4ECBA

Chimeric gst containing inserts of kininogen peptides
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
225
structure length
202
Chain Sequence
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chimeric protein between GSHKT10 and domain 5 of kininogen-1
publication title Chimeric glutathione S-transferases containing inserts of kininogen peptides: potential novel protein therapeutics.
pubmed doi rcsb
source organism Schistosoma japonicum
molecule tags Transferase, protein binding
total genus 70
structure length 202
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2012-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 4ecbA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ecbA01
2H6XA 3IAS2 4BVXB 1AUCA 1V98A 1VGLA 1XVQA 5F06A 10GSA 4HQSA 3ZFLA 3M9KA 4TR0A 5IMCA 3G9BA 4NWYA 3O3TA 3S9FA 2R6KA 3H93A 3GX8A 3K8NA 3ZITA 2HT9A 2V1MA 1U87A 2VD1A 4LMWA 3P8WA 2GLRA 3IC8A 2FGXA 5D9VA 3UBKA 3CBUA 4AGSA 1DSBA 1F6MC 3P2AA 4MF7A 4OCEA 4PXOA 1K0CA 2JZSA 3AY8A 2NPBA 4ZL7A 2R37A 5J9CA 4IQ1A 3CXGA 3ZIVA 3QD9A 3MAKA 3KCMA 2VCTA 2KOKA 3VFIA 4MA9A 3U6VA 2MMZA 1A8YA 1AQWA 2WB9A 3CSHA 1YF0A 3HJPA 3BD2A 2PGTA 4TOPA 1MTCA 1SENA 5D9XA 17GSA 3RDWA 3DD3A 2JACA 3GFKA 2YCDA 4F0BA 1QXHA 3GSTA 1YDKA 5DAKB 5ECPB 4X0XA 3QPMA 2YANA 4ZBBA 2XPDA 3ZMLA 3DRNA 4O5RA 1UVZA 2VO4A 2REMA 3TOUA 5DAKA 2O8VB 2L6CA 5G1LA 2HYXA 1TP9A 1XWAA 1B9XC 3FR3A 2CZ3A 2CT6A 4TR4A 1X9WB 3APQA 3HVXA 3QAGA 5C00A 1SK1A 1K0NA 2LNTA 1S3AA 2CA8A 1R26A 1EGRA 4GCIA 3HA9A 4IQAA 2H66A 4PQIA 2OJLA 2PBJA 1J08A 5ELAA 2PN8A 5ECQB 1XBSA 1B4PA 2X8GA 1JZWA 1XXUA 1J0FA 3RPPA 1NW2A 4XIHA 2OADA 3QOUA 2GGTA 3TGZA 1YZXA 1XWBA 3IBHA 5J3RA 1V2AA 1G6WA 5B8BA 3SWLA 1OAZA 1H75A 5EVOA 1PX7A 1GUKA 1AIUA 2V41A 3WYWA 1T7PB 1PD21 4USSA 1IYIA 2LQOA 1QMVA 2PU9C 3M1GA 1ON4A 3EU3A 2C4JA 3GTUB 2VLUA 1DE2A 4KAEA 1HNAA 1F9MA 5DJMA 1ST9A 4XCSA 4LL4B 2P5RA 3IC4A 1PMTA 5IM9A 1PSQA 2V6KA 1PL1A 4ZILA 5H5SA 2WULA 5CRGA 3GTUA 2EIRA 2FWFA 5ENUA 5D96A 3EWLA 2HSMB 4H86A 5IPGA 4MABA 4TVEA 5DCGA 2V6OA 4AJ6A 2DLXA 2FWEA 1XWKA 4RI6A 1TRSA 1UC7A 5IMZA 2H0IA 3F9UA 5HR2A 4G2EA 2HNLA 1T1VA 3Q74A 2FWHA 2FWGA 3DGQA 2LJAA 4PGTA 1M9BA 3C1RA 1ILOA 4WEYA 4POMA 5B7CA 2LQQA 22GSA 2C3QA 3LGCA 3IE3A 3C71A 2KLXA 2YNXA 4IHUA 5JCUA 2C0FA 3ERWA 2RUFA 1BX9A 3FKFA 2H70A 2X8CA 1WPIA 2MMOA 1KNGA 5H5QA 1TXXA 2WFCA 3MSZA 4OCFA 1TI3A 1ZYQB 3GIXA 1NHOA 2JZTA 5JWOB 4EDYA 1ACVA 3WT2A 4WR4A 3VI7A 5ECMB 2YZHA 1G0TA 2C0GA 1YQ1A 4KDUA 2RLIA 4L0UA 4FYUA 5F05A 2PVOC 3FR9A 1A2JA 3A2XA 4XS4A 3HVVA 4Q5FA 4FYCA 3VWXA 3UL3A 1WWJA 2B5EA 3VI5A 2CX4A 3N9JA 4BL7B 1TJDA 2V32A 3MWHA 2H30A 2YV7A 2QGVA 5HR1A 4HQZA 2K18A 1WJKA 1GUHA 2FA4A 3TDGA 1K0MA 2L4CA 3RAZA 5GAND 5GZZB 3QDNA 4N10A 4BL7A 4WBRD 4OFNA 4OO4A 2ES7A 1USBA 4KW6A 20GSA 2VCQA 1TKDB 1O8WA 4GF0A 2B6MA 1F37A 4HU9A 3IRAA 4PUAA 2OKAA 1MD3A 4K7NA 2VD0A 1A2MA 2GQMA 4OFMA 4PNGA 3GRXA 5ECSA 3KH9A 1R7HA 4ZL9A 4V1Ag 2YP6A 4HJMA 4YQVA 1PGTA 1EV4A 2H1GA 1O6JA 2HRFA 4WF5A 1TDIA 2HZFA 3EMXA 2FNOA 1QK8A 4TXOB 2AV4A 4IBPA 3TJJA 3VWWA 3WT1A 2CVKA 3HKRA 5F8BA 2YN1A 5AISA 2LS5A 3U5RE 1SKSB 2LTKA 1ZCPA 4NV5A 1U3AA 2LRNA 1AQXA 2H1BA 3NOFA 3TUEA 4KF9A 4KX4A 3LXZA 1A2LA 3IA1A 4PUFC 3GYKA 3UVTA 5H5RA 4QL7A 1Z6NA 2HLSA 1K0BA 5L71A 4K6XA 2MMAA 4RI7A 1RQMA 5ID2B 4MJCA 2L5LA 1B4QA 3D4TA 2B5YA 5IMFA 4JZQA 1V40A 1SD8A 3IXRA 3J7Yk 5B6MA 2LKUA 4EUYA 5ID2A 1GSFA 4TN8A 3TKSE 2H19A 4IGJA 1EP8A 4QQ7A 2GVPA 3BCKA 1TK0B 1PKWA 1WRYA 1XWCA 5A4UA 3KMNA 3PR8A 2B7KA 1XOAA 1SJ6A 4EF0A 3GKMA 4KDXA 2H0HA 1K3OA 2YWMA 1FAAA 3HHVA 3VLNA 19GSA 3F6FA 3F6DA 2TIRA 2ZUPA 4J2FA 1SYRA 2IJYA 4TR1A 2YWIA 1A0RP 4K2DA 2JZRA 2DC5A 2VL9A 1YKAA 2C3TA 4X43A 11GSA 2H71A 3SBCA 4BVYB 5GSTA 3HDCA 4GTUA 3IK9A 3WGDA 2YOIA 4XS6A 3W6GA 5IOWA 4BVYA 2Z9SA 1A23A 1MEKA 1EEJA 1YKCA 4O32A 4KE3A 3ZREA 2H0GA 5FWGA 1JLWA 4I2UA 1X9MB 3TKSA 1YY7A 4HDEA 1VF1A 1KBNA 3HJOA 1TRUA 4POLA 2F8AA 1W4VA 2H1DA 1SKRB 4MDCA 2DBCA 1LU4A 3EINA 4WETA 1JZOA 3EMPA 1XW6A 4JBBA 1T3BA 5IPHA 2HRKA 3TJBA 2L59A 2JSZA 1YEXA 2E2GA 4Z7XA 4LL1B 1GSQA 3HD5A 3GA4A 4BA7A 4MF5A 2FA8A 4OFTA 3D4MA 1GSDA 1HNCA 2E7PA 3ZL5A 4YAPA 4BVXA 5J4UA 3FEUA 6GSTA 3FRCA 4HI7A 3VWVA 4F03A 4QL9A 1K0DA 1FVJA 1M0UA 2K8VA 4PURA 2VLTA 3F0IA 1RW1A 3OR5A 3DYRA 3BCIA 3I43A 3C73A 4FQUA 3Q18A 3DVXA 4DVCA 1U3IA 3UAPA 5KN0A 3NIVA 2CV4A 4KA0A 1O85A 5G31A 4KB3A 2IN3A 3F63A 1EZKA 2DMLA 1Q4JA 2PUKC 2NDOA 1ZOFA 4ZB6A 2R5GA 5AIXA 3ZZXA 1FO5A 1YJ6A 1EP7A 2K9FA 2B1KA 3A5WA 4Q5QA 5AN1A 1Y25A 2H76A 1IYHA 2EIQA 3GHAA 2DSAA 3O6TA 4IVFA 3EU4A 4NHZA 3APSA 2GZZA 2H75A 1TRVA 4HS1A 5JWQB 3UOMA 2H6YA 2CAQA 2ZNMA 3C1SA 1TK8B 4OWYA 2VCXA 7GSSA 1WP0A 4MJAA 2C8UA 3GX0A 4FO5A 4N0ZA 4MF6A 5B6NA 12GSA 5KN1A 4DSQA 4O92A 1M7TA 2HZEB 2C0EA 4L0WA 3D0ZA 4PX1A 4MZWA 4EKZA 1GLPA 1H4OA 