BFSA 5MEOB 5IHLB 1VB9A 4POUB 4QTIH 2C3VA 4WI9A 2Q7NA 1BFVL 4YXHH 3NACL 4L8DB 1UENA 1MLBA 1KTKE 4NJ9L 1UWXH 4LGRB 3TH3T 2FEDD 2FYYB 2BHYA 2ATKB 5DMYA 4M6AA 1WBXA 2HAZA 3HG1D 4RMUA 1PG7L 3KS0H 4NQVA 4XPBH 2HT4C 3QUXB 3KPNA 1SEQL 4PRDA 5T5NG 3R06A 4IOIA 2VABB 1LILA 3E3QC 3WUWB 3CDGA 3MRGB 4QY8A 5SWZE 1I9EA 2OP4L 4OLXH 5F96L 2EIZB 3LEXA 5DVOA 3TN0B 1W2KT 1TETL 1U8LB 2BRRL 5SX5H 2R9HD 3U7WH 3FQTA 5I66B 1BREA 2H3NA 5AYUH 1EHXA 5IGXH 3BW9B 3ULSA 2GCYA 3SKUD 2NXYB 4POZC 3DX8A 2NY4B 4M1GH 5SV4A 2FX7L 3BKMH 3I3BA 2YUZA 3SCMD 4DZ8A 4ORGA 3O2DL 3U30B 5FFLA 3HC3H 3FN0L 4PJCB 3DV6A 4XHQA 1I7ZB 2EDEA 4QOKB 5D7LB 2YPLE 4HS8L 4HWEH 2CO7B 1CLOH 1AGCA 5TDPB 4H8WL 3KPOB 5EU4B 4PP1C 4OZIA 4X6EA 3C6SA 4L5FH 1CTOA 3GSXB 3RVUC 2Z8VC 3MJ6A 1EAPA 1JGVL 1TQCB 4U3XA 1JMXA 4XNUH 4ZOAA 5L2KE 1PEWA 4G8EA 3L3DA 1N26A 4MA8H 2O5ZH 2F15A 1F3DJ 5E5UB 4JCLA 1XGUA 4XC3L 1QFWL 1WV7T 3F8UB 1KIPA 4KROD 1FNGB 1MUJB 1GC1C 4PJBF 4PD4K 2Q86A 1E4KA 1CXLA 4NQCA 4YX2H 1KPVB 5FYKU 5I9QB 2P5EA 5DJDB 2IH3A 2P8LA 1T1XA 5K9QI 2JCCE 2OMNA 2P7TA 1SM3L 3IYLW 4X7SH 1JYVA 4ODHL 4K23H 3N1PC 1SYSB 2AKRA 4UTBH 3VGGA 3HC0A 5KVGH 4XCCL 2XKNA 5E00B 4GQ9L 4ZS7L 1SYVB 5DRNA 1CDYA 1GOFA 3JWOC 2W0FB 4LSDA 4PJ7A 2SEBB 1A1MB 3D3VD 4YEEA 3VFTB 2FGWH 5I8KH 3FAXA 3S37L 1NGYB 1E6JH 4X98B 4QO1A 2VXUL 3KJ4B 1CGSH 1NL0L 1U2CA 4LSUL 3W39A 5E8PB 2G75B 4K9EH 4NN5C 1DEEA 3KPMA 2HKFL 1CL7L 1X4YA 4NSKA 4NHCH 4LLYB 4U2YA 4HD9A 3VXSB 5D6DC 5C0AD 4MMXC 1CN4A 1T89A 3CPLB 2VLRA 4KK9C 4RGMB 4JO2H 1U8MA 1FO0B 1KB9K 3QCUL 4YHYC 5I1DB 4JN2B 1BAFL 4FNLH 2LFGA 2V2TB 1U95A 4P49A 2GSIA 1J18A 1R5IA 2I07B 1IEAB 5SWSD 5DJXA 2BVEA 4EUPG 3BESR 5E8DH 5I6XB 1HILA 2WBJC 2PTTA 1EJ6A 2VITB 3EO0A 5FV2A 3PWPB 3ARGD 2GK2A 3NIDE 2X89D 1RY7B 1M71A 1J0ZA 1XR8B 5FO9A 4U1IB 1BIIB 3EYFB 1SEBB 4O4YH 1MNUL 4NZRL 2E7LA 4H25A 2AJZA 3DGGA 4P46B 1N6UA 5ANMB 4CBPA 5CJXC 4LK4A 3WIHA 2C4FT 3BHBB 2AJ3B 4IM8A 1FAIH 2GI7A 1G6RA 4OCSH 2QBWA 4MXVE 5CJQH 3IKCB 2UWEB 5FECB 5DEGA 3SJVE 4JG1L 5I17B 4Z7QF 3QQ9D 3LS4H 5T1MA 3D0VB 3MRNA 4ODTL 1X4ZA 1Q9KA 1T4KB 4DAGL 1OOAA 5HY9A 3HR5B 3WFEL 1U8QA 4X5XB 1J0JA 4M93B 4YGAB 3V8OA 4GS7C 2D4FA 2FL5A 3BUYB 5I1AA 4BH8B 2AK1H 1MH5A 4TTDD 2B4CL 2NTSP 1TZIB 4OT1L 4TOYH 3H9HA 1KGCD 1MCSA 5TF1H 4F3FA 5C0CE 3ARBB 2V2WA 1PEZA 3FOMB 5GHWH 3G9VA 5I75B 2QQKH 1DUZB 4OTXL 4NCC1 1OP3H 5ESAB 1KNOB 2HRLA 4QGTA 2X4NA 3FN9A 1EGJA 3EYUH 3NFSH 4R3SA 5DHXB 3VFUB 3WIIH 4ISVA 2FBJL 3S88H 4PJIE 4JDVB 5C0BE 1FFPB 4Y8AA 1BLNB 1P4LB 5GGVH 3W82A 4FFZH 2R8SL 4LSPL 4D9RE 1DN0A 5DSCA 4YDIH 3SDYH 2BVOA 3OJDA 3V2AR 1S9WA 2D7TL 3CFCH 1V3MA 4HMCA 3PXHA 3ZZ1A 3MLRH 3FO9B 4GO6B 5J11B 2QADC 2EYSB 5D72L 1ZGLB 1MJUL 2H45A 1V8HA 4DKFH 2C7UA 1DL7H 2XQYG 1YYLH 2CQVA 2EDQA 3DX9B 4IRJB 4Q0XH 3KWWA 2ZSWB 2J6EA 3WFCL 1JNLL 5GISH 5IMLB 4X6BB 4H0HB 5MERA 3HPLA 5F7KC 1S7WA 2FO4B 1K5NB 1RJLB 2DQIL 3VJ6B 1XF5A 3SKNB 5F9DC 3WO4B 3SDDB 4IMKA 5JIPA 5MEND 3V6OA 2AJYL 5EO9A 5EO0A 4P4KA 2Y07L 2BSRA 1A1NB 5F7EL 1MCKA 4HC1L 3MC0A 1NJ9B 4OZIF 2ZCKL 5GS2H 2BSTB 1G7HA 4P2OD 4MLSA 4I2XB 4M4RA 3ARDC 3LDBB 5IR1A 2A74A 3TA3D 2PTUA 3MXVL 2EXYC 3V4VL 4M6OL 1ZEAH 1WLHA 3HTLX 3BVNB 1K4CA 4HIEA 4KHTH 5IFAL 1LEKA 5ITBL 3R0MA 1UCBL 2VZUA 3L1OH 5FGBA 4ERSL 1IAII 1OGAB 4U7SA 1BF2A 1KXTB 4JRXB 4NWTL 3NAAL 4NCC2 3RTQC 5FUZH 3K4ZA 3GJEA 4KK6D 3QNXB 4QTIL 4GOSA 3OPZH 4YXHL 4TNWK 4OF6A 3LMJH 1B0GB 4L4TD 3KXFB 1VGEH 3NCYS 4Q7DA 5CP7B 1QBML 3B3IB 3IGAA 4MD4B 5CJ5A 2W9DL 5HYEA 2XWTB 1FH5L 5CGMA 4XNYL 1TMCB 1VGKA 1PKQB 4XPBL 4WFHE 2BXYA 1S7VA 3DXAD 2WMPA 4PJ7F 1XH3A 2Y7QB 3OTTA 4L3EE 3UEZA 4AG4H 5MEPA 2H8PB 1YEGL 1NGZA 4FQXB 1ZVSA 1N8ZA 4OLXL 4KVCH 1NC4A 3ALPA 3AXLA 3O3EB 3U7WL 3FO1B 2VUYA 3QWOA 2P45B 4HUVA 1T03L 2X1XR 4K71C 4LP5A 5HI3D 1I1FA 4LLAA 5IGXL 4M8QB 1CFBA 1UB6A 4F80A 3C6LB 1M6OA 1CS6A 3WS6A 3ULVF 1MVUA 1IL1A 1PG7X 1KBGH 4ZFOA 3KPPA 2ATPA 3MLTB 2AJXH 3BKML 1JZ2A 3L7FB 4XHJC 3DYPA 2Q20A 1ZTXH 4JZNA 1FNFA 2ZSVB 3SQOL 4HWEL 2ESVD 3QIUA 5F9AC 2V9QA 