4EBQL

Fab structure of anti-vaccinia virus d8l antigen mouse igg2a la5
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
211
Chain Sequence
QIVLTQSPAIMSAFPGESVTMTCSASSSVSYMYWYQQKPGSSPRLLIYDTSNLASGVPVRFSGSGSGTSYSLTINRLEAEDGATYYCQQWTSYPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHATSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-Vaccinia D8L antigen monoclonal IgG2a antibody LA5, hea
publication title Structural and Biochemical Characterization of the Vaccinia Virus Envelope Protein D8 and Its Recognition by the Antibody LA5.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 49
structure length 211
sequence length 213
ec nomenclature
pdb deposition date 2012-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ebqL01
3GMNA 1TJHH 2ADFH 3QXWA 1AH1A 3KS0H 5HYJB 3VXSE 4NQCD 1KIRB 4HUXA 1JF5A 43CAB 1EH9A 3QXAA 5DWUL 3G9VA 4YHYB 4WGVB 4EI5B 1A6TA 3CD4A 3EOTH 1IQWH 4ONHB 1O0VA 4N5ED 4U7MA 5KW9H 1MELA 3SOBL 4XC3L 4ISVB 3QISA 2DMKA 4M5YH 3H42L 4KKLD 2X6MA 2OTUB 2QSVA 2ENYA 5T1LB 1A7NL 1W72B 3MRDA 1CE1H 1JYVA 2ARJA 1A2YA 5F7EH 4WI7A 4K3JH 1AJ7H 2IAMB 5HDQH 3K80A 3ZMRA 5KS9B 5L88L 2H26A 3VXNA 4IDJL 2YD9A 1EZVY 4LGRB 4HS6B 3AS2A 4I9WD 4QXUL 3BN3B 2P8LB 1T66C 2IH1B 5CEZL 2QQKL 2FATL 1TETH 1J1XL 4U6VH 1FSKC 4FQCL 4PJXE 5GS0D 2E7BA 2EYSA 2R56L 1F3JB 3MNWA 3OR6A 5CJQH 4G9FA 2NX5D 4JHZA 3WL9B 4EUPH 1DL7H 1FV1A 4GRMA 3ZSTA 4UB0H 1RJZB 2Y36H 3PG2A 2VL5B 5D7IF 1CL7I 3VA2C 4HIEB 3CU1A 4YPJA 2BVQA 5DUBA 3PWVA 3MRRB 3QG7H 5L6YL 1QFUL 2FR4B 2DLFL 3BWAB 5H2BA 5JUEL 1JL8A 2Q8BH 5DT1L 1C5DB 4Y2DC 3STLA 3TV3H 4NCC1 4M43H 1NGZB 3L5HA 3ARTA 5C0GB 4FQIL 1BQHA 5KG9B 2YPKA 4LIQH 4DUXA 32C2A 1QG3A 1C16A 1T20B 4Q0XH 1A7RL 5FHBL 4R2GB 4QRTB 1EO8L 1JK8B 2C3XA 2X4PA 4PJ7B 3C5ZA 3PDOB 3WYRA 3RWJA 4NZTL 1SM3L 3X14B 3BYYA 3DXAB 3S96B 2GITB 5HDOA 4QRRB 4MNHB 3FHAA 4M6ML 1QRNB 4HT1L 5C07A 5C7XH 5IB1B 2W0FA 2VZTA 1KCUH 4U0RC 4CVXB 5CUSL 3PGDA 5EBWA 1FYTE 3OGOE 2C4XA 4IRJA 3TESA 5CGYD 2ITCA 1RUPL 5I71B 3GMRA 4AIXA 3EYVA 1T4KA 2R29H 3ZKND 4PTTA 3GSNA 4PRPD 2VAAB 1QLRA 2PO6D 1ZSDB 1TIUA 3P0YH 1CWVA 3DARA 1XAUA 5E6ZA 4JHAL 4X99B 1DQLL 3SO3C 3PWJB 4XBGA 5T3XE 2W0PA 4DW2L 3GJFH 5H94A 4NOBA 1LD9B 3BZEA 2YOCA 4EOWH 1I85A 5IVZB 3X3FL 3PHOA 2KZ1B 5DRXB 4FNLL 2J12B 3SE3C 5C08D 3DRQB 2X1PA 1C7TA 4OLZL 3OKEB 4K3GA 3THML 1JRHL 2FHFA 3GO1L 3HZMB 5A16B 3JUZA 5DC9B 2O5XL 2D9CA 3UBXI 3EJYC 5J13C 1OD7A 4RMWA 4M8VA 5ESVB 1HXYA 3BKCH 4R26L 2M26A 4BH7B 2YSSB 3SDCD 1XGPA 2EH7L 1NMCB 2DOCA 1U93A 5IB5B 5KOMC 3BO8A 3TZVC 3U9UA 2JIXD 5FYJU 4Z78B 3QNZA 4JFPA 2Z93A 1FNGB 5ADPH 1Z9OA 4H26A 3O6KL 2OZ4A 5D8JL 4ORZC 2ZOKB 5IJKC 1HDMA 4MNQA 5BW7A 4X6EB 1G7MA 2D0FA 3I02B 5A43C 4QHKI 3JV4A 3TBTA 4KV5F 3IDMB 3S37H 4LSVL 2AABL 5DA0B 5JHDE 4HAFA 4CW1A 5BOZG 4ZAKA 1HH6A 1IC4L 4N1EA 1MI5B 1Y6NR 3ZKSD 1GCFA 3MPCA 4E41D 4HCRH 2FB4H 3V52H 3TA3C 2EDDA 1I8MB 3SE4A 5IV2B 1EFXA 5D2LE 3CFEB 3DYPA 2EDNA 4ODTL 4HMEA 4UBDD 3J7HA 2EIZA 5D72L 3B2UC 5D7LE 1RZIB 2WWMD 1OAXL 4LASL 4YE4H 5IF0A 1K9TA 1BP3B 3EAKA 1KN4L 4KK8C 2OJEA 1A6WL 2ATKA 1AY1L 5ID0B 1LO0H 2F9BT 4JFXA 4O2EA 3D0LA 3EYQD 1FG2B 5E6ID 3VRIA 1NCWL 2XYCA 4WRLA 5I1HL 1ZOXA 1P7HL 4JM2A 4FQXA 3QIBA 4QHUB 4V1DB 3RIAK 2AXGA 2WQRA 4O2FB 1B3JA 1DN2A 1XF3A 2XA3A 2JELH 4V2BA 2WANA 4PRHA 3RBGA 5KVDH 1B0RA 3OGCB 1IL1B 1OGAB 4KZEL 4JKPH 4PJGE 2GK0A 3CX5J 3FCTB 2EDTA 4H20H 4WW1A 2BNUA 3Q3GB 4JFZH 3B2VH 3BH9A 4TVPD 4PB0L 3MRHA 3QO1A 2EICA 3IDIB 3ARBC 4Y4FA 4M7ZC 1PKOA 4LEOA 3LD8C 3QQ4A 3RZCB 4UUJA 5T1LD 3VE0B 3B9AA 4LKCA 1GOGA 2OMBA 4X5LA 5CGMA 1MCWW 2IAMD 2IG2H 3ARPA 5HYQB 1JYNA 1NCDL 4HKXB 3HE6A 3VFUA 5IKCB 5GJTL 1NBYB 4L29A 4UNVA 1IQDA 5C0IB 3OJDB 4CL7A 3DOSA 5DJCA 1EVUA 5BS0D 2R1XA 1H8NA 3CZFA 4U1MA 3ALWA 5IEHB 4QYOB 3BGAA 3QUKA 4LF3A 5CBEB 3BMVA 1QP1A 1CU4H 4TSBL 3R4DA 4FXGB 4RFEA 5L2JA 4R96A 3OB8A 5AZ2H 2RIKA 3AXLB 4XPAL 3LZFH 5IW3A 2C9AA 3G6JB 1MHPH 4DTGH 4G8GA 2DQGH 3QWQB 1IAIL 2B2XL 4FQJH 4IRZL 3TP4A 4DVBA 3GJEB 1BMGA 2YA2A 3TCXA 3ULUF 3H0TA 1MY5A 1F4XH 2VXQH 4Z7NF 3P40A 5C0CE 1JNNH 2R1YA 4MHHG 4PJBB 3DWTA 5A2KH 3EGSB 4CUCA 4YBQC 3HZVB 3CSYA 4LMQE 4TPRL 4XP4H 3WV0A 2APVA 2DYPB 3KYKH 3UZEA 1BQLL 4ELKB 1QACA 3PQYA 5GIRA 1KC5H 5CLTA 5D1QD 4ZFOA 1NGQL 1EFQA 4PJIF 3MLYH 4QF1B 5HVHB 2KQMA 4O2CB 4FHBD 3IFNH 4UILL 4XCCL 3BEWB 2HT4D 4YNYB 3QPXH 3AU1A 1EO7A 3L3DA 1JZ5A 1G9ML 1I3VA 1QRND 2VLJB 3TVMA 5EBGA 4MZ3A 3BSZH 2IALA 4WW2C 1S5IL 1T7YA 1XH3A 3DV4B 5KN5A 5D1ZC 3BZFA 3HE7C 1GVIA 5I1EL 2CDGB 1T0MA 1MFCH 3MGTA 4RGMC 5B39A 1EBAA 3FT2A 4FTVE 1Q9LB 1AC6A 2DQCL 2P7TA 1XZ0B 1DQQA 4MD5B 3QHZL 4LIQE 1I7ZA 2P5WD 3IETA 3NH7H 3SKMA 2CK0L 3UP1A 1X7QB 4WTZG 3LKSA 2OXHA 2ICWB 3ZDYF 4WU7B 5CS7A 4YGVA 1IE5A 3P77B 4O58H 3IS0X 3QUZB 5JORB 5ESQA 1VFBB 4X6BB 1D5XB 2ED9A 3BPLC 4M93C 5I1IH 1H3XA 4ZTPH 2JE8A 4WWKA 1KV3A 3LCYA 4APQA 1S3KL 4C54A 5F7DA 3LN9A 5F7MC 5LG1A 1WWAX 5DUMH 5T3ZH 4OI7A 1UXSA 1ZHNA 5GRZA 3F6LA 2VDQL 3TT1H 5F97E 3MRMB 3C6LA 4KKCD 5DRNA 5C0JA 2HFGH 4IS6B 4HKBB 2NMSA 2DS4A 1BVKA 3BE1L 4E42B 3WIHL 4POYA 2DB8A 1T7ZA 3P4MB 1DR9A 4G8FA 5AYUL 1RJLA 3WHE1 5HPMB 1CI5A 1U3HB 4JFOA 3PP4L 1HH9A 