4EBUA

Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
306
Chain Sequence
GVDLGTENLYFQSMMHILSIGECMAELAPADLPGTYRLGFAGDTFNTAWYLARLRPESRISYFSAIGDDALSQQMRAAMSAAGIDGGGLRVIPGRTVGLYLITLRSFAYWRGQSAARELAGDADALAAAMARADVVYFSGITLAILDQCGRATLLRALAQARATGRTIAFDPNLRPRLWAGTGEMTETIMQGAAVSDIALPSFEDEAAWFGDAGPDATADRYARAGVRSVVVKNGPHAVHFLQDGRRGRVPVPPVAQVVDTTAAGDSFNAGLLDSVLAGQPLETAIAAAAALAGQVVQGKGALVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a sugar kinase (Target EFI-502312) from Oceanicola granulosus, with bound AMP/ADP crystal form I
rcsb
source organism Oceanicola granulosus
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxygluconokinase
total genus 102
structure length 306
sequence length 310
ec nomenclature ec 2.7.1.45: 2-dehydro-3-deoxygluconokinase.
pdb deposition date 2012-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 4ebuA00
2R3BA 4O1GA 3RTEA 4C5NA 1YGJA 3HICA 2FV7A 3K5WA 1YGKA 2AJRA 4K8KA 4K9IA 3MBHA 4N09A 3B3LA 4XCKA 4E8ZA 3NBWA 4EOHA 4C5KA 4KADA 2HW1A 3RQ2A 3RU2A 1V1SA 2ABSA 3HYOA 4JKSA 3B1PA 3RS9A 1RFVA 3RO4A 3NC2A 1BX4A 3VAQA 3IN1A 4XF6A 3IBQA 3RSGA 4JKUA 2ABQA 3KEUA 5EYNA 3RQQA 2PKFA 3RTGA 4E8WA 4XDAA 1JXHA 1TZ3A 3UQDA 2C4EA 2RBCA 1UB0A 3NCAA 5BYCA 1GQTA 3Q92A 3RY7A 3N1CA 3RSQA 1JXIA 2DDMA 3RQ5A 1RFTA 4YWRA 1RK2A 2C49A 3ZS7A 3RQ6A 3RTAA 4B8RA 3RTBA 3RS8A 5CGEA 1V1AA 4DC3A 4LCAA 3NL2A 2JG1A 3IH0A 3RM5A 3NL6A 2A9ZA 4O1LA 5B6AA 3QA2A 5EY7A 5C3ZA 3FHYA 4C5MA 5F0ZA 3UQ9A 4E8YA 3RQXA 3PL2A 4E69A 3HPDA 4K8TA 4S1MA 4LBGA 5C41A 1TD2A 1TYYA 3B1NA 3NC9A 2F7KA 3UMPA 2F02A 5F11A 5BYDA 1LIKA 1C3QA 4XF7A 2Q5RA 3RREA 3I3YA 3LOOA 2PKKA 4C5LA 3RQHA 1KYHA 5C3YA 3BF5A 5BYEA 1ESJA 1L2LA 3KZHA 3W4SA 2A9YA 3B1OA 5BYFA 2DDWA 1V19A 2I6AA 2HLZA 4K8PA 3H49A 1VM7A 2HQQA 1GC5A 2PKMA 4N08A 2AX3A 3GO6A 3RPHA 4C5JA 3MBJA 3RRBA 4U7XA 3B1RA 3LJSA 2JGVA 3QAIA 2NWHA 3RU3A 3B1QA 5CGAA 3NL3A 3NM1A 3KTNA 2PKNA 2DDOA 4LC4A 2YXUA 3IQ0A 3OTXA 2AFBA 1RKDA 3NM3A 3RT7A 2V78A 4KAHA 4KBEA 3UMOA 1YHJA 4K8CA 1LIIA 4DU5A 3DRWA 3NBVA 4LBXA 3UQEA 4S1HA 1WYEA 5COJA 3UBOA 4WJMA 4E84A 2I6BA 2QCVA 2QHPA 3VASA 4EBUA 3CQDA 1LHPA 2AJPA 3FHXA 4X8FA 1U2XA 