2F51A 4N30A 2F9SA 2HSYA 4G0KA 2FD3A 3RHCA 2HZEA 2H73A 5JCGA 5G30A 1GP1A 3KXOA 4KSMA 1G7EA 1AXDA 4N0VA 1EEMA 4CDOA 3ZFBA 4J57E 1ABAA 2X64A 1TTZA 2GZYA 5HR3A 5DALB 6GSWA 5LD0A 3GNJA 3DKSA 1M9AA 1OYJA 1TI1A 3O76A 2G0FA 3WGEA 4CW9A 5G5FA 3ISOA 1XIYA 1A0FA 3GL5A 2CVBA 3ZLPA 1WE0A 5G1KA 2DJ2A 4ECIA 4HU7A 3LG6A 1TRWA 3F4SA 2CAIA 3KGKA 5IIZA 3GKKA 2AAWA 4TRXA 4NMUA 1U6TA 3A3TA 2DJ1A 1M99A 2VL2C 2YJHA 3RBTA 1XVWA 5CRWA 1SK2A 1Y6EA 2LNSA 4OMVA 5ELGA 5CYYA 4XRAA 3ZVJA 1MD4A 5DDLA 2I4AA 2LJRA 3ZIJA 2VCWA 4F2IA 1GTUA 3UARA 4EVMA 1OE8A 4JR4A 4V1Ap 2A2SA 1HD2A 1AQVA 4X1UA 3A2VA 3CRUA 3F3RA 1RK4A 4GLTA 5GSSA 3PGTA 1O8XA 3ME8A 4GSSA 1K0AA 4YQMA 2HSMA 5D9TA 1N2AA 1A24A 2H8LA 2VL3A 2FLSA 1MDKA 3IV4A 2GT5A 2WS2A 2AJQB 1E2YA 2I9HA 2L57A 1BEDA 4WBJA 1VF4A 1SKWB 2DJ0A 4DSRA 3H79A 3M8NA 4RQRA 4IP6A 4JU5A 4BPYA 2VCZA 4MZCA 2DJ3A 5HFIA 3MDKA 3FZ4A 3DVWA 2L6DA 4ZB8A 3P7XA 3EE2A 4L5LA 5LCZA 2GS3A 16GSA 5JCWA 4EXJA 2N5AA 4WF4A 1MDIA 4AJ8A 1F3BA 4IELA 4GRFA 2RM5A 4WR5A 5AGYA 5FHIA 1YF1A 4MH3A 2H1AA 1K0OA 3KH7A 4F9ZA 2L5OA 4ZBAA 5KEJA 2TRXA 3KTBA 2YZUA 2H6ZA 4K1FA 3UBLA 3LSZA 1SL0B 1XWGA 3TKRA 2BMXA 2E2MA 4V2LA 4I2TA 2HRAA 5IMDA 5CO3A 1PRXA 1XFLA 4ECJA 2IMDA 1HQOA 4IW9A 1URMA 4HOJA 5DCHA 3UVHA 2PPTA 2IIYA 2VAFA 1I5GA 3HYPA 2PVQA 1JZRA 3G7JA 3PPUA 2LEGA 1FB6A 5AIVA 1U88A 2LV3A 1V9WA 2YPMA 2VUPA 1N8JA 1M2BA 2M80A 2I1UA 1Z3EA 2J9HA 2C3NA 3CYNA 3BJ5A 4ECCA 1F2EA 1X5DA 3GN3A 3JCML 2X99A 1QFNA 3IAM2 4HZ2A 1BG5A 4K0NA 5G5EA 5A4VA 1LJRA 5D8IA 2XBIA 4G10A 2G2QA 4ML1A 3CSIA 4KDYA 3G7YA 3APOA 1B48A 3QCPA 2WCIA 8GSSA 2CQ9A 2I81A 5D9WA 3FHKA 2MBTA 3RPNA 3LXTA 4JRRA 1S3CA 4GXZA 4KCAA 4J56E 2YV9A 2J23A 4TXOA 2JU5A 4XS1A 4BWSA 4HZ4A 1JLVA 2LRTA 1GL8A 3TJKA 2YWOA 2GSRA 4PQHA 5DQSA 3H1NA 5IMAA 2H74A 3HZ4A 2EC4A 1PQNA 1VF3A 1T4ZA 3HVSA 2CX3A 3L9SA 5CP1A 5ECKB 1R5AA 2IMIA 2IMKA 2KP1A 18GSA 4ZL8A 1MDJA 1T4YA 4MCUA 1X0RA 4K8MA 3KP9A 1TK5B 3VK9A 1QUWA 3F4TA 4FYBA 3GUSA 5IQYA 3FZ9A 4MPGA 1KEBA 3GH9A 3P90A 5GAPD 1O81A 3KM6A 4JEDA 3EC3A 3MNGA 1THXA 3FW2A 4K7OA 1W89A 1OC3A 4P3YB 3ZTLA 5INYA 3Q6OA 3L9UA 1PN9A 4IN0A 1PX6A 3N5OA 6GSYA 3M9JA 3F4RA 2FHEA 2M72A 3FY7A 1R5PA 3VURA 3HZ8A 1FG4A 3IK7A 1UN2A 4GQFA 2DJKA 2L4QA 3A2WA 5A4WA 2IFQB 4TXVA 5EL8A 1X9SB 4OO5A 2O85A 4ILFA 4LA1A 3IHQA 4AF2A 3TRXA 3QR6A 1GTBA 1X5EA 4EL1A 4V2MA 5IMVA 5DBQA 3WD6A 2QSIA 3D5JA 2OE3A 1V58A 4RQXA 2OBIA 2B5XA 2C1YA 3KMOA 13GSA 4G19A 1QQ2A 5B8AA 4IKHA 1GSYA 3UEMA 1SK0A 1G7OA 4E8HA 3QFBC 3LYKA 4IS0A 3M0FA 2N5BA 5E4WA 4EO3A 2XPEA 3FZAA 3D6IA 1GTIA 1XW5A 1S3DA 4O7HA 1GNEA 1VRSD 1ZZYA 4DSSB 5F07A 3LYPA 4PNFA 3DIEA 6GSXA 4POBA 1Q98A 1TW9A 2RUEA 1F3AA 4CHSA 1B8XA 2B3SA 3TJGA 3CRTA 2EIOA 1GRXA 1ZMAA 1M2DA 4DSSA 1BQ7A 3H4KA 3QAVA 2GQLA 3KIJA 3CMIA 3TRQA 3D22A 3ERGA 2H72A 4TR3A 9GSSA 3LEFA 5D93A 2KUCA 2K8SA 2BTOT 2KP2A 4G0LA 5LNKe 2GT6A 2JSYA 2GSTA 1VF2A 3R3EA 1T8EB 1Z7RA 4GWRA 1FHEA 4ZIJA 3DMLA 2NTOA 2R2JA 3IOSA 1TU7A 2CZ2A 4NV2A 2NBSA 5EPFA 5JWRB 3GL3A 4JE1A 3E9JB 2IMEA 2PWJA 5F0GA 1I9DA 5CNWA 3KTLA 3C8EA 2E0QA 1TOFA 2B7JA 4F82A 5HQPA 2MZCA 3E3EA 4K0GA 2NVLA 4MJBA 3EURA 2HE3A 1K3YA 2R3XA 4HJ2A 3I69A 2OE1A 3VWUA 5KN2A 2ON7A 3DXBA 2C80A 2IWTA 1NHYA 2JADA 4XTSA 2HI7A 3QMXA 1XCCA 4MJEA 2GDRA 1M2AA 5ABRA 3GURA 1EOGA 1YEPA 2BJXA 2YJ7A 5EY6A 3ZMKA 1NSWA 2XC2A 2WRTA 3G7IA 5J9BA 2B1LA 3EYTA 3IR4A 4MH2A 4EE0A 5DALA 4I6XA 3TRPA 3FK8A 2ON5A 3HXSA 3GH6A 3LQ7A 1ZL9A 3BBYA 4ZBDA 2I3YA 1THOA 4K9ZA 2PMTA 4KH7A 2HRNA 4TW5A 4WXTA 4IP1A 4MZBA 4MPFA 3I9V2 3US3A 1GSEA 5ECLB 5CRDA 1Z9HA 3KZQA 2O89A 4ACSA 5ECIB 4MK3A 4KUNA 2IMFA 3W8JA 1SJIA 4BWQA 1O7UA 3GKXA 1ML6A 4JR6A 5DVBA 5HFGA 1WMJA 4NHWA 4ZXGA 4MMMA 2RIIA 4WKWA 1EGOA 1CQHA 5IOXA 3QFAC 3L78A 3L0HA 4KGIA 1GULA 3GSSA 4NXIA 3ME7A 2MYGA 1OC8A 4KSOA 6GSUA 4KNDA 3CTGA 3R2QA 4ULXA 5ECRB 4IJ3A 1Z7PA 4Q5RA 1OKTA 2AUVA 2UZ8A 2FY6A 1FOVA 4GSNA 1LBKA 1EOHA 4ECBA 1Z5YE 1OC9B 2QKEA 3LJRA 4L5OA 3VPTA 2X8HA 3CSJA 2VIMA 2F3MA 4YQUA 1OC9A 4LLRA 2TRCP 1FW1A 1HYUA 4ZB9A 1OKDA 2DJJA 2WGRA 5HR0A 4GSTA 4GQCA 3PINA 4F0CA 1GH2A 2DMMA 3QAWA 3NZNA 2A2RA 1SJZA 2JL4A 1SU9A 1EV9A 1QGVA 2RM6A 2HQTA 1GWCA 2ZCTA 2OBKA 2D2ZA 5DJLA 1V57A 3LWAA 2R4VA 1WOUA 3FZ5A 2A4VA 4XS4B 5J5NA 6GSVA 1ZGNA 4V2NA 1UA5A 5ECHB 4Q5NA 2QC7A 2P31A 2HFDA 1GUMA 2CVDA 1B9YC 3D21A 4TKYA 2WDUA 2AYTA 4E8EA 1C72A 2VL2A 2XBQA 4HUAA 3DWVA 5E59A 1G6YA 2K6VA 2GSSA 1GTAA 1PKZA 1ERTA 2HSNB 1XOBA 4YAVA 3TB2A 2F8FA 3V1WA 2LRCA 3TCOA 1CQGA 2LUSA 1DE1A 1ERVA 2O87A 4POKA 2OE0A 2AHEA 5C04A 3HY2A 3UIWA 1XPVA 4I97A 4YH2A 2M46A 5CREA 4G0IA 5IO0A 3KEBA 4K7IA 5COHA 4MP4A 1GNWA 5G2ZA 2DIZA 3VPQA 5ECOB 2AB6A 4L8EA 3L4NA 5KN3A 3UJ1A 3I6AA 3TKSC 3ZRDA 2VM1A 1T00A 1SL2B 3ED3A 1ERWA 3IDVA 3M3MA 4I8BA 2VOCA 2LSTA 5BMUA 2N5FA 2YWNA 2GZPA 14GSA 1GLQA 1TU8A 5ECNB 1GSUA 4DEJA 3L9VA 4LMVA 4KCEA 