4EBQL

Fab structure of anti-vaccinia virus d8l antigen mouse igg2a la5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
211
Chain Sequence
QIVLTQSPAIMSAFPGESVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTSYSLTINRLEAEDGATYYCQQWTSYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHATSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, hea
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 211
sequence length 213
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqL01
2HT3C 1LP9E 3ULUD 3L5XH 3B9DA 5E9DD 4K7PH 4BFIB 2HWZL 3VFVB 4F7TB 1QFOA 4IDJL 4OF3A 4MAUL 3JBG7 2ZCHL 3AAZA 4MLIA 5GS0C 1M71B 4JVUA 4XCEA 2Y7QB 1P4IL 1PAMA 4KRPB 3BQUC 3SKMA 3QWRD 1FHGA 4XWOD 3S6CA 2FJHA 2LAGB 4N5ED 1R5VA 1EHLH 3RVTC 1KT2B 4LHUG 3CFCL 3THML 3PHOB 2CLZA 3TA3B 1B0RB 5EN2B 4C55A 3IGAB 4PLJC 3RWHA 4L8SA 5C0AD 3ILQD 2VZ1A 4JRXD 3MRBA 4OF0A 4JFQA 2GI7A 3RY6C 3CXDL 3IDIB 4L5FL 4Q9RL 4R3SA 4XAWL 2Q7YB 1OTSD 4XB7A 1G9MH 1QFWH 1JGDA 1H15A 1MHCB 1A3LL 1JUFB 1NPUA 3G6JA 3MNVA 5BOZG 4X9FA 4NGHL 2AEIT 2HFGL 4HIXH 4Z0BL 5IJKA 4YIQA 1FIEA 4RFEA 4ERSH 2CDEB 5T33L 3HNVL 1EXUA 1WZLA 2AXFB 4KY1L 5HYSB 4YBLB 5K93A 1E6OH 2I07B 5EU6A 4F7CB 2FBJL 1WLHA 4NRXB 4Z7VF 4K7FB 5KG9A 3DUUA 1A7PH 2VXSL 4U49A 2I5YL 5ESVA 2ESVA 4P2RE 4GBXC 2F53A 5F88A 4FQXB 3MR9A 2NYYC 3VE0B 4XPTL 2EDFA 2O26U 3ULUH 2RFXA 3X3GL 3Q5OA 3D25B 4JG0L 3WNPA 1UQSB 1CFQA 4R4NC 2VR5A 2F5AH 2YK1L 4G6MH 3V5KB 5IHZA 4Q2ZB 4PJ7F 1UZ8A 2YRPA 1QKZH 1NSNL 3PGFL 2HFTA 1OCWH 4ALAL 2VLJD 4F3FA 3K4ZA 4XPFH 2Y6SC 1ZT7A 4ZS6C 3TT1L 3ROLB 1ZK9A 4JZNB 3JXAA 1JPGA 3CX2A 4XP9H 4U1SB 4NIKB 1GC1L 4TVPD 1W72H 1KPRA 2KPNA 4OZHE 1XIWC 4DKEL 3BN3B 3VH8A 3LQAH 3C5ZD 3HE6B 1RAMA 2HJFB 3KYMA 3VU2A 1Z9OA 4KPHH 3B9VA 3SQOL 2K9UA 3EGSB 1GOGA 4O2FB 5CD5D 1T6WA 2VIRA 4WUUE 4LPYA 3TZVC 1PG7H 1FYHB 4PJ5E 2XTJB 5FKPB 4BFIA 3VFVA 4WO4C 2F5BL 1X5JA 5B39B 4F7TA 5DD0L 5CINL 2X1XR 2AVGA 1U8OB 4HD9A 4LPWA 2UUDK 1NCAL 3OF6A 4H5SB 4M7LL 4XNXL 4Z8FH 4GSDH 5F1IB 1HILB 1M71A 3TIDB 5EZOH 1B6UA 4LSUH 2Y7QA 4N90E 4MLSA 1ADQL 4QHUB 2DQIH 2D7OA 5HTSA 5KSVB 4EI6B 4N8VG 1KN4L 3VGBA 2LU4A 4K71C 1KT2A 4PJ8D 3OKEB 3TA3A 1B0RA 4JO1H 1F90H 3IGAA 4U2ZA 3U7WL 3MUJA 3LSOB 5C1MB 4NC0B 4WFGD 1IFHL 5DWUH 1LEKB 3I9GH 2DD8H 3IDIA 4S2SB 4F2MB 2Q7YA 4FZ8H 1MHCA 3I50H 1JUFA 1WTGT 4QXUH 3ZTNL 1DLFH 1C5BL 5D2LE 1JHLH 3ZTJH 3P0VH 1MJUH 4UOJA 5TJWK 1P5VA 1F8TH 2CDEA 5C3TA 5CKAA 3QIWD 1SVZA 3O6LL 2F8XC 3EHBD 2CR6A 4JPVL 4TVPH 4PLKD 2AXFA 5HYSA 2W65B 2VXVL 4F7CA 1TJIL 4NRXA 4OLYL 2X40A 4K7FA 4FFYL 4Y16D 5DJXB 1PYWA 1T83C 5CBEB 3WEXB 12E8L 1G7MB 1QSFB 2ZNWA 1MHPL 4LSSL 4FQXA 3OKDB 5EUOF 3C60B 3VE0A 4C4KT 1UVQB 2V5RA 3NAAH 4TTDC 3D25A 3DI3B 2IJ0C 2NXYC 3VXRE 3D3VE 1TZGL 1UQSA 2HKFL 1O5DT 2V7NB 3QWOB 2YHGA 1RIUL 3MJ9H 4ZTPH 2P43B 3V5KA 2V5SA 4YHLH 4Q2ZA 4FS0A 1G9MC 1WWCA 4G6AD 1TVHB 1EO7A 3T2OA 4EDWL 2HTKD 5FCUH 2JJUA 5JDJA 3QXTA 2WMPA 3FRPG 3ROLA 3R1GL 3MV9D 3ESVF 4JZNA 3L3GB 3V9FA 4DQOL 1DP0A 5MP6L 4UT7L 3DETD 4MD0B 3CFKB 3QFJB 1W2KT 2AQ2A 3M1BB 2ZJSL 4U0RC 4ZXBD 5F8QC 3KYNA 2HJFA 4PJAB 3UO1L 4JFED 4P4KC 1JMZA 1KOAA 5GRJH 1WK0A 4EBQH 1WCBA 3ULUC 4YHYB 4LLWA 3EGSA 4O2FA 3ZE2E 2DJSA 5JXAL 5C8JB 3UDWC 5LBSL 5D7JC 1FNSH 5FKPA 2DQHL 5JUEH 4ENED 3ULVL 4DGYH 5B39A 5J89A 3ZDYF 3NH7H 1BECA 5EC1A 5KSBE 1U8OA 4GG6F 4R0LC 5J9PB 4P2QB 4IMKA 4Y8AA 5JPMB 4GFTB 4OBRA 5C0FB 4IJ3B 4HCRL 5F1IA 1HILA 1BMGA 4XWOC 3TIDA 4HUUB 3V6FB 2XWTB 5J06A 4JZJB 4QHUA 5E03A 5GRVK 1F42A 5KSVA 4NC1E 4DGIH 1JFQL 5DD5L 5GGRY 2R0WL 4EI6A 3NBNA 2AV7B 3U7YL 4PV8B 3ILQC 5HYIA 3OKEA 2ZZUT 4L9DA 2ADIB 5TPWH 1OTSC 5DK0B 1UXWB 1MCRA 4J6RL 1VFBB 4S2SA 4F2MA 4FQPA 1HKLL 1FIGL 2OM5A 1OGAE 4HWBH 4Y19E 3ARUA 5EDXA 3M07A 5LGJB 3S34H 3EDKA 4YPJA 4FP8H 5BV7L 2HRPL 5JW3L 2H32H 5DHVB 2BY2A 2O5YH 1NUNB 3P9MB 4QHNB 5C0GB 4YHKH 3GNMH 1A47A 1CK0H 3HZKB 4QHKJ 3OL2A 4Z7NF 3VXTA 2W65A 1EFQA 4KVCL 3MLZH 4FNLH 5F9JB 1YEJH 1RZ7L 5DZNA 3CVHH 1KCRH 1SMOA 4Y4KC 1MCNA 3D1MC 5DJXA 4RBPH 5CBEA 4R26L 3WEXA 2J3SA 1G7MA 1QSFA 5I73C 3V5DB 2X44D 4NOBA 5H35B 3VFSB 3WDHA 2OZ4L 3OKDA 5L6YH 3C60A 1LNUB 1S3KH 3RAJL 1UVQA 1FNHA 4LAQL 2QHRL 4WWKD 5GRXG 1DBKH 3QDGE 2YMXL 3QWOA 1CD1A 2DOCA 2YUXA 2AJUL 2W9EH 4DN3L 4LP4A 2A83B 2IGFL 3ETBF 1TVHA 2D9CA 2DF3A 4JDZB 4ODUB 4PJBE 5D7KE 3AS1A 3N9GL 3VGAC 3O4LB 2JB5H 3LMJL 5KW9H 2VXUH 2VQ1B 4PP2B 4X5WB 5BO1L 4N0FB 3BKCL 4DGVH 4HMCA 4NKDB 3WFHB 3K8KA 3U9UB 1X9QA 4ZD3H 3L3GA 4MX7A 2WIMA 4MD0A 4F7EB 3Q6GL 3CFKA 5IHUL 3QDMD 3QFJA 4OLUH 3C5ZC 1JGLL 4DN4H 3M1BA 3CIQA 2B1HL 4K2UH 5L8LB 4GW4B 3GSWB 4MJ2A 2A0LD 1YPZA 4PJAA 1RJCA 1ZLVK 2VN7A 1KCLA 4KTEH 3C5JA 4ZFGH 4MAYB 2P7TB 1MFAH 1YEKL 4WFHD 3FN0L 5HHXL 1QUNA 2CGRH 3D18A 5F7FA 4KWUA 3ARFD 5I71C 4GW5B 1RHHA 4Q9CA 5J9PA 5D7SL 4P2QA 5JPMA 5ESQB 1H8NA 1WFOA 4G8GE 5C0FA 4HUUA 4TSAH 3V6FA 2XWTA 3OJVC 4JZJA 4PJ8C 3OAZK 2ADFL 2AV7A 3CMGA 3RKDC 1CGYA 2AJVL 4CVZB 5H37H 4HIHB 4ELKB 4NJAL 1JTOA 2ADIA 1YEEL 2QKIB 1NC4B 1LO0H 5F8RC 5DK0A 1UXWA 1VFBA 3I2CL 3E0GA 5LGJA 2YKLL 1HCFX 4X8XA 4ODBD 3V4VH 4FA8A 3V8OA 2Y36H 5DHVA 4X6DF 3RU8L 3P9MA 4QHNA 5C0GA 1HYSC 4PLKC 5E2VH 