1ESQA 3RPZA 4YL5A 2I5BA 1VI9A 4EUMA 3Q1YA 5CM5A 1LIOA 1V1BA 5C40A 3EWMA 1EKQA 4K93A 4KANA 2AB8A 2VARA 3KD6A 3IE7A 4S1IA 5TQIA 4GM6A 4K9CA 1RFUA 1LIJA 3JULA 3GBUA 3PZSA 3NL5A 3RTDA 4B8SA 3DZVA 3RQ8A 1VK4A 1EKKA 4JJPA 4E3AA 3BGKA 3LKIA 2XTBA 4S1IB 1UA4A 3RRJA 1LHRA 3RT9A 3H74A 4PVVA 3LHXA 3RSFA 3UQ6A 1RKAA 3RSSA 3RRFA 2YXTA 1RKSA 3IKHA 5TRWA 2JG5A 2DCNA 3GO7A 4UBEA 1TZ6A 3K9EA 4KALA 3RTCA 2AWDA 4EN4A 1DGMA 2R3EA 2AA0A
chains in the Genus database with same CATH superfamily
2R3BA 2UUPA 4K9IA 4O1GA 2JFHA 3RTEA 4C5NA 1UAGA 1YGJA 1W7KA 2FV7A 1YGKA 2AJRA 3HICA 3K5WA 3MBHA 4K8KA 3B3LA 4N09A 4E8ZA 3NBWA 2GCAA 4C5KA 1P3DA 4KADA 4CVKA 2HW1A 3RQ2A 1P31A 3RU2A 1V1SA 2ABSA 3HYOA 3HN7A 4JKSA 3B1PA 3RS9A 1RFVA 3RO4A 3NC2A 1BX4A 3VAQA 3IN1A 4XF6A 3IBQA 3RSGA 4JKUA 2ABQA 3KEUA 4UAGA 1EEHA 1O5ZA 5EYNA 3RQQA 2VOSA 2X5OA 2PKFA 3RTGA 4E8WA 4XDAA 1JXHA 1TZ3A 4EOHA 3NRSA 2C4EA 3UQDA 2RBCA 1UB0A 3NCAA 4CVMA 1GQTA 5BYCA 2GC6A 3Q92A 3RY7A 3N1CA 3QCZA 3RSQA 1E0DA 1JXIA 2DDMA 3RQ5A 1RFTA 2F00A 2AM2A 1RK2A 2C49A 4YWRA 3ZS7A 4BUCA 3RQ6A 3RTAA 4B8RA 3RTBA 3RS8A 5CGEA 1V1AA 2UAGA 4LCAA 4DC3A 3NL2A 2JG1A 3IH0A 3RM5A 4HV4A 3NL6A 2A9ZA 2UUOA 4O1LA 5B6AA 3QA2A 5EY7A 5C3ZA 5A5EA 3FHYA 4C5MA 5F0ZA 3UQ9A 4E8YA 3RQXA 3PL2A 4E69A 3HPDA 4K8TA 4S1MA 4LBGA 4C13A 1TD2A 1TYYA 3B1NA 3NC9A 2F7KA 3UMPA 2F02A 4QDIA 5F11A 5BYDA 1LIKA 1C3QA 2Y1OA 2Q5RA 4XF7A 1JBVA 3I3YA 2VTEA 2PKKA 3LOOA 3RREA 4C12A 2VTDA 4C5LA 3RQHA 1KYHA 1GG4A 5C3YA 3BF5A 5BYEA 2WTZA 1ESJA 1L2LA 3KZHA 4XCKA 3W4SA 2A9YA 3B1OA 5BYFA 2DDWA 1V19A 2JFFA 4CVLA 2I6AA 2HLZA 4K8PA 3H49A 1VM7A 2HQQA 1GC5A 2PKMA 4N08A 2AX3A 3GO6A 4QF5A 3RPHA 3MBJA 3RRBA 4C5JA 4U7XA 3B1RA 3LJSA 2JGVA 5C41A 3QAIA 2NWHA 3RU3A 3B1QA 4ZIYA 5CGAA 3NL3A 3NM1A 1FGSA 3KTNA 2PKNA 2DDOA 4LC4A 3ZM6A 2Y66A 3ZM5A 2YXUA 3IQ0A 3OTXA 2AFBA 1RKDA 3NM3A 3RT7A 2V78A 4KAHA 4KBEA 3UMOA 1YHJA 3HJ6A 4K8CA 1LIIA 4DU5A 2AM1A 3DRWA 1GQQA 3NBVA 4LBXA 3UQEA 4S1HA 1WYEA 5COJA 1W78A 3UBOA 4WJMA 2WJPA 4E84A 2I6BA 3PYZA 2QCVA 2QHPA 3VASA 1JBWA 3CQDA 4EBUA 1LHPA 2AJPA 2XJAA 3FHXA 3LK7A 4X8FA 1U2XA 1ESQA 1GQYA 3RPZA 4YL5A 2I5BA 3UAGA 2GCBA 1VI9A 2Y67A 4EUMA 