1IZJA 4EI6B 5KAQF 4UQ2A 4M3KB 5E9DD 4JQXC 4GXVH 1I4FB 2EDFA 1IC4L 3P3YA 4LSRL 4OZFB 4Y16B 2APBA 3C5ZC 2AXFB 3D2UD 4QRPB 4NO5A 4P3WA 1EV2E 2O5ZL 1KUMA 3UZVB 4X8XA 3U0TA 2ARJA 2DM7A 4NN6B 3SOBH 4LPXA 4FXGB 2B39A 3F58L 4HJGB 4QHMA 2HMID 1DE4A 2WLYA 5IW3A 4XP1H 2PYEB 3KJ6H 4NZTL 5IB5A 1IQDB 2JIXB 3ZE0F 1CLYH 4LKXB 3RZWA 2XFXA 4IIQC 5D5MF 2APXA 1A6TA 2JB6A 4NO3B 2IAMB 5E7FA 4X7SL 3VGAC 3GSRA 3H6JA 4F37F 2Z0BA 4NKDA 4YXKL 2HJKB 2R15A 3FT3B 3JV6A 1NC2D 4JPIA 3CUPA 3PHOB 5A2IH 3HLAA 5LKNA 1BZ9A 2DBLL 3OKOA 3QBTB 3SE9H 5HDBF 4IS6B 4JO1L 3LQZB 3KDMA 1U8JA 3WSQH 4JKMA 5C9JB 4ODUB 3ARQA 4XPTH 2RGSA 3WLWD 5I0DA 3TC9A 1WBYA 4MDIB 1AXTH 1H5BB 1HE7A 2FHFA 2MSPA 3PGDA 4IOSD 1E6JL 4JZJB 4NPYB 1K2DA 5MENA 4JRYB 4C56D 1CGSL 1YZZA 5IHBA 2DMCA 1ED3A 4Y4HD 5D7JA 2RB8A 4G6JL 2NY0C 3OF6D 4NHCL 2WUCH 4P2OA 1YECH 1MVFA 3DRTA 2Q3ZA 4XNZC 4W4NA 3TA3A 1MIEL 4FFYH 4GUPA 3WLBB 3GMRA 3M8OH 3OGOE 3QULA 1AJ7H 3ZTJH 1QLRB 4AEIL 2X44D 4FNLL 1QVOB 3GRWH 4ZOEA 4RA0C 1T0MB 3SGKC 2XA3A 4KI1A 1XGQA 3MRLB 2V5TA 1BOGA 1AXSB 4MJID 4O5LL 3EFFA 4OZ4A 4KI5C 1XCTB 3UTSB 1NCUA 4AY0A 3V8CA 4MQXC 4L4VA 1M05B 5HGAB 3GMMA 1CGWA 2GJ6E 3UJJH 3HFMH 3Q5TA 4JFOA 1G9ML 4L4TA 4U7KA 1NPUA 5F8RC 2F53A 3WXVL 5HJ3A 1YMMD 2OBGA 1NMCB 4QRTB 3WXWH 4HXBH 4HF5H 5F1NB 4OCSL 4BKLB 4IBLT 4K8RL 5DMKA 3HE7D 3LS4L 5ETUB 5C86A 2GJZA 1VPOH 1OVZA 2F8XC 4JFFB 3OXSB 3OZ9L 4KKAD 2Y23A 1YYMH 4ZO8A 5E8OB 2DLIA 1NFDB 1U8PB 4IEFB 5E08H 5HHQB 5IHUH 3QFJA 2AK1L 3RZCA 1WCBB 5T3ZE 1HSBB 1Z6JT 4WV1C 3BKJH 4ZNCD 5CD5D 1MJJB 4TOYL 4L29A 4BQ9A 4YDVB 3W2DH 4NNPH 3AS2A 3VGFA 1S7SB 3ULUD 1K6QH 2QQKL 4LLWB 2YD1A 3PQYA 2R56H 1S7XA 2IBZX 5IBUG 2IH1B 3WIIL 1C8PA 3S88L 2Z9TA 3G08A 4ZSOA 3HZVB 5C0EA 3TIEA 4C4KO 4FFZL 3FT2B 2FB4H 1NLDH 2BOCA 4HK0B 2R2CA 1OPGH 3PL6D 3SDYL 4WWKA 3ZTNH 5F7HA 35C8H 3CFCL 3BIBX 1XGRA 4PJFF 2CLVB 3D2UA 3NGBC 5KSAB 1HYSC 2NY7L 5DS8A 2Z35A 1M1SA 1TJHH 2LE9A 4ACPA 3ARED 1DQDH 3B9VA 1D5BB 5KZCB 4DKFL 4OAWB 2NY5H 3VFWA 3ZE2F 1ORSB 5FYKL 4Y5XA 1DL7L 3VRIA 1YYLL 5JQ6L 4Q0XL 1EUUA 1QACA 2IQ9H 2ICWI 3MGOB 4GXUM 4TSCH 3LHPL 3MROB 1ONQA 2Z4QB 1UXSA 1NANI 1F6LL 2A73A 1GOHA 1MCDA 5BOZG 3S96A 1S78C 2OL3B 5AUMB 3QEGL 2JLLA 1Z0NA 5DVMA 1EA9C 3T4YA 5L6YH 5D6CB 5GSRB 1BWWA 4F9LA 1I85A 1P84J 4KKNA 4ZUVB 5FO7B 3RKDC 3QUXD 1WZLA 3OJMB 4HKJA 1NQBA 2A1WH 1Q9LB 1JF5A 1I3RB 5GGRY 3BWUC 2YA1A 2MMXA 4HIHB 4I1NB 2X4RB 4EDWL 4KHTL 3CFKA 4C56A 5L2JB 4Y4HA 3HNSH 1YDPA 2OR7A 3TF7C 1KN2H 4KJQD 1QQDA 4PS4L 4YHIB 1YA5A 3EOAB 5BMFL 5L7XH 3W11D 2VDMH 3F5WB 1BWMA 3G6DH 5FUZL 5KOMC 3NA4A 2YEZA 2NXYD 4Y7MA 4CJ1A 1C5BH 1ZA3A 1T20B 3SQBA 4TUOB 4LCYA 2Z31B 4Y2DB 1RMFH 3ECBA 4PFEA 3LMJL 3RL1B 1ZVYA 3D25B 4RAVB 1VFOA 3FQRA 4EUPB 2W60B 4QOKD 5D7LD 4ELMA 1OD9A 2IFGA 5J8OA 3VWKA 4MJIA 4FQLH 3BRGC 4RRPG 1AD0B 1I8IA 3DRQB 4PRNA 3OKKB 1RK1A 1XGYH 4B0MM 4R4BB 3WNPA 3QJFB 3WIFB 4N0UB 2VLJA 4KVCL 4NZUH 2DLHA 4MAYA 4RFNB 5DRWA 1HI6A 4ZNEA 1SBSL 3WJLA 3QDJA 3GBNL 4MWFB 4FQQB 3T04D 4ZFGL 3CVHB 1ZS8A 4UDUB 3G5VB 2E8ZA 3MV8E 3TWCH 3E8UH 1KBGL 3MR9A 1VEPA 2HTLC 3TEUA 4WJ5A 3U4BL 2AJXL 5TGBA 4PJBE 3F7YB 3RAJH 3V5KA 5IK3A 1LD9B 2YPKB 3K8LA 2K7QA 3MBXL 5IKCA 1KJMB 1Z5LA 5E2VH 2AS5M 4U49A 4CU7A 3VU2A 1T5XA 4LVNB 2Y1VA 1UM6H 1F4YL 3D18B 1Y18B 5J6GB 3MA9H 3UPCA 2X9XA 5C07E 2EKSB 5H94B 5MHSD 3TJHC 4M1DH 5TH2A 2XWJA 1G7JB 4KJWD 4Z7NF 3D69B 3X13A 1SQ2N 1I7TA 5TE7H 4I3SH 1KIRB 1EJOH 5AEAA 4DUWA 3DIFB 1TITA 2MKWA 4XP1L 4J8RA 3E0GA 4K07A 2R2BA 1H3XA 1F2XK 5D1QB 2PW2B 3QXDB 5CEYB 3VXSD 5T5FL 1RJCA 4DVRL 3FCTA 1CFQB 1YNLH 1MAML 5EZIL 5B22A 3U2SA 1Y0LB 2ZCLH 4L9LA 4NQXA 3AREA 5KSBF 2H9GA 3ME0A 1U8HA 2Z8RA 4YAQA 3CXDL 3WFDH 3Q48A 2PKDA 4YDJB 3SE9L 1IM3A 5MEOA 1DBBH 4YWGH 5BJTB 4XPTL 3MLWL 4RFEA 1BBDL 1DVFA 1AXTL 5IVZB 1ES0B 1U8NB 3U9UB 3SO5A 2XN9E 1NEZG 4P46D 2FYYA 1UXWA 5BW7A 2VLME 3MJ9H 1RZJC 2ATKA 1JMZA 1OW0C 1EBAA 3K1KC 1NFIB 3L3JB 4WCYL 3VW3H 1OSZB 2WUCL 4R96B 3CDYA 4L9DA 2FJFA 4F9PA 3PWUA 2BSED 1JJUA 2EDHA 2CO6B 2VABA 4FFYL 1IKFH 