3HZKA 3BN9D 3RGHA 4C56B 3VFPB 1YC8A 3BKML 4Y16C 3LQMA 1B2WL 3KG5A 3TJHD 1KN2L 5LXGH 3V5DA 2AGJL 5L2KB 3RUGB 1EH9A 4G7VH 4AQOA 2HVJB 4KRLB 2UVFA 4LARL 2X89A 4UNUA 1DCLA 4L3ED 1LNUA 4EJ1C 4F33A 5DURD 3VMNA 1NAMH 1RZGB 2IPKB 5AG8A 5DHYB 1TJGL 1EMTH 5IMMB 3C08L 2HTKC 2W0KA 2A83A 4D0CA 1UT9A 4XAKD 4M7JL 3B9KC 2OJZL 4JDZA 4ODUA 3S4SG 5ID0B 4P9ML 2AABH 4DOHB 3O4LA 3BP5B 4ZFFB 2YPLB 4MGXA 4LAJH 5KSAD 3SJVD 4ZO6A 2VQ1A 4PP2A 4X5WA 3F58L 3GSNB 2QADD 1S7QB 3H3BC 4N0FA 4NHCH 1BJ1H 2DQEH 2PN5A 1HQRB 5F7EL 3OAUL 4N0YL 4NKDA 2OL3H 3WFHA 3U9UA 3LRHA 4I3GA 4JVPA 3WSQH 1TQBC 4XP6H 3EKCA 1P4BH 4F7EA 2CIIB 5F1NB 2YXMA 3SGJA 5JHLL 1RZFL 1FJ1B 3STZB 4GW4A 2IANE 3GSWA 1H5BC 3QHZH 4AG4L 4LHUB 4N1HB 4MAYA 1IM9D 2P7TA 1GHFH 3P30L 2VXTL 2P5EE 4NO0B 3FHAA 4J4PA 4O51B 3DWTA 5E2WL 3BP4B 5CWSB 5C86A 1XH3B 2BC4B 3MV8D 1HHJB 4GW5A 3K80A 1D5IH 1CI5A 4HEME 5JMOC 1NGXB 4PG9B 4KV5E 4D9RE 4YPGB 5ESQA 4U1LB 3ZKXB 3DARA 5JNYB 3BPOC 1V3JA 2NMSA 1MHHB 3DRTB 1MFCH 4NUGH 4CVWA 2VABB 4D9QE 5ISZB 2YPKB 4CVZA 3BJ91 4HIHA 4ELKA 5GGRB 3TLRA 1SM3H 1CU4H 2ILLA 5E00B 2QKIA 1NC4A 4LRIA 3H7LA 5JR1H 3P0GB 3O2VH 5T3XD 2CKBL 4NQUA 4XRCB 3NIDF 3T77B 1OAUL 3T0EA 3ZSSA 2NY2D 3O6FD 1KB5H 3RIFF 3PQYD 1WIOA 2OLDA 4BA8A 3BXNB 4PRIB 1MWAL 4F15B 4ZAKC 2XN9B 1CL7I 4PJGB 1UZ6E 4NCDA 4G7YH 1J87A 3VFPA 4Y2DC 1FAKT 5IVNA 3QA3B 3OSKA 3HE7B 4B41A 2DM4A 4YXLH 1Y6MR 4OD1H 5H8DA 4DVRL 1F3JB 2K7QA 4AENB 5L2KA 3RUGA 2VLKB 4WWKC 2HVJA 2Y5TB 5MEPB 4GXVL 2D31B 1RZGA 3EBAA 3I6KB 5D7IE 1CLOH 1B4JL 2YD6A 5DHYA 4M7KH 2AAVA 4QRTB 5IMMA 1GH7A 3FFCB 5IGXH 1WF5A 3BD3A 3U36B 3QIUB 5DMIH 5ID0A 5JOPD 4ZFFA 3BP5A 3A0OA 4OM0H 2YPLA 4J7RA 4CMHB 3GSNA 1S7QA 2FGZA 4LCWD 3QJFB 4U7KA 2VLLB 4WW2B 1ZLUK 1HQRA 1JYXA 3JWNC 3HFMH 3OZ9L 1FGNH 4UILL 3QR2A 2Q86B 5I1HL 3RL2B 3V0VB 2MWCA 2CIIA 2VC2H 4XNUL 5T3XH 4GAJL 5F1NA 3QH3B 2PTTB 1PW3A 1ZHLB 3KXFE 2K1MA 1FJ1A 5FM5M 3STZA 5BS0B 1G7HB 4YFLI 4XC1H 2R9HD 1CFSB 3RHWF 4N8VB 5EORH 3JVGA 1SVCP 2F8OA 3IU3B 3ARGC 4TUKL 4LHUA 4Z6AT 3H9ZA 3IDYC 4FG6D 4L4VB 4NO0A 5E7BA 5J6HB 4O51A 4MCZB 3ARFC 5LGHH 1MJ7H 3BP4A 5CWSA 4RAHA 1CL7L 2Y06L 1XH3A 2BC4A 4NN7B 3IDUA 1HHJA 3HMWH 2GYSA 35C8L 1NGXA 4PG9A 2NR6D 5C08E 5ADPH 3CX5J 4U1LA 5DMJB 1QVOB 1NQBA 1FLTX 4NQCB 5JNYA 1MHHA 2DQTH 4NWTL 4IBLT 3O3BB 3DRTA 3QEGL 3SCMD 4JFHE 2VABA 5ISZA 2YPKA 3F7RA 5GGRA 3LKPB 5L9DL 3A6BH 1NJ9B 2R0LL 5E00A 3H42L 3ARED 1ZOXA 1HHGB 3ULVF 2FGWH 1ITCA 1OTTC 1P84K 2WBJD 4E41D 3T77A 1MCPH 4YAQA 4U1MB 2P8PB 1BVKB 3AC0A 3BDYH 3LV3B 4PJXA 5JQ6H 2B7DT 1JZ3A 1UJ3B 3GFUA 2AEWA 3UTSB 3TO2B 4D0DB 4H1LB 4X7TA 3BXNA 4PRIA 3GJFA 5CMAB 4U1KA 5C7XL 2XN9A 2HTLC 3IDXH 3QUZA 1BVZA 4P2CG 4PJGA 3ZE0E 4UTBH 4LVNC 1J10A 3NMEA 2QEJA 4KKCD 4XP1H 2APTA 3HE7A 3LS4H 4OCWL 4NOFA 1OAKL 3C87A 2DMKA 1NMAL 5DRWB 5GPRA 4HSQA 1ZXQA 5TDPB 4AENA 5MI0B 1NCBL 3WFCL 2EEAA 2VLKA 5J7CC 1J1XL 2Y5TA 1MI5E 4YDIH 3LB6D 5MEPA 4KZEL 5EC2B 3RBGA 1RMFL 2D31A 2FH6A 3I6KA 3E3QC 5DZOA 4TPRL 2UWEF 2FX9L 1F4WL 3OAZH 4QRTA 5SX5H 4QTIH 3JWDH 4HKZB 1VPOL 3FFCA 3WKMH 4ZO7A 2CXKA 1GIGH 3C8KB 3P4NB 3U36A 1D9KD 4OD3L 3QIUA 2QADC 4Z9KB 4D94A 1S7UB 1RD6A 2ORBL 4XPGL 4M9OA 1Z5LA 3B2VH 2EO1A 2N4IA 5I15L 2DIAA 2H9GB 2CKNA 4LCIL 3QJFA 4WW2A 1MCJA 2VLLA 2WK2A 4AMKL 2F19H 3RL2A 4QEGA 5DVMA 4XPBL 5E8PB 3V0VA 1F45A 2HWZH 5KSUB 3BRGC 3HAEH 4LDLB 1OY3B 3QH3A 1ZLSH 4IDJH 5HDLA 3EYVB 1ZHLA 4RX4D 2ZCHH 1WZMA 4LEXL 1G7HA 4LLYB 4UV4H 1X4XA 5SWZB 3SDAD 1MELA 5BS0A 2V2WB 1CFSA 5LQBL 4V2BA 4Z7UF 3IU3A 1DBBH 4B0MM 1YN6B 1L0QA 5EU4A 3QDJD 3CFCH 5EZIL 4OIBA 1SYVB 3GHBL 3O8XD 4E0RB 5I19H 1U8JB 3TBVB 2VMFA 1F6LL 4UINL 1BGXH 1A64A 1VERA 4L5FH 4Q9RH 1QVOA 4NQCA 1D5XB 4JM4L 2LVEA 1MFEL 3O3BA 2FO4A 3BGFB 1D5MB 1EAPB 2Z9TA 5EOCJ 3UC0L 4NGHH 1GAFL 3LKPA 4Z0BH 4TOYH 2JJTA 5T33H 4XP4L 3HNVH 4PBWD 1WFUA 1HHGA 1CXHA 3FAWA 2VSCA 2X4SB 3PJSA 4XB8A 4U1MA 5I8EB 1LP9F 1MIEL 1MLBA 2P8PA 1A7NH 2DKSA 2M8XA 2VL4A 2VXSH 3LV3A 2I5YH 2NZ9C 4W81A 1UJ3A 3UTSA 3TO2A 1BZ7B 4H1LA 3SY0B 4L4TB 1T5XB 1FO0H 5CMAA 5D93C 2R0KH 4XPTH 4Z7OE 4YDLB 2NX5E 2ZUQC 4OI9A 3X3GH 4JG0H 5ITBL 4ODWB 3BPLC 4OCXL 4EN3B 3T0WA 4Y5VC 4N8PA 2WP3T 2N56A 4XBGB 3QUXB 5FOBB 3RGVB 4JO3H 3FRPA 4P59L 1VESA 3R0MA 5DRWA 5HI5C 4JPWH 5IK3B 3PGFH 4ALAH 5TDPA 4D9LH 4HH8A 2XXMB 3ZYZA 3TT1H 5ALBL 5EC2A 3VFGL 6FABL 3WUWA 1INQB 1M1SA 3DXAD 3VXUD 4DKDC 4NCC2 1YEGH 3SE4C 4JHBA 3V4PL 3EYUH 5KTEH 4HKZA 1VEOA 3CZJA 3OB0H 1PX4A 2XZCL 2XWBB 1I1AB 3C8KA 3P4NA 4DKEH 4AEHH 5J1SC 2BVYA 3WNKA 1S7UA 3BH8B 4MJIE 2H9GA 5FIEA 2ICWB 4PUBL 4X98B 1YY9C 3V6OA 5CBAA 1GGIL 4HF5L 4L9LB 5L88H 5EBLB 2HFEB 3GIVB 4NQEA 5I6XB 5D1ZD 1N6QL 4OKDA 3T3ME 3G6AB 5E8PA 4OZ4B 1GGYA 5KSUA 5DD0H 2LAAA 2VXQH 3SO3C 3EYVA 2CDGB 1W0VB 4MXWH 1NCAH 3W0WA 4LLYA 5SWZA 1JF6A 1PY9A 2V2WA 4XNXH 1N2RB 2BNQB 4FG6C 5IIEB 4X6CB 1G7IB 2LFGA 4JVWA 1MLCB 4JRYB 4YO0B 1YN6A 2GHWB 1KN4H 1G9EA 5I0DA 4Y5YC 4HPYL 1SYVA 5DJ8B 5DK3A 2X4PA 4YR6B 4E0RA 1Y0LB 1MOEA 3BE1L 4XPHH 1OOAA 2NR6C 1U8JA 4LL9A 1RJYB 4YQXH 4L8DB 5SX4I 3TBVA 2DIJA 5B3NA 3PNWB 5F89B 3RWGB 4WHCA 2BOBB 1EV2E 5T1KB 1AD9A 3SCMC 3RKPA 5FUZL 4D8PB 5H94B 4PB0L 1D5XA 5I8KH 2EXYC 