2VABA 4PRBA 2Z4QB 3T04D 2W9LA 3T0XA 3UJIH 5CSGA 1VPOH 2DTMH 4NBYB 4Z7WA 1AE6L 3KPMB 4KKAD 4I18C 5T1KD 4Q58C 3U48A 4GRWB 3MV9E 1TJHL 2ADFL 2CIIA 3IF1A 2L0DA 1GAFH 3DMMD 4WTZA 4KH2A 4EJ1C 3MJ7B 3QEHA 3UTSE 3KWWA 3OJMB 1MI5D 5F96L 1HI6A 5KW9L 3REVB 1PFCA 2BNQA 2XWTA 1J11A 3I3DA 4M5YL 4LNRB 5IK3B 3VGAC 3QJFB 1CE1L 3RIAF 2X9YA 5F7EL 4F9PA 4PJEF 3MV8A 4K3JL 1AJ7L 1X9QA 2BERA 5HDQL 3IU3A 2AP2A 3TIDB 1DBBH 5GZOD 3HG1A 1V5JA 4NZUH 1GRWA 3DROB 4XAKE 4C58B 4G6JH 2ZUQB 1A64A 35C8H 1RUMH 3B5HA 5CJBA 1TETL 4U6VL 1K4CB 5HDLA 1YN7A 3IDXH 4MJIE 5CJQL 5HHQA 4HXAH 2C3HA 3L3KA 1N6QH 2AS5M 1MQ8A 5I75B 1KXVC 3BKML 1DL7L 2V2XA 4JY4B 4V1DD 4UB0L 1KPVA 2Y36L 1WEJH 5CIPA 2BC4A 4J3VA 1GZPA 1T7XA 1HHIA 1YYMH 3CDGB 3GMMA 4OM1H 2IPUG 1HCVA 1HN1A 2FJHB 2Q8BL 1KULA 1CZ8H 3KPQA 4M1CC 3TV3L 3IDJB 4M43L 1DZBA 5C2BH 5EBLB 5CEXA 5DJDA 4GRLA 2VSDA 2ZNXA 3RGVD 2BVUA 1PLGL 4L3CA 2X4TB 3AFLA 4Q0XL 4CMHC 4U1JB 1UZ8B 4WUKH 1S9XB 1MCCA 4MLSA 2ESVB 3VWKB 4BFIA 2HVKA 4XCNB 3W39B 4HFUH 4A6YH 4PGEA 1KIQA 1LP9B 3BWUC 1RIVH 3W82A 1D5BA 5C7XL 3OXRB 4OIAA 5JW5B 1BVLA 1KCUL 4QXGH 3LKPA 2NXYB 3VG0L 1U92A 2QADB 4FABH 5B4MC 3JSSA 3VMPA 4M62H 1U8NA 3Q2CA 4BSJA 4AT6B 2P8PA 2VXSH 3WFDH 5ETUA 4JFYA 3NFPA 1J87A 4ZSOE 4X7EC 5GSRA 5LVEA 1FC1A 1ZVSB 2NTFB 5DGRA 1QA9B 3P0YL 4YLQT 2VDOH 1UB6A 2DKUA 3K8KA 4Y5YA 3I3BA 3BAEH 1LO5A 3LKRB 4Y2OA 3QULA 1EAPB 3Q5OA 5I74B 3O9WD 2UUDK 1ZV5A 1NJ9B 3T0DA 3ZDZE 2JCCE 1L6XA 4MQTB 4PJHF 4EKXA 3VD4A 3X17A 4NRZB 4YPGA 3KHOA 2X89D 1AQDA 1XGRB 3P4LA 2PKDA 2EKJA 2QSTA 2IADB 2F53B 5SWZB 5D7JC 3BKCL 3BIKA 4F33B 2NY5C 4OI9A 3V5DA 3ILPB 3I9GH 5FECA 1LEGB 2XOTA 7CGTA 4JGMA 2EDJA 4XXCA 4IRJC 5EIIB 2Z92A 5JZ7D 4J2XA 4NFDA 2Q1EA 1TVHB 2GFBB 2HVJA 5K9QG 4LLAA 2XG5A 2VLJD 1OT1A 5E8PB 4ZOEA 1FVDA 1MCLA 5BZWB 4FQHB 4PP2B 2V17H 3HHRB 1OWWA 4OLWH 2G75A 4KK5C 3D0VA 3ABZA 1D5ZB 4YDJB 4MQXD 2VLLB 4N0UA 3S37L 1XGTB 2AXFB 2NY3C 4LSTH 4MD4A 5FYKH 2GSIA 1E4JA 4HWZA 4A2LA 1PZ5A 4QRUB 1UC6A 1FL6B 4ODVH 2V2TA 3P9LB 3WE6A 4HCRL 2FB4L 5EZJB 3V52L 5F8QC 1FNFA 3QCTH 3TNMB 2VZ3A 1UQSA 4KK6D 4HKZA 2Q8AH 5IMLA 4DKFH 3FO2B 1MCEA 2AK4A 2UY6A 2AJUL 3SN6N 2EZ0D 4XXDA 5GGTA 3DX8A 4P9MH 1LK2B 4HK3J 1EJ6A 2VZUA 4L3EE 4PD4K 2MHAB 3NIFE 4PRDB 3TN0A 4YE4L 1EDQA 3ECBB 1ZT7B 2R2BA 4ZUTB 3FO0L 3KXFA 3HNVH 3LQAC 4H88H 3C8HA 4Y1AD 3T0EB 3D3VD 1U3HD 3OX8B 2VITA 1A3LH 2EO9A 1T7VA 1JZ4A 2JELL 4KKBD 2I9TB 2A6IB 2AJ3B 5JOFA 1NKRA 1Q9WB 3GSUB 3HMWH 1NFIB 4BFGA 1KYOK 1N5AB 4EIGB 4NKOA 1HE7A 2X4UA 3QIWC 4QHNB 2A6DB 2ICES 5H37G 1CDYA 5B3NA 3I2CH 1NUNB 1OAKH 1S7WA 5ALBH 3B2VL 1QNZH 3QO0B 3GRWH 1T2JA 5C8JA 1LO3L 3RPIB 1IGML 1BBJB 4ZPVB 3MCG1 4N8VG 3QDME 3ES6B 1MRFH 4PR5A 5FHAH 4BELD 4F80A 5I8CB 1MHHA 1Y0LA 2VC2H 4ZG1A 3RWEA 3IFOB 3VXMD 2IG2L 4XPTH 5SX4I 4YJZL 2GT9A 2YD3A 1RZJC 4OUUB 4RAHA 3V4PH 4JKLA 4FQXC 3VI4E 4HUKB 4IMKA 3MRBB 2V5TA 2VAJA 2BVOA 1I8LC 4P3CH 1CU4L 1CGXA 4E5XA 4JG0H 2DLIA 3C09C 3PL6A 1QSFE 1QSEA 1YEGH 2VXTH 1KNOA 4D9QE 5BVPL 3LZFL 4LNVA 1KCRH 1HNFA 1MHPL 2N7AA 3FQUB 4DTGL 1E4WL 2DQGL 4WI4A 5ITBH 5GS2H 3HS0A 1GH7A 1F4XL 1XCQA 1JNNL 5EU6E 5TPWH 1CBVH 4Y4FC 1FG9C 1HINH 5A2FA 1RIUH 3L9RA 4I1NB 3WKML 4XP4L 1ZHBB 3KYKL 3D2UB 3MV7D 4N8VA 2CJUL 2D9QB 3SCMC 3WSQH 4NRXB 2AJSH 3MR9B 4PRNA 1ZLWK 3BVNB 3WUWB 3MLYL 3QI9B 3MNZB 3SY0A 1D6VH 2XXMB 3TLRA 2BX5A 3H9SD 5ENWA 4Y5XB 1J8KA 3QPXL 1TJGH 2J1KA 3AM8A 5B21A 4XCYB 2D7MA 4YDKH 3FOLB 3BSZL 4LLUA 3FB6A 2X4OA 1T5WA 3QUMH 1EGJH 2BSTA 2F8XC 1T2XA 4OV5B 3QUYA 3QXUA 3RAJH 3MUGA 5F1NB 1MFCL 5TQ0H 2OI9C 4S1QH 4HJGB 2NW2A 4XH2B 3HAEB 1RZKC 1L7IH 1MVFA 5BQ7B 4O51B 3I6GB 2Q76A 3I75B 1FFPA 4C57C 2A83A 3LEXA 4X4XA 4DCQB 1ZXQA 3L7EA 1LEIB 1UVQA 2R9HD 2F74A 4LDOB 5HHOB 2FIKB 2J8UA 4IIQC 1GHFL 1JF1B 4LGPB 1ZLVH 1CDGA 1D5MB 2VXVH 4O58L 1S9VA 2HFTA 2CDFB 3CMOL 4Y4HA 3AS3A 3HFMH 4JLRA 4Y0GA 5I1IL 3SJVA 4ZTPL 4GG6F 4KUZH 3TBYB 1ZT1B 3KJ6L 2PF6A 2IQAB 4XNZB 3NAAL 1MEXH 5T3ZL 5DUML 3DX9B 2H6PB 2F53D 3UJTH 2DIJA 4LPUA 1KB9J 2HKFH 1M6OA 3ZL4H 3BJ91 3KR3H 3EKCA 2HFGL 4Z77B 2YBRB 4OM0H 3VXSB 4MNGB 1RUKH 3OKKB 4JKKA 5D1XC 4L8DB 4N0CC 3RDTA 3UJIL 4Z0BH 1MCOH 1VPOL 2DTML 5GGQL 1MCFA 3VRLF 1BM3L 2XQYG 5DK2A 4QOKB 5IVXE 1U8OB 3SGEH 3NZHH 1GAFL 1IBGH 2VISA 4WHTA 1NFDE 3SDAD 5D7IB 3A0OA 4TSAH 2J8HA 3LMJH 5TF0A 4J3SA 5ILTH 4WWKC 4Q9RL 3SDDB 3QQ3A 3OKNA 3CCHA 4HZLA 1R5IB 3VFRB 4PY8I 4LVOC 3MRFA 3BQUD 1QVOB 3PHQA 4HJ0C 4LCYA 4DZBB 3EYOA 3LH2L 1N4XL 3C6LC 3U0TB 4PJXB 3LKQB 1DBBL 3VMNA 5AD0B 1J0ZA 5GGRY 1T2QH 4G6JL 3S97C 1NKOA 4ZODA 4UV4H 3HUJA 3VWJA 3FO1B 2VN7A 5MI0B 35C8L 3O6FA 1RUML 5F3BA 3O3BA 1FL5A 4LAQH 5DRZB 3IDXL 5F9WB 4HUUA 5FYKE 1IGIH 3DSFH 5F6HJ 2RFXA 4AEFA 2YEZB 4UT9H 1N6QL 4JREB 4H8WC 4QHLB 3VU2A 2XKNB 5E99H 3VH8G 1UZ6E 3QHFH 4CNIA 5JPNA 5GS1B 4NDMB 4RWYH 1NDMA 1WEJL 3K4AA 5E7BA 3GKWH 1I1AC 4G9FE 5TFSH 4H25A 1KJ2B 5C6PB 5ESAB 4JZJB 4OM1L 1A3RH 4PGBA 5SV3A 4D0BB 3C60A 2ZSWB 1KTRL 4OCXH 3VXTB 1CZ8L 3I6KA 1ZMYA 1XF5B 1FJ1A 5C2BL 4ORGA 5FA4B 4ZUUB 5ICXA 5J0BA 1BD2A 4H5SB 4LCCA 1I1CA 5DEFA 3HR5A 3PWLB 2Q7YA 3UTQA 2ORBL 3AREA 1FYTB 1O7SA 4P2QA 3FOMA 5EO9A 4KHTL 5LAXA 3K8MA 4UDTA 1RUAL 1OP3K 4A6YL 4X5WB 4RMSA 1GGCL 4FZ8H 