3MRGA 2OYPA 3LKNA 3M8OL 1AJ7L 3EFDH 3NCMA 4PG2A 2G9HA 1IT9H 3V0WH 4YHML 3TN0A 4Z7QE 4G5ZL 5TQ2H 2FECI 5D2NE 1QRNE 5IIEA 3V5HB 4RQQB 3QDGA 4NC1E 1NCCH 5AYQA 4M5YH 1HQRB 4ETQB 3C60C 2OL3L 1RIHH 1WIUA 3MODH 4MGXA 3ARBD 4WTZA 5FO8B 4KKBC 3PGFH 4R2GC 5D7IA 1QG3A 1JGEB 2FZ3B 2WK2A 2KDGA 3HFML 4XGZA 4NQEB 3LKSB 3LZFH 1JNHB 2E27L 3BZDA 4HKZB 3TCLB 5J3HD 1I7ZA 4QOKA 4OCNC 5HDQH 5EG6C 4XPFL 5DHVH 2H2PD 3WXWL 3U36B 3HMWH 2GIYA 4BZ2H 3V9FA 2CPCA 4OLYH 5C0ND 4LPUA 2EDYA 2ENYA 2KZWA 3GSXA 4ZPTA 4RNRB 1QFOA 4Q9CA 4U1LB 5AAWA 1GAFH 1VPOL 4HC1A 1MHHA 3V7MA 4YHLH 3D85B 2IGFL 3MFGB 4R7DB 4PY7B 5E1AA 4FQ1H 4LPTA 5IVNA 1KLGA 1FNGA 4HKXB 1MUJA 3EHBC 1N3NB 4ZAKA 4K94H 1K8DB 1R24B 1NGWB 3AB0C 4LSSH 4ONOA 1J0KA 4AM0B 3BQUC 3QFDB 3H3BC 4S1RL 4X8JA 3VFSB 4X7FC 4HSQA 5JXEA 4J3TA 5EU3B 4I8DA 5D96B 4I0CC 4JREC 1WFNA 5DK3A 1SYSA 3ILPA 4X6DB 4ELMF 5JDJA 1MEXL 3IDJB 5B3JF 4LAQH 1I1YA 1A1MA 1D6EB 2LU7A 1OPGL 2ZNXA 4KTEH 5ADPL 1R5WA 5IROA 3IAGC 5JR1H 1NGYA 3L3GB 4X98A 1FCCA 3O9WB 2Q8BH 4OZIE 4K8RD 3QG6B 1GPOH 1QFUL 3CVHL 2NY5L 5DMIH 3CFJA 1A7OH 5EUKB 1OGAD 2B2XL 1ZLUK 4BSJA 1LQSR 4JRXD 3CZFB 1U3HA 1FORH 1V05A 1ZHLB 4HS3A 3VXSA 3T65A 2LABA 3WFBH 5HVFB 4YHPB 3CPLA 1T2QH 4ZD3H 2NX5B 1DR9A 3O3AB 3O3DA 5DZLA 4QRRA 5I1DA 2IPUK 1OARH 2YD8A 2Z92A 1SJHB 2H41A 4NQCE 5D1ZC 5AZEL 2P5EE 2EIBA 1UYWH 1IEAA 1F13A 2FHCA 1KTRL 3BPOB 4HIJA 1DQLH 4QHLA 1NDGB 2HJFB 3KPLA 3PWPA 1DBKH 4OCXH 1KCUH 2BY0A 1BIIA 3EYFA 1SEBA 3E2HC 4YFLF 1NMAL 3UZEA 4FQXD 3HUJA 1FYHB 3DLQR 4PJ7E 1BJ1J 5GGUB 2DJSA 3BHBA 3HNSL 1Z3GH 4C57C 2MKLC 1KN2L 5HGGS 3U1SL 5L8LB 3CZJA 3IKCA 2UWEA 5FDWB 3ETBF 5L7XL 5I17A 1CFNB 3NBNA 3C6LD 5FYKD 5A40E 1LWRA 4X5XA 1RMFL 3QO0B 4Y4KC 3SDCC 3U9PH 3DURB 3VXUE 2ERJC 5HHOB 4JFXB 3ULVE 4LLQB 1A47A 2YC1A 25C8H 1U8OB 3V6ZA 5BV7B 4EI5A 3ARBA 2VE6A 4LIQL 2JJUA 4GRLC 5F9OH 2BMKA 1A1OB 3FOMA 1XGYL 1DUZA 1FC2D 1RK0B 4Y16D 1HNFA 2HWZH 5ESAA 1PY9A 2DYPB 2YOCA 1KNOA 4QRPD 3VFUA 4KGLA 3P30L 4KKLC 2YR3A 3FOLA 1CDGA 1FFPA 4NZUL 4I0PA 4EQ3A 1DQJB 1BLNA 1CG9B 3SO3B 2PW1A 2DQGL 4YFEA 2PYED 4P57B 4MQ7B 2OSLB 2JIXD 2ID5A 4XPHL 5B39G 3SE4C 5GS1A 4XZUB 3TYGH 3QEQA 4ZFFB 5BS0E 3KPSB 5FF6A 1T7YA 3TWCL 3E8UL 4OFIA 1CTNA 2IAMD 2OTWA 4DZBB 3NH7H 2EYSA 4WHDA 1ZGLA 3ZE0E 1AQDB 4D0DB 3MRIB 5CGYD 5D5ME 4GKZB 3FQUA 1EX0A 4IRJA 1E4WL 4MCZB 1A14H 2OQJB 4IDJH 4PJGB 5IMLA 3MA9L 4X6BA 2VXTH 2VZVA 3JV0A 3TBSB 5IBUB 2EECA 1K5NA 1RJLA 2I5YH 2VDPH 4P5KB 5D7IF 3VJ6A 4DJMA 1H15B 5CEXB 1D7FA 1UVQB 4M1DL 3SDDA 2V2XB 4E9LA 5HDBE 4JDZA 1NCNA 4OGAD 4JRYD 1J10A 3JTTA 4FQCH 5TE7L 2EDJA 1J7VR 2VDLH 4DGYL 1NJ9A 4LASH 5F7DA 2KKQA 4LVEA 4I2XA 2FECL 3LOWA 1AD9B 12E8L 5DI8B 4G9FB 2OXGA 5F93C 2OJZH 4HV8B 3H9ZA 4TQEL 3LVEA 1T66C 1EHNA 1YNLL 3BVNA 2ZCLL 5FUOH 1JZ6A 4GG8B 4OLUH 2YRLA 4W68A 3UP1A 5FGCE 1MQ8A 3GEWB 1OGAA 5I2IB 4A6YB 3ULUC 3VI3F 1AGDA 1RUAL 1WIOA 4CU8A 5BZDB 4JQVA 4AIZB 1MRCL 3UTSD 5CWSA 4YWGL 3VI4F 2H32H 3QNXA 3NOIA 2DMKA 2E6PA 1CU4H 3QUYA 2HRPL 2B1HH 2P47B 4HX1A 5ESVB 1BM3L 4F7CA 4NRXB 1B0GA 3A6OA 3CU7A 3QHZL 1AO7E 2Y4SA 3KXFA 4MA1B 3TM6A 1UJ3B 1NFKA 5I16B 4XMPH 3RA7H 3B3IA 4MD4A 3D87B 2PXYB 5H35B 2XWTA 4FMFA 4QXUL 4PJEB 1PKQA 2KQMA 4K7FA 3W0WA 1PLGH 1GHFH 1JGDB 2Y7QA 2RJMA 3FB6A 1Q8MA 3S35L 4UINH 2EDRA 2ICEB 1PSKL 4MNHB 1IKFL 1CR9H 1ZLUH 1HCVA 3K81A 4JFFD 2H8PA 5DURB 3QHTC 4FQXA 3PJSB 4I18C 1IT9L 2N7AA 4JM2C 5GSVA 3HS0B 4P99A 4ZDHB 4UT7H 5A1AA 3C5JB 1L6ZA 2C3WA 1JNNL 1DDHB 3ZO0A 1NCCL 4GAYB 4MD5B 4M8QA 3C6LA 3MODL 1IKNA 3GO1L 2GY7B 2N1KA 1YY9C 4FZEL 2B20A 3RWDB 3FFCE 5HGHA 2J8UA 1N59A 3B5TA 3QWRD 2ZSVA 1HWHB 4YBLB 3R8QA 4R8WH 3VXRB 3I84A 1INDH 3HMWL 5DVLA 4U1HB 5DJ2B 4BZ2L 2A83B 3AU1B 4P23B 4X7DC 1I4FA 3DGCR 4AEHL 1N5AA 3SKMB 1YEFH 4Y16A 4U1MA 5CEZL 1GAFL 3SY0B 2AXFA 4H1LG 4PTTB 5KSAD 2XWBB 4YHLL 3FQNA 3QIWB 1R3LA 5IG7B 4FXGA 1FYTA 1JTOA 2A0LD 4FQ1L 4MJ6B 3HUJF 2NY2C 3DO3A 4NQDD 4KJQC 5EZLB 5KZCD 5EB9A 3JWDC 4P9HH 4PJFE 1YEDB 2BDNH 4K94L 2JIXA 1CT8B 3CFEB 2OS7A 4WU7B 3P11L 