3F12B 1D5MA 1EAPA 1TETH 2PYEB 5IBLC 2VDRL 3EO1A 2WAHA 3C9NA 4HFUH 9CGTA 2VDKL 4KXZI 1TVBA 5C09B 2WBJC 4JPVH 5CLWA 4IRSD 1B4RA 3ULVD 1J8HE 1ZLUH 4RGOL 4KTDL 1M7XA 2CJUL 3VXME 1RIHL 4WEBL 5F6HI 4OLYH 5I8EA 3S7GA 1CXEA 3L3HB 4AM0A 3G04B 4PRPD 1NUDA 5J1AB 1KNOB 1XEDA 1MHPH 1BZ7A 3SY0A 3TO4C 3P73B 4L4TA 1T5XA 2FX7H 1II4E 1M7IB 5HDBE 4NQDD 4KKCC 2JK5B 1G6RB 4K7PY 4OF6A 5H2BB 4YBHA 4AEIH 2HKFH 2NY5H 1HH9B 5E8OB 2IAMD 4KK5D 3WIHA 4XBGA 3QUXA 3F6IA 5FOBA 3O3EB 3RGVA 5IESL 3PWLB 5IK3A 3KPSB 2NZIA 1I8LA 4BQBA 1OAQL 3VRIB 5HGHB 5JHDD 1INQA 5MP6H 1AGEB 4WVRA 3ARDC 5IEKB 1ETZA 3I6LE 5D2LF 5EU6E 2ZJSH 2GEEA 2XWBA 3ZKMD 5CJQH 4M48L 1L7TL 4PGBB 3UO1H 5KANG 4P4RB 1X5GA 1H3UA 3U0WL 3BH8A 1DVFB 4U4BA 2ESVE 2ICWA 3GMQB 4N9OB 1JZ8A 4L9LA 2QSTA 2EIDA 2HFEA 3GIVA 3MJ8B 1INDH 4KROD 5F21B 2ZG1A 1ES0B 3G6AA 1DR9A 4OZ4A 3ULVH 4PJEB 4KC3B 4JEGB 3SDAC 1AGCB 1YEHL 1NGQL 1Q0YH 2CDGA 1W0VA 1KELH 4GUPB 4AIZB 2CSPA 3G5YB 5CUSL 1T1XB 4YXKL 3U2SA 1N2RA 2BNQA 5IIEA 3B43A 4X6CA 4NBXB 1G7IA 1MLCA 3AVEA 1QRNB 4NKOB 5DVLA 2OMNA 3SOBL 4EUPA 4YO0A 4HPOH 4RA3A 1JFQH 3PDDA 3O8XC 3DO3A 1BIHA 3DECA 2G60L 4GOSA 5DJ8A 1CGWA 5E94B 1Y0LA 4HC1L 5GZND 1RJYA 4F58H 4L8DA 2GFBB 4ZYKB 1HDMB 3PNWA 3N50A 5F7WC 1QZ1A 1AC6A 5F89A 2GSIA 3O2DA 4I0CC 3RWGA 3SDYL 1CFTB 2JKXA 4EOWL 1HKLH 5GGUB 2BOBA 4UUJB 5T1KA 2DLFL 4Z7WB 4D8PA 5H94A 2ZOKB 5IW1A 4TUJB 3MGTB 2V17L 2WWKO 4OT1L 2HRPH 5JW3H 3RWJB 3SKUD 3WFBH 2PYEA 4OZFB 1X6LA 2EDYA 1I9EA 4UAOB 3SDCA 5C09A 4YNYB 5ADOH 3GSOB 1JIBA 4KK6D 2OK0H 1EA9C 4AK1A 5B38B 3O3UN 5IF0B 3JUZA 1RZ7H 3ZE2F 2VQTA 3FL7A 3L3HA 3G04A 4R26H 5J1AA 1KNOA 1J0YA 1JYNA 5DJDB 2OZ4H 2GTZB 3WHE1 5KSBF 1BIIB 4K3DL 4YLQT 1M7IA 2QHRH 4Z95L 1G6RA 5H2BA 4PV9B 5AYUL 1YEFL 3FJTA 1HH9A 3VD7A 5E8OA 3O3EA 3QUMB 3PWLA 2OR7A 4PD4J 4JY5H 4R97C 3KPSA 3TVMC 2E7LA 4M1DL 1FFOB 2ZWLT 5HGHA 3VRIA 3BKCH 1MFBH 1XGQB 4O5LH 4QY8A 4U7MA 1FVDB 4MD5B 1UYWH 1BBDH 2BNUB 4CN6A 3BYTA 3GSUB 3QI9C 1AGEA 1Q9OB 5K9JL 5IHUH 5IEKA 1ZV5A 1U2HA 1JGLH 4OFDA 4X7DC 5FYKE 3ARBD 2QQLL 5D8JH 7CGTA 4PGBA 1UFUA 3MREB 1FBIH 4ZSOB 1A6UL 4BZ1L 1DVFA 4YFLF 1UACL 4DK3A 4HUVB 1D5BB 3GMQA 1RUKH 5TE4H 3MLSL 1YEKH 2H41A 3MJ8A 2H2SD 3WFZA 1CTNA 2NY5C 2APWA 4PBXA 4QLRA 4XVJL 2X9WA 1ES0A 4WTWA 1NMBL 4PJEA 1Q38A 4P2RD 5HI4C 3QUYC 5CZVL 1AGCA 2IFFH 1WFNA 4GUPA 4AIZA 4GXUM 5IP4A 5D7SH 3G5YA 1YY8B 1T1XA 5F7YC 1EGJA 1T0MB 1A1OB 3DV6B 4PG2A 4UIMB 3LVEA 4NKOA 1QRNA 5KAQF 3QXAB 1DN0A 2NY6B 1AR1D 5A16B 4K3GA 3TN0D 4PJBF 1J1PH 3UAJD 5E94A 1YEEH 2V2XB 1T7WA 1EERB 1IKNC 4JAMB 1HDMA 4ZYKA 1G6VK 3NPSC 3IB4A 4K3JL 1CFTA 5GGUA 1EJOH 1TQCB 2BHZA 4Z7WA 2ZOKA 4TUJA 3MGTA 1NCTA 1ONQB 3CDGB 2F54B 3I02B 3RWJA 3BKJL 2ZG2A 4OZFA 3ZYJA 3MOQA 3DX8A 3RU8H 1OSPH 4P5KB 4ELMB 1QA9B 2YPVL 3ULVC 6CGTA 3EYSL 1JGUH 1WEJH 4CJ1A 4ODHL 3OKOB 5JW4N 3GSOA 5B38A 3HMXA 4HG4J 5IF0A 1B2WH 4KK9D 4WUUD 5IROA 4J1UA 5TF0A 4PJ5D 3V79C 2VUYA 1KN2H 3CU7A 3MJ7B 4NCC1 4RMRA 1ROWA 2IMMA 2AGJH 5DJDA 2GTZA 5L2JA 2XZAH 1W8NA 2IAMC 4KK5C 3SEPA 4N90D 4PV9A 4IMLB 1WFTA 1TJGH 4OD2B 5I74C 4FXKB 3C08H 2EKSA 1A02N 4FTVA 4JM2D 1MF2L 3AM8C 1A6VL 3QUMA 4F37F 3MMEB 5C3LD 4KMTH 3MRKB 3OPZH 3OMZA 1QTYT 5FGBC 4RISL 4WGWB 1E4KA 5ENWB 2N1KA 1FFOA 4HKJB 2VH5L 1K85A 3OAUH 1R5WB 1X7QB 2A6IB 1BQHG 1HOCA 2XICA 1FVDA 4HWUA 4MD5A 1V5JA 4DW2L 1TENA 3VD5A 3WO4C 3GSUA 4JZOB 1NLDL 2I9LB 2NXYB 2FECI 1LD9A 3KYOB 1NCCL 1XGTB 4K8RL 3MREA 5T1LB 4ZSOA 2Z92B 4NZJA 5HHPB 3NIFE 1QSFE 4AG4H 5FDWB 1D5BA 3SE9H 1F11B 4UOW1 3B5HA 3QEHB 4S1RH 4L8CB 3FRUA 2HAZA 3GI8H 5F7HA 2PYFB 4HK3N 2R29H 3AUVA 5GHWL 4GS7C 5BCAA 1S7TA 4JQXA 4FZEL 4MDIB 3LOWA 4YXHH 1YY8A 2OI9C 4LQ1A 1T0MA 1A1OA 3VXRD 3DV6A 4UIMA 1JPFB 2BDNH 5CZXC 2FWOB 4HZAA 4U0RB 1B88A 3QXAA 4POZD 3D69B 5A2FA 4XC3H 5GZNC 5A16A 1FV1B 4UZGA 4I18C 4FQ2L 2V2XA 3KVQA 2IH1B 3QFJE 1QBML 2HLAB 4DFHA 4JAMA 4MDJB 3WJJC 1E6JL 1OAUH 1FNGB 1BJ8A 1KYOJ 4Q9QL 4GJTB 1YPZE 1I1RA 4Y88A 4UIKL 3CMOL 2WUCL 2Y4SA 1ONQA 3CDGA 3LKOB 2F54A 3I02A 3UJIL 2D7NA 1FCGA 1MWAH 1MHEB 4LSDA 1JWSB 2BRRL 1S9YB 4ELMA 1QA9A 3VWKD 2FHCA 4P0DA 5CEYA 2ZUWA 3D85D 4KK6C 1UENA 4QRRA 1KJ3H 4S1SH 1CFNB 5E2UL 3IS0X 4JPIB 1HIMH 3OKOA 4ONFL 4BK5A 3RNKB 4P2QE 3FMGH 1I4FB 1W72B 5FYLL 2FECL 2HG5B 4UQ2B 1T20B 5I76B 1RZJL 2QV2A 4DVRH 4IIQB 3C09C 4JR9L 1KXTB 4K9EC 1BPVA 1Q1JH 4XCCH 4KV5F 5KN5B 5TE7L 2L7UA 3HKFA 4IMLA 1B4JH 1PZ5A 3LD8C 3V0AC 3EO9L 4QWWD 4FXKA 4NKQB 3U9PL 3WBDA 3NVQA 1NGPL 1ZEAH 3U46A 2LVCA 3MMEA 3MRKA 2Z35B 3SGDI 5ENWA 2EDKA 3JWOH 4HKJA 4HS8H 1X7QA 3GK8L 3IRZA 2A6IA 3QZWB 1A0QL 1I9IH 1T83A 1TCMA 1OGAD 4UILH 5GRUL 4Y19D 1ZT1B 5I1HH 4JZOA 5IB1B 4CVXB 1CDUA 1N5AA 4XNUH 4K55A 5L7XH 2I9LA 3MXVL 4GMSH 3WMSA 3KYOA 1XGTA 5F93C 3CPLB 5F7KC 1DQTA 5T1LA 2FH8A 2W60B 2Z92A 2C1OB 5HHPA 3UPRA 1FSKC 2H2SC 5AZ2H 1F11A 2VLJB 2BHUA 3E8UL 3QEHA 3G6DH 1EEZB 4I0PB 2F9BT 1AQKL 2C1PA 4L8CA 2GTWB 4OAWB 3SDDD 2C3GA 4LPVA 2PYFA 1KPVB 2HA1A 2BHYA 3J7HA 2GSGB 3UJJL 3OHXB 1BLNB 4FN0A 4IS6B 2G5RA 25C8L 3AMKA 1JPFA 3QDGD 4HULB 3TN0C 2CR3A 4NWTH 4PRHE 3D69A 3UAJC 4RMTA 1AGDB 2NNAB 3QAZB 2HJLB 1FV1A 5D7KD 5L9DH 3T08A 2R0LH 2IH1A 3LN4B 3S3SA 