3Q19A 4EC0A 5IO2A 2HSHA 3F3QA 1PL2A 2O7KA 3J7Yb 1FVKA 2OA7A 1DBYA 1OVNA 1AC1A 1JFUA 3IPZA 3GMFA 2IL3A 2OACA 2C0DA 3DEXA 3ZVJD 2VLVA 1SL1B 1J9BA 4FH8A 2DIYA 3TKPA 5D73A 4PQ1A 3KJYA 2H01A 4ISDA 4NAXA 3F8UA 5CRHA 4XHMA 3WGXA 1NM3A 4FIWA 2FUG2 2MMNA 1XZOA 4ID0A 1O73A 2GSQA 3E0UA 1FB0A 1XW9A 5J41A 2IPAA 4ML6A 2WJUA 3CTFA 3GV1A 4NPBA 2P0GA 4TR1B 3LFLA 2XHFA 1K3LA 4AJ7A 4EDZA 6GSSA 2HXKA 1GSSA 5FT3A 1R4WA 2ALBA 5A5KA 3ZYWA 4I5QA 4XRDA 1AAZA 4MLYA 1Z6MA 3KP8A 3TJFA 2P5QA 1BAYA 4N11A 1AW9A 3UMAA 3H8QA 3FR6A 3GKNA 5DQYA 2MBSA 3EVIA 1DUGA 3TOTA 1E6BA 2PERA 3KD0A 4HEA2 4RUVA 3LORA 1HNBA 3PH9A 3ERFA 1A8LA 1X5CA 2KHPA 1JZDA 3TKQA 3BOAA 2IFQA 2V2GA 1ERUA 1JHBA 5CAXA 1WIKA 4OD7A 1KTEA 1BJXA 3RHBA 2VM2A 2GTUA 3W8SA 4D73B 2VCVA 2WZ9A 3HJMA 3FYGA 2LJKA 1BYEA 1SD9A 3HCZA 4G9HA 1EWXA 1OE7A 2HRKB 2FCHA 4D73A 4IJIA 5HFKA 1SYXA 1ZYEA 4PTSA 2GQKA 3C7MA 1PA3A
chains in the Genus database with same CATH superfamily
2H6XA 3IAS2 4BVXB 1AUCA 1V98A 3CQFA 5A1NA 1VGLA 1XVQA 5F06A 10GSA 4HQSA 3ZFLA 3M9KA 4TR0A 5IMCA 3G9BA 4NWYA 3O3TA 3S9FA 2R6KA 3H93A 4Z2RA 3GX8A 3K8NA 3ZITA 2HT9A 2V1MA 1U87A 2VD1A 4LMWA 3P8WA 2GLRA 3IC8A 2FGXA 5D9VA 3UBKA 3CBUA 4AGSA 1DSBA 1F6MC 3P2AA 4MF7A 4OCEA 4PXOA 1K0CA 2JZSA 3AY8A 2NPBA 4ZL7A 2R37A 5J9CA 4IQ1A 3CXGA 3ZIVA 3QD9A 3MAKA 3KCMA 2VCTA 2KOKA 3VFIA 4MA9A 3U6VA 2MMZA 1A8YA 1AQWA 2WB9A 3CSHA 1YF0A 3HJPA 3BD2A 2PGTA 4TOPA 3RFRC 2UV8G 1MTCA 1SENA 5D9XA 17GSA 3RDWA 3DD3A 2JACA 3GFKA 2YCDA 4F0BA 1QXHA 3GSTA 1YDKA 5DAKB 5ECPB 4X0XA 4X4JA 3QPMA 2YANA 4ZBBA 2XPDA 4EIQA 3ZMLA 3DRNA 4O5RA 1UVZA 2VO4A 2REMA 3TOUA 5DAKA 2O8VB 1Y1UA 2L6CA 5G1LA 2HYXA 1TP9A 1XWAA 1B9XC 3FR3A 2CZ3A 2CT6A 2WZSA 3MIXA 4TR4A 1X9WB 3APQA 3HVXA 3QAGA 5C00A 1SK1A 1K0NA 2LNTA 1S3AA 2CA8A 1R26A 1EGRA 4GCIA 3HA9A 4IQAA 2H66A 4PQIA 2OJLA 2PBJA 1J08A 5ELAA 2PN8A 5ECQB 1XBSA 1B4PA 2X8GA 1JZWA 4PHZC 1XXUA 1J0FA 3RPPA 1NW2A 4XIHA 2OADA 3QOUA 2GGTA 3TGZA 1YZXA 1XWBA 3IBHA 5J3RA 1V2AA 1G6WA 5B8BA 3SWLA 1OAZA 1H75A 5EVOA 1PX7A 1GUKA 2EFDA 1AIUA 2V41A 3WYWA 1T7PB 5J40A 1PD21 4USSA 1IYIA 4AKGA 2LQOA 1QMVA 4AKIA 2PU9C 3M1GA 1ON4A 3EU3A 2C4JA 3GTUB 2VLUA 1DE2A 4KAEA 1HNAA 1F9MA 5DJMA 1ST9A 4XCSA 4LL4B 3HMJG 2P5RA 3IC4A 1PMTA 5IM9A 1PSQA 2V6KA 1PL1A 4ZILA 5H5SA 2WULA 5CRGA 3GTUA 2EIRA 2FWFA 5ENUA 5D96A 1XG8A 3EWLA 2HSMB 4H86A 5IPGA 4MABA 2O36A 4TVEA 5DCGA 2V6OA 2OT3A 4AJ6A 2DLXA 2FWEA 1BF5A 1XWKA 4RI6A 1TRSA 1UC7A 5IMZA 2H0IA 3F9UA 5HR2A 4G2EA 2HNLA 1T1VA 3Q74A 2FWHA 2FWGA 3DGQA 2LJAA 4PGTA 1M9BA 3C1RA 1ILOA 4WEYA 4POMA 5B7CA 2LQQA 22GSA 2C3QA 4CY6A 4PI2C 3LGCA 3IE3A 3C71A 2KLXA 2YNXA 4IHUA 5JCUA 2C0FA 3ERWA 2RUFA 1BX9A 3FKFA 2H70A 2X8CA 1WPIA 2MMOA 1KNGA 5H5QA 1TXXA 2WFCA 3MSZA 4OCFA 1TI3A 1ZYQB 3GIXA 1NHOA 2JZTA 5JWOB 4EDYA 1ACVA 3WT2A 4WR4A 3VI7A 5ECMB 2YZHA 1G0TA 2C0GA 1YQ1A 4KDUA 2RLIA 4L0UA 4FYUA 5F05A 2PVOC 3FR9A 3RGBC 3CHXC 1A2JA 3A2XA 4XS4A 3HVVA 4Q5FA 4FYCA 3VWXA 3UL3A 1WWJA 2B5EA 4YKGA 3VI5A 2CX4A 3N9JA 4BL7B 1TJDA 2V32A 3MWHA 2H30A 2YV7A 5A5HA 2QGVA 5HR1A 4HQZA 1SVLA 2K18A 1WJKA 1GUHA 2A4HA 2FA4A 3TDGA 1K0MA 2L4CA 3RAZA 5GAND 5GZZB 3QDNA 4N10A 4BL7A 4WBRD 4OFNA 4OO4A 2ES7A 1USBA 4KW6A 1M3JA 20GSA 2VCQA 1TKDB 1O8WA 4GF0A 2B6MA 1F37A 4HU9A 3IRAA 4PUAA 2OKAA 1MD3A 4K7NA 2VD0A 1A2MA 2GQMA 4OFMA 4PNGA 3GRXA 5ECSA 3KH9A 1R7HA 4ZL9A 4V1Ag 2YP6A 4HJMA 4YQVA 1PGTA 1EV4A 2H1GA 1O6JA 2HRFA 4WF5A 1TDIA 2HZFA 3EMXA 2FNOA 1QK8A 4TXOB 2AV4A 4IBPA 3TJJA 3VWWA 3WT1A 2CVKA 3HKRA 5F8BA 2YN1A 5AISA 2LS5A 3U5RE 1SKSB 2LTKA 1ZCPA 4NV5A 1U3AA 2LRNA 1AQXA 2H1BA 3NOFA 3TUEA 4KF9A 4KX4A 3LXZA 1A2LA 3IA1A 4PUFC 3GYKA 3UVTA 5H5RA 4QL7A 1Z6NA 2HLSA 1K0BA 5L71A 4K6XA 2MMAA 4RI7A 1RQMA 5ID2B 4MJCA 2L5LA 1B4QA 3D4TA 2B5YA 5IMFA 4JZQA 1V40A 3FMWA 5KOWA 1SD8A 3IXRA 3J7Yk 5B6MA 2LKUA 4N3ZA 4EUYA 5ID2A 1GSFA 4TN8A 3TKSE 2H19A 2X49A 4IGJA 1EP8A 4QQ7A 2GVPA 3BCKA 1TK0B 1PKWA 1WRYA 1XWCA 5A4UA 3KMNA 3PR8A 2B7KA 1XOAA 1SJ6A 4EF0A 5J4VA 3GKMA 4KDXA 2H0HA 1K3OA 2YWMA 1FAAA 3HHVA 3VLNA 19GSA 3F6FA 3F6DA 2TIRA 2ZUPA 4J2FA 2QA2A 1SYRA 2IJYA 4TR1A 2YWIA 1A0RP 4K2DA 2JZRA 2DC5A 2VL9A 1YKAA 2C3TA 3A5IA 4X43A 3MYDA 11GSA 2H71A 3SBCA 4BVYB 5GSTA 1ZYPA 3HDCA 4GTUA 3IK9A 3WGDA 2YOIA 4XS6A 3W6GA 5IOWA 4BVYA 2Z9SA 1A23A 1MEKA 1EEJA 1YKCA 4O32A 4KE3A 3ZREA 2H0GA 5FWGA 1JLWA 4I2UA 1X9MB 3TKSA 1YY7A 4HDEA 1VF1A 1KBNA 3HJOA 1TRUA 4POLA 2F8AA 1W4VA 2H1DA 1SKRB 4MDCA 2DBCA 1LU4A 3EINA 3EPTA 4WETA 1JZOA 3EMPA 4K2XA 1XW6A 4JBBA 1T3BA 5IPHA 2EFHA 2HRKA 3TJBA 2L59A 2JSZA 1YEXA 2E2GA 4Z7XA 4LL1B 1GSQA 3HD5A 3GA4A 4BA7A 4MF5A 2FA8A 4OFTA 3D4MA 1GSDA 1HNCA 2E7PA 3ZL5A 4YAPA 4BVXA 5J4UA 3FEUA 6GSTA 3FRCA 4HI7A 4O5UA 3VWVA 4F03A 4QL9A 1K0DA 1FVJA 1M0UA 2K8VA 4PURA 2VLTA 3F0IA 1RW1A 3OR5A 3DYRA 3BCIA 3I43A 3TU3B 2WW0A 3C73A 4FQUA 3Q18A 3DVXA 4DVCA 1U3IA 