5I1IH 3MRQB 1UZ6F 2UWEF 4LKXA 1JP5A 1FGNH 5KSVB 2IAMA 3ZE2E 3C5SA 2XTJE 1AGEB 4H0IA 1FLRH 5DO2D 4S10A 2HJKA 5IW1B 2H32B 5BV7L 1MCFA 4Y5VC 5DEFB 2Y5EA 3HI5H 3KG5A 3PHOA 3UPRB 4JO3H 2VDNL 1OAYH 2ZCHL 1P84K 5JO5A 1IGML 1RSFA 4N0RA 5GS0H 1S3KH 4LAQL 2YD6A 2L7UA 3O11A 4IS6A 5JW5B 4KTEL 1DSFH 5GRJH 4QXTB 4P2QB 4ODUA 5IB4B 1NUNB 4PG9A 2D0FA 3MBEB 2F54B 4YUEH 1LEGB 4OLVH 3RBGA 5I15L 4MDIA 1TVBA 4UOW0 1AGFB 5JPMB 3GHBL 1R3KA 2VERN 4C83A 5I1EH 1PDKA 3BDYH 4RMSA 4WFFD 2EDTA 3BD5A 4RDQG 3EOBB 2Y5TB 5ICXB 1J05A 1T0NB 5GJSH 3T08A 4XBEH 1FORL 1WZ1H 5L0QC 5TFSH 4OCRL 3WFBL 4GRWB 3ZE1F 1T2QL 3WS3B 4Y19B 3RWIB 1QLRA 5HVHB 2Z31D 2BNUA 4Y2DD 1OARL 1QVOA 2ICCA 3MJ8A 4FZ8H 1T0MA 2NTFB 1EEZA 4AQOA 3MRLA 1UYWL 1RIUL 2ILLA 5ESQB 1DQLL 1XCTA 3UTSA 5C0FB 4FQHA 5I8CB 3HN3A 3TO4B 2YUVA 1M05A 1DBKL 3DUHA 1DP0A 1NEZB 1PGRB 4OCXL 1YJDH 1OTSC 5HGAA 1OCWH 5HDOA 1MCJA 4UNTA 4M6MH 1T1ZA 1NSNH 1QR1A 2X42A 1HINL 1Z2KA 1TCRB 3BN9D 4QRTA 5BRZA 4MNQA 4A2LA 1OT2A 2ADIB 5I1KL 1BFOB 1AGBB 5MENE 3RY6A 3LS5H 1ITCA 4TNVK 4JFFA 3OXSA 2XXMB 3GHEH 5E8OA 2IG2H 5GPRA 3RGVC 4A6YL 4UZGA 1FVCA 4JVWA 4XVSH 3BZ4A 1WCBA 2VR5A 1HSBA 4H26B 3HB3D 1HK6A 5IV2B 4K3EH 3I02B 3V4PL 1RVFH 1Q94B 4YDVA 4WGWB 2WIIB 4GH7B 4Z95L 3VWJC 5FYLH 5T3XL 4CAGA 1EFXA 4XBGB 5ILTL 4LLWA 4XVJL 2HWZL 2C4FU 2C3HA 2I26N 3BKCH 1EEYB 3AMKA 2Z93B 2RFXB 2IH1A 5CMAA 5IBLC 5DTFA 3HZVA 6FABH 5HD8D 2BVPB 5KVFL 1MJ8H 3IU3B 3FT2A 1CDUA 4L4VE 5BCAA 3GMOB 4YFDB 4HK0A 4XXDB 5CZVL 1H3PH 2NYYC 5D1QD 4Z7NE 3ARVA 4L8BB 4HWBH 1DLFH 2F53E 3I6GB 4E42B 1BX2B 3SDAB 5KSAA 1KIUA 4R9HA 3NH7L 2DJ4A 1CE6B 3HAEH 1E6OH 2UZXB 1NMBH 3IDXL 4GMSL 2CKBH 2W9EH 3Q5YA 1D5BA 2PYFB 4OAWA 4U4BA 3N06B 4FQJH 5K9KB 2IEPA 1ZKAA 3CLFL 1RUML 4ETYA 4ONFH 2Y6SC 3MGOA 2HN7A 3MROA 4LPYA 2VXTL 5KSBE 2Z4QA 5J9PB 3QFJE 1KPRB 2OI9C 5JOPE 3SPVA 3ZYIA 2J8UF 2OL3A 3O8XD 1GZPB 3MOBH 4C59B 1XIWB 3MUGB 4LSQL 4NJAH 5AUMA 3UTTB 4JO4L 3FT4A 4X4YB 4BK5A 1VEOA 4W6WB 4DN4H 1OTUC 2JK5B 4P2RB 5C09A 4HJ0C 3I75A 5D6CA 5GSRA 3PQYE 4P5TC 1HWGB 2OJEB 5FO7A 1EK3A 1B90A 4LASL 1T80A 1RZKH 3SGDI 4NC1C 1L7TL 2X4UB 4ZSOE 2KBGA 2OJZL 2VZOA 4U1NB 3ZKMD 4L8SB 1Q9LA 5DJCB 2X4TA 1G9NC 2H26B 3ZKND 4HIHA 2X4RA 4KMLB 2NXZC 4OLUL 5DJAB 2XZCL 1B4JH 3E6HB 5IM7B 2FX9L 1CLZH 4YHIA 4UIMB 3EOAA 4V1DA 5JHDA 1UKSA 3MV7B 5GRVK 2JE8A 1OAKH 4GLRH 3OJVC 1T20A 1RU9H 1RD6A 5E56A 2VSCA 4TUOA 5LXGH 2F8OA 2Z31A 2B1HL 4JGJA 2G60H 4NQED 3D25A 1QLEH 4RAVA 4PJ5B 2W60A 3B2UD 3K74B 4XMPL 2VB5A 4TUJA 5DD1L 1U3YA 2BC4B 4YR6B 1RUKL 1UWGH 1PLGL 2RIKA 1GHFL 1J8KA 1B2WH 2X41A 4NOBA 4Y1AB 3RVVD 4D8PB 3BPCB 4Y2OA 4O00A 5D1XC 5E94B 2EKJA 3QJFA 3T4AA 3ESVF 4NHUA 3D85D 4XC1H 3WIFA 1YY8B 2FJGB 1MF2L 2RCSL 4DKEH 4MZ2A 1F4HA 1B0WA 3EJZC 1JRHI 3OBAA 4XMKH 3V6FB 4AH2B 4UNVA 4BELD 2AEWA 4MWFA 4FQQA 1S9XB 4JFQA 2CKBB 5E5RB 5CBAA 3CVHA 3G5VA 4F8QA 1A6WL 5IJVB 4N5UA 5E4EB 2AJSH 3VA6A 4N0CC 3BDXA 4PLJD 1KTLB 3MJGX 1RUQH 3BAEH 4X5WB 1A7RL 1LD9A 3HI6H 5DHYA 3TBYB 1KJMA 3VD3A 5KANG 4ONGH 4DCQA 4ZG1A 4X6FA 4R8WL 1EXUB 1FIGL 5L9DH 5IT2H 4JFZL 2HT2D 3GMLB 1INDL 3D18A 1R5VA 4NN7B 2VLKA 5EBWB 4HH9B 4OCYL 2EKSA 1YEFL 1PFCA 1KEGH 3N1FC 4QHNB 3DETC 5EC1A 2V7HB 4U3HA 2UUDK 4ELME 3V52L 2N56A 1U93B 5A2FA 5B3JE 3BSZH 4XI5D 5IEKB 2AAVA 3D69A 3O9WD 2CJUL 1NUDA 4UT9H 4DUXA 3NFNB 1SMOA 2X4QA 4WVRA 5MI0B 4P9HL 5B39B 3LKRA 3DIFA 4NOFA 4LNRA 1RFDH 4HLZG 5EPMA 1LP9A 2NCMA 3PDOB 2XZQH 4KRPC 2VLJE 1FGNL 3MNVA 1QSFB 2ITDA 3SKJL 2P8PA 4JY6B 2NX5D 1Y0LA 4ZNEE 4B7LA 3HNVH 3GJFK 5F9WC 1KLUB 2R39A 3QDJE 4NBZB 4XWOC 2R29L 4DFHA 3D9AH 4M7ZC 2G5RA 2WINB 4HEPG 3QT2A 5GS0L 1HDMB 1J86A 3UX9B 5EU6A 5GRJL 3T2PA 4OIAA 1J1OH 1L0YA 4ZODA 5BJTA 2M2DA 4WUUA 5T1LA 1BZQK 1ES0A 1U8NA 3DSFL 1MFCL 3GI9H 3PWLB 4TRPH 5CEZD 1T3FB 3BDYL 5C3TA 5KJRL 2XTLA 3L3JA 1OHQA 4X7TB 1FFNB 4PY8J 3LQAL 3ULVC 1OSZA 4R96A 1FFRA 1ZWIB 5GJSL 4UB0H 5TFSL 1AI1H 3JTSB 4RGNE 1D5MA 2F74A 2P5WA 1FP5A 3O3UN 2EDXA 5HHOD 5TE6H 3V5HA 4RQQA 1QEWB 5HHMD 2GW5A 3PABA 4M61A 4ETQA 