1KIPA 4OUOA 4IOIA 3LRSB 4OZ4A 4WEUD 4RMUA 3KHQA 5EBMA 2R0KH 3BKYH 1MLBB 3KPLA 4W70A 2Y07H 1KTKE 4QRPB 3TBVA 1U8HA 4NKDA 4K55A 1U3JA 1YNLL 2EDHA 4XPHL 5HHME 2VWEE 4FABL 4DGVL 2E8ZA 1FL3B 4WJ5B 3UBXB 1KTDB 1KCLA 4GXVL 4L4TE 3FQWB 3CFDB 3IU4H 2VXSL 3P3YA 3WFDL 2I9LA 4GH7B 3D85A 4IOFD 2CRMA 3DVIA 5FOJA 3SDXF 1DTUA 4Z7UE 5MHSE 4OI8A 2GCYB 3QAZC 5CZVH 4GO6B 2VDOL 2HT2C 4U1LB 1X5FA 4EVNA 2DI9A 1CDJA 3TNNA 3P4OB 2X1WL 3BXNA 4XGZA 4HK0A 4GRLC 4S1DC 3BAEL 4XMPL 1JFQH 3PABA 1AO7D 5CZKA 2NY1D 5F9JB 3OG4B 1J8HB 1H8OA 1S9WB 4O02H 4NZRL 4RNRA 4DN3H 2IAND 4G7YH 1NSNL 3MUHL 3Q1SL 3H3BC 4KPHH 3FQXA 3KPSD 4O00A 1A6AA 2P5ED 1FNSH 4JHWH 5EO0A 5JIPA 1K2DB 3GMLB 1INQA 4BSWA 3I9GL 3QI9D 4X8JB 2X41A 1MWAB 5IBTH 3BGMB 3JXAA 4LLWA 1D5IH 3L7FA 1KSRA 5ALCH 3UPRB 4EI6B 4XAWH 4F58H 3NBNA 3JV6A 4NQEE 5AAMA 5IROA 5J3HD 5L2KA 4R7DA 1AR2A 5C0NC 4OLWL 2FX9L 5KSBA 1YQ2A 4JFEA 4Q2ZB 4Y5YC 2OTWA 4N68A 5FF6B 2X40A 2FHCA 1NGXA 4LSTL 2J8OA 5D2LB 4MNQE 1JRHI 3NCCB 4OLXH 4MWFA 4B50A 4YHZL 2V2WB 2VLRB 1XR9B 3O11A 3LOWA 1N5YH 2X70B 2UVEA 1MIEL 1YC7A 2IEPA 3HI1A 3IJHA 1BBDL 5HHXH 1I9EA 2SEBA 4G3YL 4G80A 4JEGB 2V5YA 2Q8AL 5KVGH 4DKFL 1F8TH 4RCAA 5LGJB 2L7UA 3EOBA 1UM4H 4WY7L 4LP4A 4RA3A 1JMZA 1EEUA 5HGGS 1P4LB 3WHXA 3MBEB 4N9OB 3HNVL 1A7OH 4H88L 2LVCA 5HPOA 3CC5B 1QLEH 3C6SA 4HPYH 3VXUE 4WI6A 2RCSH 2ICWJ 3VXSD 3QEGH 4ELME 4NO0D 3WXWH 3X3GH 5INCB 2Z91B 1A3LL 3D69A 4JZNA 4ZFGH 1IFHH 2P8MA 3HMWL 3PWPE 1IEAB 1A9EA 1RU9H 4HUNB 4FXKB 3W0WA 2B7DT 1CYGA 5B8CB 5DYOA 2FEEL 4JO2H 5I17B 3I2CL 3V6FA 2O5YH 3NFSH 4BH8A 1OAKL 5I0ZA 4LVEA 4TRPL 1QNZL 3FQNA 3UTTA 2H8PA 5CSBA 2W65B 2C5DC 3TYFB 1W8NA 2YUWA 5I8OL 1MRFL 4XPBH 4PY7B 5FHAL 1JNHA 1M7IA 4MVBD 1CK0H 2VC2L 1G7LB 5ICYB 2CO6B 2GTZB 5IMOA 2GTWB 1U8IB 2P47B 4I77H 3V4PL 1C1EL 4JM2F 1WVZA 5JDSA 5IB3B 2ZCKH 1IILE 5C09A 1EAJA 3QYCA 3K1DA 4NM8H 4NYLA 4LCWA 1CICC 5BZDB 2CR6A 1EV2E 1CDBA 3W9EA 4HG4K 1KCRL 5MEQA 1M05B 1H5BA 1MJ7H 4HIHB 1JWSB 5ITBL 3HZYA 4KC3B 4W81A 1Y6MR 3RA7H 1FO0L 2FWOB 5MENB 4BUHA 5TPWL 2JJSC 5DHVA 2EDEA 2N4IA 4MXVE 3GDBA 2H9GA 5JMOC 1LVEA 1FO0A 1RIUL 5CHNA 3INUH 4P46B 5A2LH 4X98B 4P5KA 5DVLA 3VFWB 4G8EB 4LSSH 4S11A 3WSQL 4OGAD 4KQ4H 3WFHB 2ERJB 5BRZE 3RKDC 3U46B 5J1AA 2AJSL 4NSKA 2VJXA 4IMKC 1WIOA 1D6VL 3GMOB 4FFZL 2AGJH 5MEPA 4NT6A 3L95B 5I73C 1FYTD 1DVFB 3ULSA 1DQJB 1H3TA 3PL6C 3T3ME 4JRYB 4U1HA 3VFMA 5EDXA 1BFVL 1MHCA 4XMKH 1IAII 3BX7C 3OF6D 4YDKL 1JPFB 1N59A 4YDLC 4YEEA 3QUML 1IM3A 1EGJL 3IDYC 2ZJSH 5IB4B 1D9KB 2VE6B 3HZKA 1N3NB 1TPXC 5TQ0L 3DETD 2DIAA 1EEYB 4JANA 4RFNB 2RAMA 4NN7C 4TULH 1L7IL 2G60H 1T1WA 3O3AA 2B5IB 2XZCH 2HRPL 1ZA6A 1CD0A 5JNYA 2NZ9D 2R23A 4M02A 4UU9B 4K94C 3TH4T 1DLHA 3MUZ1 2E5EA 1VESA 2O61A 3MRCA 3X11A 4TTGA 4PJ8A 2P45B 3SHSA 5FO7A 1KPUA 4MA3B 1TZIA 4GBXC 2VXVL 2O93L 1J05B 3U0PB 1X5JA 5TE6L 4MX7B 4R8WL 4LLYA 1LK3H 2GSGA 1HHHB 1XGQA 4KUZL 1N7MH 2V9RA 5E5MA 5J7CC 3PP3H 3HNSH 1WBYA 1MEXL 1XF4B 5HHNB 5C9JA 5I1KH 3EO0A 4EDXB 2H45A 3UJTL 1J88A 5IUSA 5E2UH 3ZL4L 4MHHI 5LWYH 3HNTH 3UPCA 3BP5A 3ARFA 3QUYC 4OM0L 4ODXA 3NIDF 2M2DA 3IFPA 4MS8C 3T4YB 1BAFH 2ZPKH 2AXHA 1RUKL 1ZTXH 3CVHL 4GKNA 1DE4B 1PDKA 2RGSA 3U79A 5JHDD 3UTSB 5F7HA 2KH2B 3L5XH 1NAMB 4Z0BL 1MCOL 2KL6A 1FSKB 3U6RB 2Z9TA 3TWCH 3CVHA 3H7BB 5JW4Q 3QXVA 1PKQA 5I1LA 4KJWD 5GGUB 1OTSD 2W60B 1TDQA 3NZHL 5F3HA 1S7TB 4AIOA 4PP1C 2G9HA 4TSAL 2LQRA 2DMCA 3LMJL 2HN7A 1OAZH 5FUZH 4CJ0A 4P4KC 4QCIB 3RL2B 1T7WA 2PYFA 5ILTL 1XT5A 2DTSA 3KJ4C 3G04B 5D7LD 2BMKB 1EX0A 4S0SD 4Y2DB 2QKIA 2X9WA 3WN5A 1NC2A 1JYXA 2BSSB 3VMOA 3HC4H 4Y5VA 3ARGD 1X5ZA 4E0RB 4MJIB 4N9GB 1TTUA 4M7KL 1T2QL 4XVTH 4UV4L 2AJYH 1U8MA 3OWEA 3MBXH 3RDTC 4NUJA 3RJQB 4EXPX 3CSBA 5IBUG 3MRNA 1JZ8A 4Z7WF 4ONOA 3Q5TA 1A02N 1IGIL 4U31A 4WUUE 4DK6A 3IVKA 1AGEB 1X4YA 1FHGA 2BSRB 2CD0A 3G5XB 4U0RB 4ZQKB 5IMKA 5JW4R 4LOUD 1NCTA 5E99L 1A7QH 2CLRA 1EXUA 3QHFL 4IM8A 3BI9X 4RWYL 5BJTB 4NQUA 1KJMB 4J8RB 4R7NB 3GKWL 1TLKA 2A77H 5TFSL 1SVZA 3L3HA 4CU6A 4NNXA 3G08A 4GW5A 4OCXL 1FNLA 3WLWC 1IGJB 3SO3B 4YHYC 5DFVD 2RR3A 5CBAB 2H2SC 3MOBH 3BYTA 1S9YB 3S36X 3TFKC 4CADA 3L6FA 3VXQB 3S3SA 3EHBC 5E94B 3U7YH 3FFCB 3P73B 3ESUF 4Q6IA 2H3NB 1YMHA 3E6HB 5FKAA 1A9BB 5SWSA 3OZ9H 4PJHB 1AXTL 3DO7A 3RNKA 4NQVA 2PCPB 3RY6C 4R90H 4FZ8L 5KSVB 1I1RA 3RTQA 2CKBB 4ZSOB 4K8RC 1IKFH 2R0KL 3BKYL 4N8PA 4PG2A 4FQPA 2OQJA 2Y07L 2BFVL 2V5MA 4DGYH 3TZVB 1FLTX 1V3LA 4NUGH 3GSWB 5C0CD 4ZFZB 3VFNB 3IU4L 3KPOA 1UM5H 1A47A 4X6FA 1EJOH 3C60C 1ZK9A 1BF8A 4YBLC 3W11D 1AC0A 3RWGB 5CZVL 1K8IB 2VDKL 1FZMB 2JCCB 1A1NB 3M17B 4JJ5B 3CXDH 5BVJB 5DJ2A 3BP6A 2MPAH 1KBGH 4LCCC 4K23H 1J5OH 3OR7B 1JFQL 2F54A 4JDZA 1Q9OA 2WIIA 1Z6JT 4O02L 4P46D 3MLVH 4DN3L 2AEIT 4G7YL 4KPHL 3FZUD 2APWA 2FEDD 1OTTC 2G5BB 3TA3B 3O8XA 4JHWL 1VEOA 4DAGH 1C12A 5FCUH 1A6ZA 4R2GC 3F58H 5IBTL 3BIBX 1D5IL 1DVFD 4GSDH 2XKSA 5DJ6A 1VGKB 4ZS6D 5DQ9B 5IIEB 2BNRE 4KROD 4XAWL 2GJZB 3FONA 1R3IH 4FTVD 3ZE1E 3GMPB 2R2HB 3AMKA 5E08H 4OFIA 1D9KD 3TYGH 3JWNC 3W9DA 3VXOB 4AZ8A 1CFTA 1VA9A 3RVWD 4N8CH 3DVNA 3BN9C 1JGLH 2P48B 4TVPH 4F2MA 1NGWB 1LO4L 3WNMA 4OLXL 4ODWB 4EQ3A 3KPRD 4Y88A 1HQRB 1HXMA 4FS0A 3EOYG 4HFWA 3RZWA 1WZMA 1FH5L 