3UAPA 5KN0A 3NIVA 2CV4A 4KA0A 1O85A 5G31A 4KB3A 2IN3A 3F63A 4EIPA 1EZKA 2DMLA 1Q4JA 2PUKC 2NDOA 1ZOFA 4ZB6A 2R5GA 5AIXA 3ZZXA 1FO5A 1YJ6A 1EP7A 2K9FA 2B1KA 3A5WA 4Q5QA 5AN1A 1Y25A 2H76A 1IYHA 2EIQA 3GHAA 2DSAA 3O6TA 4IVFA 3EU4A 4NHZA 3APSA 2GZZA 2H75A 1TRVA 4HS1A 5JWQB 3UOMA 2H6YA 4K5SA 2CAQA 2ZNMA 3C1SA 1TK8B 4OWYA 2VCXA 7GSSA 1WP0A 4MJAA 2C8UA 3GX0A 4FO5A 4N0ZA 4MF6A 5B6NA 12GSA 5KN1A 4DSQA 4O92A 1M7TA 2HZEB 4E68A 2C0EA 4L0WA 3D0ZA 4PX1A 4MZWA 4EKZA 1GLPA 1H4OA 2F51A 4N30A 2F9SA 2HSYA 4G0KA 2FD3A 3RHCA 2HZEA 2H73A 5JCGA 5G30A 1GP1A 3KXOA 4KSMA 1G7EA 1AXDA 4N0VA 1EEMA 4CDOA 3ZFBA 4J57E 1ABAA 2X64A 1TTZA 2GZYA 5HR3A 5DALB 6GSWA 5LD0A 3GNJA 3DKSA 1M9AA 1OYJA 1TI1A 3O76A 2G0FA 3WGEA 4CW9A 5G5FA 3ISOA 1XIYA 1A0FA 3GL5A 2CVBA 3ZLPA 1WE0A 5G1KA 2DJ2A 4ECIA 4HU7A 3LG6A 1TRWA 3F4SA 2WW3A 2CAIA 3KGKA 5IIZA 3GKKA 2AAWA 4TRXA 2R0GA 4NMUA 1U6TA 3A3TA 2DJ1A 1M99A 2VL2C 2YJHA 3RBTA 1XVWA 5CRWA 1SK2A 1Y6EA 2LNSA 1YEWC 4OMVA 5ELGA 5CYYA 4XRAA 3ZVJA 1MD4A 2WVYA 5DDLA 2I4AA 2LJRA 3ZIJA 2EFCA 2VCWA 2DKHA 4F2IA 1GTUA 3UARA 4EVMA 1OE8A 4JR4A 4V1Ap 2A2SA 1HD2A 1SVOA 1AQVA 4X1UA 3A2VA 3CRUA 3F3RA 1RK4A 4GLTA 5GSSA 2QA1A 3PGTA 1O8XA 4GSSA 3ME8A 1K0AA 4YQMA 2HSMA 4ZB7A 5D9TA 1N2AA 1A24A 2H8LA 2VL3A 2FLSA 1MDKA 3IV4A 2GT5A 4ICYA 2WS2A 2AJQB 1E2YA 2I9HA 2L57A 1BEDA 4WBJA 1VF4A 5J47A 1SKWB 2DJ0A 4DSRA 3H79A 3M8NA 4RQRA 4IP6A 4JU5A 4BPYA 2VCZA 4MZCA 2DJ3A 5HFIA 3MDKA 3FZ4A 3DVWA 2L6DA 4ZB8A 3P7XA 3EE2A 2X4AA 4L5LA 5LCZA 2GS3A 16GSA 5JCWA 2EFEA 4EXJA 2N5AA 4WF4A 1ZYNA 1MDIA 4AJ8A 1F3BA 4IELA 4GRFA 2RM5A 4WR5A 4PI0C 5AGYA 3LW9A 5FHIA 1YF1A 4MH3A 2H1AA 4BIKA 1K0OA 3KH7A 4F9ZA 3CWGA 2L5OA 4ZBAA 5KEJA 2TRXA 3KTBA 2YZUA 2H6ZA 4K1FA 3UBLA 3LSZA 1SL0B 1XWGA 3TKRA 2BMXA 2E2MA 4V2LA 4I2TA 2HRAA 5IMDA 2O5VA 5CO3A 1PRXA 1XFLA 4ECJA 2IMDA 1HQOA 4A5PA 4IW9A 4O5QA 1URMA 4HOJA 5DCHA 1S4BP 3UVHA 2PPTA 2IIYA 2VAFA 1I5GA 3HYPA 2PVQA 1JZRA 3G7JA 3PPUA 2LEGA 1FB6A 5AIVA 1U88A 2LV3A 1V9WA 2YPMA 2VUPA 1N8JA 1M2BA 2M80A 2I1UA 1Z3EA 2J9HA 2C3NA 3CYNA 3BJ5A 4ECCA 1F2EA 1X5DA 3GN3A 3JCML 2X99A 1QFNA 3IAM2 4HZ2A 1BG5A 4K0NA 5G5EA 5A4VA 1LJRA 5D8IA 2XBIA 4G10A 2G2QA 4ML1A 3CSIA 4KDYA 3G7YA 3APOA 1B48A 3QCPA 2WCIA 8GSSA 2CQ9A 2I81A 5D9WA 3FHKA 2MBTA 3RPNA 3LXTA 4JRRA 1S3CA 4GXZA 4KCAA 4J56E 2YV9A 2J23A 4TXOA 2JU5A 4XS1A 4BWSA 4HZ4A 1JLVA 2LRTA 1GL8A 3TJKA 1PFOA 2YWOA 1FOHA 2GSRA 4PQHA 5DQSA 3H1NA 5IMAA 2H74A 3HZ4A 2EC4A 2R0CA 1PQNA 1VF3A 1T4ZA 3HVSA 2CX3A 3L9SA 5CP1A 5ECKB 1R5AA 2IMIA 2IMKA 2KP1A 18GSA 4ZL8A 1MDJA 1T4YA 4MCUA 1X0RA 4QMKA 4K8MA 3KP9A 1TK5B 3VK9A 1QUWA 3F4TA 4FYBA 5BRTA 3GUSA 5IQYA 3FZ9A 4MPGA 1KEBA 3GH9A 3P90A 5GAPD 1O81A 3KM6A 4JEDA 3EC3A 3MNGA 2WW2A 1THXA 3FW2A 4K7OA 1W89A 1OC3A 4P3YB 3ZTLA 5INYA 3Q6OA 3L9UA 1PN9A 4IN0A 1PX6A 3N5OA 6GSYA 3M9JA 3F4RA 2FHEA 2M72A 3FY7A 1R5PA 3VURA 3HZ8A 1FG4A 3IK7A 1UN2A 4GQFA 2DJKA 2L4QA 3A2WA 5A4WA 2IFQB 4TXVA 5EL8A 1X9SB 4OO5A 5J4YA 2O85A 4ILFA 4LA1A 1TXUA 3IHQA 4AF2A 3TRXA 3QR6A 1GTBA 1X5EA 4EL1A 4V2MA 5IMVA 5DBQA 3WD6A 2QSIA 3D5JA 2OE3A 4CY8A 1V58A 4RQXA 2OBIA 2B5XA 2C1YA 3KMOA 13GSA 4G19A 1QQ2A 5B8AA 4IKHA 1GSYA 3UEMA 1SK0A 1G7OA 4E8HA 3QFBC 3LYKA 4IS0A 3M0FA 1BG1A 2N5BA 5E4WA 5KOXA 4EO3A 2XPEA 3FZAA 3D6IA 1GTIA 1XW5A 1S3DA 4O7HA 1GNEA 1VRSD 1ZZYA 4DSSB 5F07A 3LYPA 4PNFA 3DIEA 6GSXA 4POBA 1Q98A 1TW9A 2RUEA 1F3AA 4CHSA 1B8XA 2B3SA 3TJGA 3CRTA 2EIOA 1GRXA 1ZMAA 1M2DA 4DSSA 1BQ7A 3H4KA 3QAVA 2GQLA 3KIJA 3CMIA 3TRQA 3D22A 3ERGA 2H72A 4TR3A 9GSSA 3LEFA 5D93A 2KUCA 2K8SA 2BTOT 2KP2A 4G0LA 5LNKe 2GT6A 2JSYA 2GSTA 1VF2A 3R3EA 1T8EB 1Z7RA 1N25A 4GWRA 1FHEA 4ZIJA 3DMLA 2NTOA 2R2JA 3IOSA 4MNNA 1TU7A 2CZ2A 4NV2A 2NBSA 5EPFA 5JWRB 1YVLA 1S3RA 3GL3A 4JE1A 3E9JB 2IMEA 2PWJA 5F0GA 1I9DA 5CNWA 3KTLA 3C8EA 2E0QA 1TOFA 2B7JA 4F82A 3IHGA 5HQPA 2MZCA 3E3EA 4K0GA 2R0PA 2NVLA 4HSCX 4MJBA 3EURA 2HE3A 1K3YA 2R3XA 4HJ2A 3I69A 2OE1A 3VWUA 5KN2A 2ON7A 3DXBA 2C80A 2IWTA 1NHYA 4AKXB 2JADA 4XTSA 2HI7A 3QMXA 1XCCA 4MJEA 2GDRA 1M2AA 5ABRA 3GURA 1EOGA 1YEPA 2BJXA 2YJ7A 5EY6A 3ZMKA 1NSWA 2XC2A 2WRTA 3G7IA 3HVNA 4K5RA 5J9BA 2B1LA 3EYTA 3IR4A 4MH2A 4EE0A 5DALA 4I6XA 3TRPA 2WVZA 3FK8A 2ON5A 3HXSA 3GH6A 3LQ7A 1ZL9A 3BBYA 4ZBDA 2I3YA 1THOA 4K9ZA 2PMTA 4KH7A 2HRNA 4TW5A 4WXTA 4IP1A 4MZBA 4MPFA 3I9V2 3US3A 1GSEA 5ECLB 5CRDA 1Z9HA 3KZQA 2O89A 4ACSA 5ECIB 4MK3A 4KUNA 2IMFA 3W8JA 1SJIA 4BWQA 1O7UA 3GKXA 1ML6A 4JR6A 5DVBA 4G01A 5HFGA 1WMJA 4NHWA 4ZXGA 4MMMA 2RIIA 4WKWA 1EGOA 1CQHA 4YKFA 5IOXA 3QFAC 3L78A 1M3IA 3L0HA 4KGIA 1GULA 3GSSA 4NXIA 3ME7A 2MYGA 1OC8A 4KSOA 6GSUA 4KNDA 3CTGA 3R2QA 4ULXA 5ECRB 4IJ3A 1Z7PA 4Q5RA 1OKTA 2AUVA 2UZ8A 2FY6A 1FOVA 4GSNA 1LBKA 1EOHA 4ECBA 1Z5YE 1OC9B 2QKEA 3LJRA 4AI6A 4L5OA 3VPTA 2X8HA 2DKIA 3CSJA 5A34B 2VIMA 2F3MA 4YQUA 1OC9A 4LLRA 2TRCP 1FW1A 1HYUA 4ZB9A 