3UYRH 5FO8A 1UA6L 2E9JA 4WFGD 3NZ8B 4GAJH 4N8PA 3TBWB 2O61B 4PV9B 3QXWA 2DYPD 1KB5H 1OCWL 2E7LC 4NQEA 1CD1B 3PF2A 4KAQL 5EDXA 5IHZA 5FCSH 4B7IA 5JXAH 4HKZA 3TCLA 1NSNL 4JAMB 2DDQH 1JI2A 5F89A 5E0QA 4YDKL 5MEQA 2J4WH 4MA3A 5I8EB 1VA9A 2YD7A 5EULV 5EBLB 4Z7WB 2A9MH 1K4DB 4LARL 4PJ8A 3KPSD 1X5GA 1QR4A 1MWAB 4FP8L 3GHEL 3D85A 3FO0H 4N8VG 3VRJB 4R7DA 4MB4A 2IG2L 4H0GA 3P0YH 3MREB 3GIZL 3C8KB 3Q1SH 4XVSL 1UGNA 3DMMA 5LCVH 4YPGB 4HKXA 1N3NA 2XACC 5CKAA 4ZTPH 2CLZB 5JMRA 4K3EL 4S1SL 3IJSB 5IQ7H 1HQ4B 1NGWA 3ISWA 3JWNC 2O5YH 3VXTA 2HFFB 5GGRB 3VFSA 3ROLB 3KYNB 3BO8B 3BKCL 5ID1B 1Y6KR 3MOAL 4OD2B 5FB8B 3QDGE 3OKLB 4NN5B 4A2MA 1A3RL 3MUHL 1MFEL 5GZNC 1CFVH 4X6DA 1H8SA 5D7IE 3DVNB 1I7RA 1D6EA 2EZ0D 5A43C 2BCKB 2XG4A 2DD8H 1H3PL 1YPZB 5BXFB 4H1LB 4RBPK 3TH4T 1TIUA 4HWBL 1IC7H 1MRFH 4G9FD 3M45A 4Q6IA 4YHYB 2MQ0A 3L3GA 4RCAA 4KKCD 1E6OL 3UTPD 3QG6A 2CKBL 43CAB 2DQJH 1EUTA 4BFIA 4Q2ZA 4KTDL 1BP3B 2AI0H 2DQFB 1F45A 5EUKA 2FATH 5JIIA 2VDOH 2WBJB 3C2AH 4N5EC 1GVIA 2NX5A 3O3AA 1UEYA 3ROOA 1OT1A 4XP4L 3BP6A 5BQ7B 2GSGB 3GMNA 5EOTB 3VI3E 3MOBL 1J1XH 1I7UA 1SJHA 4NJAL 4P4KC 5T3XD 3C09C 5T33H 2UUDH 2VXQH 3VI4E 1OD7A 2LV4A 2L0DA 5JOEA 3S34L 3RWEB 1BD2B 1U91A 3CGTA 1J88A 3P9MA 1QNZL 2HJFA 3STBA 1RZKL 4PIRF 5F70A 1VFAB 1KG0A 1GGCL 1MHCB 5K9JH 2NMSA 1UEMA 2B0SH 1A2YB 4GS7B 5JZ7D 3RBSA 5CZXC 5DURD 4HFWB 3REVA 1IQWL 3NIGF 5GGUA 4MDJB 1B4JL 4OV5A 5D7SL 1IRAY 4O51B 2XY1A 3I6LE 1WFTA 4Y4FA 1CLZL 4PJHB 4WEMB 5IF0B 5JW3H 4Q9RH 4H88H 1FFOA 4JRWA 5H2BB 4M6NH 2R69L 4J3SA 1OSPL 1LP9F 5FHBH 4U1GC 1OAKL 3SEPA 3EDDA 1CQYA 4FQ2H 4HXAH 5F7YC 4TULH 5C7XL 4XCFL 1ITBB 3FZUC 5EH1A 2G5BB 1OM3H 1HH6B 1QLEL 3DURA 1ZLVK 1BVLB 4JFXA 2JTDA 4OZGB 5CZKA 1A6PA 3LSOB 5D2LA 3VXRD 4JHZA 1P4IH 3WEXB 5ADOL 1I8LA 1KJVB 1UWGL 1JGLH 2P8MA 3MLUH 4P23D 5FOBB 4QRRE 1A1OA 1RK0A 2Q7YB 2DYPA 2QADB 5DF0A 3CFDB 1KCRL 2VSDA 4XC1L 5KOVC 4GW4B 3QIWD 2XTJC 3LN5B 3S4SA 1TXKA 7FABH 1DQJA 1X5LA 4DUVA 1CG9A 1ZA6B 1FVEA 3MYZA 4LSVH 1TPXC 1JPGA 3PWPE 2GTZA 3CSBA 3VE0B 5FCUL 3UCRA 4KK5D 4PLOB 4P57A 4MQ7A 2OSLA 4X6CB 1DJSA 3OAYK 3ARFA 1MHPL 2CRYA 2NY1C 1A4JB 1A3LL 3MZTA 1MLCB 3KPSA 5HVWA 3HUJE 3MGAA 1KULA 3MFFB 4G9DB 4LLDB 1FL5B 2VDQL 5DQ9B 5FUCE 3RJDA 1CBVH 2HT3C 3EYOB 4WO4C 1RUQL 4Z77B 1GGUA 3BAEL 1HZHH 3BDBA 1ZHKB 1OB1B 3HI6L 3QIUC 1UZ6E 2UWEE 3MRIA 4OSUH 4JN1H 5DK2A 4NKIH 2EE6A 3QZWA 4PJGA 5FYJH 4GQPH 4UDTA 2YD4A 3DROA 3ARDB 5FM4A 4YEFA 3P4LA 4JFDB 3TBSA 4KMTL 3FHQA 1GC1L 4P5KA 4P2QD 1I9JH 3RIAF 3MBED 4KXZI 2F54D 3JV5A 1H15A 1J5OL 3IDYC 5J13C 1SJXA 4C54A 3PV6B 3U7AA 4JPKH 1HH9A 4GKSB 1QBLL 4QRQA 5ERWA 4UT9L 3CVIH 1VESA 1AC0A 2HYMA 1O0VA 2VYRE 4QF1A 1MWAL 1RFDL 3RTQB 4BK4A 4CRPA 3D39A 4XNXL 1AD9A 5DI8A 2XZQL 2YA0A 1ND0A 3FMGH 4U6HB 4TVSa 1WZMA 2EO9A 3JWOL 3X11B 1UZ8B 4Y19D 5INCB 2AK4D 5BZWA 3D6GA 3O2WL 3D9AL 4NQSB 4XB7A 5FGSA 4L3CA 3QEQE 2HFEB 3FTGA 3ZE1E 3T3PF 5JW4M 3SGEI 3RNKA 3ZDXF 1J8HB 3G5XB 3KGRA 1Z9LA 5HGBB 5BZDA 5H37H 4CNIB 3GGWA 4JFEB 1J1OL 4Z0BL 4TPRH 3QEUB 5E95B 3TO4D 4KUCD 3KS0J 5DJYB 2VZ3A 3UZQA 3LEVH 4NRXA 4ZMAT 4RBPH 3GI9L 5CUSL 5I16A 3I9GH 2H1PH 5D7JC 4UBDD 3O4LA 4K71B 2PXYA 3OAUH 2BX5A 3VDBA 4WHTB 4PRBB 3DYOA 5TQ0H 3ZYOA 4G6ML 2FGZA 2AABH 1PBYA 4MNHA 3IS1X 1F3RB 3NFPB 3TBVB 4MNGA 3IFLH 2OR9L 1HSAB 4XTRD 1YEIH 3PJSA 1T7VA 3QQ4B 2ZKHH 3HS0A 3H9SA 3OJ2C 1WWAX 2D9QB 2ZZUT 4I2XE 5ISZB 1H3TA 2EXWC 2ADGB 1DDHA 1NEUA 4GAYA 1JI1A 4DVBB 2VL5B 4MD5A 4JFYB 4NRYB 3C5ZB 4IMLB 4NM4H 1WEJL 3P73B 1VADB 2Q76B 4MYWB 2NZ9D 3QXAB 4M7JH 4MJ5B 2VUOA 4WEBH 2VISB 1KB5L 3F12B 1P2CB 4XH2A 5KANI 1KOAA 1FSKC 3QI9A 1U8KB 2DDQL 2R0KH 4KQ4H 5F7FA 1MCPH 3AS0A 4JHAH 3VXOB 1O5DT 2DWEA 5DJ2A 3VXQB 5EIIB 3AU1A 3B5HA 5CIPB 4IIQB 2V17L 4PRIB 4YBQC 4G6FB 3SKMA 4LEXH 1BJ8A 2A9ML 4MXQC 4Y88A 3MLYL 3SY0A 3KXFE 3VGAB 5AWNH 1LDSA 1FE8H 4PTTA 3SDAD 2XWBA 1S9YB 3FO0L 1YEKH 5HI5C 3BGMA 1FBIH 1I1RA 5GRVL 4HPOL 3Q1SL 4MJ6A 1PKQE 4XP9H 3W0WE 3IDMB 2W0LA 3C9NB 4O58H 5LCVL 5EZLA 3KPRE 3EZ8A 1UJTA 3QRGL 