4OFPA 4Z7VE 1UH4A 3RWIA 1FVEA 1W72H 4LFHG 5EU5A 5HHXL 1S5HA 2RB8A 3FQTB 4KRLB 5DJYB 4Z0XB 3RBSA 2OL3B 2DQHL 1OW0C 3OXSB 1RSFA 5KVGL 4QRQA 1A3QA 1KFAH 2IH3B 1F8TL 4K8RH 3O2DH 4OCMC 3PV6A 3WDIA 3F5WA 3WS3B 5SV4A 3ARBB 3MSPA 4M7ZB 3V4VL 3H6JA 3MLWH 1KOAA 1P4BL 3LD8B 4W4NA 3AY4C 4X7DC 4DFIA 5IROC 3GGWB 5D93C 3ARSA 4KU1A 5I9QC 1JIBA 2EDLA 5D6DC 3E6FA 4BKLB 3MV9D 5I6XC 2RCSL 4MDIB 1LMKA 3VDCA 3H9HB 3QEGL 4JR9H 5DGQA 2N1KA 3VG9C 3X3GL 4AH2A 4W6WB 1WTLA 3UTSD 4I3SH 2YRZA 3KPNA 1WWBX 1IFHL 3MCKB 1CFVH 4PJDE 1RU9L 5IOPB 3WFBL 2YPLB 4NKMB 1YY8B 4GW4A 4JO2L 3SBWC 4X83A 3TC9A 2O5YL 3NFSL 5K9QI 3WO3B 1K6QH 4WO4C 5F1IB 3IJSA 1BX2B 1FP5A 5ERWA 3ARWA 3BHBA 1MOEA 1BZ9A 1HHKA 4XAKD 1CG9A 3KYOA 3FMGH 1ZS8B 1OQOA 4Y2DD 4MJ5A 1IGYB 3MOAH 4LKXA 4U1NA 5GXBB 3QDJA 1CK0L 1K5NB 1Q9KB 2NY0C 5MERA 3WCYA 2EKSB 1KG0B 1DUYA 4LBEB 4I4WB 4MJID 4OZGE 4U1IA 1JV5A 1RY7B 4I77L 2GK2A 3NTCH 5D5ME 4S2SA 5J06A 1KB5B 2ZCKL 4JPIB 5E8DL 5E8OB 1R5WA 4YDVB 4AEHH 5EU6B 3QA3B 4NM8L 3RHWK 1HCFX 1WSST 5C0BA 2E9WA 1OAYL 2BOBA 4JO3H 5ACMA 1JI1A 2VQ1A 4GAYA 3GSVA 2NY7H 2CLVB 3WXVL 3HE7B 3TO4D 3BIAX 4BUGA 2Z31A 3U82B 4U3CA 1HKLH 5TH2B 4RGMB 4Q7DA 3RA7L 1QSEE 1F45A 1RPQA 3LDBB 4KI1A 3U4EA 4KK9C 4P23D 1FQ9C 4J3UA 4G7VH 3IS1X 4X6CA 3INUL 1S7XB 5DQJB 4WHCA 3RWCA 1TFHA 3DSNA 1HILB 1FVCB 3B9KA 3DX6A 4KJQD 4LSSL 3JBG7 2VLKA 4KQ4L 1OPGH 4XCEA 4F7PA 3GK8H 4MCZB 4PLKC 1BZ7B 4MDJB 2ZKHH 1ITBB 4HGWA 3QP3A 3RKPA 5I2IA 4U6XA 3CDYA 3VFSA 3BPLB 4M93B 3EDFA 4N90E 1I7RA 1YUHB 3FT3B 1O7VA 1Q1JH 2A9ML 1SVCP 3EFFB 1RK1B 1YPZA 3SDYH 1CGYA 3NIGF 4C56B 2O26U 1CVSC 5IFAL 3EJYD 4XMKL 4GAJH 4IOSD 1H5BC 2IQ9H 5TQ2H 4MQSB 4R9HA 1WC7B 1WQVT 1NEZA 5DHYB 3TZVD 4KMLB 5K9OB 4G43A 4EN3D 4GKSA 1ND0B 2AEPH 3L3OA 2P49B 4YXLL 1E4KA 4XHJC 4TULL 3RNQB 2G60L 4U3HA 4GXUN 1FE8H 4NQCA 4UAOC 2XZCL 5EUOE 5CAYB 5C0AB 2RJMA 1RI8A 2XZAH 2HYMA 3T2OA 2VUYA 3V7MA 3N1GC 2HJLA 1GYAA 1WV7T 1T80A 5FYLE 1MFBH 4ZNCD 3GHBH 3PNWA 1LK3L 5DMKB 1AR1C 2C1OB 2I5YH 4OCNC 1JHLH 1CFSB 2J8UE 1N7ML 5JQ6H 4XX1E 3HNSL 4HWBH 2DMBA 4PLNC 5D6CB 2X1QA 1RZ8A 5E2UL 5LWYL 3HNTL 3B9DA 3SJVE 1CE6B 5HVHC 1T1YB 3IGAB 2VDRL 5DVOA 1FIEA 5IBLC 3B2UD 4Z76A 5IVXB 2XXCB 1ZTXL 4L5FH 2NX5A 1EEQA 1OF2A 1X5AA 5ISZB 1URLA 2ID5A 3L5XL 3OG6B 2QQLH 3VRJB 1PVHA 2EEDA 3TWCL 1A4JA 3GMNB 2DF3A 4PRIE 4PJ8C 1X4ZA 1YNTB 1YY9C 3GFUA 4DZ8B 4XP5H 1A6TB 2PW2A 1OAZL 1E0OB 4JCLA 5FUZL 4KZDL 1QYGH 3QEQA 1LHZA 2OCFD 1T5XB 3CLFH 1UWEL 4L3ED 3MRDB 2ARJB 1A2YB 4EIZC 1YEHL 2X7LA 3GMQA 4R3SA 4JAMA 2CRZA 4U6TA 4UDUA 3WBDA 5T1MA 3HC4L 1ZE3C 4HV8A 1ADQH 3ARFC 3QUZC 4KGLA 5IJVA 3ULVC 2H26B 3VXNB 1G6RA 3ARBD 4X9HA 2JLLA 4PUBH 3WIIH 4CMHB 3MJ8A 1L7TH 1OD9A 1U8JA 2AJYL 4XVTL 5IQ7H 1KUMA 4WU5A 2GAZB 5HYJE 1PW3A 3LY6A 3MBXL 3VGHA 3PJSB 2HTLC 1JGVH 2EYSB 3MNWB 3OR6B 4G9FB 3EYFA 4PLJD 5JW4N 3IXAA 1FV1B 3NOIA 2R15A 4UIKH 1DBJH 1CLZH 1A7QL 2FYYA 2HRLA 4GRMB 4PRPA 2PO6A 1T04B 1NCCH 1YA5A 2PYEA 2BVQB 5DUBB 3PWVB 4Q6YA 4W6YB 5CZXC 5H2BB 1LNUA 5IR1A 1YNKH 2VRAA 1MFNA 3QDMD 3MODH 3DX7B 3WN5C 3HI5H 4YHLH 1JZ2A 5C08A 1BQHB 4Y5VC 3T1WA 2YPKB 3MOBL 32C2B 3SEPA 4J7RA 1C16B 5BXFA 3DVGB 3U7YL 1YN6A 1MCPL 2B4CH 2X4PB 3HUJF 3C5ZB 1QBMH 5A1AA 3RWJB 3OZ9L 4HQQH 3L3IA 2IFFL 3O3DA 2W0KA 2ZP0T 4R90L 2X1OA 1QSFD 1NMBL 1S7RA 4F7TA 4L4TB 2JIXA 5C07B 4D9QD 1D3CA 2W0FB 4WFEE 4QTIH 1IKFL 3V95A 4Z7UB 5A40E 3PGDB 5EBWB 4OCRL 3IRZA 3NVQA 3V7AG 1UT9A 4IRJB 4DGYL 1MH5A 3GMRB 4NUGL 3SE8H 1UM6H 3EZJB 3U83A 3MTRA 2XY1A 1T4KB 3EYVB 5IGXL 1DBMH 1UM5L 4PTTB 2CRYA 3GSNB 1EJOL 1QLRB 2KPNA 4X9GA 5EIVA 5DF0A 5D1ZD 4HWEH 4FA8A 4XB8A 4D3CH 4PJ7E 4XBGB 5DD0H 3CXDL 1KEMH 5H94B 2MPAL 1KBGL 3S9DB 4E41A 4PRAA 2E9JA 5DD1L 4QRRE 1J5OL 3ULVH 4XBEL 3PHOB 4TNVK 2EXWD 1DQDH 1A1OA 5KAQG 4LSUH 3DYOA 4W6XB 4CU7A 3U9PH 1G7JB 4R97C 1QFWL 1IAIM 3MLTA 3P30H 1KT2B 4JFHE 1RULL 5DO2D 4NBZB 4DAGL 1XGPB 5GSVA 4LQFH 2DM2A 4I0PD 3OHXA 5FCUL 2XNAA 1U93B 3F58L 3U9UB 1J1OH 3BO8B 4RGNC 2XTLA 2X10A 5EU4B 4GSDL 3QNZB 4JFPB 2Z93B 1BGXH 2CRIA 3VD7A 1HHJB 1EHLH 4U2ZA 4J3OC 5E6IA 4H26B 1R3IL 1UADC 3NA9H 1F11A 1HDMB 4MNQB 4XP9H 1G7MB 1VDGA 2VO5A 3EBAA 5D9SB 2FLBT 4GRWH 5E5UB 3IKCA 3TYGL 2Z8SA 4TNWK 3FRUA 3AVEA 3L1OH 1MQKH 4N8CL 4PGCA 4CW1B 1JGLL 4TVPL 1HH6B 1OVZA 1RZGA 2NY2D 3DO3A 1QKZH 43CAA 1Z5LB 2Y23A 5KSBE 1XF2B 2AJVH 3CFKB 3H3PH 1W72L 2C3GA 2LAAA 3QIWB 4OD1H 3O8XC 1EIBA 3B9EA 3QR2A 1AD9A 5D2NA 5HGHA 6FABL 2DL9A 4WIQA 5T1LA 3N0PB 3OMZA 1KFAL 3VFVA 3O2DL 3CPLA 4OZIF 2EIZB 4FMFA 2IAMA 1KTLA 5EZOH 3OKDB 1NBZB 4PPTA 1H15B 4KJPC 1ZAGA 2FGWH 1DSFL 3EDEA 3FB5A 5IF0B 4D9RE 5BS0A 4HS6A 2E27H 2ATKB 2V7NA 4DEPC 2FO1A 3T09A 3VGEA 2DI7A 4JFXB 2IH1A 3D0LB 3VRIB 2R0LH 4FQXB 1IC7H 2DQJL 2EYTA 3C2AH 4M6NH 2BK8A 4MXWH 4JR9L 1XF3B 3EO1A 2BZDA 1DANT 1R24A 4L9DA 1RV6X 4PRHB 3C09B 4I3SL 1B0RB 2NQCA 1CFVL 3K81A 2GK0B 4C83B 1ZA3A 1RIHH 4QRSB 3U4BH 3D18A 4WW1B 4X7FC 3TBWA 2BNUB 5LXGH 4G42A 1C5DA 1K6QL 3BH9B 2XPGB 5DJ0A 3W5MA 3MRHB 3QO1B 1S7UA 2F8OA 4JDVA 5KG9A 4Y4FB 2AI0H 1OCWL 4LEOB 3QQ4B 5D1QA 2A74A 4UUJB 1SYVA 4Z5RA 4M1CD 4LKCB 3LAFA 2NY4C 3MOAL 2E6QA 3HRZA 1QBAA 1TZGH 3DPBA 3HE6B 1E4XH 3VFUB 4L8CA 5C71A 5FYKD 5DJCB 4MNHA 