1OKDA 2DJJA 2WGRA 5HR0A 4GSTA 4GQCA 3PINA 4F0CA 1GH2A 5A34A 2DMMA 3QAWA 4GDFA 3NZNA 2A2RA 1SJZA 2JL4A 1SU9A 1EV9A 1QGVA 2RM6A 2HQTA 1GWCA 2ZCTA 2OBKA 2D2ZA 5DJLA 1V57A 3LWAA 2R4VA 1WOUA 3FZ5A 2A4VA 4XS4B 5J5NA 6GSVA 1ZGNA 4V2NA 1UA5A 5ECHB 4Q5NA 2QC7A 2P31A 2HFDA 1GUMA 2CVDA 1B9YC 5A5HB 3D21A 4TKYA 2WDUA 2AYTA 4E8EA 1C72A 2VL2A 2XBQA 4HUAA 3DWVA 5E59A 1G6YA 2K6VA 2GSSA 1GTAA 1PKZA 1ERTA 2HSNB 1XOBA 4YAVA 3TB2A 2F8FA 3V1WA 2LRCA 3TCOA 1CQGA 2LUSA 2VKZG 1DE1A 1ERVA 2O87A 4POKA 2OE0A 2AHEA 5C04A 3HY2A 3UIWA 1XPVA 4I97A 2HSNA 4YH2A 2M46A 5CREA 4G0IA 5IO0A 3KEBA 2H1LA 4K7IA 5COHA 1I1IP 4MP4A 1GNWA 5G2ZA 2DIZA 3VPQA 5ECOB 5BMUB 2AB6A 4L8EA 3L4NA 5KN3A 3UJ1A 3I6AA 3TKSC 3ZRDA 2VM1A 1T00A 1SL2B 3ED3A 1ERWA 3IDVA 3M3MA 4I8BA 2VOCA 2LSTA 5BMUA 2N5FA 2YWNA 2GZPA 14GSA 1GLQA 1SVMA 1TU8A 5ECNB 1GSUA 4DEJA 2A2PA 3L9VA 4LMVA 4KCEA 3Q19A 4EC0A 5IO2A 2HSHA 3F3QA 1PL2A 2O7KA 3J7Yb 1FVKA 2OA7A 1DBYA 1OVNA 1AC1A 1JFUA 3IPZA 3GMFA 2IL3A 2OACA 2C0DA 3DEXA 3ZVJD 2VLVA 1SL1B 1J9BA 4FH8A 2DIYA 3TKPA 5D73A 4PQ1A 3KJYA 2H01A 4ISDA 4NAXA 3F8UA 5CRHA 4XHMA 3WGXA 1NM3A 4FIWA 2FUG2 2MMNA 1XZOA 4ID0A 1O73A 2GSQA 3E0UA 1FB0A 1XW9A 4Z2UA 5J41A 2IPAA 4ML6A 2WJUA 3CTFA 3GV1A 4Z2TA 4NPBA 2P0GA 4TR1B 3LFLA 2XHFA 1K3LA 4W66A 4FXYP 4AJ7A 4EDZA 6GSSA 2HXKA 1GSSA 5FT3A 1R4WA 2ALBA 4AKHA 5A5KA 3ZYWA 4I5QA 4XRDA 1AAZA 4MLYA 1Z6MA 3KP8A 3TJFA 2P5QA 1BAYA 4N11A 1AW9A 3UMAA 3H8QA 3FR6A 3GKNA 5DQYA 2MBSA 3EVIA 1DUGA 3TOTA 1E6BA 2PERA 3KD0A 4HEA2 4RUVA 3LORA 1HNBA 3PH9A 3ERFA 1A8LA 1X5CA 2KHPA 1JZDA 3TKQA 2WVXB 3BOAA 2IFQA 2V2GA 1ERUA 1JHBA 5CAXA 1WIKA 4OD7A 1KTEA 1BJXA 3RHBA 2VM2A 2GTUA 3W8SA 4D73B 2VCVA 2WZ9A 3HJMA 2WVXA 3FYGA 2LJKA 2WW1A 1BYEA 1SD9A 3HCZA 4G9HA 1EWXA 1OE7A 2HRKB 2FCHA 1PN0A 5A1NB 4D73A 4IJIA 5HFKA 1SYXA 1ZYEA 4PTSA 2GQKA 3C7MA 1PA3A 2O3EA
chains in the Genus database with same CATH topology
2H6XA 3IAS2 4BVXB 1AUCA 1V98A 5A1NA 1VGLA 1XVQA 5F06A 10GSA 4HQSA 3ZFLA 3M9KA 4TR0A 5IMCA 3G9BA 4NWYA 3O3TA 3S9FA 2R6KA 3H93A 4Z2RA 3GX8A 3K8NA 3ZITA 2HT9A 2V1MA 1U87A 2VD1A 4LMWA 3P8WA 2GLRA 3IC8A 2FGXA 5D9VA 3UBKA 3CBUA 4AGSA 1DSBA 1F6MC 3P2AA 4MF7A 4OCEA 4PXOA 1K0CA 2JZSA 3AY8A 2NPBA 4ZL7A 2R37A 5J9CA 4IQ1A 3CXGA 3ZIVA 3QD9A 3MAKA 3KCMA 2VCTA 2KOKA 3VFIA 4MA9A 3U6VA 2MMZA 1A8YA 1AQWA 2WB9A 3CSHA 1YF0A 3HJPA 3BD2A 2PGTA 4TOPA 2UV8G 1MTCA 1SENA 5D9XA 17GSA 3RDWA 3DD3A 2JACA 3GFKA 2YCDA 4F0BA 1QXHA 3GSTA 1YDKA 5DAKB 5ECPB 4X0XA 4X4JA 3QPMA 2YANA 4ZBBA 2XPDA 4EIQA 3ZMLA 3DRNA 4O5RA 1UVZA 2VO4A 2REMA 3TOUA 5DAKA 2O8VB 1Y1UA 2L6CA 5G1LA 2HYXA 1TP9A 1XWAA 1B9XC 3FR3A 2CZ3A 2CT6A 3MIXA 4TR4A 1X9WB 3APQA 3HVXA 3QAGA 5C00A 1SK1A 1K0NA 2LNTA 1S3AA 2CA8A 1R26A 1EGRA 4GCIA 3HA9A 4IQAA 2H66A 4PQIA 2OJLA 2PBJA 1J08A 5ELAA 2PN8A 5ECQB 1XBSA 1B4PA 2X8GA 1JZWA 1XXUA 1J0FA 3RPPA 1NW2A 4XIHA 2OADA 3QOUA 2GGTA 3TGZA 1YZXA 1XWBA 3IBHA 5J3RA 1V2AA 1G6WA 5B8BA 3SWLA 1OAZA 1H75A 5EVOA 1PX7A 1GUKA 2EFDA 1AIUA 2V41A 3WYWA 1T7PB 5J40A 1PD21 4USSA 1IYIA 4AKGA 2LQOA 1QMVA 4AKIA 2PU9C 3M1GA 1ON4A 3EU3A 2C4JA 3GTUB 2VLUA 1DE2A 4KAEA 1HNAA 1F9MA 5DJMA 1ST9A 4XCSA 4LL4B 3HMJG 2P5RA 3IC4A 1PMTA 5IM9A 1PSQA 2V6KA 1PL1A 4ZILA 5H5SA 2WULA 5CRGA 3GTUA 2EIRA 2FWFA 5ENUA 5D96A 3EWLA 2HSMB 4H86A 5IPGA 4MABA 4TVEA 5DCGA 2V6OA 2OT3A 4AJ6A 2DLXA 2FWEA 1BF5A 1XWKA 4RI6A 1TRSA 1UC7A 5IMZA 2H0IA 3F9UA 5HR2A 4G2EA 2HNLA 1T1VA 3Q74A 2FWHA 2FWGA 3DGQA 2LJAA 4PGTA 1M9BA 3C1RA 1ILOA 4WEYA 4POMA 5B7CA 2LQQA 22GSA 2C3QA 4CY6A 3LGCA 3IE3A 3C71A 2KLXA 2YNXA 4IHUA 5JCUA 2C0FA 3ERWA 2RUFA 1BX9A 3FKFA 2H70A 2X8CA 1WPIA 2MMOA 1KNGA 5H5QA 1TXXA 2WFCA 3MSZA 4OCFA 1TI3A 1ZYQB 3GIXA 1NHOA 2JZTA 5JWOB 4EDYA 1ACVA 3WT2A 4WR4A 3VI7A 5ECMB 2YZHA 1G0TA 2C0GA 1YQ1A 4KDUA 2RLIA 4L0UA 4FYUA 5F05A 2PVOC 3FR9A 1A2JA 3A2XA 4XS4A 3HVVA 4Q5FA 4FYCA 3VWXA 3UL3A 1WWJA 2B5EA 4YKGA 3VI5A 2CX4A 3N9JA 4BL7B 1TJDA 2V32A 3MWHA 2H30A 2YV7A 5A5HA 2QGVA 5HR1A 4HQZA 1SVLA 2K18A 1WJKA 1GUHA 2A4HA 2FA4A 3TDGA 1K0MA 2L4CA 3RAZA 5GAND 5GZZB 3QDNA 4N10A 4BL7A 4WBRD 4OFNA 4OO4A 2ES7A 1USBA 4KW6A 20GSA 2VCQA 1TKDB 1O8WA 4GF0A 2B6MA 1F37A 4HU9A 3IRAA 4PUAA 2OKAA 1MD3A 4K7NA 2VD0A 1A2MA 2GQMA 4OFMA 4PNGA 3GRXA 5ECSA 3KH9A 1R7HA 4ZL9A 4V1Ag 2YP6A 4HJMA 4YQVA 1PGTA 1EV4A 2H1GA 1O6JA 2HRFA 4WF5A 1TDIA 2HZFA 3EMXA 2FNOA 1QK8A 4TXOB 2AV4A 4IBPA 3TJJA 3VWWA 3WT1A 2CVKA 3HKRA 5F8BA 2YN1A 5AISA 2LS5A 3U5RE 1SKSB 2LTKA 1ZCPA 4NV5A 1U3AA 2LRNA 1AQXA 2H1BA 3NOFA 3TUEA 4KF9A 4KX4A 3LXZA 1A2LA 3IA1A 4PUFC 3GYKA 3UVTA 5H5RA 4QL7A 1Z6NA 2HLSA 1K0BA 5L71A 4K6XA 2MMAA 4RI7A 1RQMA 5ID2B 4MJCA 2L5LA 1B4QA 3D4TA 2B5YA 5IMFA 4JZQA 1V40A 3FMWA 5KOWA 1SD8A 3IXRA 3J7Yk 5B6MA 2LKUA 4N3ZA 4EUYA 5ID2A 1GSFA 4TN8A 3TKSE 2H19A 2X49A 4IGJA 1EP8A 4QQ7A 2GVPA 3BCKA 1TK0B 1PKWA 1WRYA 1XWCA 5A4UA 3KMNA 3PR8A 2B7KA 