1GJIA 2HLAA 1H9VA 4MDJA 1KIQA 1P7KA 4I2XE 1R3IL 4WTZA 3V95A 3MBXL 1K4DB 1LEIB 3GB7B 3LKOA 3SDXA 1MHEA 3AFLA 3QWRA 5C7XH 3S5LA 1JWSA 2DLHA 3VXOB 3HUJB 1CXLA 3ARRA 3QIBD 4MMXC 3QHFH 2CRYA 5F9WC 5ABDE 1T04A 1UH3A 5I9QC 4M7ZB 4KK9C 1CFNA 4P5TC 3SBWC 4YHPB 3FQNB 1IC7L 2B0SL 4WV1C 1LE5B 2VOTA 4N0UB 3RNKA 4OCWH 4HMDA 3P4OB 5E08H 2V2TB 1JZ4A 4YZFE 1I4FA 1OAKH 5HVHB 1JPTL 1W72A 1S9VB 1FAIH 4NQVB 2HG5A 4UQ2A 1I7UB 3BD4A 5I76A 3JTTA 5CHNB 4IIQA 3WFCH 2YS4A 3QCTL 2EH7H 5KVDL 1J1XH 1J5OL 5KN5A 4G8GD 2C3HA 2BMKB 5DJ2B 5SV4A 2PXYC 4HV8B 3QIWB 3BZFB 3DYOA 1MCBA 3T0BA 3NTCH 3T0EE 3TBTB 2QL1A 3GMPA 2Z35A 2ORBH 3EDJA 4XPGH 5DVNA 3V7AG 4Y16B 5I15H 2PF6A 4LCCA 4EI5D 1A4KB 3MLWH 2D7PA 1KEGL 1K8DA 5J8OA 1BQSA 3QZWA 5HD8C 4AMKH 1GOHA 3AB0C 5IFHL 4CVXA 4EVNB 1XGYL 4XPBH 3N85L 3DO7B 4Q6IC 1DFBL 2CMRL 1CGTA 2AEQL 4FQJL 3CPLA 5LQBH 4OQ1A 3ZE0F 1FFQA 1QSEB 2W60A 4Y4HD 5D72H 2C1OA 4P2YA 1XAUA 2XOTA 5L2KE 1MRCH 2ED7A 5FYKL 2VLJA 3JSSA 3RUGE 1EEZA 4I0PA 2GTWA 4OAWA 2HJKB 3MV9B 1BFTA 5EZLB 1S7VB 3GHBH 5T1DL 1KPVA 2R4RL 3JV0A 1QD0A 3CH8A 2GSGA 4OGAD 5E8DL 3P11L 4UINH 3OHXA 2J4WL 1T89C 1BLNA 1CDBA 4ZXBB 4IS6A 4POZC 4DOHE 1J0JA 3V6ZB 1TPXC 3JWOC 3CVHB 3VXSE 1MFEH 1FFPB 4MNGB 5GS0L 1QNZL 3TIEB 5LKNA 1AGDA 2NNAA 3UC0H 2HJLA 1KC5L 1GAFH 3MCLL 4WU5B 4U1NB 4NN5C 4XP4H 1JNLL 4XP5L 1CYGA 2P42B 4XMKH 3LN4A 4KDTA 2GITB 2XRAL 4KDVA 4WEUD 3DV4B 3EDFA 1OT1A 2D2OA 1EHNA 4QOKE 3D39E 4KJWC 1A4JB 2NLJB 2LTQC 1K4DA 5FM8A 2G9HA 5DK2A 1LEIA 3QUKB 2B5IB 4MVBD 3GB7A 3LH2L 2PKDA 1G7PB 3NFSL 4KFZC 1TTGA 3BPOB 4U6YB 2IAND 3HUJA 3VXOA 5KZCD 3QG7L 1H8SA 5ITBH 4UMGA 3M8OL 2AXHA 4OCXH 3MYZA 4XTRC 1KFAL 4YHPA 1AY1H 4RMUA 2P5ED 1YNTB 1LE5A 5B8CA 4N0UA 5C2BL 1WWBX 2V2TA 3P4OA 2P45B 1B0GA 2EC8A 4J3TA 1S9VA 4P59H 4G6JL 4EQ2A 5E4EC 5CHNA 2QJDA 2R23B 2A9MH 4U1GB 1JZ5A 4D9RD 2UZIH 5ALBH 1CD8A 2FYYB 4WDIA 1WAAF 2PTUA 2FATH 4N9GB 3VFGH 4QWWC 6FABH 1JZ6A 2APFA 5CJOL 2BMKA 4NC1C 1XR8B 5DJ2A 4F8TA 3FO9B 4HV8A 3QIWA 2ZSVB 3BZFA 3RPKA 3BUTA 2DN7A 1ZVSB 4OF5A 4OM1L 4H0HB 4D9QD 3GRWA 1W8OA 3TBTA 4XPAL 4ZQKA 5EH1A 2QSCL 1KCVL 2QQQA 4PJXE 4Y16A 5IVXE 4PUBH 2ICCA 1QR1B 1A4KA 3LIZL 3S96A 5MENE 1GGIH 1N6QH 3VFMB 4MA1C 3UYRL 4YC2C 4CU7A 4MNHB 5FGRA 2I26N 4P2OC 4Q0XL 4WWKB 2YA2A 5CGYD 2BOCB 2MCPL 3DO7A 4KI1A 5I1DB 4RGNC 1KLFA 4Z7OF 4J8RB 4POUB 1FG2B 1QSEA 5C2UB 2VAJA 3W9EB 1RUAL 5DUMH 1NAKL 1GPOL 2VLKE 3HB3D 4DUVA 4R90L 2Z93A 4PJ9D 2HJKA 3MV9A 4GXUN 4HPYH 1S7VA 4XNYH 5EZLA 5BXFB 3BE1H 3IFOB 2I25N 4P23D 3QDMB 5J3HD 3FFCE 5DA4A 4ZXBA 1AHWC 5B4MD 5CJ5A 2HN7B 5FUZH 3V6ZA 4PB0H 1MCQA 2XWJB 1FFPA 3LN9A 4MNGA 1I85A 2HLFD 5IW3A 3TIEA 4WU5A 4U1NA 2VDKH 2Z8VC 1PEZA 3MUZ1 1IT9L 3IDYB 3WXVL 1A6WH 3IAGC 5E6YA 2GITA 3ARFB 1X5IA 1SBSL 4KTDH 2CJUH 3U0TB 1XF1A 3DV4A 4WEBH 4E5XB 4Y7MA 3S36L 2X4NB 1A4JA 3T3MF 3L3OB 1VDGA 4JN1H 1RY7B 1IGFL 3QUKA 5F72S 4TTGA 1FPTL 4IOSD 5JLZB 2NY0B 3U0PA 3KXFD 3AS0A 1G7PA 4UT9H 2FD6L 1G84A 5IG7B 4U6YA 2X6MA 5KJRL 1IILE 1MREL 1T4KB 3FB8A 1IAMA 4Z7VE 5GGTL 3L5XL 2BVUA 4ZOAA 5DYOB 3N1PC 1YNTA 4XH2B 1KXQE 5KOMC 1KEMH 5GGSY 3DVIA 5IESH 1A22B 5GQBA 2W07A 2WQ8A 5J4MA 4A6YH 1BQHB 2NY1D 1F3DH 1V7NH 2XPGB 3NCJH 4J3WA 5IFAH 2XA8H 1OAQH 2Y23A 4NFBA 1TTFA 5C08D 4FQLH 2FYYA 4N9GA 4U6VH 3U6RA 3SPVB 1XR8A 4M6MH 1A3QA 3FO9A 1Z9MA 1IGCL 3QHTC 4MNQD 3EW3B 4BYHA 2ZSVA 3RY5A 5FYJE 1N8ZB 4JFHD 5D1XC 5SX4H 1J8KA 5KVEH 4EI5C 4HHAB 1L7TH 2ADGB 3I3DA 5D7LA 5I16B 4KKAD 2N7BA 3UTSE 1QR1A 3VJ6B 2L7JA 2X1OA 4QTHB 3VFMA 2NY3C 5FGSA 1FYTD 4HIXL 4MNHA 2IF7A 4ERSL 5E1HB 1ZTXH 5I1DA 3ARYA 4NN6C 4WEMB 1E6OL 5CUSH 4J8RA 5HDBF 4NUJB 2M26A 1FG2A 1LK3L 3W9EA 3GBMH 5KSAB 1YECH 3SJVB 2FL5B 4PJIB 5GS1C 3OQ3B 1A9BB 2G60H 1CD0A 3CD4A 1W0WB 5BXFA 4H88L 4BK4A 3RWIB 3ULUL 4HC1H 3IFOA 3MTRA 1F00I 3QCUH 1CICD 4NM4L 4S1QL 1MI5D 1PKQB 1P9MA 4P3CL 4G6ML 4WI7A 3SDYH 1EHAA 5C0JB 3IYLW 1J05B 2DLFH 2HN7A 2MFNA 2J7LA 2XWJA 1QKZL 4YEFA 2V17H 1KXVC 4HQQL 4NNPH 4OT1H 3BIKA 1OCWL 3V6OE 4JKWA 3EOAB 1T7XA 5D71L 1IM9B 3ZZ1A 3BX7C 4NQEE 5HHOE 2R56L 4DZBB 5DC4B 1KJMB 1NUFA 1CTOA 4MQSB 3DSFL 4E5XA 3STLB 4NP4H 3W0WE 4MVBC 3HZMA 2X4NA 2Y07H 4HH9A 2EDEA 3L3OA 5JLZA 1JHTA 4KPHL 4F9PA 4QHKI 1F3DJ 3KPRB 5IG7A 4K3DH 3IKCB 1MCOL 4Z95H 5I1AB 3I84A 3O4OC 5AAWA 1T4KA 1PG7L 5AYUH 1YEFH 1VFUA 5E5UB 3NZHH 5TE6H 5DYOA 4M61B 3OKLB 3V4UH 1NKRA 2R4SL 3DHMA 4F9LC 1UWGH 4XH2A 1N7MH 5EUOE 2D4DA 1HN1A 3EOYG 4Z8FL 2NY2B 1BQHA 2BY3A 2XPGA 1CFVL 3O6FB 5EZOL 5C0RL 4GRWB 4LSUL 4M1DH 4X8JB 3PL6B 1U58B 1CR9H 2DQIL 1L6XA 3PF2A 3ARSA 3IJYB 3SPVA 2WLZA 4ODSL 1HQ4B 4DTGL 1MRDL 3VWJC 4HFWB 4JO1L 1F90L 5I0ZA 2VRAA 5K9JH 1N8ZA 2IPTH 1NBQA 4HHAA 2QQLH 2X4QB 1AJ7L 5IKCB 2ADGA 5I16A 2J6EA 4X4ZA 3UP1A 2HMID 4BZ1H 1UACH 1XT5A 4LGRB 4EKXA 4PRBB 4L4TE 3I50L 3P4MA 3VJ6A 5CGYC 1DLFL 4QTHA 1JHKH 4NBYB 3P0VL 3WS6C 2D7TH 4XVJH 1F8TL 1LO4H 4LLMB 4TVPL 3MACH 1P6AB 2NX5D 1XF3B 3TT3H 1WTLA 1BVLB 4L1HA 4NUJA 4UQ3B 3HI5H 4OFYA 5L0QB 3TF7C 4PBVC 5KSAA 4QF1B 2X5PA 3K1DA 2FL5A 1XMWA 4PJIA 3SJVA 3ZT5A 4LCWB 4P3DA 1A9BA 4K94H 4P23C 1W0WA 3RWIA 5J3HC 2YN3A 3LEYL 3NAAL 1A1MB 4L4JA 1UKTA 2ED9A 4MXVE 2V6HA 1AGFA 5B4MC 1PKQA 