2D2OA 2ITCB 5ECJE 4ZTPL 2CIKB 1CT8A 3CFEA 4UT6H 5T1KB 4K3DH 3IETB 3MRQA 3RL2A 1ZLVH 1W0WB 5IJKC 5JMOC 2O5YL 5HHVL 3B6SA 3SDXB 1N0LA 2HG5B 1JVKA 4J1UB 4E41A 4OM0H 1MY5A 5IW1A 2H32A 5JPNB 1XIWD 1ULVA 3UTTD 4DTGH 3HPJB 3VXMB 3UPRA 1IEBB 1FGVH 4G8FA 1CFVL 1WFUA 5D2LF 2NY0B 4P2RD 1C08A 2FR4B 4HGKC 4I4WB 4WWKC 4J6RL 4OLWL 1HKLH 5C6TH 4XNZB 1FJ1A 2J8UE 4N1CA 1A9EB 2DD8L 3RVWC 3DVGB 3FHAA 5JW5A 1D5IL 3UC0L 3OX8B 4P2QA 2F54A 5I73C 4JHWH 1I9IH 4O2EB 2Z91B 3WE6A 5JPMA 5HI4D 3OAYH 5HHPB 1IGCL 4OUUA 1C12A 1A4KB 3FQWA 3MLVH 3IFNH 4Z7UA 2DQJL 3VD5A 5F6IB 4XPAL 4Y5XC 3AVEA 2AI0L 1C7SA 2XZAH 3G5YB 2FATL 4TVPL 2VDOL 5ICXA 3EO1B 5IQ9B 3MV7D 1KELH 4PLJC 1U58B 4CKVX 4DGVL 1DBJH 1FYTE 5DR5H 3RVTD 1ZLSH 3WS3A 4Y19A 3RWIA 3BFOA 2E6JA 1PZUB 1J1XL 1QFHA 4MHHG 5D70L 3L5IA 5T33L 3W9DB 2NTFA 2ZPKH 4Q58C 2EDKA 3RWCB 5CSGA 1JHKH 5CINH 5IB2B 5ESQA 1QFWM 4APQA 3WHXB 3IB4A 4XRCA 1NGQH 4Y1AD 1VCAA 3TNMB 5I8CA 1Q1JH 1NEZA 5K9JL 1XZ0B 1EPFA 5LG1A 2B0SL 1MI5B 1U8IA 5EOCH 4O2CB 1WCQA 1S8DA 3F7QA 1AKJB 5C08E 4WV1B 5DD0H 3ARZA 2XG5A 3L3KB 3LKPA 3MYJB 5GJTH 3WBDA 4LF3B 4Q9RL 3KPTA 1D9KA 3AFLA 3TCXA 4M6NL 2W07A 1BFOA 1N64H 2C3XA 3KLAB 4FQ2L 2WM0A 3OR6A 1T7XA 4LRNL 3FRPG 4ODVH 2HFGH 3VWKC 2NW3B 4GRMB 4PUBH 3I02A 1CXFA 1CGUA 4KV5F 1QYGH 4LLMB 4R97C 3CLEH 1JGLL 2WIIA 4JY4A 2CRIA 4P3CH 4LCCC 3NGBB 2YBRB 2DLFH 3T8XA 5JORB 4BZ1H 4F8TA 2Z93A 2I24N 4Y5YA 2VWEE 2YZ1A 1YUHB 3F7VA 3QXUA 4JFHD 1JYXA 2BVPA 7FABL 3IU3A 1IFHH 1QOKA 3EO9L 4G6AC 3WJLC 2XKUA 4LSVL 3K1DA 2D7QA 3JUZA 2BVQB 4LOUD 3GMOA 3MRDB 4XXDA 4N8VB 4OZHA 5TDOB 2QLVB 2XPGA 4KY1H 4ZXBC 4E42A 4AENB 4P59H 4F15C 1CBVL 2YK1L 3EKCA 2X1OA 1CE6A 5SWZB 1HZHL 2H2SC 5BRZE 1TZHA 5DUPH 4MNQE 3OKMA 2OK0H 3P2TA 4PB9H 2H6PB 4X7EC 1V3JA 4N8CH 3ARPA 3CK0L 5K9KA 2YPVH 4KJYB 2HT4D 4JFFE 5FYJL 2BSSA 2A38A 5DUMH 3HHRB 2MOVA 4XAKD 4GFTB 5IVXA 1KPRA 4G8GE 1UH4A 3K0WA 3MRFB 1GZPA 1XIWA 3V0AC 3UTTA 4RGNC 5DQDH 4X4YA 5F6HJ 2YPLB 3VGBA 2ZUUA 2CR6A 2Q1EA 2HVJB 4OD3H 5E99H 3FONA 3F7RA 4DGIL 4POZD 2X4UA 3DYMA 2DQEH 5GZOC 4UOJA 1II4E 4PJAA 5L2KB 3LEYL 5DJCA 1CGTA 1F8TH 4U6XA 3NA9H 4MLIA 5DA4A 3CJJA 4M5ZL 5FHAL 2BY2A 4JPVH 4PP1D 3E6HA 3D3VB 5IM7A 4ODWA 2R1XB 1CLCA 2CIIB 3RVUD 1KTDA 3MV7A 3RDTA 3EBAA 3CX2A 4WEUD 4G80B 5DYOB 1DVFC 4PGCA 1KEMH 1RZ8A 5CILH 5J06A 2OM5A 3LEVL 2QR0B 4OCWH 1GIGH 3EYVB 4PJ5A 3I9GL 2H1PL 1ACZA 5L88H 1T1YB 3OAUL 3TJEH 2EDBA 2BC4A 1IGYB 4LLVB 5A2KH 5TQ0L 4F9PC 4EOWL 4WHYH 4OI9A 3WNKA 2CMRH 2IPTL 2I9LB 3BPCA 5A3IC 4NKQB 2AABL 4JVPA 5ITFA 1KIQA 3VH8G 1C5DB 3IJYA 4ZYKA 5E94A 4XP6H 4G3YH 1CGYA 1KB9J 4PG2C 4KRMB 3PP3H 1N7ML 5C09E 1YY8A 2FJGA 3MOQA 4AT6B 4HWBA 2ZKHL 4BQ8A 3MACL 4Z7UF 1S7UB 5ICYA 3V6FA 3VFPB 2EH7H 3HAEA 3VFRA 3UTQA 2CKBA 1FPTL 2ZUXA 5I1JL 2CUMA 1UM4H 3K2UH 3RPKA 4XPGH 1BF8A 4PGDA 3BD4A 5IJVA 5ALCH 5IMMB 4XNQA 5K9OB 2DQCH 1KTLA 4WEBL 4D94A 4JEGB 2LAAA 4X5WA 1KYOK 3NN8A 5DRXB 5ICZA 5JIHA 3TBYA 2R0WH 2WBKA 4V1DE 1MJ7H 5JHDE 1FNSL 3ARUA 1M7DB 1B4RA 2EYRA 3GMLA 4I77H 8FABB 5KTEH 5FKPA 3ZDYF 4KZDH 1FVDB 4HH9A 1NAMB 5DA0B 1T2JA 4QHNA 1L7IH 4D0CA 1HN1A 4KK9D 1FE8L 3CC5B 3FQXA 4G43A 1UT9A 1U93A 1MFDL 3BRDA 5IEKA 2PETA 3N9GL 4NO0B 4QWWC 4XP9L 3NFNA 4ZAKC 3A6BL 4EVNB 3L9RA 3N0PB 3SBWA 1MCQA 4UT6L 3AUVA 1RZIB 2WBJD 3WFZA 3SJVB 4AQ1B 3U0WL 4NZDA 4TYUA 5JXEC 1YEHH 2HP4A 3ZKQD 3QPQC 1KC5H 1QSFA 4M62H 4JY6A 3TPUB 1V7NH 1UM5H 3L6FB 4OM0L 3LIZH 1C5CH 4EDXB 1JZ7A 2XV6B 1FGVL 3PWVB 3G04B 4IRSD 2WINA 3QSKB 3PUCA 3T0EA 4RZCA 1ZT7B 1A7PH 2UV3A 5GRXG 3ILQC 1I9IL 4IRZL 4WW1B 5HGDA 5GRUH 1R3HB 2APVA 1Q0XH 3EYSL 2R0ZH 2FEEL 2VLKE 3PWLA 3MLVL 5FM8A 3REWA 4PJIB 4F2MA 3IVKB 1T3FA 5I1LA 1IM9B 4M7KH 2XNAB 5IB1B 4UTAL 1FZOB 4X7TA 1FFNA 3C60B 1U3HC 1BFVH 4R2GB 1ZWIA 4RAUA 5HSFA 3NACH 1QA9B 4OZHF 1MCNA 3NIGE 3JTSA 3BISA 4PV8A 3KNBB 4UQ3B 2GAZB 3VD4A 1ERNA 1NCAL 1WK0A 1HHHB 1LP9E 3IRPX 1QEWA 2BJMH 2BY1A 1JHKL 5CINL 5GQBA 4B41A 4LLUA 1F6FB 1KCLA 2MQ3A 2EC9U 4OGYH 4F7PB 5JLZA 4UI2A 3I50H 1Q1JL 5F96H 2VLLA 3NCFB 