3Q1YA 5CM5A 1LIOA 1V1BA 3ZL8A 5C40A 3EWMA 1EKQA 4K93A 4KANA 4BUBA 2AB8A 2VARA 3KD6A 3IE7A 4S1IA 5TQIA 4GM6A 3N2AA 1RFUA 1LIJA 3JULA 3GBUA 3PZSA 3NL5A 4K9CA 3RTDA 1J6UA 3DZVA 3RQ8A 4B8SA 2GC5A 1VK4A 1EKKA 4JJPA 2JFGA 1E8CA 3BGKA 3LKIA 4E3AA 2XTBA 4S1IB 1UA4A 3RRJA 1LHRA 2VORA 2XPCA 3RT9A 3H74A 4PVVA 2Y68A 3LHXA 3RSFA 3EAGA 1RKAA 3RSSA 3RRFA 2YXTA 3UQ6A 1RKSA 3IKHA 5TRWA 2JG5A 2DCNA 3GO7A 4UBEA 1TZ6A 3K9EA 4KALA 3RTCA 2AWDA 4EN4A 5A5FA 1DGMA 2R3EA 2AA0A
chains in the Genus database with same CATH topology
2R3BA 4O1GA 3RTEA 4C5NA 1YGJA 3HICA 2FV7A 3K5WA 1YGKA 2AJRA 4K8KA 4K9IA 3MBHA 4N09A 3B3LA 4XCKA 4E8ZA 3NBWA 4EOHA 4C5KA 4KADA 2HW1A 3RQ2A 3RU2A 1V1SA 2ABSA 3HYOA 4JKSA 3B1PA 3RS9A 1RFVA 3RO4A 3NC2A 1BX4A 3VAQA 3IN1A 4XF6A 3IBQA 3RSGA 4JKUA 2ABQA 3KEUA 5EYNA 3RQQA 2PKFA 3RTGA 4E8WA 4XDAA 1JXHA 1TZ3A 3UQDA 2C4EA 2RBCA 1UB0A 3NCAA 5BYCA 1GQTA 3Q92A 3RY7A 3N1CA 3RSQA 1JXIA 2DDMA 3RQ5A 1RFTA 4YWRA 1RK2A 2C49A 3ZS7A 3RQ6A 3RTAA 4B8RA 3RTBA 3RS8A 5CGEA 1V1AA 4DC3A 4LCAA 3NL2A 2JG1A 3IH0A 3RM5A 3NL6A 2A9ZA 4O1LA 5B6AA 3QA2A 5EY7A 5C3ZA 3FHYA 4C5MA 5F0ZA 3UQ9A 4E8YA 3RQXA 3PL2A 4E69A 3HPDA 4K8TA 4S1MA 4LBGA 5C41A 1TD2A 1TYYA 3B1NA 3NC9A 2F7KA 3UMPA 2F02A 5F11A 5BYDA 1LIKA 1C3QA 4XF7A 2Q5RA 3RREA 3I3YA 3LOOA 2PKKA 4C5LA 3RQHA 1KYHA 5C3YA 3BF5A 5BYEA 1ESJA 1L2LA 3KZHA 3W4SA 2A9YA 3B1OA 5BYFA 2DDWA 1V19A 2I6AA 2HLZA 4K8PA 3H49A 1VM7A 2HQQA 1GC5A 2PKMA 4N08A 2AX3A 3GO6A 3RPHA 4C5JA 3MBJA 3RRBA 4U7XA 3B1RA 3LJSA 2JGVA 3QAIA 2NWHA 3RU3A 3B1QA 5CGAA 3NL3A 3NM1A 3KTNA 2PKNA 2DDOA 4LC4A 2YXUA 3IQ0A 3OTXA 2AFBA 1RKDA 3NM3A 3RT7A 2V78A 4KAHA 4KBEA 3UMOA 1YHJA 3HJ6A 4K8CA 1LIIA 4DU5A 3DRWA 3NBVA 4LBXA 3UQEA 4S1HA 1WYEA 5COJA 3UBOA 4WJMA 4E84A 2I6BA 2QCVA 2QHPA 3VASA 4EBUA 3CQDA 1LHPA 2AJPA 3FHXA 4X8FA 1U2XA 1ESQA 3RPZA 4YL5A 2I5BA 1VI9A 4EUMA 3Q1YA 5CM5A 1LIOA 1V1BA 5C40A 3EWMA 1EKQA 4K93A 4KANA 2AB8A 2VARA 3KD6A 3IE7A 4S1IA 5TQIA 4GM6A 4K9CA 1RFUA 1LIJA 3JULA 3GBUA 3PZSA 3NL5A 3RTDA 4B8SA 3DZVA 3RQ8A 1VK4A 1EKKA 4JJPA 4E3AA 3BGKA 3LKIA 2XTBA 4S1IB 1UA4A 3RRJA 1LHRA 3RT9A 3H74A 4PVVA 3LHXA 3RSFA 3UQ6A 1RKAA 3RSSA 3RRFA 2YXTA 1RKSA 3IKHA 