4K3JH 1UWEL 4ZTPL 4YHLL 3P77B 5C0JA 1J05A 1K9TA 2VLRA 3Q0HA 2HLFC 3S37X 1KENL 1AP2B 2EE6A 1GSMA 5FCUL 4C54A 2WBKA 4G6FB 4P46C 1JE6A 1IM9A 2GJ6D 4KUZL 4OZGA 2D4FA 3CSPA 4DZBA 3ISWA 3OG4B 4JPKL 4MJID 5DJZB 1KJMA 2KDGA 2EDQA 4XZUB 2P24B 1WC7B 4FMFA 4LNVA 4GKNA 2MQCA 1EFXD 2Z4QB 2CRZA 3DUHA 4LKCB 5IMKB 1MH5B 5A2KH 2D9QB 4EXKA 5GRJL 5TFSL 1SY6L 4EBQL 2Q76B 2EECA 3KPRA 4QCIB 15C8L 2NY4D 1AC0A 4TYUA 4G9FD 1AXTL 4TN9A 3GKWH 5I1AA 2V9QA 4U6TA 5M94B 4JB9H 1QQDB 3OJDB 3AREB 4M61A 4DGYL 3OKLA 4PLNC 3F7PC 1FRGH 4M02A 2DI7A 3BP6B 2NY1C 1X5AA 4E41B 5J11B 1U3JA 3HNSL 2L4OA 4LLDB 5J12B 5GGSB 3UJTH 3C8HA 2J8UB 4ZOCA 3O6FA 2HH0L 4OCMC 3RDTD 4X8JA 3PL6A 1CDGA 3FT3B 3RQ3A 2PYEE 4DGIL 1YUHA 1DANT 3IJYA 3V7MA 1JCKA 4LLUB 5C09E 1HQ4A 1NLDH 4HFWA 1WT5A 3U30C 3NGBB 5DJCB 1JTPA 1NCCH 1VFAB 2BVOB 1T3FB 3PHSA 4FABL 2W0PA 3RWFB 4HWBL 1J8HD 4PRBA 3S34L 3VXMD 4FP8L 3O9WA 2E5EA 3CCHA 3WO3B 1G7LB 2YD4A 4YHKL 3ZHKA 1BEYH 1NBYB 5F6IB 1CK0L 2P4AB 3B6SB 4LLMA 4I1NB 4WHYH 1IAIM 5JIIA 3D0LB 1A2YB 4FNLL 1XF3A 1YEJL 4EXPX 1EIBA 2W9LA 4UQ3A 1D9KB 1Q9WB 1Q9LB 2YUWA 4QF1A 4LCWA 5DLMH 4DUXA 4M93C 1CICC 3CFIC 1S3KL 1VKXB 4FQ2H 2IEPA 4NZTH 3TGXA 3L5HA 1CE1H 4JFXB 1A1MA 3CFEA 1QBMH 4M6NL 1DBKL 1TCRB 1E6JH 1GCFA 5CP3H 4O4YH 4X4XB 4Q9QH 5DS8A 1A6TB 1RUML 3VFOB 1AP2A 3CMOH 1NC2D 2WUCH 1X5YA 2JB5L 3UJIH 5KW9L 5EU6D 4ZS7H 2DS4A 2BVPB 1G7QB 5DEFB 4PR5B 2UY7A 4WI3A 1A3RL 4DGVL 3QDJB 1LHZA 4JFZH 2PO6D 5DJZA 3T2PA 1ZHKA 3LDBC 3O8XB 5E2UH 3NIFF 4XZUA 4HIEB 2XY1A 5K59E 2P24A 5GGVH 1WC7A 3WFDH 4OLUL 4JKKA 4P49A 3MBEB 4DN4L 2RIKA 4IHOA 4X6DE 4JY4A 4BQ6A 2Z4QA 4JLRB 3UTTA 4DKFL 1X5KA 4LKCA 4D2NA 5IMKA 3BZDA 5JTWA 4NQTA 4K94C 4QXGH 5HDOA 4JR9H 2Q76A 2VAAB 5DTFB 2DICA 4ZFGL 4QCIA 1MFAL 3C6LC 1X5LA 3GSXB 4LSRH 4Y5XB 4MMZC 3T4YB 3V52H 1QQDA 3OJDA 3EO9H 3AREA 2ATPB 4HK3J 3MRNB 3U9PH 3BP6A 3W81A 2ICES 3QSKB 4LLDA 3UPAA 4D3CH 1F4HA 1EHXA 4Z7WE 5GGSA 3L9RB 4BH7B 2J8UA 2YOCA 4MWFB 4A2MA 3FT3A 5ESAB 3NA9L 3BMVA 2AEPL 2D3VA 3EUUA 5DMYA 2HYMA 1A0QH 4K07A 5GRUH 2JCCB 4LLUA 1YPZF 4PJAF 3VCLB 2MCG1 1MJ8L 1SJXA 3MXVH 5DJCA 3PGDB 1RU9H 2W91A 2ZOLB 5HDQH 2OX5A 2BVOA 1T3FA 2W59A 5I75B 3RWFA 2IQ9H 3I6GB 3VDCA 4LSVH 2B4CH 1O7SA 3HC3H 3E8UH 1G1CA 2A73B 3B8SA 3WNLA 3OF6D 4JJHA 2Y36L 1G7LA 3UROR 4R97B 5IOPB 1F58H 5E2VL 3DXAB 1NBYA 3VXUB 4HUNB 4X5XB 3MRRB 3B6SA 3VXQB 3SHSA 4LPTA 4U1HA 3D0LA 1A2YA 4FTVE 3RTQC 4M5YL 2HT4D 1BFVH 3TA3D 1D9KA 25C8H 1Q9LA 4NJ9L 4U31A 4W4OC 5LVEA 1AI1H 3QNZA 2UYLB 3MRCB 2H45A 5IVZB 5LXGL 5JW5B 2ERJC 2VZSA 4G7VL 2W0FB 4O02H 3QEQE 4PTUA 5D1ZB 1PDKA 2H2PD 2NXZC 1NAML 5C0ND 4JFXA 4RMSA 1IM3B 2CH8A 1TCRA 5A2LH 2OR8A 2YD1A 1R3IH 4U33A 4RX4A 1LEGB 4X4XA 1J0IA 1R3JA 1A6TA 5T5FH 3QDAA 4ZSOE 3VFOA 3MRHA 4JQIL 2AABL 3EJYD 4Z77B 4KUCF 1CT8A 5ALCH 2GJZB 2GT9B 3IRPX 3TH4T 1E27B 1G7QA 2BVPA 5DEFA 5FYKD 2BFVH 1K8IB 4PR5A 2DQEL 2EYTB 3IDNA 3QDJA 1MCLA 4Y2OA 2OL3L 3WSQL 2VZ3A 3O8XA 1MEXL 4HIEA 4XP6L 5BRZA 1HHHB 4TSCH 4EIZC 4HAFA 1P4LB 3MBEA 1PD6A 3OR7B 1TJHH 4JLRA 2DJ4A 2NY4C 3B2UD 4H8WC 2VAAA 3QCTH 3QHZL 4M7LT 5DTFA 5GS0D 1YQVL 1GHFL 3H9HB 4OGZA 5KAQG 4RFNC 1T2JA 3BQUD 3GSXA 4Y5XA 3T4YA 4I4WB 1JWMB 4IRSB 2QBWA 2ATPA 1HI6B 3MRNA 3MRGB 1I75A 3D9AL 1NUGA 4PLJD 1QFWM 2R0ZL 1BD2B 1F4YH 3L9RA 4BH7A 1CCZA 1JK8B 4E9LA 4HWEH 4HUMB 4MWFA 1INEH 5ESAA 1WBZB 1KEGH 1ADQA 2MSPA 4U3HA 2AI0H 1MFCL 3CFBB 4NUGL 4ELME 2VYRE 3P40A 2JCCA 3VCLA 4QRRE 5CIPB 1NEZB 3MROB 3N85H 3WDJA 3SN6N 1K4CA 4DUWA 3LRGA 1DFBH 3RWDB 3PGDA 5JR1L 1OAZL 2ZOLA 4JKLA 1KGCE 5EG6C 3F6LA 5I74B 2C3XA 3I6GA 5DO2D 1J9CT 1KB5L 5E4IA 3DVFA 5FYKH 5EBWB 2D03L 5BV7B 5JHDB 4YZFF 1UB6B 5IOPA 3IFLH 3FCTB 3DXAA 1LK2B 2R4RH 4GBXD 5DDHA 3VXUA 4X5XA 4G7YL 4UDUA 2UWEB 3MRRA 3QO1B 4NM8H 3VXQA 2WBWB 3WUZA 1I8KB 4L8SC 3MCKB 1U93B 3CFJB 1CF8L 1IEAA 3UPCA 4URTB 3RX5A 2C4FU 4MYWB 2VSDA 4YXLL 2EDJA 1S9WB 2UYLA 3MRCA 5GS0H 2IFGA 5JW5A 5GJSH 2E8YA 2O5ZH 5D1ZA 3F62A 4KROB 2YN5A 5D2NB 3O6KL 1N4XL 3ZL4H 4HZLB 3HC4L 4ZS6D 4Z76B 1C5DB 5IJKC 2XRAH 1CLOL 1IM3A 4QGYA 2YSSB 1KACB 4M7KL 3DX9A 1LEGA 4MB3A 2X42A 1ULVA 2Q20A 2B4CC 5J13C 2E27L 2BSTB 4OM0L 5IQ9B 2GJZA 1XR9B 2DJUA 3X3FH 1E27A 3NFSH 1K8IA 2EYTA 3HFML 2ZUTA 5IM7B 3EYQC 3M8OH 2JE8A 1FGNL 1BJMA 2Y1VA 2VB5A 4HUKB 5I8CB 1QSFD 2DI9A 2BCKB 4CDHA 1KFAH 4YK4C 1CXIA 3RUGF 1HHHA 2XV6B 1P4LA 3OR7A 4WO4D 4WW1A 4Y4FB 3GGWB 1T1WB 2BY0A 5I1JH 3DMMB 3H9HA 1SEBB 4S1DD 5T1MB 5CJOH 5LGHL 3OKNB 1MJ7L 4I4WA 1AQDB 1JWMA 3MLUH 4IRSA 1HI6A 3MRGA 5C92A 5ETUB 4OM1H 3VI3F 2YA0A 2AJSL 1ND0B 2DRUA 2QSCH 1BD2A 3O6MH 2VERN 4MJ6B 5HPOA 1JK8A 4HCRA 4HGWB 5IB5B 3SDXE 3O2DL 3LIZH 1WBZA 4B5EA 3OTTA 2EDRA 4G43A 3E2HC 1RSFA 3CFBA 1WVZA 2QR0A 3P2TA 1A5FL 5CIPA 4P9HH 1NEZA 3MROA 3A6BL 4Z5RB 1I7TB 1WBXB 4WI9A 4EIGB 3RWDA 1DJSA 1NFKA 4GRLA 3CDFA 2FGWL 4HWNA 2ZSWB 1MCPL 4U05A 1EBPA 2Z8RA 1RUAH 3BPCB 5EBWA 2E9BA 5EOCL 4QT5B 4P2QD 1LO5B 2OQJB 4R90H 3Q1SL 5JHDA 3VG9B 1S5IL 1UB6A 3QNYB 3FCTA 1LK2A 1ZKAA 4DKAA 2UWEA 3QO1A 1QFUL 4Z7UE 2HT4C 2GAZB 4UTBL 1JNHB 3TA3C 4TTDD 3DBXB 4Y1AB 3S9DB 2ITDB 4XNQB 2F74B 1U93A 3ARBB 3CFJA 5T5NG 1KLGB 3NCYS 5C6WH 4NNYB 5LWYH 1S9WA 