1TETH 4HBCL 4PV9A 3IXAB 2DQUL 5DEZA 2QADD 5IVXF 3H7BA 5EOCL 1CD1A 5FUCC 4KQ3H 1LK3L 3FFDA 2GEEA 3QIBD 4JAMA 5GGQH 1EERB 1K3IA 1QSEA 5EU6E 3BP5B 1O7VA 2CDGB 3V79C 4XCYA 3MRHB 1EIBA 4WUUE 2Q3AA 2FX7H 4V2BA 1JK8B 5EBLA 3BQUB 3OB8A 1N64L 1K4DA 3O2DH 3OHXA 3DUUB 1MWAA 3M17B 4EIGB 5CCKH 1CDHA 4HS8H 4PJAF 4JREB 4TVPD 3VRJA 3WHE0 5HYJD 4H8WH 1LO3L 1PD6A 3C8KA 2HFGL 3DXAB 4YPGA 3S3PA 5LGJA 4PGEB 5E8NB 3K2MC 4PUBL 4G7VL 1JGVH 4EI5C 1QYGL 3F65A 1EDQA 5EZJB 1IGJB 1X44A 3ARDD 3IJHB 2HFFA 4HHAB 5GGRA 3ROLA 4JFDD 3GMQB 2DLFL 1VHPA 2P5WE 3KYNA 3HE6C 2EXYD 1QFWH 3MZGB 4OD2A 1SJVA 1GJIA 5FB8A 4I0PC 4KTYA 4P3DA 3RWFB 1A7NL 1A6VL 1AE6L 4KUZH 1IFHL 3PIQB 3QDMD 4OQ1A 2W0KA 3DVNA 1V3KA 5GS1C 2BNRA 3HC4H 5CJ8A 5J6HB 1U6AL 2BCKA 4RX4D 4K9EC 5D6DA 3RTQD 1WTGT 1YPZA 4ODHH 1CICC 1EFQA 1HXMA 4BQ6A 4Z76A 5IESL 4PJDA 4L3EB 4P59L 2R1YB 1FZMB 2PF6A 1H0DA 1PG7W 4GQ9H 4ZS7H 4QEGA 5D1ZB 5DUPL 43CAA 2VC2L 1JHTA 4PB9L 1LE5B 3PG2A 2DQFA 1G7PA 4J4PA 2GFBA 2WBJA 1Q0YL 1Q9OB 5HYSA 3S37H 1J8HD 1QSVA 2OTUB 4JFED 1FZJA 3LAFA 3E2HB 3O41B 5BQ7A 2GSGA 1AXIB 2R0LH 2WAHA 2Z8SA 3N1QC 5EOTA 3Q0HA 3T3PE 1CE1H 4MHHI 3ZDXE 2HKFH 1CL7H 5DQDL 2OCFD 2D7PA 2UY7A 4R4FH 3ARRA 1T1WB 1KB5A 32C2B 3GI8L 3RWEA 5E99L 1BD2A 1D5XB 1U3JA 1UQSB 1TVHA 5C0JB 3INUL 5DD5L 1A7QL 3QCUH 1BAFH 1VFAA 1ZSDA 2DQEL 3PWNB 1A0QH 4I3GA 1MHCA 1NC2B 3ULUH 1A2YA 1T22A 3O45B 4XHJD 4Y4KB 1JWMB 2ERJB 3UPAA 5JA8B 4HFWA 4L3AA 4CVZB 2PUQT 3Q6GL 3W5NA 4MDJA 3KYMB 3LB6C 1E27B 4JPVL 5ISZD 3EGSB 4WI4A 3R1GL 4JQVC 4GRLB 5H2BA 2PNDA 4G42B 1F00I 1MNUH 1RZJL 3C5ZD 4N90D 3QUYC 4HMDA 2ZWLT 1KEML 4QRSB 5IVOA 3T0AA 1WQVT 1C16B 1FL3B 1IAIM 3GKWL 4LRIA 1HH6A 4IOFC 3LSOA 3OGCB 2HFTA 4WI3A 3TJEL 3WEXA 5F3BB 4MX7B 1KJVA 5F88B 5ABDE 4DAGH 3T2OA 4PRID 1JV5B 5BO1L 4POYA 1M7XA 2W1NA 1DN2A 3EJYC 2J12B 4FS0A 2B4CH 4QHKJ 1T21B 4OT1H 3IXTB 4LDLB 1ACYL 3LN5A 3GSNB 2P44B 1T83A 1XCQA 2IF7A 4HUXB 1ZA6A 3B43A 2EH7L 3VE0A 3GM8A 1DZBA 4OTXH 5T1KD 1G1CA 5EN2B 5LAXB 5EBMB 5E2WL 1A4JA 1CZ8L 4NKMA 1LMKA 4XPGL 4J2XA 3MFFA 4G9DA 5DQ9A 1FL5A 3TVMA 5CEZE 1CGVA 3EYOA 3RRQA 1OAQH 4LSPH 3TZVA 1ZHNB 3HE7B 4JY5L 3VXMD 1RZFL 5IWLC 2NY0D 3ARDA 1N2RB 4NCDA 1CXEA 1WJ3A 3JVGA 2RR3A 2YSSA 1TNMA 5D2LE 2GJ6B 3PV6A 4FRWA 4ZUTB 4HJJH 4GKSA 3G5ZA 2AV1A 3WFCH 1JNLH 5CBEB 1VERA 2YMXL 4KI5D 5INDB 2DQIH 4MS8C 5LGHL 4MQXD 2AP2A 3F7PC 1YEHL 4U6HA 4XNMB 4QTHB 2AJYH 4M62L 3B9EA 1UZ8A 1X6NA 1N5YH 5INCA 2MHAB 3WDHA 5F7EH 3QPXL 5FAAA 3PL6B 1MY7A 2ZCKH 5D8JL 1T5WA 1YNTB 3SE8L 3HZMA 3O6FA 1JWSA 1S7QA 3MXVH 3UAJC 2IANA 3V4VH 4M6OH 4JFEA 1TTFA 4OB5L 4TSBH 5IFAH 3QEUA 4P2CG 5ITBH 1X5KA 4CJ0A 5F7NC 4I18B 1EEQA 4ERSH 1MI5D 2VKXA 3MCLL 5D7KE 5DZOA 1BZ7B 2O26U 1AKJD 4NWTH 1NGPL 3OAZK 4M7KL 3VMOA 4CN6A 4WHTA 4PRBA 4FFVC 1C1EL 3RPIB 3LKQA 1JTTA 2FJHB 4JANA 1YPZF 4HK3N 5ID0A 1UB5B 3HNTH 3NFPA 3TBVA 4PJDF 3O6LL 4XVUC 1I3VA 1QBMH 2IBZY 4HCRL 3ZKXC 2W9DH 1FH5H 1OP3K 4XNYH 1NCTA 3FRUA 4LVOC 4R4NC 5GIRB 2VWEC 3D39E 3KYKL 2ADGA 2BJML 5FA3A 4JQXA 1WGOA 4DVBA 4JFYA 4OGYL 3THMH 4IMLA 1YEGH 2DQDH 3P73A 5CJOH 1VADA 3CDFA 3I50L 3ABZA 3AS3A 1KT2A 1HYSD 4E5XB 3QXAA 3V95A 2VISA 3F12A 3WNNA 1P2CA 5C0GB 3OWEA 1P69B 2JJSA 3MJ7A 2NY2B 4KV5E 4KQ3L 4NFCA 1T03H 2ADJA 5GGQL 1U8KA 4GBXA 3S36H 1FO0H 2DQHL 3VXQA 1U92B 5EIIA 5M94B 3VH8B 5CIPA 4PRIA 2QQNL 5B8CC 5FM5M 2B7DT 4JKPH 3VFVB 4LQ1A 3W9EA 4QKXB 1NDMB 3SQOH 1S9YA 3U79A 1S78D 4MQTB 5CCKL 3O4LE 3RUGA 4Y5VB 4OKVB 5SWZD 3EZJB 3IDMA 1BECA 2A6KB 3C9NA 3QUKB 2O5XL 4CW1A 1TDQA 4NQUA 3TO2B 1IC4H 1RURL 4LSRH 1J87A 3IETA 3RKDD 3QP3A 2W0PA 4MNGE 3OXRA 1FZKB 4R0LA 1W0WA 3X3GL 2UYLB 3PHQB 3U6RA 2IQAB 1WF5A 3H9SE 4G8IA 3BD3A 3F58H 1NBYB 4XXCC 2GHWB 1X5IA 5JPNA 3U4EA 5KN5B 4NZTH 3B9DA 4R90H 4HG4K 1EVTC 3VXMA 1NKRA 4KUZL 2NY3C 3UBXG 2YPLD 3FKUS 1VKXA 2FR4A 1U42A 2NR6C 3A6CH 1LO2L 3WV0A 1BBJB 5DQJA 3HC4L 5L0QB 1VFUA 1A9EA 1NCBL 4JLRA 3OX8A 5HXMA 3GSNL 4YXKH 3RWHA 2Z91A 3LCYA 3VFGL 3G6AA 1PYWB 43C9B 5L2KD 4ZS6C 5HHPA 2X4SA 3PGCB 2WUBL 1LO4H 