5TRWA 2JG5A 2DCNA 3GO7A 4UBEA 1TZ6A 3K9EA 4KALA 3RTCA 2AWDA 4EN4A 1DGMA 2R3EA 2AA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R3B A;  4O1G A;  3RTE A;  4C5N A;  1YGJ A;  3HIC A;  2FV7 A;  3K5W A;  1YGK A;  2AJR A;  4K8K A;  4K9I A;  3MBH A;  4N09 A;  3B3L A;  4XCK A;  4E8Z A;  3NBW A;  4EOH A;  4C5K A;  4KAD A;  2HW1 A;  3RQ2 A;  3RU2 A;  1V1S A;  2ABS A;  3HYO A;  4JKS A;  3B1P A;  3RS9 A;  1RFV A;  3RO4 A;  3NC2 A;  1BX4 A;  3VAQ A;  3IN1 A;  4XF6 A;  3IBQ A;  3RSG A;  4JKU A;  2ABQ A;  3KEU A;  5EYN A;  3RQQ A;  2PKF A;  3RTG A;  4E8W A;  4XDA A;  1JXH A;  1TZ3 A;  3UQD A;  2C4E A;  2RBC A;  1UB0 A;  3NCA A;  5BYC A;  1GQT A;  3Q92 A;  3RY7 A;  3N1C A;  3RSQ A;  1JXI A;  2DDM A;  3RQ5 A;  1RFT A;  4YWR A;  1RK2 A;  2C49 A;  3ZS7 A;  3RQ6 A;  3RTA A;  4B8R A;  3RTB A;  3RS8 A;  5CGE A;  1V1A A;  4DC3 A;  4LCA A;  3NL2 A;  2JG1 A;  3IH0 A;  3RM5 A;  3NL6 A;  2A9Z A;  4O1L A;  5B6A A;  3QA2 A;  5EY7 A;  5C3Z A;  3FHY A;  4C5M A;  5F0Z A;  3UQ9 A;  4E8Y A;  3RQX A;  3PL2 A;  4E69 A;  3HPD A;  4K8T A;  4S1M A;  4LBG A;  5C41 A;  1TD2 A;  1TYY A;  3B1N A;  3NC9 A;  2F7K A;  3UMP A;  2F02 A;  5F11 A;  5BYD A;  1LIK A;  1C3Q A;  4XF7 A;  2Q5R A;  3RRE A;  3I3Y A;  3LOO A;  2PKK A;  4C5L A;  3RQH A;  1KYH A;  5C3Y A;  3BF5 A;  5BYE A;  1ESJ A;  1L2L A;  3KZH A;  3W4S A;  2A9Y A;  3B1O A;  5BYF A;  2DDW A;  1V19 A;  2I6A A;  2HLZ A;  4K8P A;  3H49 A;  1VM7 A;  2HQQ A;  1GC5 A;  2PKM A;  4N08 A;  2AX3 A;  3GO6 A;  3RPH A;  4C5J A;  3MBJ A;  3RRB A;  4U7X A;  3B1R A;  3LJS A;  2JGV A;  3QAI A;  2NWH A;  3RU3 A;  3B1Q A;  5CGA A;  3NL3 A;  3NM1 A;  3KTN A;  2PKN A;  2DDO A;  4LC4 A;  2YXU A;  3IQ0 A;  3OTX A;  2AFB A;  1RKD A;  3NM3 A;  3RT7 A;  2V78 A;  4KAH A;  4KBE A;  3UMO A;  1YHJ A;  4K8C A;  1LII A;  4DU5 A;  3DRW A;  3NBV A;  4LBX A;  3UQE A;  4S1H A;  1WYE A;  5COJ A;  3UBO A;  4WJM A;  4E84 A;  2I6B A;  2QCV A;  2QHP A;  3VAS A;  4EBU A;  3CQD A;  1LHP A;  2AJP A;  3FHX A;  4X8F A;  1U2X A;  1ESQ A;  3RPZ A;  4YL5 A;  2I5B A;  1VI9 A;  4EUM A;  3Q1Y A;  5CM5 A;  1LIO A;  1V1B A;  5C40 A;  3EWM A;  1EKQ A;  