1XOAA 1SJ6A 4EF0A 5J4VA 3GKMA 4KDXA 2H0HA 1K3OA 2YWMA 1FAAA 3HHVA 3VLNA 19GSA 3F6FA 3F6DA 2TIRA 2ZUPA 4J2FA 2QA2A 1SYRA 2IJYA 4TR1A 2YWIA 1A0RP 4K2DA 2JZRA 2DC5A 2VL9A 1YKAA 2C3TA 3A5IA 4X43A 3MYDA 11GSA 2H71A 3SBCA 4BVYB 5GSTA 1ZYPA 3HDCA 4GTUA 3IK9A 3WGDA 2YOIA 4XS6A 3W6GA 5IOWA 4BVYA 2Z9SA 1A23A 1MEKA 1EEJA 1YKCA 4O32A 4KE3A 3ZREA 2H0GA 5FWGA 1JLWA 4I2UA 1X9MB 3TKSA 1YY7A 4HDEA 1VF1A 1KBNA 3HJOA 1TRUA 4POLA 2F8AA 1W4VA 2H1DA 1SKRB 4MDCA 2DBCA 1LU4A 3EINA 3EPTA 4WETA 1JZOA 3EMPA 4K2XA 1XW6A 4JBBA 1T3BA 5IPHA 2EFHA 2HRKA 3TJBA 2L59A 2JSZA 1YEXA 2E2GA 4Z7XA 4LL1B 1GSQA 3HD5A 3GA4A 4BA7A 4MF5A 2FA8A 4OFTA 3D4MA 1GSDA 1HNCA 2E7PA 3ZL5A 4YAPA 4BVXA 5J4UA 3FEUA 6GSTA 3FRCA 4HI7A 4O5UA 3VWVA 4F03A 4QL9A 1K0DA 1FVJA 1M0UA 2K8VA 4PURA 2VLTA 3F0IA 1RW1A 3OR5A 3DYRA 3BCIA 3I43A 3TU3B 3C73A 4FQUA 3Q18A 3DVXA 4DVCA 1U3IA 3UAPA 5KN0A 3NIVA 2CV4A 4KA0A 1O85A 5G31A 4KB3A 2IN3A 3F63A 4EIPA 1EZKA 2DMLA 1Q4JA 2PUKC 2NDOA 1ZOFA 4ZB6A 2R5GA 5AIXA 3ZZXA 1FO5A 1YJ6A 1EP7A 2K9FA 2B1KA 3A5WA 4Q5QA 5AN1A 1Y25A 2H76A 1IYHA 2EIQA 3GHAA 2DSAA 3O6TA 4IVFA 3EU4A 4NHZA 3APSA 2GZZA 2H75A 1TRVA 4HS1A 5JWQB 3UOMA 2H6YA 4K5SA 2CAQA 2ZNMA 3C1SA 1TK8B 4OWYA 2VCXA 7GSSA 1WP0A 4MJAA 2C8UA 3GX0A 4FO5A 4N0ZA 4MF6A 5B6NA 12GSA 5KN1A 4DSQA 4O92A 1M7TA 2HZEB 4E68A 2C0EA 4L0WA 3D0ZA 4PX1A 4MZWA 4EKZA 1GLPA 1H4OA 2F51A 4N30A 2F9SA 2HSYA 4G0KA 2FD3A 3RHCA 2HZEA 2H73A 5JCGA 5G30A 1GP1A 3KXOA 4KSMA 1G7EA 1AXDA 4N0VA 1EEMA 4CDOA 3ZFBA 4J57E 1ABAA 2X64A 1TTZA 2GZYA 5HR3A 5DALB 6GSWA 5LD0A 3GNJA 3DKSA 1M9AA 1OYJA 1TI1A 3O76A 2G0FA 3WGEA 4CW9A 5G5FA 3ISOA 1XIYA 1A0FA 3GL5A 2CVBA 3ZLPA 1WE0A 5G1KA 2DJ2A 4ECIA 4HU7A 3LG6A 1TRWA 3F4SA 2CAIA 3KGKA 5IIZA 3GKKA 2AAWA 4TRXA 2R0GA 4NMUA 1U6TA 3A3TA 2DJ1A 1M99A 2VL2C 2YJHA 3RBTA 1XVWA 5CRWA 1SK2A 1Y6EA 2LNSA 4OMVA 5ELGA 5CYYA 4XRAA 3ZVJA 1MD4A 5DDLA 2I4AA 2LJRA 3ZIJA 2EFCA 2VCWA 2DKHA 4F2IA 1GTUA 3UARA 4EVMA 1OE8A 4JR4A 4V1Ap 2A2SA 1HD2A 1SVOA 1AQVA 4X1UA 3A2VA 3CRUA 3F3RA 1RK4A 4GLTA 5GSSA 2QA1A 3PGTA 1O8XA 3ME8A 4GSSA 1K0AA 4YQMA 2HSMA 4ZB7A 5D9TA 1N2AA 1A24A 2H8LA 2VL3A 2FLSA 1MDKA 3IV4A 2GT5A 4ICYA 2WS2A 2AJQB 1E2YA 2I9HA 2L57A 1BEDA 4WBJA 1VF4A 5J47A 1SKWB 2DJ0A 4DSRA 3H79A 3M8NA 4RQRA 4IP6A 4JU5A 4BPYA 2VCZA 4MZCA 2DJ3A 5HFIA 3MDKA 3FZ4A 3DVWA 2L6DA 4ZB8A 3P7XA 3EE2A 2X4AA 4L5LA 5LCZA 2GS3A 16GSA 5JCWA 2EFEA 4EXJA 2N5AA 4WF4A 1ZYNA 1MDIA 4AJ8A 1F3BA 4IELA 4GRFA 2RM5A 4WR5A 5AGYA 3LW9A 5FHIA 1YF1A 4MH3A 2H1AA 1K0OA 3KH7A 4F9ZA 3CWGA 2L5OA 4ZBAA 5KEJA 2TRXA 3KTBA 2YZUA 2H6ZA 4K1FA 3UBLA 3LSZA 1SL0B 1XWGA 3TKRA 2BMXA 2E2MA 4V2LA 4I2TA 2HRAA 5IMDA 2O5VA 5CO3A 1PRXA 1XFLA 4ECJA 2IMDA 1HQOA 4A5PA 4IW9A 4O5QA 1URMA 4HOJA 5DCHA 3UVHA 2PPTA 2IIYA 2VAFA 1I5GA 3HYPA 2PVQA 1JZRA 3G7JA 3PPUA 2LEGA 1FB6A 5AIVA 1U88A 2LV3A 1V9WA 2YPMA 2VUPA 1N8JA 1M2BA 2M80A 2I1UA 1Z3EA 2J9HA 2C3NA 3CYNA 3BJ5A 4ECCA 1F2EA 1X5DA 3GN3A 3JCML 2X99A 1QFNA 3IAM2 4HZ2A 1BG5A 4K0NA 5G5EA 5A4VA 1LJRA 5D8IA 2XBIA 4G10A 2G2QA 4ML1A 3CSIA 4KDYA 3G7YA 3APOA 1B48A 3QCPA 2WCIA 8GSSA 2CQ9A 2I81A 5D9WA 3FHKA 2MBTA 3RPNA 3LXTA 4JRRA 1S3CA 4GXZA 4KCAA 4J56E 2YV9A 2J23A 4TXOA 2JU5A 4XS1A 4BWSA 4HZ4A 1JLVA 2LRTA 1GL8A 3TJKA 2YWOA 1FOHA 2GSRA 4PQHA 5DQSA 3H1NA 5IMAA 2H74A 3HZ4A 2EC4A 2R0CA 1PQNA 1VF3A 1T4ZA 3HVSA 2CX3A 3L9SA 5CP1A 5ECKB 1R5AA 2IMIA 2IMKA 2KP1A 18GSA 4ZL8A 1MDJA 1T4YA 4MCUA 1X0RA 4QMKA 4K8MA 3KP9A 1TK5B 3VK9A 1QUWA 3F4TA 4FYBA 5BRTA 3GUSA 5IQYA 3FZ9A 4MPGA 1KEBA 3GH9A 3P90A 5GAPD 1O81A 3KM6A 4JEDA 3EC3A 3MNGA 1THXA 3FW2A 4K7OA 1W89A 1OC3A 4P3YB 3ZTLA 5INYA 3Q6OA 3L9UA 1PN9A 4IN0A 1PX6A 3N5OA 6GSYA 3M9JA 3F4RA 2FHEA 2M72A 3FY7A 1R5PA 3VURA 3HZ8A 1FG4A 3IK7A 1UN2A 4GQFA 2DJKA 2L4QA 3A2WA 5A4WA 2IFQB 4TXVA 5EL8A 1X9SB 4OO5A 5J4YA 2O85A 4ILFA 4LA1A 1TXUA 3IHQA 4AF2A 3TRXA 3QR6A 1GTBA 1X5EA 4EL1A 4V2MA 5IMVA 5DBQA 3WD6A 2QSIA 3D5JA 2OE3A 4CY8A 1V58A 4RQXA 2OBIA 2B5XA 2C1YA 3KMOA 13GSA 4G19A 1QQ2A 5B8AA 4IKHA 1GSYA 3UEMA 1SK0A 1G7OA 4E8HA 3QFBC 3LYKA 4IS0A 3M0FA 1BG1A 2N5BA 5E4WA 5KOXA 4EO3A 2XPEA 3FZAA 3D6IA 1GTIA 1XW5A 1S3DA 4O7HA 1GNEA 1VRSD 1ZZYA 4DSSB 5F07A 3LYPA 4PNFA 3DIEA 6GSXA 4POBA 1Q98A 1TW9A 2RUEA 1F3AA 4CHSA 1B8XA 2B3SA 3TJGA 3CRTA 2EIOA 1GRXA 1ZMAA 1M2DA 4DSSA 1BQ7A 3H4KA 3QAVA 2GQLA 3KIJA 3CMIA 3TRQA 3D22A 3ERGA 2H72A 4TR3A 9GSSA 3LEFA 5D93A 2KUCA 2K8SA 2BTOT 2KP2A 4G0LA 5LNKe 2GT6A 2JSYA 2GSTA 1VF2A 3R3EA 1T8EB 1Z7RA 1N25A 4GWRA 1FHEA 4ZIJA 3DMLA 2NTOA 2R2JA 3IOSA 4MNNA 1TU7A 2CZ2A 4NV2A 2NBSA 5EPFA 5JWRB 1YVLA 3GL3A 4JE1A 3E9JB 2IMEA 2PWJA 5F0GA 1I9DA 5CNWA 3KTLA 3C8EA 2E0QA 1TOFA 2B7JA 4F82A 3IHGA 5HQPA 2MZCA 3E3EA 4K0GA 2R0PA 2NVLA 4MJBA 3EURA 2HE3A 1K3YA 2R3XA 4HJ2A 3I69A 2OE1A 3VWUA 5KN2A 2ON7A 3DXBA 2C80A 2IWTA 1NHYA 4AKXB 2JADA 4XTSA 2HI7A 3QMXA 1XCCA 4MJEA 2GDRA 