2R1XB 2MWCA 3CZFB 3QRGH 3NTCL 1WFOA 3QUKB 3S34L 4LF3B 5IB1A 3REWA 1IMHC 1FZJA 5D96C 3BZ4A 2NNAA 4RFEB 5L2JB 3T2NH 4AEHL 4R96B 1SY6H 3PDDA 2WUCL 4ZMAT 4JO3L 4X4ME 1DEEA 4G8GB 3ROLB 4DVBB 1CLYH 1ED3A 3H0TB 4PJ5E 2P5WA 1ETZA 1HKLL 2OI9B 4H1LA 2R1YB 3QUXC 3A6OA 3BD4A 1WZKA 5EC2B 4G7VL 3CSYB 4WFGE 2E7LA 3K8LA 5JOPD 4HW6A 1IAOA 4LHUA 3PQYB 4MAYD 3LKNB 5GIRB 2NXZD 1XGUA 1AXSB 4N0YH 3GK8L 3OKEA 3QBTB 3HZMA 4KMQA 4ZFOB 5A16A 2ZKHL 5F89A 4ZOAA 4BQ9A 3I6LE 3G6JE 5ESVA 3JVGA 5IQ9A 4ODSH 5HHMD 2HAZA 5I30H 3L3DB 3SDYL 5IB5A 4L4TD 3TVMB 3ZKMC 2IALB 2XA8H 4YBHA 5D7JD 1Q72L 4GAJL 1XH3B 5E03A 2IQ9L 5KN5B 4MA1C 5TQ2L 5IWLA 4TNVF 5GRWA 5MHSD 5DK3A 4WFFE 2C3WA 1AGFA 1OP9A 2VH5H 1T0MB 2X1XR 2DL2A 4L9LA 3MGTB 1DJSA 3QXTA 3KLDA 4IRSD 4X6EA 5B39B 1NANH 3FT2B 4C4KT 5T1KA 2P7TB 2XZZA 1DQQB 1FE8L 3H7LA 1OM3H 5E00B 1I7ZB 3IETB 5D1XB 4CDHA 3DMMA 3Q5YA 2R1WA 1CGSL 3SKMB 1JZ3A 3B9KC 4OZHA 1ONQB 2XZAL 4R4ND 3LKSB 3S36L 4CAGA 4YGVB 3U2SA 5C92A 4KRPC 2NY3D 1MFBL 2K9UA 3GHBL 1I8MA 4XHQA 3T3PE 3ZDXE 2OJZH 4WCYH 4WWKB 3UXFA 4APQB 4B0MM 4NO2B 5JQ6L 4HWBL 4LVOB 5GS2D 1JPTL 3LHPL 4TNWF 4QO1A 1OTUC 1UXSB 1MHEA 1VCAA 4NQED 1RZIA 2QEJA 3C6LB 4B7LA 5DRNB 2PW1B 5C0JB 2YUVA 5DEGA 5HGDA 2DWDA 2X9XA 1ZLSH 5AYQA 3CFIC 1E4KC 4G8FB 1RJLB 3KLHD 4JFOB 4L5FL 4Z9KB 1HH9B 2VABB 4V1DA 1S7SA 1FCGA 4MNQD 1HZHH 3WEXA 1FFRA 4KKNA 4Z7WB 4O2FA 4PJEA 2QQLL 3E8UH 3ULVE 5AZEH 2DWEA 1UWGH 4N5EC 3I85A 1BFOA 4XZUA 1QR4A 3OGCA 1IC1A 1IL1A 1CFQA 2FX8H 3D9AH 3ORJA 1JNJA 3RVUD 1AQKH 5FOBA 4LRNH 3QEHB 4KI5F 3KWWB 3HI6H 4BZ2H 1HI6B 4XWOC 4OSUH 1I1AB 3ROOB 1QYGL 3JTTA 4HIIA 4M6OH 2BNQB 2FZ3B 4N1CA 3RGVA 1QHOA 2CMRH 3QIWD 3MV8B 1ZKAA 5GISH 3IU3B 3VE0A 3UDWA 1ADQL 4HZAA 4LGSB 1MJJA 4WUUB 4FMKA 3VXUD 2DD8L 4PUBL 3WIIL 4GRWE 4I2XA 1ADQA 1L7TL 1NBYA 2VIRA 2VDLL 2WUBH 5IQ7L 2FO4A 1SYSA 1JGVL 1YC8A 2CH8A 1YN7B 3PWPD 3SGEI 5HHQB 1I9IL 3CK0H 1V7MH 3RU8H 2EH8H 3GI9L 2HTKC 4FXGA 1VFAA 3L3KB 2X4NA 1QPPA 2CUMA 2Y06H 5DQDH 4UIKL 1DBJL 1CLZL 2HJFA 1KPVB 3M07A 4KRNA 5CIPB 2BC4B 4L4JA 2V9QA 1GZPB 3GSRB 3MUY1 2QQNH 4MAUH 1FPTH 1HHIB 3GMMB 3IDGA 1YNKL 4XI5C 1RJYB 4NHCH 2CR3A 3MA7A 2R8SL 2DQFA 3KPQB 3QAZB 3MODL 3HI5L 4YHLL 3O9WA 4GAGL 2W1NA 1ZLUK 5CEXB 3P9WB 3BPOC 4GRLB 3ALPA 5DJDB 5CEYA 3OAYK 4U1GC 4F9LA 4AIZA 3BPNC 1WZLA 4L3CB 4LARL 1P5VA 4P2YA 3FO9A 4X6DA 4Y4FD 5KVEH 2X89A 2B4CL 3SDDC 1KLUA 1QBML 4HQQL 4BFIB 1U8LA 2NTSP 4PGEB 3SCMD 5J11B 2E6JA 3G9AB 5JIKA 3HR6A 1D5BB 4YNYA 3GEWB 3MRIA 1BVLB 3CUPA 5DD6A 4JY6A 1MFDL 3ZKNC 2VLJA 4DN4H 3LKPB 4RX4D 4NC0B 2C4FT 3SE8L 3HAEH 1U8NB 2P8PB 4U1SA 2CDGA 2DICA 2EDKA 5ETUB 1DBML 1E6JL 4M4PA 4JFYB 5EZLA 3NFPB 3T0AA 3NPSC 4QTHA 5GSRB 4RSVA 2UY7A 4HWEL 1WGOA 4OJFH 1UB6B 3LIZH 1V3KA 4D3CL 3QDAA 1FRGL 3SGKA 4YHNA 2ESVE 1KEML 4Y5YB 5GS1C 5BRZD 5C3TA 4ENED 2AV7A 1U41A 3QULB 4P3WA 2V5SA 3RIFK 5CJ8A 3LB6C 3P77A 3RVTD 4LSUL 5F7KC 3U9PL 1WJ3A 4OBSA 4YPGB 5J8OA 1AQDB 2YD1A 4OTXL 3P30L 3G6AA 1TENA 1R3KA 2H2PD 1Q0YL 3V5DB 4NNPH 5B3JF 4WEBH 5BO1H 5FECB 2HG5A 1T6VN 1G0YR 1J1OL 1Z9LA 2Z92B 3C08H 4CVUA 2HVJB 1BGXL 4BFEA 1EHLL 1G9EA 1CVRA 4WTWA 4Y1AA 1EO5A 4AYFA 1FVDB 5IT2H 4DOHE 3P4MA 3D3VA 4XP6H 3WJJA 2AKRB 4NIKB 1U3HA 5DMGC 2AAVA 2G75B 5BV7C 3D0VB 1SEQH 3CLEH 4HSQA 3HKFA 1R3LA 2OXGA 4N0UB 3L1OL 1MQKL 3C5SA 4MD4B 2GSIB 4HC1A 3T0BA 3V8CA 1T1XB 4HWZB 1WAAE 5D1XD 4N0CD 5SWZE 1VADB 2GI7A 2V2TB 5DLMH 3MJ7A 5HDBE 1AD0A 43C9A 3WE6B 5J6GA 2EXYC 1LE9A 2AJVL 3H3PL 1UQSB 4WENB 4CN6A 4HKZB 5IMLB 4BZYA 1VACA 1G9NC 1PQZA 1CQKA 3KYNA 3UX9B 1A0QH 3VXMA 3DX8B 5EZOL 1FGVH 4NQTA 3TN0B 4HH9A 3BT2H 2HJKA 2Z35A 1FN4A 2R2BB 2E27L 2MQ3A 4NNYA 3C6LD 2GJ6A 4JM4H 3KXFB 2FX7H 2M8XA 5BMFH 4DQOH 2R0LL 2UZIH 1K4CA 5HJ3B 4PD4J 3C2AL 3TO2A 1HIMH 4MXWL 3AS0A 4WGWB 2VITB 1JWMA 2WIMA 3D39E 4JY4A 4NQSB 2YMXH 1KJ2H 2R2EA 2VDNL 3V0AC 3VCLA 2X4UB 3G5YA 3CDGA 2FJHA 5LXGL 1N2RA 3M1BA 4X80L 1CF8H 3MV7A 4KUCD 4K9EC 1I1AD 3TGXA 2VDPH 5DJAB 4PY8J 4M7JL 3CFJA 4OZGB 3K1KC 5ITFB 2AI0L 4DKEH 1U58A 4FQ2H 5EPMA 5D5MB 1YECH 5F9DC 4PR5B 5SX5K 2X4TA 3KLAA 1MHHB 3T0EE 4D0CB 1Y0LB 2R4RH 3RWEB 4HPOL 4QT5A 2MTPA 3S3JA 1OGTB 1F2QA 3FB7A 1S9XA 1GC1H 1E4XL 2UWEF 3H9SA 4OQTL 2GT9B 3HC3H 1Q94A 2LE9A 4WUUD 1OARH 5H35A 2ZCHH 3ELAT 3ZTJH 3MACH 3QRGL 1PSKH 4OQTA 2BVOB 5I73B 3QDJE 4E5XB 5T3XH 5TGBB 3NACH 1G84A 3PL6B 1QSEB 3T2NL 4LSDA 4U6HA 1F2XK 1SY6L 5HBBA 3MBEC 3FT4A 4LLMA 4CVZA 4U7SA 2VERN 1T83A 2W92A 4FN0A 1IZJA 1CLYL 3QQNA 4UQ2B 1XCQB 1TPXB 4OB5H 1W0VB 1JGDA 2QBWA 4D94A 1W2KT 5HYFA 3O4OB 5FIEA 2ZUSA 3GSOA 15C8L 3L9RB 4N8VB 4PJCA 1EAPA 4WI5A 5E4EC 3GSXA 1FBIL 3ULUC 2C26A 1WK0A 3P2TA 3TCLA 4N0YL 4S1DD 1P84K 1IM9D 4PRNB 4GBXB 2ENSA 3GM0A 1OAQH 2W9DH 4X6CE 5DZNA 1PYWA 3SY0B 4P9HL 2F53A 1MNUH 1KN2H 5ENWB 3ZE0F 4ODSL 1BF2A 3ILPA 4WTXA 5DFWH 5I30L 4NOFA 3RP1A 3RWDA 1MPAH 3F7QA 3MGOA 2XA8L 3FB6B 4LLUB 5EO1A 1T5WB 3MLRH 3FAWA 5E95B 2RQ8A 5CP3H 2BSTB 3RIFF 3QUYB 2VH5L 1I9RH 1ZANL 3MUGB 1AKJB 1A7BA 2NW2B 1CDIA 4FQHA 1DBKH 1F6FB 4GG6A 4TOYH 1GGIL 2CK2A 4PV8B 2UZYB 4K9EH 3RY5A 2YR3A 1V3JA 1OM3L 1FFPB 3LEXB 2A83B 2D2OA 2XV6B 4I5BA 1MFEH 3EJZC 4X4XB 4DKDC 3L7EB 3SDAA 1UVQB 2F74B 4HMDA 1T22A 2YN3A 1YEKL 