4K93 A;  4KAN A;  2AB8 A;  2VAR A;  3KD6 A;  3IE7 A;  4S1I A;  5TQI A;  4GM6 A;  4K9C A;  1RFU A;  1LIJ A;  3JUL A;  3GBU A;  3PZS A;  3NL5 A;  3RTD A;  4B8S A;  3DZV A;  3RQ8 A;  1VK4 A;  1EKK A;  4JJP A;  4E3A A;  3BGK A;  3LKI A;  2XTB A;  4S1I B;  1UA4 A;  3RRJ A;  1LHR A;  3RT9 A;  3H74 A;  4PVV A;  3LHX A;  3RSF A;  3UQ6 A;  1RKA A;  3RSS A;  3RRF A;  2YXT A;  1RKS A;  3IKH A;  5TRW A;  2JG5 A;  2DCN A;  3GO7 A;  4UBE A;  1TZ6 A;  3K9E A;  4KAL A;  3RTC A;  2AWD A;  4EN4 A;  1DGM A;  2R3E A;  2AA0 A; 
#chains in the Genus database with same CATH topology
 2R3B A;  2UUP A;  4K9I A;  4O1G A;  2JFH A;  3RTE A;  4C5N A;  1UAG A;  1YGJ A;  1W7K A;  2FV7 A;  1YGK A;  2AJR A;  3HIC A;  3K5W A;  3MBH A;  4K8K A;  3B3L A;  4N09 A;  4E8Z A;  3NBW A;  2GCA A;  4C5K A;  1P3D A;  4KAD A;  4CVK A;  2HW1 A;  3RQ2 A;  1P31 A;  3RU2 A;  1V1S A;  2ABS A;  3HYO A;  3HN7 A;  4JKS A;  3B1P A;  3RS9 A;  1RFV A;  3RO4 A;  3NC2 A;  1BX4 A;  3VAQ A;  3IN1 A;  4XF6 A;  3IBQ A;  3RSG A;  4JKU A;  2ABQ A;  3KEU A;  4UAG A;  1EEH A;  1O5Z A;  5EYN A;  3RQQ A;  2VOS A;  2X5O A;  2PKF A;  3RTG A;  4E8W A;  4XDA A;  1JXH A;  1TZ3 A;  4EOH A;  3NRS A;  2C4E A;  3UQD A;  2RBC A;  1UB0 A;  3NCA A;  4CVM A;  1GQT A;  5BYC A;  2GC6 A;  3Q92 A;  3RY7 A;  3N1C A;  3QCZ A;  3RSQ A;  1E0D A;  1JXI A;  2DDM A;  3RQ5 A;  1RFT A;  2F00 A;  2AM2 A;  1RK2 A;  2C49 A;  4YWR A;  3ZS7 A;  4BUC A;  3RQ6 A;  3RTA A;  4B8R A;  3RTB A;  3RS8 A;  5CGE A;  1V1A A;  2UAG A;  4LCA A;  4DC3 A;  3NL2 A;  2JG1 A;  3IH0 A;  3RM5 A;  4HV4 A;  3NL6 A;  2A9Z A;  2UUO A;  4O1L A;  5B6A A;  3QA2 A;  5EY7 A;  5C3Z A;  5A5E A;  3FHY A;  4C5M A;  5F0Z A;  3UQ9 A;  4E8Y A;  3RQX A;  3PL2 A;  4E69 A;  3HPD A;  4K8T A;  4S1M A;  4LBG A;  4C13 A;  1TD2 A;  1TYY A;  3B1N A;  3NC9 A;  2F7K A;  3UMP A;  2F02 A;  4QDI A;  5F11 A;  5BYD A;  1LIK A;  1C3Q A;  2Y1O A;  2Q5R A;  4XF7 A;  1JBV A;  3I3Y A;  2VTE A;  2PKK A;  3LOO A;  3RRE A;  4C12 A;  2VTD A;  4C5L A;  3RQH A;  1KYH A;  1GG4 A;  5C3Y A;  3BF5 A;  5BYE A;  2WTZ A;  1ESJ A;  1L2L A;  3KZH A;  4XCK A;  3W4S A;  2A9Y A;  3B1O A;  