1M2AA 5ABRA 3GURA 1EOGA 1YEPA 2BJXA 2YJ7A 5EY6A 3ZMKA 1NSWA 2XC2A 2WRTA 3G7IA 4K5RA 5J9BA 2B1LA 3EYTA 3IR4A 4MH2A 4EE0A 5DALA 4I6XA 3TRPA 3FK8A 2ON5A 3HXSA 3GH6A 3LQ7A 1ZL9A 3BBYA 4ZBDA 2I3YA 1THOA 4K9ZA 2PMTA 4KH7A 2HRNA 4TW5A 4WXTA 4IP1A 4MZBA 4MPFA 3I9V2 3US3A 1GSEA 5ECLB 5CRDA 1Z9HA 3KZQA 2O89A 4ACSA 5ECIB 4MK3A 4KUNA 2IMFA 3W8JA 1SJIA 4BWQA 1O7UA 3GKXA 1ML6A 4JR6A 5DVBA 4G01A 5HFGA 1WMJA 4NHWA 4ZXGA 4MMMA 2RIIA 4WKWA 1EGOA 1CQHA 4YKFA 5IOXA 3QFAC 3L78A 3L0HA 4KGIA 1GULA 3GSSA 4NXIA 3ME7A 2MYGA 1OC8A 4KSOA 6GSUA 4KNDA 3CTGA 3R2QA 4ULXA 5ECRB 4IJ3A 1Z7PA 4Q5RA 1OKTA 2AUVA 2UZ8A 2FY6A 1FOVA 4GSNA 1LBKA 1EOHA 4ECBA 1Z5YE 1OC9B 2QKEA 3LJRA 4AI6A 4L5OA 3VPTA 2X8HA 2DKIA 3CSJA 5A34B 2VIMA 2F3MA 4YQUA 1OC9A 4LLRA 2TRCP 1FW1A 1HYUA 4ZB9A 1OKDA 2DJJA 2WGRA 5HR0A 4GSTA 4GQCA 3PINA 4F0CA 1GH2A 5A34A 2DMMA 3QAWA 4GDFA 3NZNA 2A2RA 1SJZA 2JL4A 1SU9A 1EV9A 1QGVA 2RM6A 2HQTA 1GWCA 2ZCTA 2OBKA 2D2ZA 5DJLA 1V57A 3LWAA 2R4VA 1WOUA 3FZ5A 2A4VA 4XS4B 5J5NA 6GSVA 1ZGNA 4V2NA 1UA5A 5ECHB 4Q5NA 2QC7A 2P31A 2HFDA 1GUMA 2CVDA 1B9YC 5A5HB 3D21A 4TKYA 2WDUA 2AYTA 4E8EA 1C72A 2VL2A 2XBQA 4HUAA 3DWVA 5E59A 1G6YA 2K6VA 2GSSA 1GTAA 1PKZA 1ERTA 2HSNB 1XOBA 4YAVA 3TB2A 2F8FA 3V1WA 2LRCA 3TCOA 1CQGA 2LUSA 2VKZG 1DE1A 1ERVA 2O87A 4POKA 2OE0A 2AHEA 5C04A 3HY2A 3UIWA 1XPVA 4I97A 2HSNA 4YH2A 2M46A 5CREA 4G0IA 5IO0A 3KEBA 2H1LA 4K7IA 5COHA 4MP4A 1GNWA 5G2ZA 2DIZA 3VPQA 5ECOB 5BMUB 2AB6A 4L8EA 3L4NA 5KN3A 3UJ1A 3I6AA 3TKSC 3ZRDA 2VM1A 1T00A 1SL2B 3ED3A 1ERWA 3IDVA 3M3MA 4I8BA 2VOCA 2LSTA 5BMUA 2N5FA 2YWNA 2GZPA 14GSA 1GLQA 1SVMA 1TU8A 5ECNB 1GSUA 4DEJA 2A2PA 3L9VA 4LMVA 4KCEA 3Q19A 4EC0A 5IO2A 2HSHA 3F3QA 1PL2A 2O7KA 3J7Yb 1FVKA 2OA7A 1DBYA 1OVNA 1AC1A 1JFUA 3IPZA 3GMFA 2IL3A 2OACA 2C0DA 3DEXA 3ZVJD 2VLVA 1SL1B 1J9BA 4FH8A 2DIYA 3TKPA 5D73A 4PQ1A 3KJYA 2H01A 4ISDA 4NAXA 3F8UA 5CRHA 4XHMA 3WGXA 1NM3A 4FIWA 2FUG2 2MMNA 1XZOA 4ID0A 1O73A 2GSQA 3E0UA 1FB0A 1XW9A 4Z2UA 5J41A 2IPAA 4ML6A 2WJUA 3CTFA 3GV1A 4Z2TA 4NPBA 2P0GA 4TR1B 3LFLA 2XHFA 1K3LA 4W66A 4AJ7A 4EDZA 6GSSA 2HXKA 1GSSA 5FT3A 1R4WA 2ALBA 4AKHA 5A5KA 3ZYWA 4I5QA 4XRDA 1AAZA 4MLYA 1Z6MA 3KP8A 3TJFA 2P5QA 1BAYA 4N11A 1AW9A 3UMAA 3H8QA 3FR6A 3GKNA 5DQYA 2MBSA 3EVIA 1DUGA 3TOTA 1E6BA 2PERA 3KD0A 4HEA2 4RUVA 3LORA 1HNBA 3PH9A 3ERFA 1A8LA 1X5CA 2KHPA 1JZDA 3TKQA 3BOAA 2IFQA 2V2GA 1ERUA 1JHBA 5CAXA 1WIKA 4OD7A 1KTEA 1BJXA 3RHBA 2VM2A 2GTUA 3W8SA 4D73B 2VCVA 2WZ9A 3HJMA 3FYGA 2LJKA 1BYEA 1SD9A 3HCZA 4G9HA 1EWXA 1OE7A 2HRKB 2FCHA 1PN0A 5A1NB 4D73A 4IJIA 5HFKA 1SYXA 1ZYEA 4PTSA 2GQKA 3C7MA 1PA3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6X A;  3IAS 2;  4BVX B;  1AUC A;  1V98 A;  1VGL A;  1XVQ A;  5F06 A;  10GS A;  4HQS A;  3ZFL A;  3M9K A;  4TR0 A;  5IMC A;  3G9B A;  4NWY A;  3O3T A;  3S9F A;  2R6K A;  3H93 A;  3GX8 A;  3K8N A;  3ZIT A;  2HT9 A;  2V1M A;  1U87 A;  2VD1 A;  4LMW A;  3P8W A;  2GLR A;  3IC8 A;  2FGX A;  5D9V A;  3UBK A;  3CBU A;  4AGS A;  1DSB A;  1F6M C;  3P2A A;  4MF7 A;  4OCE A;  4PXO A;  1K0C A;  2JZS A;  3AY8 A;  2NPB A;  4ZL7 A;  2R37 A;  5J9C A;  4IQ1 A;  3CXG A;  3ZIV A;  3QD9 A;  3MAK A;  3KCM A;  2VCT A;  2KOK A;  3VFI A;  4MA9 A;  3U6V A;  2MMZ A;  1A8Y A;  1AQW A;  2WB9 A;  3CSH A;  1YF0 A;  3HJP A;  3BD2 A;  2PGT A;  4TOP A;  1MTC A;  1SEN A;  5D9X A;  17GS A;  3RDW A;  3DD3 A;  2JAC A;  3GFK A;  2YCD A;  4F0B A;  1QXH A;  3GST A;  1YDK A;  5DAK B;  5ECP B;  4X0X A;  3QPM A;  2YAN A;  4ZBB A;  2XPD A;  3ZML A;  3DRN A;  4O5R A;  1UVZ A;  2VO4 A;  2REM A;  3TOU A;  5DAK A;  2O8V B;  2L6C A;  5G1L A;  2HYX A;  1TP9 A;  1XWA A;  1B9X C;  3FR3 A;  2CZ3 A;  2CT6 A;  4TR4 A;  1X9W B;  3APQ A;  3HVX A;  3QAG A;  5C00 A;  1SK1 A;  1K0N A;  2LNT A;  1S3A A;  2CA8 A;  1R26 A;  1EGR A;  4GCI A;  3HA9 A;  4IQA A;  2H66 A;  4PQI A;  2OJL A;  2PBJ A;  1J08 A;  5ELA A;  2PN8 A;  5ECQ B;  1XBS A;  1B4P A;  2X8G A;  1JZW A;  1XXU A;  1J0F A;  3RPP A;  1NW2 A;  4XIH A;  2OAD A;  3QOU A;  2GGT A;  3TGZ A;  1YZX A;  1XWB A;  3IBH A;  5J3R A;  1V2A A;  1G6W A;  5B8B A;  3SWL A;  1OAZ A;  1H75 A;  5EVO A;  1PX7 A;  1GUK A;  1AIU A;  2V41 A;  3WYW A;  1T7P B;  1PD2 1;  4USS A;  1IYI A;  2LQO A;  1QMV A;  2PU9 C;  3M1G A;  1ON4 A;  3EU3 A;  2C4J A;  3GTU B;  2VLU A;  1DE2 A;  4KAE A;  1HNA A;  1F9M A;  5DJM A;  1ST9 A;  4XCS A;  4LL4 B;  2P5R A;  3IC4 A;  1PMT A;  5IM9 A;  1PSQ A;  2V6K A;  1PL1 A;  4ZIL A;  5H5S A;  2WUL A;  5CRG A;  3GTU A;  2EIR A;  2FWF A;  5ENU A;  5D96 A;  3EWL A;  2HSM B;  4H86 A;  5IPG A;  4MAB A;  4TVE A;  5DCG A;  2V6O A;  4AJ6 A;  2DLX A;  2FWE A;  1XWK A;  4RI6 A;  1TRS A;  1UC7 A;  5IMZ A;  2H0I A;  3F9U A;  5HR2 A;  4G2E A;  2HNL A;  1T1V A;  3Q74 A;  2FWH A;  2FWG A;  3DGQ A;  2LJA A;  4PGT