5KJRL 2J8UB 2Q20A 2B0SH 3Q6FA 4LAJH 4Y4KD 2YWZA 5FO9A 1T03H 3P9LA 4FRWA 4Z7OE 5EZJA 1S9VB 3OKLA 3BQUA 4JLRB 4YR6B 3MNVB 5I19H 4FOMA 5LGKA 2HLAA 3B8SA 3JVGC 3SJVB 4P3DA 2OJZL 3EDKA 3MRLA 5FUOH 3VXRD 2EYRB 3KJ4B 3VDAA 1YPZF 1FZKA 2BNRD 3JUYA 1OAUH 2ERJC 1B0GA 1M6OB 5IWLC 1AGCA 4JO1H 3PV7A 1B4RA 1KGCE 4L9LC 1FGNH 2CGRH 4JVPA 3WFCH 3ZT5A 4ZUTA 5DDHB 4KKAC 1LQSR 4PRIB 5HHOE 4I13B 5L8LB 2D03H 4HXBL 5DJZA 3MRJA 5DVMA 1S78C 2EE3A 1NQBA 5HVGB 1V7NL 4LCUA 3RDTB 3DMMC 5AUMA 1QFHA 3T4AA 1M4KA 1HZHL 1U8PA 2AEQH 1Q8MA 3OX8A 5DK2B 1UWGL 1F4WH 1Q9WA 1T0NA 4GFTB 5F72S 2FX8L 3QJHA 2BVTA 3D9AL 4L8BB 4WHTB 3D1MC 1D6EA 3IDNA 3MJ9H 3HI6L 4QHNA 3P4NA 2A6DA 2BJML 4BZ2L 1G7QA 1OB1A 4OSUL 4ERSH 4UT7L 3QQ3B 1UB5A 4OGYL 1OT2A 3OKNB 3QNXA 3CCHB 1NAKH 4HZLB 5ANMA 5GZOC 1I3GH 3MRFB 2GKIA 3FTGB 3PHQB 4PJAA 2CMRL 4LCYB 2YXFA 3EYOB 4MNGE 5ICZA 5DC4B 4BA8A 3QEQE 5JLZA 1ZVYA 5HSFA 5GGSB 4FG6D 3HUJB 3HN3A 3WUWG 1PX3A 1MRDH 2E9IA 4QOKE 3QFJA 4NRYB 4V2CB 4NQXA 3O6FB 5F3BB 4ESKA 3O3BB 3ZSSA 5KSAA 3MYZA 4ZNEA 1FL5B 2MNUA 5D7IE 4HUUB 3RUGA 2RFXB 3CK0L 3ARRA 3RU8L 2EH8L 2VR4A 4QXTA 1A8JH 4BQBA 4RBPK 2WBJC 5I18H 3QIUD 4CNIB 5JPNB 4ONFH 2WNGA 3LPFA 1NDMB 3FQUA 4XRCB 4KMTL 2XWJA 1CICD 5B22A 2J6EH 3HAEG 3I50H 4H25B 4MAUL 1FPTL 4LDEB 1JP5A 4PGBB 2HP4A 3C60B 5E2WL 1YJDL 4YBLB 4NHCL 3RGVC 2CKNA 4M8QA 3MLXL 4PJ9D 1AO7A 3I6KB 3BW9A 5J9PB 1FJ1B 2LAGB 4ORGB 2PYEE 4X5XA 5CSZA 1ZHBA 5ICXB 4ZUWB 4K3DL 2IANA 4OCYH 4LCCB 4NRXA 5DEFB 5KVEL 4PJFF 4UOJA 4KY1H 3KPSA 3HR5B 2EEBA 25C8H 2P5EA 3PGFL 4J4PC 2Q7YB 3UTQB 3SDXA 1VKXA 3MR9A 5K59F 4P2QB 3FOMB 2B1AH 5EO9B 1OSPH 4QLRA 5C08E 3QI9A 4UDTB 1CDUA 3BD5A 5HI5C 1KIPB 5T33H 4IOIB 4ZUVA 4OZ4B 1X44A 3RKDD 4TUOB 3O2VL 1P7QD 3C8DA 5EBMB 4KJYA 4RMRA 3H2WA 3KPLB 1U8HB 3BP4B 3T1FA 3GBLA 3OKOB 1G1YA 4UTBH 3PL6D 1QSED 5JHLH 4I3RL 3U36A 4LDLB 5F1NA 5DD5H 4ZXBA 2I9LB 4ZPTA 4XH2A 4XNQA 4GLRI 3WJLC 5F7NC 1RZFH 3ILQD 4P5TC 3TH3T 4UIMA 4OJFL 5FKPA 4EVNB 3TNNB 3MJ6A 2MSPA 2CIKA 4XGZB 3S35X 4HK0B 2XY2A 4F9LC 3PABB 1MIMH 2YUZA 3B3IB 4N5UA 1WF5A 3A6CH 1PG7W 2OP4H 3VXPB 4N90D 4RNRB 2Z8RA 1A5FL 4QRPE 4KDVA 2EDQA 3FQXB 2FL5A 1A6AB 1T1ZB 3WIFA 3TBYA 5EO0B 2A9NH 1UWXK 1ZT1A 4HIXL 2IQAA 3EDDA 4GBXD 1INQB 4NNPL 5D7SH 4BSWB 4WEBL 2X09A 5BO1L 3SGJC 4LLWB 3L7FB 1FFOA 3C08L 1CQYA 5HGBA 4Z77A 1SJEA 4Z8FH 4KV5E 3JV6B 4L1DA 5INDB 4PYHA 1NAMH 5D93B 5I9QB 4JKMA 4LU5H 4NO0A 5L2KB 3QUYD 3QCUH 4L8DA 1J8HE 1A14L 1SEQL 3CLEL 3UYRH 3WNPA 2QHRL 1AKJD 1UA6H 5KSBB 4JFEB 5I6XB 5JA8B 5C70A 2YC1A 4YIQA 1CXIA 1NGXB 3VG9B 3ARDD 4LSRL 3V6OE 5FYLD 4KK6C 4MWFB 2BHZA 1MCDA 1CGVA 1WICA 1QFWI 5DLML 4RRPG 3O11B 2ZOLA 4BYHA 4PG9B 1JGEA 3G6DH 3IJHB 5T1DH 1YDPA 1GXEA 5DRWA 4CN4A 2JB5H 4CKVX 3QPQD 2SEBB 1EA9C 1ACYL 3HB3D 4G80B 4PP1D 1ZEAH 1L0YA 4NGHH 2G2RB 1UXWA 3FN9A 4P4KD 4WO4B 2PUQT 3EIFA 3SJVD 1A0QL 2APFA 1EHAA 2FH8A 2A2QT 3QFDA 3EOBB 5EZIH 5FB8B 1FGVL 4OQ1A 4NPYA 4LVHC 4NQDA 1R5VB 3WHXB 2NY0B 4JM4L 2R0WL 4XNMA 4XWGL 2FX7L 5T5NG 5BMFL 1FORH 5IB2B 4FQQA 3C6SB 4OFDA 5IEKA 4PRID 5IW1A 2VLRE 1F4AA 1RVFL 1HIML 3ZTJG 2QSCH 4JZNB 2L7JA 2DN7A 2P8MB 2EIBA 4WDIA 3ZYJA 3Q0HA 1A9EB 5HHVL 4CVWA 2YMXL 1KJ2L 1AIFA 3DBXA 3W0WB 1RMFH 5KAQF 1P6AB 4AL8H 5DYOB 4K71C 4MA8H 1CGUA 5FYJE 3V6FB 1W0YT 4D0BA 4EXKA 4BH8B 4KGJA 4ZFFB 4ZUSA 3FQNB 3UTTB 1UCBH 4LCIH 2OR7A 3N1QC 2GJJA 2VDPL 5EC1A 5FA4A 4NCC2 2HH0H 4DKEL 5JXED 4X4YA 3TBSB 2CSPA 5H8DA 5KS9F 5CGTA 5J12C 1YECL 4P5MA 5I15L 1JNHB 1M7IB 5HYJD 4LPXA 3WLWD 1I1FA 1I4FA 5IMOB 4AEIH 1XGYH 4L8SC 1GC1L 2Y6SD 4EI5D 1HOCA 2D7NA 3HC3L 2CKBH 1AGDA 1OARL 2ZCHL 3MACL 1PSKL 1TVBA 1RUQH 1V3MA 2E8YA 1MF2H 4PJ5B 2UZXB 5T3XL 3UAJC 3NACL 2F5BH 4RZCB 3ULUE 2KZWA 5F7FA 3ARQA 4NYLB 4LCWB 1OP5K 4Z7NE 4LK4A 2BSED 4OLYH 3W9EB 4LRIC 4G8IA 5HHPA 1JPGA 2YS4A 3HMXH 4LLDA 1KTDA 5MEQB 1H5BB 3CFDA 4K8RD 3V8OA 4QNPF 1S9KC 4W68A 4OB5L 1N64H 5DHVB 2DRUA 3MYJB 2H9GB 4K07A 4HG4J 4UAOB 4NO5A 2R2CA 1JWUB 1CT8B 5CHNB 4NC1C 4PJIE 4P5KB 5F88A 1H0DA 1JGUL 5DD3H 1KEGH 3MLSH 5J1AB 3UYPA 5GPRA 1AHWA 4YHIB 4NSKB 5KZCB 1YEJL 4AENB 1OAQL 2W9DL 3KVQA 4WFED 2MQCA 5CKGA 1MWAL 3GIZH 2APTA 1KN2L 5M7QA 3ULSB 4JFFA 2AV1A 2Q7NA 1MWAA 3MMEB 4U1HB 3VFMB 3EW3B 1MHCB 3V5HA 5MENE 1N59B 1NC4B 1IM3B 1T83C 5DHXB 5DJXA 2LTQC 2XRAH 3KNBA 1FAKT 5JHDA 3HZKB 5IHZA 4R2GD 4WNQA 1I9RL 2F58L 5L9DH 4FFVC 1DBKL 2N7BA 1HYSD 5FGRA 3DXAD 3ZDYE 4YQXH 4OF3A 4QRRD 3WDJA 3CU7A 5EU7C 2DQUH 5JNYB 2IBBA 1MFEL 2R23B 4PV9A 5E2JA 1DLHB 5D2LA 2O61B 2DLHA 4HJJH 3X11B 4PJ8B 2B0SL 4URTB 5FUCC 3WFZA 2OL3H 1T03L 1XR9A 5FO7B 1KPUB 4JRYE 1TZIB 3LDBC 4JFHD 3UO1L 3JV0A 5D7LA 5GGVY 3BN9D 2BP3A 5HYIA 3R06B 5L0QB 3R8QA 2YA1A 3GUTA 2GSGB 5FUOL 5GGVH 4XVSH 1XGQB 3V4UH 4OFYA 3ARGA 1WBYB 5E24E 4NKIH 1BPVA 3SKUD 3K46A 3EO0B 3BH8B 1OAUL 4IMLB 5LGJA 3GB7A 1FFNA 3BP5B 3ARFB 4ODXB 1P4LA 2CGRL 3CXHK 3WFCL 4X9FA 3MZGB 5CFHA 2FDBP 3CC5A 4UT6H 2D03L 4GKNB 3B43A 4GT7A 4Y8DC 5F6HI 4PJGA 5SX4H 4YZFF 2MJWA 1NUGA 3JTSA 3SDAC 4CBPA 2AEQL 3CVHB 5FA3B 5FGCB 2Z91A 3S35H 4OZHF 2E7MA 1CFNA 5I1LB 1F4WL 4LPWA 4JO4H 2DQEH 5F3HB 2G9HB 2FBJH 3BQUC 3MJ9L 5TF1H 4JPWL 1K85A 4PJEE 4NCDA 4Y89A 3DTXA 5I17A 2BXYA 4ERSL 3WIHA 4GAFB 