1IAII 2CUMA 4NHUB 1TNMA 3CJJA 4X4MA 1VA9A 4BM7A 2OZ4A 2AV1B 1U3HA 2BSED 4YDIL 1IT9H 5D2NA 3RWCB 4PJXF 4Z76A 1C5DA 4P2RB 1SBSH 2YSSA 2XQBH 1OWRM 3MV7E 3EJYC 1ZT4B 2NY7L 4PJGF 4YBLC 5B3JE 4L29B 1CVRA 3MOAH 4MHHG 4DFIA 4KUCD 2BSTA 3B2VL 5IQ9A 2AKRA 3GJFK 3IXTB 3ZHDA 3FQRB 2IH3B 4P4KD 4HK0B 5IM7A 4FQXC 1MREH 2DKUA 4QHLB 4R4BA 5FYKU 2BNRB 5TGBB 5GGTH 5I8CA 1Y18B 2F19L 2BCKA 5HGAA 4RBPK 1N59B 4OZIA 5D7JD 1ZLSL 4HX1B 3X17A 5FUCE 3B2UC 4UV4L 4Y4FA 3GGWA 3WJJA 2AXGA 3MPCA 1ZGLB 2GQHA 2XQYG 1DBBL 3DMMA 2VISB 5F71A 2P5WB 1DQML 4PLOB 1SEBA 5DXWA 4OZHB 4E42B 5T1MA 3GM0A 3OKNA 1PG7W 4BH8B 5JMRA 1AQDA 1IGCH 4PRHD 5I19L 1M7DB 2ICEB 4TRPH 4JHAL 4WW2F 5DSCB 5HYFA 1BGXL 1FGVL 1ND0A 4WUUB 4PJ5B 5SWSA 2RHEA 1QLFB 2WLYA 4MJ6A 4HGWA 5IB5A 2YUVA 3MRJB 5HI3D 1XGPB 2FNBA 1IAIL 4BQCA 4R8WH 2W1NA 4X5LA 4TOYL 4YDKL 3INUH 5DHVH 1I7TA 1WBXA 4MAYD 2XTJC 3DYPA 4N0UE 2V9RA 3Q6FB 2CKBB 2VLME 5DO2C 3UTPD 3GKZA 4JM2B 3OXRB 4MA8L 1NGYB 4OLZH 1LK3H 1A7NL 1KIRB 1XF2B 4IMKC 1IAOB 5DJ0B 3BPCA 5HVGB 3K81A 4QT5A 1IZJA 1TIUA 1IGML 4Y4KD 1FO0L 3DLQR 3QNYA 1MWAB 2R0KL 4NBZB 4H88H 3OJMB 1VADB 4XNZC 4XBEL 5FXCH 3AXLA 2GAZA 3AB0B 1JNHA 4NM4H 2VR9A 4S1QH 3BT2H 2PTVA 3DBXA 4Y1AA 4P3CH 4J3XA 2ITDA 4AEEA 2F74A 3ARBA 3QRGH 4Q6IB 4JO3L 2DLIA 4F57L 1KLGA 4OIIH 4NNYA 4J3SA 4HQQH 4JPWL 1NCDH 5EO1B 5D71H 4D9LL 1CLZH 3T0ED 1HK6A 4NHUA 4P9HC 4XBPB 2AV1A 5F7MC 1FDLH 2R56H 3RWCA 3Q2CA 1MFNA 3BEVB 1YEGL 4QRQB 3CDCA 5DQJB 3DSFH 3EYUL 5KTEL 1N64L 4W68A 4YH6A 5EFIB 1ZT4A 2L0DA 4JJ5B 3LZFL 2R1WB 4FQHB 4L29A 1BZQK 1QSEE 3MOBL 5D1QA 3VFUB 3VXRB 4AEHL 3O3DB 3WIIL 3X14B 3IXTA 3KJ4C 3FQRA 3DGGB 1HSAB 2IH3A 4JFPB 3SGKA 4CW1B 1MCOH 4HK0A 5L88L 3MV9E 3X11B 3L3DB 4QHLA 4QHMB 5TGBA 2BNRA 3C60C 1Y18A 5J56B 5L2KD 1N59A 2R4SH 3CUPB 2VXQL 1FVEB 4MXWL 4NPYB 1I8IB 2KKQA 4OCRL 5C0EB 1OPGH 1CFVH 5C0RH 5ACLA 1ZGLA 1YA5A 4S1DC 3A67L 1LWRA 2VISA 2P5WA 2LTQB 4ZNCD 1MCWW 1H3VA 4OZHA 4E42A 4ODSH 3VWKB 3DUSB 4BH8A 3PHOA 3VXSD 4DTGH 2E9WA 1MRDH 3D85B 5EN2A 1GZQB 1M7DA 2ICEA 4XPHL 3RKDD 4ZO9A 4RDQF 1MSPA 4YQXL 2PETA 5F44A 2K7PA 4WUUA 1AJ7H 5EU7C 4PJ5A 3ET9F 5DUPL 4YBQD 4BUGA 4OI8A 2VDQL 2LV4A 1QLFA 4PS4H 5I8KL 4MCYB 3N1MC 3ZKND 4PJCB 4PPTA 1HYRC 5KSBB 2XYCA 1L0XA 1TETL 1XGPA 2PR4H 4QOKD 3D39D 4WWID 3GBNL 1MAML 4HFUL 4YHYC 1P6FA 4WI6A 4JY6B 2C4XA 5A1AA 4GMTH 1HYSD 2JELH 4XX1G 3DIFB 4NO0D 3CC5B 4TNVF 3NABH 3Q6FA 3CNKA 2I07A 4BSWB 2CKBA 4FQIL 2ZG3A 4JM2A 5FM5O 3OXRA 2DYPD 1OP5H 1NGYA 4XXCA 1KIRA 1FZJB 1IAOA 5DJ0A 1HWGB 3QXWA 4C59B 4YHOL 4JO2H 4HDIB 3HNTH 1U2CA 4JKPL 2FX7L 4JZJC 2UZYB 1MWAA 1GGUA 1VADA 1AFVH 3LEYH 4X9IA 4Y19B 1KJVB 2IBGA 3H9SB 4AEIL 3HHRB 2NY5L 4MA1B 4LDEB 1UWEH 5I1LB 5D7LE 1DBML 1KENH 5TQ2L 2OTUB 1CDCA 2FEDC 2WUBH 3B9KD 1G9NC 3KLAB 3CX5K 3MC0A 4KUZH 4XBPA 4RFOL 3REWB 2EDXA 1I9JH 4PGCB 1WZ1L 3SDDB 4JPKH 1MPAH 3GSNH 4JFFB 5MEND 4U1SA 5DQJA 5BJTB 4OUOA 3QUZD 4XHJC 5EFIA 4JJ5A 2QQKH 2R1WA 4FQHA 5CJQL 2XACC 3VFUA 3HE6A 4I48B 3O3DA 3X14A 4FQQB 1AHWB 5TFSH 3GSVB 1SY6H 3DGGA 1HSAA 4JFPA 4ISVB 5K9KB 2IQAB 4JREB 2E7HA 15C8H 4CW1A 3FONB 1AXTH 3DI2B 3X11A 3L3DA 1GGBH 1INDL 4QHMA 3C6SB 1BBJB 3MODL 1RJLB 1U95B 1A9EB 3T0DA 4IRJB 1JGVH 2VLKD 5HHME 3CUPA 1FVEA 1Q0YL 3HNSH 5GRZA 1KELL 5BW7A 3QPQC 4H5SA 1I8IA 1CGSH 4HXAL 1S9XB 5C0EA 1N26A 2HH0H 4MXVF 3EAKA 1U8HB 5CKGA 4GAFB 3HG1D 4L3AA 4HPOL 5K9QI 1F3RB 1E4XH 1UM4H 4FMKA 3TJEL 5JIHA 3QIUD 1Z2KA 4ONHB 3IVKB 3VWKA 3DUSA 3QIBB 1E28B 5HHNB 3EOTH 5DJYB 1X44A 1GZQA 3LSOA 4M3KB 4F58L 5FV2A 1LEKA 3SGJC 1CS6A 1R3KB 5HI3C 4FABH 4N0CD 4U0QB 1ITBB 4WHYG 4YFDB 1CXFA 4MCYA 5D6DA 4PJCA 5ELIA 3WFBL 4DEPB 5E6IB 3EIFA 4MAYC 5GISL 4JY6A 4X6CF 4J4PC 3CFDB 3V5HB 4K23L 4RGNE 4TNWF 4ZAKD 3GJFH 3DIFA 2OSLB 3CC5A 5ADOL 1QSVA 3BO8B 4TQEL 3CVIH 4K7PX 4BSWA 2OK0L 4QRPB 3LRSB 4ZFOL 4Y2DD 1AKJD 3CSYB 4YHNB 2G75B 4EI5B 3H7BB 3LY6A 4HDIA 1YEDB 2EZ0D 4X83A 3LKRB 3NOIA 4GT7A 1MIML 4Y19A 1KJVA 4ZUWB 4PJDB 1R0AL 3H9SA 1IC5L 2RR3A 2R2CA 4M6NH 4WIQA 3BAEH 3NPZB 2V7NA 4LRIC 4R9HA 5I1LA 4ZO8A 1RUMH 3T0EC 2OTUA 5HGGS 4Y4HB 4LLQB 4JY5L 5FYJD 1VGKB 4V2CB 4K3EH 3KLAA 4YGAB 2DM3A 3GSRB 1A3RH 1MFBL 3Q5YA 4QXTB 2CUHA 4PYHA 4O5LL 4PGCA 4XCYB 1UYWL 3SDDA 1BBDL 3MUY1 2DQUH 1BAFL 4JFFA 3GSQB 1WIUA 1YDPB 4UOW0 4DKFH 4HGKC 5D8JL 4I48A 2FSEB 4GH7B 4JHWH 2VQUA 1FBIL 2Q8AL 4FQQA 3VGDA 4F8QA 3GSVA 4UU9B 3G5VB 4ISVA 1RUKL 3MA9H 5K9KA 2IQAA 5TE4L 1I7RB 2MQ3A 3FONA 2DWEB 3ME0A 5C8JA 1FN4B 3ARGD 3BPNB 3WL9B 1BBJA 1YMHB 4BFBD 3TBWB 1RJLA 1U95A 1A9EA 1PGRB 4IRJA 1Z9LA 1PKQE 3LKNB 2IFFL 1NFIB 1C1EL 2VLRE 3BWAB 2X4OB 4G8IB 3GUTB 3NA9H 2AEPH 5SX5K 4RGMC 4YGVB 4OUUB 2DQFB 4OZGE 4PV8A 1NL0L 5KZCB 3GBLA 1UJTA 3QIBA 1E28A 1J1PL 1YMME 4K9EL 5DJYA 5HHNA 1MJ8H 3QCVL 5CCKH 3DOSA 3T1WA 4I8DA 3OB8A 4YBQC 1AIFB 3MRIB 2P5EB 4NQED 5HHOD 1R3KA 2V7HB 4W6YB 3ZKNC 3ABZA 4V1DB 1EJOL 1OTTD 4PJEF 5FYJH 1OSZB 5K59F 1DUZB 4ESKA 2Q8BL 3JVGC 3W0WD 4LCUB 1BOGB 3KPRE 1FFRA 5E6IA 2BZDA 3UBXI 4CUCA 1OSPL 1R24B 3K7UA 4ONOA 5L8JB 3CFDA 4H1LH 1BQLL 1JGUL 1WEJL 1B6DA 2HTLD 2OSLA 4W4NA 3BO8A 3QEUB 5F9JA 4QRPA 1HWHB 3LRSA 3VFWB 2M2DA 4M5YH 4BZYA 4EZMA 2J12B 3V0WL 4G42B 