1ZANL 3SGKA 1F90L 4U0RC 2DBLH 4CMHC 4JO1H 3HCVA 3T1FB 3G5YA 1OQXA 2XQBL 3DVIA 4M00A 3S3JA 3NIFF 5IQ9A 4NUGH 1U58A 4NKOA 3KVQA 4Z0XB 3VA2C 5GGTH 2R0LL 4U1JA 4PJBB 1CE1L 4PP2A 4G6JH 4KH2A 2GYSA 4R4FL 3I85A 5D93C 3RWCA 1MIEH 5IB2A 2IPKB 1G7LB 3MLZL 1AQKH 3WHXA 1VFBB 5DRZB 4E41E 4AEIH 3TNMA 3X12A 5C07B 2HTLD 4F7MB 1A0QL 3MV9E 3RGVB 2O93L 3ULUL 1MI5A 4O2CA 4GW5B 3P77B 5F1OB 1AKJA 4HZLB 4YQXH 5FK9A 4O5LH 4G6KL 4D0BB 5CKGA 2DAVA 4UIKL 3MYJA 4HFUL 3WJJC 3BZFB 4LF3A 4M1CC 4P2QE 3U46B 3S5LG 2I9TA 1MCIA 4U1SA 3VWJB 4HEME 4KRNA 3U4AA 4HLJA 4LDEB 1G9MH 4Z5RB 2A2QT 3MRMB 4Z7UE 3TJHD 3WXVH 1WISA 4ZO9A 3B5GA 4HH8A 3HG1A 4IRSC 3OB0H 5F9JA 4PTUA 1X5FA 4FABH 4PGBA 4GRMA 4K8RH 2W9LA 4LLMA 5F3HB 3OZ9H 5JHLH 5SWQA 1FL6A 5HHNB 3AM8C 3KLHC 3OAZH 2YBRA 3QCTL 3CSYB 1ODAA 5JORA 1ADQL 5KVEL 4MAUH 1CIDA 5DLML 3ZDYE 4NO0D 5I0ZA 1ZHBB 2C1PA 4ALAH 2BVQA 3L5WB 3X3FL 3OV6A 3O0RH 2OLDA 2NY5C 2AV7B 1T7ZA 3WL9B 3SCMA 4N8VA 3VCLA 1FRGH 2OI9B 3SJVD 4YO0A 1J1PL 2ED7A 3GJFB 4J12A 4OLZL 5DDHA 3NCYP 3NPSC 3IDIA 1OAQL 4LSTL 1WBZA 1TTUA 1MCWW 5ALBL 2H6PA 3WNOA 3MTRA 4ZUUB 1QRNB 4P5TB 2GTWB 1IAIH 2IBGA 4NQTA 2ZOKA 2NY7H 3EYQC 5C0CD 3ARYA 2J1KA 4RMTA 4S1QH 1FC1A 2D9CA 3QIBC 2P24B 3L7EB 5LGKA 4PRHE 2NXZB 5DWUH 2E9BA 3MRFA 3DBXB 4HJJL 4W4OA 5FYKH 1A21A 1UKQA 3PE9A 3PXJA 3VFOB 5JQ6H 3BP4B 2YWZA 1GYAA 2ORBH 2VRAA 5C0BD 3LHPH 1IM9D 3MLPA 2VJXA 4NDMA 4S0TD 4KVNL 2C3VB 3C60D 1G7IB 3LRGA 4D9RD 5IW6A 4KKBD 4R2GD 4Z78B 5E1HB 1JHLL 1MLBB 3QEGH 4JJ5A 1URLA 5E2TL 3OL2A 4OZFH 1N5YL 2NW2B 3RUGF 1WBXB 4G7YL 4ELKA 3STZA 3VXNA 1V5JA 1LE9A 3D3VA 3KPNB 4OZHE 2R1XA 2BNQB 2Q6WB 4PRDB 4UAOC 3R06B 5EWIH 4IOIB 4FTVE 3CDGB 4QY8B 1OGTA 1A6UL 3TFKC 5D1XB 4EDWH 5CFHA 1GZQA 4TSBL 1NBVH 5SX4I 3CNKA 1DFBH 1T7WA 2CUIA 1FNEB 3FQTB 2QR0A 4LPCA 2H3NB 3EYVA 1HHKB 2VDKH 4PS4H 5IP4A 5BMFH 3EHBD 4IHOB 2GCYB 1T1YA 2FD6L 4QT5A 5C0AA 1GGIH 5IVXE 3DX8B 4HPYL 4LHUD 1O7SA 1BIHA 2I9LA 2DTML 3BQUD 1X7QB 3HNTL 4DZ8B 5KG9A 2D0GA 3CSPA 1CQKA 1PW3A 2DM3A 3WNLA 5SWSA 4R7NA 4AT6A 4MSWB 1F4WL 5EUOB 1A02N 1CDCA 1ZAGA 2F5BH 3ARGA 1EAPB 4BM7A 2X89A 1DANU 4PJAE 3L3DB 3THML 1S7RB 4MCYB 5HYQA 2DQDL 3QA3B 5CJOL 3OKNB 1INEL 1JWUB 4R26L 5K9OA 2YRPA 5HHXL 3DWTA 2FH8A 3X17A 1KIPB 5AG9A 5JDSB 2HLAB 3QWQB 1SBSH 4ZUSB 1MCOL 3GBNH 4EJ1C 3V0VB 4ZFGH 3S36L 1FO0L 2P5EB 8FABA 4U1KB 3O6ML 7CGTA 2IH3B 2P8LB 1T1XB 5FXCH 5C70A 2P7TB 1FVDA 3L5XL 4KRPB 3U4BH 5GGVY 4PJ8C 4JKPL 4WFHD 5FYLE 1HIMH 2ADFL 3MBXH 3MO1A 4AEEA 4PJ5E 4L3ED 4MVBC 5F9WB 3HC0B 4YDLC 5HDLA 2YD3A 3DMMC 4WY7L 1F4YH 4M7ZB 4NO0A 5E6IC 5D1ZD 5DRNB 3VXPB 4OF3A 4J3VA 2GUOA 1A5FL 1GRWA 3GSWA 1RZIA 1CVRA 5ACZB 3BRFA 4N0FB 1XF2B 4HUUB 2D31B 4F58L 4BA8A 5KVDH 3TPUA 3H3PL 2CGRL 3L6FA 4DOHE 1E4XI 1PJ9A 1DEEB 4KPHH 5DK0A 1JFQH 1OW0A 3IAQA 4R90L 3VXUB 2R1WB 3G04A 3MRKA 4OI8A 3A6CL 4IDLA 3HMXH 5T5FH 4DVRH 1MAMH 5DD6A 5EZIH 5E70A 1JN6A 4YGVA 3P4OB 4Q6IC 5CP3H 4Z7VA 4WW1A 1U95B 4K3HA 1R3HA 2XQYK 1R5IB 2XY2A 4Y4KD 1LO4L 3CXDH 3SDCD 3IVKA 5DJXB 4D9QD 5C8JA 4PJIA 4V2CB 1IM9A 5J7CC 1JBJA 2XNAA 3TIDB 3V6BR 1NUFA 1HILB 1FZOA 1B9ZA 3BEVB 3C60A 3MLWH 1BBDH 4QXWA 4GRLD 4WW2C 1QA9A 5FO9B 4NUGL 3AAZB 2DWDB 5DFWH 1I8KB 5BS0B 3DGGB 3HZYA 3ZDZF 2QHRH 5EOQH 4Y0GA 1A22B 3KNBA 5GGTL 4KKLD 1A6ZA 4WCYH 1MCCA 1DBAH 1G6RB 3OKDB 1HHHA 3HRZB 1ZT4A 4HGWB 1WIPA 5D5MB 4OFPA 5C6PB 1R0AH 1QSFE 4J3WA 4GMTH 2JJVA 1X6LA 4F7PA 1AQKL 5HY9B 2ZUVA 1U8QB 2HVKB 2AXGB 4YHMH 4NNYB 3S37X 5I1AB 4G5ZH 4X99B 1CFTA 4E0RB 3GNML 4QHUA 3T0EE 3L5HA 3H9HB 4YQXL 2Z8WC 4Y4FC 3TT1H 2OL3H 2CDGA 3HZKB 5C0DA 3MRHA 2PO6C 4D9LL 1JK8A 4NO2B 3IT8D 3RIAK 4K94C 5CJBA 4R3SB 2E27H 4ISVB 3CFIC 4XPFH 2DICA 5BVJA 3Q5OA 4FABL 1S5IL 3DXAA 3T0WA 4PGEA 4AZ8A 5E8NA 1DN0B 5DSCB 5FGCB 1I8LC 1FN4A 1S9WB 1W72B 1IGJA 4PGJA 5JHLL 2IGFH 3IJHA 3GMPA 4HHAA 3MSPA 3GMQA 3A67L 1NANH 1T66D 1CVSC 2OTPA 3GM0A 4HIXL 2C7UB 2DLGA 2GJ6D 4MAUL 3RWFA 1NCDL 2G2RB 1AO7B 3KWWB 3UBXI 3PIQA 1IARB 4KJPC 4ALAL 1F11A 4S1RH 4EUPH 4ZUWA 3S8WA 3ARFC 1S7WB 5J6H