3DIFA 1NAKL 2H32A 3AC0A 2XQBL 4IHOA 4YX2H 5K9JL 2QKIB 3MRPA 4D9RD 4JCMA 3WN5B 3PWUA 4PGZA 5KVFH 4Y5VB 4PY7A 4EUPG 1P2CA 4WO4D 3EOTL 1T0PB 1IQWL 4R4BA 2W07A 4HULB 1KLGA 2GTZA 3CH1B 2GYSA 4OD3H 2DBJA 1KB5H 4J1UA 3JWDC 5HD8D 1MRDL 1U8MB 3BDYH 3WLBB 4NUJB 3KDMA 3VFTA 2MOVA 3N1FC 5IB3A 2NY0D 3T8XA 3IVKB 1I75A 4M3KB 3ZKXC 5C0CA 3P9MB 1IZKA 4I2XE 5J1TC 5IMKB 5EH1A 2UUDH 2YUXA 2CLRB 2NW3A 1EXUB 4OKVA 3N85H 4ONFL 1MCWM 1C08A 1TQBC 4JZOA 6CGTA 3QDGE 1N0XH 4ZDHA 2J6EL 3R0NA 3L3HB 3HPJA 4NN6C 2HA1A 3B5GA 5GJSH 4HS8H 2VZSA 4GW5B 2UYLA 1QBBA 1T3FA 3FQRA 3JWOC 4P46A 4OCYL 1YMME 4KK9D 3OBAA 3VFWA 4CADB 1PAMA 4EUPA 3TIEA 3QG7L 5JW3H 4KY1L 25C8L 2A73B 1YMHB 4CDGC 5FKAB 5SWSB 1OGAD 2B1AL 3RNKB 5KSAC 3SGDI 5C86A 3BJLA 3TJHC 4R97B 3O2WH 5T33L 3NA4A 5E9DE 4KTYA 5IBUB 5I0DA 1U95A 2WV3A 4LIQL 3RTQB 2MKWA 2QR0B 2OQJB 4M9OA 4FTVA 4IOFC 5DVKA 4RGNB 4PJ5D 3RZCD 3VD9A 1D9KA 5JHLL 5C6TH 3K4DA 1AFVH 3KPOB 5CD3A 1N3NA 4LLVA 4X6FB 1I3RA 2XACC 4WFGD 4PJBF 4HBCH 2NY1C 3FFCE 2GW5A 2ZUTA 4ODUA 2VB5A 3KPRA 3MO1A 4PJHE 3BP6B 4XHJD 3KAAA 1WUNT 1MIML 4JDZB 4X6DF 1CD1A 5EOCJ 4CMMA 1Q9OB 4UOW1 2R29L 2WK2A 3IAPA 3I6LD 1JBJA 2ICEA 3OPZH 1NMAH 5DR5H 1FDLH 3S8WA 2NZIA 3O8XB 4G6KH 3GHEH 1XEDA 5KZCD 1C12B 5DJ8A 3SPVB 2EE6A 5D7SL 3O81A 5DC0A 5HHNA 4DOHB 4EOWL 5BOPA 5JMRA 5K33A 1A6ZB 4WFFD 2HFFA 3GJFA 2K3TA 5DJ6B 3C5ZC 2DYPD 3ZE2F 4BJLA 5JO5A 2B8OT 4NKQB 3FONB 3HA0A 2E3VA 1DUZA 2D4FA 3MV9A 4OF8A 4ZXBC 3S3PA 4YO0A 4OAWA 1NC4D 1NAML 2MCPH 2ICWI 4DEPB 5IM7A 1DE4A 4PREA 5JQHC 1LEKA 3UYRL 3UTSA 1RFDH 5FV2A 1UA6L 3W9DB 2XICA 1CFTB 1ORSA 2N56A 4HKJB 5IBLD 2RBLA 3RFZC 2OLDA 4L4VE 3SE9H 3AS1A 5ADPL 1NEUA 4PIRF 4YFDB 4ZD3H 4HFWB 4LPYA 3S5LG 4WV1A 5EU3A 3RWIB 1FVEB 5T1DL 3LQZA 1S5HB 2JB5L 4PJ8D 3SOBH 3TM6A 1RK0B 1YY9D 1F13A 4NGHL 4QRQB 1I85C 4Y2DA 3QXDA 4J6RH 4U1KA 3PV6B 3F5WB 3OTTA 4KTEH 2AK1H 4LL9A 1PG7X 3JZ7A 3MRQA 5GRJH 4XPFH 3LPGA 1J12A 4MJIA 3DRTA 4N9GA 2BY3A 5CINH 2CDEA 2NY4B 2FRGP 5E8EA 3D39B 1J86A 3DI3B 4U0QB 2CQVA 1QQDA 4JFQB 4HCRA 4QWWC 4MGXA 5CEZH 3ARFD 3QUZD 2FLRT 4X9BA 4HIJA 3ULVD 2FATH 3BMWA 3E6FB 1J1XH 4F8TA 1RHFA 4Q9CA 1UACH 5D96B 4DUVA 1R3JA 2QSCL 2GJ6E 3TO4A 1X5GA 2HTLD 3KPNB 4LEXH 2HWZH 4M9PA 1W0WB 5BW7C 5BJTA 1LO0L 1ZLWH 5I66A 4I3GA 2I26N 4J8RA 1RMFL 4AL8L 1QFUH 3G5VA 4P23A 3S5LA 4MA8L 4GW4B 4MCYA 2EO1A 5DT1H 3PIQA 3QUXB 1UCBL 4LCIL 4ZAKC 1TCRA 3CDFA 5ERWB 3BHBB 3UC0H 1HHKB 2FJGA 5KVDL 4XBPB 3CFBA 4JKPL 4MJ5B 5FHBH 4U1NB 3P73A 1PBYA 3QDJB 1TZHB 4H20L 3SE4C 5MERB 5JXAH 3MV7E 3P0VH 4AEIL 1XGYL 1XIWA 1DUYB 3LEYH 2EIEA 4JFZL 3FKUS 4F7MA 2NY5H 4U1IB 1JV5B 4NC1E 4S2SB 5GS3A 1KENH 1EVTC 3UYOD 4CU8A 1RUQL 3EO9H 2YPLE 3QRFM 2G5RA 1MF2L 4ZSOA 2PXYA 1R5WB 2F5BL 1IRAY 1BREA 4ZO8A 5C0BB 3TZVA 3GSNH 1VFMA 5JA9A 2BOBB 4EN3A 3HMXL 5A3ID 2VQ1B 4GAYB 4ZFZA 1JNLH 3GSVB 5AG8A 1U42A 4MA1B 2Z31B 3K3QA 4JM2C 3VGGA 1KPRA 2IC2A 3QIBC 5E70A 1JCKA 5IJKA 1GGBH 1N64L 2A38A 3U4EB 2JCCA 3M17A 2DLTA 3T65A 2PTTA 2WQ8A 3X12A 5AZ2L 3DURB 1UEYA 4X6CB 2FD6H 2LU7A 3RWCB 3F12A 1JTTA 5C0EA 4FNLH 3VGDA 2KUTA 3B9KB 3DX6B 3F7YB 4FQJL 2VLKB 3HPLA 5DD3L 1MVUA 3MJGX 1KEGL 4DWHA 2VXQL 4F7PB 3MLSL 3THMH 1E27A 3FFDA 4KRPB 4OF6A 1HSAA 4HGWB 5GZND 4LSQH 1LP9F 5I2IB 4U6XB 3GIZL 1I8KA 4NO3A 1I7RB 1ZGLP 1YPZB 2NR6C 5FUCE 2J5LC 2OZ4H 3HE6C 1IKNA 1KC5L 3MRKA 4XCFH 5F8RC 4G9DB 3LQAH 5EWIH 5DFTA 4NZDA 2VQTA 2XRAL 3GMPA 3QZWG 1NEZB 3OJVC 4HUVA 2A0LC 2IWGA 2NZ9C 3RY4A 3QQ9D 4G43B 2ILLA 4GKSB 4Y19E 4XVUC 3IFNL 3L3OB 3OAZK 2ESVD 2A6JA 3VWKD 1QO3B 1J18A 4YQXL 4NQCB 2AABH 2DQUL 3VI3F 4NC2B 3MRGB 4PJCF 1XFPA 4OCWH 1NGWA 3SKOA 4GG6E 2NXYD 3NN8A 2QADD 2OL3L 3O41A 5D71H 1AHWC 4C56E 4L3EA 2E6PA 3O4LE 1SJHA 3FQTA 4Z0XA 1CXKA 4NJAH 3PNWB 1N26A 1KELH 4JQIH 4YAQA 3UROR 3DECA 5GGVL 3NH7L 1H9VA 3V4UL 2W91A 5I1AA 3MREA 4NKIL 2AVGA 3B6SB 1F3DJ 3EYUH 3ARBA 3FN3A 1JI2A 1RZ8B 2X4RB 3QT2A 4LASH 4I8DA 5LQBH 1NANI 2DKMA 1RZJH 2BVPB 5C0AE 1N8ZA 3VRLE 2C4FU 3QZWA 4Z76B 2X44D 5FDWA 3RPKA 2PNDA 4UT6L 4B53A 1OF2B 4YK4C 4KJWC 3EOAA 1OTSC 4JRXA 2OR9H 4MDIA 3TVMC 1FCCA 5SWZD 1QFWM 3TT1L 1A4JB 3I3EA 1G9MC 4GMSH 1VB9A 4JQXA 4P4RA 3VJ6A 4JO4L 2ED8A 2PW2B 4HLJA 2FBJL 3QDMA 4NKMA 1OP3H 5TF1L 8CGTA 4EDWH 1F4HA 1S8DA 3C9NA 1A22B 5IW6A 1I7UA 3QEQB 3VFOB 5C0RH 3PWNA 3ARGC 1J7VR 4RIRB 4YX2L 1KCKA 2ADGA 4UI2A 2X05A 1CXLA 2HT3D 3NGBC 2X7LB 3GMQB 5HI3D 4R3SB 4WI9A 5KVFL 1ZS8A 1EPFA 4UDUB 5B38B 5T1MB 4HV8B 3T2QA 5ISZE 3OB0K 3BPOB 3X13A 1G6RB 1K5NA 1YZZA 4U1GB 1Q9KA 5FM5O 3BPNB 1NCDH 5ANME 1IEBA 1BFTA 1QSFA 5E8NA 4OD3L 1KB5L 4APQC 3MJ8B 1U8JB 4I4WA 3GIVA 4WU5B 3DJ9A 1RZ7H 3BDYL 4BFBD 2NY4D 3KGRA 4LLQB 4GS7C 3D39D 3D6GA 3Q48A 3VFGH 2C1PA 1KLFA 2WW8A 4TSBH 3OV6A 1O5DT 3IXAB 4FQLH 1C8PA 1WT5A 3BGFB 2Q6WA 4XPAH 2W9EH 1V8HA 4NZUL 3QFJE 3NZ8A 4PRPB 3NCMA 4WW2A 1BECA 1LWRA 3N85L 2B2XH 5D1ZA 2PYEB 1XCTA 4JDTH 1J9CT 1RZKH 1N0XL 2FIRT 5JDJA 1EHXA 5IR1B 3NPSB 3WFEH 4P2OA 4HS8L 5GJSL 4HXAL 1H3UA 4N0FB 4PJAF 2NYYC 3T0ED 5C08B 3P11H 5JIIA 1PG7H 5DQJA 1B2WH 5IMMA 1BQLH 3QUXD 5BXFB 2LV4A 1OWRM 1YN6B 5JW3L 2VMFA 2ED7A 5CEZE 1YYML 2X4QB 4NBXB 3L3IB 2P4AB 4F15C 3O3DB 3AROA 4I0PA 1R6VA 1S7RB 4F9PC 3NCEB 4F7TB 3O2WL 