2C3WA 4NJ9H 4YHNA 2Z31B 3NFNB 3KHQA 2G75A 3NACH 4GRWE 3ZKXC 4RRPA 3H7BA 4IOIB 1YEDA 2DLTA 3VFSA 3ZHLA 5H35A 3N1QC 3LKRA 5I1EL 5JOEA 1RIVH 3SKJH 2A9NL 2XZAL 4Z7WF 1Y6NR 2AJ3B 2I27N 4OIAA 2EEBA 4PJDA 4FRWA 2WSKA 4S0SD 5EB9A 1D3CA 1NKOA 3VH8G 2XTLA 4CNIB 3FHQA 4JCLA 2M1KA 4XMLL 1SEQL 3PWUB 1FH5L 1CQYA 1V05A 1FLRL 3L5IA 4JQIH 4HEPG 4KMTL 4YJZL 4Y4HA 3OPZL 1SJVA 4LLQA 1ZLWH 3EYFB 1VGKA 5E2JA 3GSRA 5AZEH 2C7UB 2OYPA 2C3VB 4PJ9B 4F15C 1WIPA 4XGZB 3QUZC 1MEXH 3W82A 4ODTL 1HKFA 5C0BD 3GSQA 4OV6F 3UZVB 4OF7A 1YDPA 5IFJB 4I5BB 1QBLL 3RBSA 5E0QA 4YWGL 4X9BA 4Q6YA 3HE7C 3CLFL 2FSEA 5D7IB 2EH8H 4UU9A 5KVFH 3G5VA 3QUXD 4LCWE 3SE9L 1YQVH 4JGJA 5DQ9B 4H26B 2DWEA 5IJVB 4S1RL 4AEFA 1YMHA 1JZ2A 3K8MA 3GI8L 3CK0L 2R29L 4LVOC 3LKNA 3D9AH 3MLRH 3HC0B 1NFIA 4YXHL 2R0ZH 1TZHB 3BWAA 5D6CB 3RZWA 2X4OA 4G8IA 3WJLA 2BDNL 3QIUC 1JZ7A 3GUTA 2D0FA 3S3JA 4MJ4A 3KXFB 1H3GA 2A1WH 4XC3L 2DQFA 2OR9L 2MMXA 3OB0K 4WW2C 5HYSG 4W6XB 3T2QA 1ACZA 4G8FB 3EFFB 3P9LB 5FA4B 4FXLA 1AIFA 3AY4A 3MRIA 4N0CC 43C9B 4ONGH 1A7QH 1OAZH 3DURB 4CBPA 3REVB 2V7HA 2VZOA 3UTTE 4V1DA 4WCYH 1U8LB 4R96B 3S8WA 1OSZA 4PGZA 5EBGA 1DUZA 2D03H 3GMOB 4C83B 2WINB 4LCUA 1BOGA 5C08B 5DRXB 2NZ9D 1ACYL 1VFOA 3GMMB 4OSUH 1R24A 4X80L 2Q87A 5CEZE 3RIFK 1KJ3L 4C56A 4S1SL 1T03L 4MNQB 3HI1B 3QEUA 1HIML 5E95B 4LF3B 4NN7C 4CAGA 3VFWA 2X41A 3FMGL 1CF8H 2EZ0C 2ZPKH 3OKMB 2J8UE 2Z31A 1OD9A 4W70A 3NFNA 3WIHH 4IOIA 2J1KA 1PLGH 2IADB 3RI5F 5LCVL 1EO5A 5ICZB 4Q9BA 1DBAH 5HI5D 2DM2A 1Q1JL 4XCCL 5T1KD 3ZT7A 4DJMA 2AJ3A 3O6KH 1FYTB 1N4XH 2IPKA 3HC4H 4IOFC 1U91B 5C9JB 3I3EA 2JJTC 2PYED 4Q58C 2VDPL 4CNIA 2YWZA 3SDCD 3A6OA 4ELMF 5BVJB 3PWUA 3IU4L 2EE9A 4KK8D 3U4EB 3KLHC 5BVPH 3R4DA 1ZEAL 4GKSB 2E27H 2AK1H 3EYFA 3MNZB 4LGPB 2AJXL 2C26A 1UJ3C 3JWOL 1JYVA 5FYJU 4HS8L 4OGXH 2C7UA 1ZVYA 2DBLL 2LE9A 5B39G 4PJ9A 2D0HA 1I9IL 1F13A 1AO7B 1YY9D 4XGZA 1WICA 1P2CB 1KPUB 5L7XL 3U7AA 3IFPB 5EA0H 3PXHA 4I5BA 1M4KA 4HGMA 1MI5B 4GMSL 4XNMB 3LS5H 4C4KO 1RULH 5D7IA 4FQCL 3ZKQD 4GQ9H 5JA8B 4UTAH 1OP3K 2RQ8A 5AZ2L 3KPOB 4O58H 5MI0C 4H26A 3G6DL 5IJVA 1BREA 1XFPA 4ORZC 3RHWK 5J0BA 3FT2B 4EUPH 1QPPA 1AH1A 3EDDA 2IMNA 3H8NA 3D6GA 3HC0A 4M6AA 2AJSH 3S88H 1L6ZA 1CQKA 4YPGA 2A6JB 4OCNC 5D6CA 4LGSB 3MX0A 4IRZH 4KI5F 3O2DH 2FJGB 2IG2H 2X9YA 3G5XB 3KXFA 4ZPVB 1A5FH 2EXYD 3MSPA 4PD4K 3V6OC 4PJHB 3CSGA 1EPFA 3BSZL 3ZT6A 1DVFD 5IBLD 4G8FA 4X6FB 4HC1A 5BRZE 2CK2A 5FA4A 3FFDB 5C07E 2E9IA 2EYSB 3O81A 43C9A 4XRCA 2P46B 2AK4E 3DURA 3REVA 3VGHA 4HIJB 4DAGH 3U4AA 1N3NB 2IPUG 4R96A 4JFYB 5FCSH 2MNUA 8FABB 5JW4M 3I75B 4UNTA 5F7LB 3HCVB 5EOCH 3GMOA 4C83A 2WINA 3Q1SH 1L7IH 5C08A 4F80A 1S5IH 5DRXA 4DVBB 3GMMA 1CDHA 1NANI 3TO4D 5FO9B 3OXSB 4NRYB 3QHFL 5INDB 1U8KB 4KZDL 1QFUH 4MNQA 3HI1A 1UEMA 1GRWA 4LF3A 2JJVA 2J8OA 3QA3A 1RVFH 2MQ0A 1G6RH 5E08L 1IQDB 1IZKA 4NT6B 3OKMA 1FAIL 5CEXB 1Z3GH 4NKIH 1XGRB 3MGAA 1F3JA 3W39B 5E2TL 2IADA 3WIFB 1RI8A 5A2IH 3ZKSD 2EH7L 5IQ7L 3KGRA 5ICZA 3BGFC 2JCCE 1VEPA 3M17B 3MNWB 1FYTA 3GEWB 3VD9A 1H0DB 3OKKB 5C9JA 3SDXF 2ICWJ 3QULB 1WITA 4LQFL 5KBNC 4U6HB 1OAYL 2NY7H 1DEEB 2DLEA 3NTCL 4YEEA 3ARDD 3QP3A 3U4EA 3S98A 1C7SA 3PWPD 4NO3B 2ZCKH 4GKSA 3MRQB 3LN5B 1OL0A 5T3ZE 3DHJA 3MLWL 4OLVH 1UH2A 4KQ3L 1NGZB 3RZCB 4LVHC 2MKWA 1AO7A 3VXUE 5DFVD 2Q86A 1X6NA 4YDLC 1WZKA 1P2CA 3IJHB 1KPUA 3IFPA 4FFWD 2PTTA 1MI5A 1N6UA 4XNMA 3GI9L 1G1YA 4KAQL 3QUXC 4R6UA 2YR3A 5I1GL 5JOFB 3IS1X 4N8VA 5D72L 2OTPA 3LKSB 4LP5A 4DWHA 4HG4K 3KPOA 1MRCL 1DQMH 4FTVD 4YFEA 3H3KA 4L4VA 5D5MB 1KCKA 4BJLA 1I8LC 5J6HA 2GJ6B 4MCZA 1PX3A 3FT2A 4G5ZH 4MJIB 4JHAH 1ZA6B 1RUQH 32C2B 1SQ2N 2EE3A 1FGVH 3QEQD 1I7ZB 2A6JA 1WAAE 2O5XH 1EO8H 2I24N 4XVTL 3F7YB 2FJGA 4QRSB 2DQJL 4ZPVA 5E5MB 3KPPB 1MCFA 1I1YB 1IAIH 1IGJB 4X9HA 5B3JF 5CZKA 2YA1A 4PJHA 4G9FB 4L9LC 3B5TA 4YDKH 5I6XC 5E6ZA 1NJ9A 4OZFH 3RY4A 4XMKL 2HT2D 2VDLH 2XA3A 5HYJD 3FFDA 3U1SL 4YHZH 4KJQC 3EZJB 3QQNA 1CDIA 4MA3B 1N3NA 4MA8H 1QG3A 3NA4A 3UTQB 4JFYA 8FABA 5IB3B 4UDTB 1BVKA 3I75A 3VDAA 3HMXH 3HCVA 3B83A 5HVFB 4D0BB 3RDTB 4D0DA 1IGMH 4GLRH 3JV6B 4DVBA 4LPCA 5C0CE 5HPMB 1JPST 2JIXB 4XBEH 3OXSA 4NRYA 5FO9A 5INDA 3UTOA 1U8KA 4POYA 4PYGA 1AGBB 2NY6D 4JGUA 1AY1L 2YEZB 5EZJB 1IGTB 1ORQB 4EQ3A 3LQZB 1IQDA 4NO2B 1BD2E 1B90A 4NT6A 2EXWD 2J8HA 4F57H 1PQZB 5CEXA 2LABA 2PNDA 3NIGE 2WANA 4XXDB 1J8HB 1XGRA 3W39A 2A9ML 3WIFA 3VXMB 3QUMH 3D48R 1G0DA 3VGFA 4ZUUB 2UZIL 3TVMD 2FATL 3C2AH 3M17A 3MNWA 2P1YA 3SDCC 1KB9J 1H0DA 4KK8C 3RIAF 3SKMB 3QULA 3CXHJ 2FJHB 1N64H 3WXWL 2ZKHL 3G5ZB 3QI9D 4U6HA 1DEEA 5IMLB 3LZFH 4QRRD 4NO3A 2QSVA 3MLVL 3MOBH 3WFEL 2UV3A 3MRQA 2WIIB 3MXWH 5CJBA 3WIIH 5BZDB 1KJ2L 1I1FB 5CLTA 1TTUA 3O0RH 1KYOK 5JHDE 1NGZA 4LFHD 4XCFL 4W4OA 1KGCD 3RZCA 4XWGL 4R3SB 2A2QT 2ARJQ 1WV7T 3PWVB 1Q0XL 4MHHI 3IJHA 5KOVC 3QXUA 5HI4D 3QUYD 4OCRH 5JOFA 2JJWA 3LKSA 1NC2B 5CILL 3A67H 3RJQB 5EO0B 5DUML 5EU6B 4X4ME 5D5MA 1KIUA 2E7LC 2GJ6A 5FA3B 1MRFL 3S35X 4XNYL 5JW4Q 2X05A 2PO6B 4MJIA 5IWLA 5GGQH 4WI4A 4RCAA 1ZA6A 5F88B 1JF5A 3WN5B 3ZTJG 5ICXB 32C2A 3GMRB 1FG9C 5EULV 1I7ZA 4RQQB 4Y0GA 5DUPH 3VA2C 2VDQH 3KYAA 3HA0A 3F7YA 4YHMH 1MCIA 4QRSA 1H3PH 