5BYF A;  2DDW A;  1V19 A;  2JFF A;  4CVL A;  2I6A A;  2HLZ A;  4K8P A;  3H49 A;  1VM7 A;  2HQQ A;  1GC5 A;  2PKM A;  4N08 A;  2AX3 A;  3GO6 A;  4QF5 A;  3RPH A;  3MBJ A;  3RRB A;  4C5J A;  4U7X A;  3B1R A;  3LJS A;  2JGV A;  5C41 A;  3QAI A;  2NWH A;  3RU3 A;  3B1Q A;  4ZIY A;  5CGA A;  3NL3 A;  3NM1 A;  1FGS A;  3KTN A;  2PKN A;  2DDO A;  4LC4 A;  3ZM6 A;  2Y66 A;  3ZM5 A;  2YXU A;  3IQ0 A;  3OTX A;  2AFB A;  1RKD A;  3NM3 A;  3RT7 A;  2V78 A;  4KAH A;  4KBE A;  3UMO A;  1YHJ A;  3HJ6 A;  4K8C A;  1LII A;  4DU5 A;  2AM1 A;  3DRW A;  1GQQ A;  3NBV A;  4LBX A;  3UQE A;  4S1H A;  1WYE A;  5COJ A;  1W78 A;  3UBO A;  4WJM A;  2WJP A;  4E84 A;  2I6B A;  3PYZ A;  2QCV A;  2QHP A;  3VAS A;  1JBW A;  3CQD A;  4EBU A;  1LHP A;  2AJP A;  2XJA A;  3FHX A;  3LK7 A;  4X8F A;  1U2X A;  1ESQ A;  1GQY A;  3RPZ A;  4YL5 A;  2I5B A;  3UAG A;  2GCB A;  1VI9 A;  2Y67 A;  4EUM A;  3Q1Y A;  5CM5 A;  1LIO A;  1V1B A;  3ZL8 A;  5C40 A;  3EWM A;  1EKQ A;  4K93 A;  4KAN A;  4BUB A;  2AB8 A;  2VAR A;  3KD6 A;  3IE7 A;  4S1I A;  5TQI A;  4GM6 A;  3N2A A;  1RFU A;  1LIJ A;  3JUL A;  3GBU A;  3PZS A;  3NL5 A;  4K9C A;  3RTD A;  1J6U A;  3DZV A;  3RQ8 A;  4B8S A;  2GC5 A;  1VK4 A;  1EKK A;  4JJP A;  2JFG A;  1E8C A;  3BGK A;  3LKI A;  4E3A A;  2XTB A;  4S1I B;  1UA4 A;  3RRJ A;  1LHR A;  2VOR A;  2XPC A;  3RT9 A;  3H74 A;  4PVV A;  2Y68 A;  3LHX A;  3RSF A;  3EAG A;  1RKA A;  3RSS A;  3RRF A;  2YXT A;  3UQ6 A;  1RKS A;  3IKH A;  5TRW A;  2JG5 A;  2DCN A;  3GO7 A;  4UBE A;  1TZ6 A;  3K9E A;  4KAL A;  3RTC A;  2AWD A;  4EN4 A;  5A5F A;  1DGM A;  2R3E A;  2AA0 A; 
#chains in the Genus database with same CATH homology
 2R3B A;  4O1G A;  3RTE A;  4C5N A;  1YGJ A;  3HIC A;  2FV7 A;  3K5W A;  1YGK A;  2AJR A;  4K8K A;  4K9I A;  3MBH A;  4N09 A;  3B3L A;  4XCK A;  4E8Z A;  3NBW A;  4EOH A;  4C5K A;  4KAD A;  2HW1 A;  3RQ2 A;  3RU2 A;  1V1S A;  2ABS A;  3HYO A;  4JKS A;  3B1P A;  3RS9 A;  1RFV A;  3RO4 A;  3NC2 A;  1BX4 A;  3VAQ A;  3IN1 A;  4XF6 A;  3IBQ A;  3RSG A;  4JKU A;  2ABQ A;  3KEU A;  5EYN A;  3RQQ A;  2PKF A;  3RTG A;  4E8W A;  4XDA A;  1JXH