4UILH 3FT3A 4OF7A 2LU3A 1SEBA 3RUGF 3O6LH 2YD8A 1G9MH 1HSBA 2KKQA 2R0ZH 2VL4A 3SDXE 1NBVH 5IP4A 1S5IH 3HLAB 3W11C 1MH5B 5CD5C 3O0RH 4WUKL 5C6TL 1AFVL 5HYSG 1QSVA 4HFUL 4HGMA 3ZKMD 1RIVL 3RNQA 4HBCL 4YDIH 5BV7B 4A6YA 4MJ6A 2C7UB 4QXGL 5L8JB 2D7TH 4P2RA 4I18A 4E41B 3VH8A 4PRAB 5ID1B 3U30C 4M48H 4M62L 2FEDC 4FFYH 2DQTH 5C07E 3C8KA 4I48A 4PGDA 5LBSH 4U6YA 1A1OB 1YEIH 3B9KD 3OPZL 2VOTA 5DR5L 3RRQA 3RWHA 1S3KH 1CFSA 4ZS6C 4G6KL 3GHEL 4QHMA 2QSQA 3OHXB 2XNAB 2VDQH 3D2UD 2P1YA 3IGAA 5HI4C 5J11C 1FNEB 1F11B 5IVXA 2MCPL 3RVWC 5HYSA 2W0LA 1MCNA 1UH3A 3VD3A 4ZOBA 1NFDA 4UMGA 3DYMA 5DSCA 1X3DA 4H8WH 4OZIA 1RFDL 4X0KA 4KAQH 2DM4A 4NM4H 3LPWA 3SE9L 4PGCB 2F15A 1RZGB 1YNTA 5HVFB 5DMYA 3OL2A 1EUTA 4DZ8A 4ZD3L 2AW2A 2V17L 1A6PA 1ZGLA 5F96H 5I1DA 4TUJA 1T5XA 5HVWA 1AD9B 5D2NB 5HGHB 1DQMH 1NPUA 1BQHG 4J6RL 3VFVB 3CPLB 5FYKL 4XWOD 2AJZA 1F4YH 4KTEL 4B5EA 2AK1L 5T5FH 1KGCD 3GZKA 1KTLB 5GRJL 4ODVL 1H8SA 4XPFL 3FB5B 5M94B 4E9LA 5HHOD 5CINL 5BS0B 4AQ1B 3QCTL 4GKOA 2V7NB 1SBBA 2GAZA 2Y7QA 2I07B 3PJSA 4XXCC 2EYTB 5GRUH 1VEPA 4NQDE 2DM7A 4P9ML 3EO1B 1UACL 2ARWA 1R24B 5CIPH 4FXLA 3BKMH 3ME0A 5E2TH 3W5NA 2DLEA 4LEXL 4QGYA 1QR1B 1T04A 5DS8A 2HWZL 4H0IA 4WV1C 2ADIA 2HTKD 4YUEH 1ZA3B 3MUJA 1K8DB 3D18B 3WNKA 3TBWB 5ACZB 2JK5A 1F58H 3LKOA 2WZPD 1BOGA 1TQCC 4G42B 3KPPA 5FK9A 2H1PH 4HEME 5DJ0B 3DX7A 3ARUA 1S7UB 3QEQD 4JDVB 7FABH 3UC0L 4MAYA 2Q86A 3LSOA 4XI5D 5D1QB 2A74B 4PJXF 1SYVB 1U9KA 3BP7A 1KXTB 5EOTB 1PLGH 4Z5RB 5CMAA 5ABDE 4QOKD 1ZWIB 3DVGA 3HRZB 5E4EB 5FAAA 1P1ZA 2J4WH 2ZCLH 2HKHH 5KSUA 1ES0A 4XPGH 5JXAL 4L8CB 3P0VL 2EDBA 1JN6B 5IFJA 4PRHE 3LEYL 2NY5L 5ALBL 1DBAH 3D25A 3GRWL 4L4TA 5MP6H 2F19H 3SDDD 5KANG 1KENL 3REWB 5D7JA 1FZJB 5TDPB 3BZ4B 3EO9L 1ZHKA 3OSKA 2NNAB 3TN0C 3GRWA 3TO4C 4Z7UA 1KJ3H 3VG0H 3N50A 1LILA 2AJXH 3GSNL 4IRSA 5CP7A 1DEEB 4XPTL 1JNLL 3QH3B 1WIUA 4P23C 5KTEH 4AJ0A 4PJIB 1ED3B 2P5WB 5I76B 1ETZB 4H1LB 1GGBL 2PYED 2I24N 4P3CL 4JG0L 4KJQC 1MCIA 2YWYA 2X2YA 1YEGL 2VXTL 1H3WM 1F02I 1U8KA 2FD6L 2HLFC 3PGCA 3S6CA 4NP4H 3LS5H 5F44A 4YGAB 1IAOB 4LHUB 1WFTA 1XIWC 2DQIH 1XGUB 3DUSA 1CD8A 1G7JA 5F89B 5C1MB 1QEWA 4LSQL 1MLCA 5T5NF 1KT2A 1CBVL 3LB6D 2PETA 1HINL 4NQEA 2BRRH 4G8GE 3LRHA 4XP1H 2PXYC 5IQ9B 1R3HA 2I60H 1UJ3A 2AQ3A 2OZ4L 4OIBA 3OKMA 5EU4A 1I7TB 3BUYA 4EN3C 4WHYH 4XCFL 1HHJA 3LQAL 5EWIL 4ETYA 1AGFB 2D3VA 4JFFE 4L9LB 1DN0A 1NDGA 4D9LH 5L8KB 3G5ZA 5D9SA 5T1KB 3DUUA 5ELIA 2OX5A 3PQYE 1TJGL 3DV6B 4RGOH 3DMMB 3TPUA 1BOYA 1J0HA 2R1WB 4F57H 3NCYP 5DMGD 2DIBA 4OZHB 4OCWL 2XIDA 5TJWK 5FO8A 4QRPD 1HHGA 4HHAA 3RAJL 1Z5LA 4HH8A 3U2SB 5D71L 4S1QL 3QUMA 5T3XD 1EGJA 3IDUA 1L4IA 4RISH 5MEOA 1XF2A 3CFKA 1TNNA 3QIWA 2Y5TA 3O4OC 1AP2B 4NJAL 1KELL 4JQIL 5GGTH 5M95B 1F6AA 2EXYD 5HGAA 3NIDE 4OGZA 2AJUH 2ATPA 5IHLB 4N1HB 5EUKA 3EYUL 5DTFA 3OKDA 1NBZA 1MHEB 1IKNC 3ALXA 3VXUA 1H15A 3SO5A 4ELMA 1BWWA 3QWRD 3DVFA 3T0WA 5LQBL 5DEGB 1JTPA 2IPUK 5HGDB 1RZJL 3RWFA 3HFML 3FO0H 1MSPA 1J8HD 2DWDB 1M1SA 2VZ1A 1BJMA 3PWPA 1UH2A 2HFEA 5F7YC 4M1DH 3AM8C 2OR9L 3TF7C 1S7SB 3WEXB 1WBZA 4PJEB 3GJFK 3VGFA 2JB6B 1I8LA 2DWEB 1IGTB 2HKFL 1BFOB 3KR3L 5D2LF 4GMSL 4XZUB 5DK0A 3T77A 2WAHA 3BDXA 2WBJB 2YK1H 1CFQB 4GUPA 2HMIC 4WI2A 3T08A 2J3SA 5FOBB 4C83A 4QRSA 4X7SH 2ADJB 5F93C 2ICCA 4EDWL 3FB8A 5C0RL 3JTTB 4HIIB 4ZYKB 5EB9A 2XPGA 2CUHA 3BEVA 3RGVB 1LO3H 3L3JA 1IGMH 4RAVA 1YEFH 4YHPA 1KF9B 1IBGL 3ZYIA 3QCVH 1MJ8H 1X5YA 5DXWA 1MJJB 4Y4HC 4MJ4A 2VXUH 4Z7WE 3SCMA 5EOCH 1EEZA 1QBLH 2ZSVA 4O5LH 4HUWB 4I2XB 1T6WA 2VIRB 1S7QA 2VLRD 4PLJC 2FO4B 1RZ7L 4OZFB 1SYSB 4OKDA 4YFLI 1HYRC 4PJGF 4RX4A 3VFGL 3QDGB 4MXQD 1REIA 1TJIH 1VFAB 4JQXC 2X4NB 4MA7H 4Z7QE 4QKXB 4FQLL 2I27N 1QD0A 5J6HA 2BNQE 2W9EL 5BVPH 5H37H 2HJFB 5FYJD 4YFLF 1KJVA 1E4WH 4PYGA 3QG6A 3ROLA 4JDTL 2WM0A 3MV8E 1RZKL 5B39G 2DAVA 1YMMB 3IDGB 3STZB 1CLCA 3MBED 1U91A 1WCBA 4LAQL 3V9FA 3W2DH 2OSLB 3HG1E 4HDIA 4PBVC 3WFEL 5BRZA 3MA7B 2CXKA 3DSFL 5GGRA 2DQFB 4OF0A 4K94H 4P5TB 5EC2A 4UT9L 5CJXA 2JKXA 3WKMH 3O9WB 3P11L 1ORQA 1PG7L 2BVYA 5KOVC 1B2WL 5CEYB 1X5LA 2WBKA 2CJUH 4R0LA 4F37K 5E9DB 4ZFOL 1BEYH 4AIZB 3BPCA 4X6DB 3FO9B 4IIQA 3UTPE 3LKNA 1AXSA 1KLUB 1A3RL 1EERB 5EFIA 1CN4A 4WHDA 5E56A 1U8LB 4PB9H 5IFHH 4LMQI 4JFDA 3ULUD 1DFBH 3BISA 4MSWA 3O6LL 1Y18A 3MRIB 5E2VH 3OKYA 1WT5C 3SKNA 3CUPB 5DD6B 4JY6B 2Q3AA 2R0ZL 2YD5A 1NBVL 1BIHA 5JOEA 2JJTA 2ZUVA 2OR8A 3VWJC 5JPMA 3O0RL 3O6FC 4U1SB 4DKAA 1G7PA 4GKZA 5FYLH 5EZLB 4F7EA 1JUFA 2YPVH 4QTHB 4P2OC 1YYLH 4YDIL 1E28A 1WBXB 1WWCA 3MX0A 1CDCA 2EXWC 1VEMA 3LN5A 5E00A 1PY9A 1ODAA 3O3EA 5D1XA 4YHNB 1OSZB 2D7TL 2V7HA 4GW1A 3V5KA 2AV7B 4M48L 1ONQA 4QY8A 1GHFH 1AGBA 2VKXA 4BSVA 4FFYL 2DQTL 5LBSL 3EJZD 5DO2C 3CMOH 4Y16A 1YEIL 4I0PC 3KPRE 4LHUD 2VUOA 2A6KA 3G6AB 3AAZA 3KJ6H 1R3KB 4NO2A 5MEND 3NAAH 4OCSH 2HG5B 5KBNC 3KYMA 1G7HA 1FZOA 2ZUWA 5CWSB 3AREC 2PW1A 4JQVA 4X7TB 5GRXG 1Q0XH 3QEUA 3AB0C 4L4VB 4LVHB 4TUKH 4Y1AB 4F3FB 3D3VB 1FNSL 3S4SG 2NY2C 3MROA 3NFNA 2E9BA 4H8WL 5FEBA 5GGQH 1R3LB 2DJUA 2ITDA 1BM3H 4ETQA 4KAQL 5ALCL 3C5SB 4NM4L 1S78D 1ZHLA 4JRYD 4F58L 3K74B 4PBWD 1AD0B 43C9B 5J6GB 1CFBA 1LE9B 1DDHA 1I1AA 4Q9RH 3ROOA 4K71B 1DQML 4MQ7A 4UQ3A