1UADC 1DVFC 3BP7B 5E5MA 3KPPA 4R7DB 3WHXB 1I1YA 1IGJA 2CRMA 1AE6L 2C5DC 1MAMH 3GBNH 1FZMB 5T1LD 4G9FA 4LHQB 3VG0H 4JANB 2JJSA 5CJXA 1NFDB 1A6WL 2X09A 4OZIE 4LASH 1HNFA 2Q3AA 2X4SA 2WM0A 4FQIH 4OFPA 5CP3A 4BZ2L 4MA3A 5FGCE 3UTQA 3VXPB 3VGEA 5IB3A 4UDTA 3WLWC 4JN1L 3IFNH 3L95B 4RAVB 1WISA 4ZUTB 4YHOH 4PG2C 4D0BA 4UB0H 1VEMA 3RDTA 4JQVA 1UG9A 4JKPH 1IQWL 4H0GA 3JV6A 4UT9L 5GZOD 2EIZB 3FN3A 3IVKA 5HPMA 1CZ8H 2JIXA 4CVUA 4ODWA 1AGBA 1OP3H 4EN3A 4AL8H 3VW3H 3S4SB 2YEZA 5EZJA 1IGTA 1ORQA 3CZFB 4YE4H 2I60H 3LQZA 5CEZL 4PTTB 4NO2A 1KEML 1DBMH 2J5LC 5SWSE 5TQ2H 3DPBA 4OLWL 1PQZA 1FC2D 3TBSB 2C4FT 4A6YL 3QXDB 1V7NL 4XXDA 3LHPH 3NCJL 1J8HA 5IFAL 1EDQA 3FB7B 1OW0A 2XA8L 3VXMA 3GDBA 4ZUUA 3G6JE 3O41B 3JTSB 1B3JA 4FQLL 4RFOH 3C5SB 1BP3B 1WZ1H 4U6VL 3X13B 4X7CC 4UAOC 4M6ML 5EO9B 3U4BH 1OQXA 1ZGLM 3G5ZA 5IMLA 5KVEL 1I1AA 1YN7B 2ZUYA 4G9DB 1LE9B 2WIIA 4GO6B 5IROC 2O61B 1JMXA 5BZDA 1I1FA 4X98A 4X9GA 2F53E 3HZYB 5DMGD 5DFVC 1NBVH 5DFWH 5EBLA 2VE6B 4HUWB 4FFWC 4PJFB 3PWVA 3MODH 4DK6A 4KJYB 3RP1A 4LNRB 4JGMA 3KPTA 1ZTXL 4Y1AE 1X5FA 5HY9B 2IALB 2FHFA 1E4JA 2APBA 4HXAH 5GS3A 4BELD 2WWMC 1NC2A 4BSVB 3GBML 3JV4B 4JRYA 1YECL 3PWNB 5EO0A 1E4KC 3TJEH 2R1YB 1LDPH 5CZXD 2BX5A 1I9RL 5FA3A 3VFRB 3V2AR 4YR6A 1PYWB 2PO6A 1NMCB 4AYFA 3QCUL 1EX0A 3WN5A 5ICXA 3GMRA 2VNCA 4LLAA 1T21B 2Q1EA 4RQQA 5DHXB 2R2HB 2IBZY 4ZFZB 4NNPL 3T4AB 3MV7D 4ODVL 3F12A 3BP7A 2HKHH 4R7DA 1Z6JT 3WHXA 5GISH 1FZMA 2HT2C 2BNRE 4JANA 2X1PA 3BQUB 4K23H 4YX2L 1UC6A 1NFDA 1BWMA 5ILTL 4TQEH 4I0PD 2YC1B 4NP4L 5DF0A 1J86A 4JQXC 3S3PA 2Y07L 3VXPA 5JXEA 4OQTL 5SV3A 1V8HA 3L95A 4RAVA 3T0AA 4JN2B 4ZUTA 1CDYA 3N0PB 3OBAA 4ZUVB 2P5WE 3P73A 4PGJA 1MUJB 1QFHA 3H2WA 2EIZA 3VFTB 2NY6C 2ZNXA 3T2NL 3KYNB 4CU8A 1MIMH 2Z8WC 1R0AH 2JK5A 4QNPF 1IC5H 3WYRA 5IT2H 5TE6L 3NZHL 1WCBB 3S4SA 5C6PB 2EXWC 1BQUA 3CZFA 4LLWB 3V4UL 1UWGL 4PTTA 4ZTOL 1N7ML 3PGCB 4RNRB 2F15A 3TBSA 3QXDA 5FFLA 1TQCC 3BKYL 3DVNB 3FB7A 5EC1B 4N8CL 5FO8B 1CR9L 4W6WB 2VZVA 3JTSA 3O41A 4KVNL 2MPAH 3C5SA 3X13A 3PXJA 2XT1B 5EO9A 1S7RB 4GBXB 5FB8B 5C71A 3GO1L 1BAFH 4JDVB 4M9PA 4KMLB 3E6HB 4XNZB 2IPTL 2V5MA 3UYOD 1YN7A 4G9DA 3RRQA 3LPWA 1LE9A 4P4RA 2O61A 2R8SH 1KULA 5I66B 1FNLA 2E6JA 2Q8AH 3FT4B 1RZKC 3HZYA 2VLMD 3MRPB 1DZBA 5F1SA 2VE6A 1CD9B 1JHKL 5EBMB 4HUWA 4PJFA 2FB4L 5T3ZL 4B7LA 4HW6A 4KJYA 2D7TL 4LNRA 1HINH 1LO4L 2NQCA 3MACL 1C1EH 5HY9A 5H37G 2IALA 1R3LB 2HVKB 4ACPA 3TT3L 5ACMA 3HI5L 2QQNH 4BSVA 3VXTB 1J18A 3JV4A 3PWNA 2K3TA 1XIWB 4Z18A 2R1YA 4GKOA 1NL0H 3JUYA 4K94L 3QQ9D 4K9EH 3KJ4B 3IETB 3VFRA 3WNOA 2ZUUA 1JN6B 3QCVH 1NLBH 1C12B 1T1ZB 2GFBA 1A6ZB 3TZVB 3KAAA 3QQ3B 1T21A 4KI5C 5ITFB 5HYEA 3DX6B 4WO4B 4H1LG 4UUJA 4J3OC 4PY7B 2R2HA 2GIYA 3HN3A 1MFDH 4ZFZA 1CD1B 3T4AA 2Q8BH 1L4IA 1EUTA 4MB5A 1QSED 2AERT 2XTJE 3BQUA 1KBGL 1BQLH 4YNYA 1BOYA 4PJIF 4BFEA 1IVLA 4K71B 4OFVA 5K9OB 5DJ6B 5ECJE 1IGYB 2YC1A 2BXYA 4P5TD 2HP4A 3V0WH 1ZHBB 4LVEA 4MX7B 3KPNB 1KTLB 4G8EB 3MYJB 4JN2A 3RY6A 5GZOC 4R2GD 3WUWG 4ZUVA 5I1EH 1MUJA 1J1OH 3VFTA 1BIIA 2A9NH 3D0VB 1ZMYA 1YPZB 1C5CL 3GKWL 4UI2A 4JB9L 3C5JB 4WFFE 1O7VA 4XMLH 1SEQH 1FRGL 4OZGF 2J88L 1FH5H 2PXYD 3LPGA 1OF2B 1FLRH 3PGCA 5DQDH 4RNRA 4RDQG 3D18B 3GIZL 3UJTL 1OARH 3DVNA 3GRWH 4PJCE 4AY0A 1RHHB 2ENSA 2R15A 5FO8A 1XGQA 5I1IH 1MVFA 4F37K 5TH2B 2WW8A 1JI2A 2BNUA 4N5EC 1QPXA 2V9TA 1S7RA 3PV7A 3HLAB 4GBXA 4ODTH 5FB8A 1Q9OA 2GY5A 2YD7A 5HD8D 4ZG1A 4JDVA 5IBTH 4JFDB 4UT6H 1VENA 3E6HA 3O2WH 4HBQA 4RSVA 4MQXD 1QBLH 4YWGH 3CLFH 5DMGC 5I66A 4OFIA 3FT4A 4I77L 4HUVA 3W9DB 3LQAC 3MRPA 2WP3O 1QLEL 2H1PL 2X7LB 4IIQC 5EBMA 4UV7L 3PABB 3CK0H 1O0VA 1BEYL 3KS0H 4GRWF 3H9SE 5M95B 2GKIA 2B20A 4OF8A 1KIPB 5IR1B 1R3LA 5F3BB 2Z91B 2HVKA 2VDNH 1PJ9A 3D3VD 1CDJA 1I1CA 3EZ8A 4ETQB 1XIWA 3TNMB 4LCCC 1U0QA 5DLML 2BSSB 2OR9H 4P4KB 5I18L 3VMOA 4PRDB 4H8WL 5D7LD 3W5MA 3IETA 4NZTL 1JN6A 4OB5L 4JFFE 1CE1L 5E9DB 1C12A 1T1ZA 3K3QA 3UEZA 3DRQB 1A6ZA 3HRPA 5EU7E 3TZVA 5D7JB 3QQ3A 4F33B 2OP4L 5ITFA 4O4YL 2CIKB 3DX6A 4WO4A 4PY7A 4PJAE 4RA0C 1VB9A 5I2IB 4R0LB 5AWNH 4KJWD 1YYLL 3RX7A 4ZS7L 4D0CB 1ACYH 3HPLB 4P5KA 1E4WL 4X80H 5GIRB 3JZ7A 4I0PC 4WY7H 4AQ1B 4JFZL 3WD5L 3PV6B 1CN4A 1T03H 1F97A 3QQ4B 4KH2A 4PRHB 5HHVH 3WFDL 5GGVL 5C0AB 4JRXB 2IBBA 5K9OA 5DJ6A 1ZS8B 1IGYA 4BSJA 2FIKB 4XTRD 1ZHBA 3IF1B 4LSTH 2Q3ZA 1MQKL 3KPNA 1GZPB 1KTLA 5FUCC 4G8EA 3MYJA 3QT2A 3X12B 3MJ7A 4TUOB 5HHMD 4QXGL 3AGVA 4I2XB 5LCVH 2H8PB 1FFNB 3D0VA 4PY8I 5E5RB 3QAZC 5CD5C 4LSRL 1OM3L 2DMCA 3V52L 5GGTA 1KF9B 1DQDH 1RFDH 2VDPH 5C6TH 4OD2A 4KDTC 3IU4H 1OF2A 5DC9B 5DD6B 4FQ1L 4D3CL 3MV11 3MA7B 2AJXH 4GW1B 5MHSE 4AT6B 3FB5B 3OX8B 3CLEH 4LPUA 3MLXH 1R5WA 2EDLA 3IAPA 3FTGB 4Y4KB 2DBLH 1EVUA 5TH2A 1KCSH 2R2EB 4LLVB 5I73B 3VRLF 3HLAA 2NY0D 3IDJB 5FKAB 4KHTL 4JFDA 4M7ZC 3KS0J 4QRPE 3ZYOA 4P2OD 4BKLB 4ZUSB 1QYGH 4EUPG 1AD0B 2VL5B 1RU9L 3WS3B 4N0RA 5B8CC 1S7XB 5HDQL 3VI4E 4RGND 4FQCH 5IHLB 5HVHC 5KS9B 2BSRB 2IQ9L 3W9DA 5FDWA 3ZDZF 4LSVL 1CLYH 1IBGL 2B4CL 3HC3L 3PP3K 4WFEE 3T0EB 2X7LA 3VGAB 4F7MB 2NTFB 1DTUA 1F58L 3PABA 2J8UF 4PJDE 4WUKH 2OS7A 4AJ0A 5F9OL 1XZ0B 1ZHNB 1KIPA 2XXCB 3QIWC 5IR1A 3EHBC