A;  1TZ3 A;  3UQD A;  2C4E A;  2RBC A;  1UB0 A;  3NCA A;  5BYC A;  1GQT A;  3Q92 A;  3RY7 A;  3N1C A;  3RSQ A;  1JXI A;  2DDM A;  3RQ5 A;  1RFT A;  4YWR A;  1RK2 A;  2C49 A;  3ZS7 A;  3RQ6 A;  3RTA A;  4B8R A;  3RTB A;  3RS8 A;  5CGE A;  1V1A A;  4DC3 A;  4LCA A;  3NL2 A;  2JG1 A;  3IH0 A;  3RM5 A;  3NL6 A;  2A9Z A;  4O1L A;  5B6A A;  3QA2 A;  5EY7 A;  5C3Z A;  3FHY A;  4C5M A;  5F0Z A;  3UQ9 A;  4E8Y A;  3RQX A;  3PL2 A;  4E69 A;  3HPD A;  4K8T A;  4S1M A;  4LBG A;  5C41 A;  1TD2 A;  1TYY A;  3B1N A;  3NC9 A;  2F7K A;  3UMP A;  2F02 A;  5F11 A;  5BYD A;  1LIK A;  1C3Q A;  4XF7 A;  2Q5R A;  3RRE A;  3I3Y A;  3LOO A;  2PKK A;  4C5L A;  3RQH A;  1KYH A;  5C3Y A;  3BF5 A;  5BYE A;  1ESJ A;  1L2L A;  3KZH A;  3W4S A;  2A9Y A;  3B1O A;  5BYF A;  2DDW A;  1V19 A;  2I6A A;  2HLZ A;  4K8P A;  3H49 A;  1VM7 A;  2HQQ A;  1GC5 A;  2PKM A;  4N08 A;  2AX3 A;  3GO6 A;  3RPH A;  4C5J A;  3MBJ A;  3RRB A;  4U7X A;  3B1R A;  3LJS A;  2JGV A;  3QAI A;  2NWH A;  3RU3 A;  3B1Q A;  5CGA A;  3NL3 A;  3NM1 A;  3KTN A;  2PKN A;  2DDO A;  4LC4 A;  2YXU A;  3IQ0 A;  3OTX A;  2AFB A;  1RKD A;  3NM3 A;  3RT7 A;  2V78 A;  4KAH A;  4KBE A;  3UMO A;  1YHJ A;  3HJ6 A;  4K8C A;  1LII A;  4DU5 A;  3DRW A;  3NBV A;  4LBX A;  3UQE A;  4S1H A;  1WYE A;  5COJ A;  3UBO A;  4WJM A;  4E84 A;  2I6B A;  2QCV A;  2QHP A;  3VAS A;  4EBU A;  3CQD A;  1LHP A;  2AJP A;  3FHX A;  4X8F A;  1U2X A;  1ESQ A;  3RPZ A;  4YL5 A;  2I5B A;  1VI9 A;  4EUM A;  3Q1Y A;  5CM5 A;  1LIO A;  1V1B A;  5C40 A;  3EWM A;  1EKQ A;  4K93 A;  4KAN A;  2AB8 A;  2VAR A;  3KD6 A;  3IE7 A;  4S1I A;  5TQI A;  4GM6 A;  4K9C A;  1RFU A;  1LIJ A;  3JUL A;  3GBU A;  3PZS A;  3NL5 A;  3RTD A;  4B8S A;  3DZV A;  3RQ8 A;  1VK4 A;  1EKK A;  4JJP A;  4E3A A;  3BGK A;  3LKI A;  2XTB A;  4S1I B;  1UA4 A;  3RRJ A;  1LHR A;  3RT9 A;  3H74 A;  4PVV A;  3LHX A;  3RSF A;  3UQ6 A;  1RKA A;  3RSS A;  3RRF A;  2YXT A;  1RKS A;  3IKH A;  5TRW A;  2JG5 A;  2DCN A;  3GO7 A;  4UBE A;  1TZ6 A;  3K9E A;  4KAL A;  3RTC A;  2AWD A;  4EN4 A;  1DGM A;  2R3E A;  2AA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...