A;  1M9B A;  3C1R A;  1ILO A;  4WEY A;  4POM A;  5B7C A;  2LQQ A;  22GS A;  2C3Q A;  3LGC A;  3IE3 A;  3C71 A;  2KLX A;  2YNX A;  4IHU A;  5JCU A;  2C0F A;  3ERW A;  2RUF A;  1BX9 A;  3FKF A;  2H70 A;  2X8C A;  1WPI A;  2MMO A;  1KNG A;  5H5Q A;  1TXX A;  2WFC A;  3MSZ A;  4OCF A;  1TI3 A;  1ZYQ B;  3GIX A;  1NHO A;  2JZT A;  5JWO B;  4EDY A;  1ACV A;  3WT2 A;  4WR4 A;  3VI7 A;  5ECM B;  2YZH A;  1G0T A;  2C0G A;  1YQ1 A;  4KDU A;  2RLI A;  4L0U A;  4FYU A;  5F05 A;  2PVO C;  3FR9 A;  1A2J A;  3A2X A;  4XS4 A;  3HVV A;  4Q5F A;  4FYC A;  3VWX A;  3UL3 A;  1WWJ A;  2B5E A;  3VI5 A;  2CX4 A;  3N9J A;  4BL7 B;  1TJD A;  2V32 A;  3MWH A;  2H30 A;  2YV7 A;  2QGV A;  5HR1 A;  4HQZ A;  2K18 A;  1WJK A;  1GUH A;  2FA4 A;  3TDG A;  1K0M A;  2L4C A;  3RAZ A;  5GAN D;  5GZZ B;  3QDN A;  4N10 A;  4BL7 A;  4WBR D;  4OFN A;  4OO4 A;  2ES7 A;  1USB A;  4KW6 A;  20GS A;  2VCQ A;  1TKD B;  1O8W A;  4GF0 A;  2B6M A;  1F37 A;  4HU9 A;  3IRA A;  4PUA A;  2OKA A;  1MD3 A;  4K7N A;  2VD0 A;  1A2M A;  2GQM A;  4OFM A;  4PNG A;  3GRX A;  5ECS A;  3KH9 A;  1R7H A;  4ZL9 A;  4V1A g;  2YP6 A;  4HJM A;  4YQV A;  1PGT A;  1EV4 A;  2H1G A;  1O6J A;  2HRF A;  4WF5 A;  1TDI A;  2HZF A;  3EMX A;  2FNO A;  1QK8 A;  4TXO B;  2AV4 A;  4IBP A;  3TJJ A;  3VWW A;  3WT1 A;  2CVK A;  3HKR A;  5F8B A;  2YN1 A;  5AIS A;  2LS5 A;  3U5R E;  1SKS B;  2LTK A;  1ZCP A;  4NV5 A;  1U3A A;  2LRN A;  1AQX A;  2H1B A;  3NOF A;  3TUE A;  4KF9 A;  4KX4 A;  3LXZ A;  1A2L A;  3IA1 A;  4PUF C;  3GYK A;  3UVT A;  5H5R A;  4QL7 A;  1Z6N A;  2HLS A;  1K0B A;  5L71 A;  4K6X A;  2MMA A;  4RI7 A;  1RQM A;  5ID2 B;  4MJC A;  2L5L A;  1B4Q A;  3D4T A;  2B5Y A;  5IMF A;  4JZQ A;  1V40 A;  1SD8 A;  3IXR A;  3J7Y k;  5B6M A;  2LKU A;  4EUY A;  5ID2 A;  1GSF A;  4TN8 A;  3TKS E;  2H19 A;  4IGJ A;  1EP8 A;  4QQ7 A;  2GVP A;  3BCK A;  1TK0 B;  1PKW A;  1WRY A;  1XWC A;  5A4U A;  3KMN A;  3PR8 A;  2B7K A;  1XOA A;  1SJ6 A;  4EF0 A;  3GKM A;  4KDX A;  2H0H A;  1K3O A;  2YWM A;  1FAA A;  3HHV A;  3VLN A;  19GS A;  3F6F A;  3F6D A;  2TIR A;  2ZUP A;  4J2F A;  1SYR A;  2IJY A;  4TR1 A;  2YWI A;  1A0R P;  4K2D A;  2JZR A;  2DC5 A;  2VL9 A;  1YKA A;  2C3T A;  4X43 A;  11GS A;  2H71 A;  3SBC A;  4BVY B;  5GST A;  3HDC A;  4GTU A;  3IK9 A;  3WGD A;  2YOI A;  4XS6 A;  3W6G A;  5IOW A;  4BVY A;  2Z9S A;  1A23 A;  1MEK A;  1EEJ A;  1YKC A;  4O32 A;  4KE3 A;  3ZRE A;  2H0G A;  5FWG A;  1JLW A;  4I2U A;  1X9M B;  3TKS A;  1YY7 A;  4HDE A;  1VF1 A;  1KBN A;  3HJO A;  1TRU A;  4POL A;  2F8A A;  1W4V A;  2H1D A;  1SKR B;  4MDC A;  2DBC A;  1LU4 A;  3EIN A;  4WET A;  1JZO A;  3EMP A;  1XW6 A;  4JBB A;  1T3B A;  5IPH A;  2HRK A;  3TJB A;  2L59 A;  2JSZ A;  1YEX A;  2E2G A;  4Z7X A;  4LL1 B;  1GSQ A;  3HD5 A;  3GA4 A;  4BA7 A;  4MF5 A;  2FA8 A;  4OFT A;  3D4M A;  1GSD A;  1HNC A;  2E7P A;  3ZL5 A;  4YAP A;  4BVX A;  5J4U A;  3FEU A;  6GST A;  3FRC A;  4HI7 A;  3VWV A;  4F03 A;  4QL9 A;  1K0D A;  1FVJ A;  1M0U A;  2K8V A;  4PUR A;  2VLT A;  3F0I A;  1RW1 A;  3OR5 A;  3DYR A;  3BCI A;  3I43 A;  3C73 A;  4FQU A;  3Q18 A;  3DVX A;  4DVC A;  1U3I A;  3UAP A;  5KN0 A;  3NIV A;  2CV4 A;  4KA0 A;  1O85 A;  5G31 A;  4KB3 A;  2IN3 A;  3F63 A;  1EZK A;  2DML A;  1Q4J A;  2PUK C;  2NDO A;  1ZOF A;  4ZB6 A;  2R5G A;  5AIX A;  3ZZX A;  1FO5 A;  1YJ6 A;  1EP7 A;  2K9F A;  2B1K A;  3A5W A;  4Q5Q A;  5AN1 A;  1Y25 A;  2H76 A;  1IYH A;  2EIQ A;  3GHA A;  2DSA A;  3O6T A;  4IVF A;  3EU4 A;  4NHZ A;  3APS A;  2GZZ A;  2H75 A;  1TRV A;  4HS1 A;  5JWQ B;  3UOM A;  2H6Y A;  2CAQ A;  2ZNM A;  3C1S A;  1TK8 B;  4OWY A;  2VCX A;  7GSS A;  1WP0 A;  4MJA A;  2C8U A;  3GX0 A;  4FO5 A;  4N0Z A;  4MF6 A;  5B6N A;  12GS A;  5KN1 A;  4DSQ A;  4O92 A;  1M7T A;  2HZE B;  2C0E A;  4L0W A;  3D0Z A;  4PX1 A;  4MZW A;  4EKZ A;  1GLP A;  1H4O A;  2F51 A;  4N30 A;  2F9S A;  2HSY A;  4G0K A;  2FD3 A;  3RHC A;  2HZE A;  2H73 A;  5JCG A;  5G30 A;  1GP1 A;  3KXO A;  4KSM A;  1G7E A;  1AXD A;  4N0V A;  1EEM A;  4CDO A;  3ZFB A;  4J57 E;  1ABA A;  2X64 A;  1TTZ A;  2GZY A;  5HR3 A;  5DAL B;  6GSW A;  5LD0 A;  3GNJ A;  3DKS A;  1M9A A;  1OYJ A;  1TI1 A;  3O76 A;  2G0F A;  3WGE A;  4CW9 A;  5G5F A;  3ISO A;  1XIY A;  1A0F A;  3GL5 A;  2CVB A;  3ZLP A;  1WE0 A;  5G1K A;  2DJ2 A;  4ECI A;  4HU7 A;  3LG6 A;  1TRW A;  3F4S A;  2CAI A;  3KGK A;  5IIZ A;  3GKK A;  2AAW A;  4TRX A;  4NMU A;  1U6T A;  3A3T A;  2DJ1 A;  1M99 A;  2VL2 C;  2YJH A;  3RBT A;  1XVW A;  5CRW A;  1SK2 A;  1Y6E A;  2LNS A;  4OMV A;  5ELG A;  5CYY A;  4XRA A;  3ZVJ A;  1MD4 A;  5DDL A;  2I4A A;  2LJR A;  3ZIJ A;  2VCW A;  4F2I A;  1GTU A;  3UAR A;  4EVM A;  1OE8 A;  4JR4 A;  4V1A p;  2A2S A;  1HD2 A;  1AQV A;  4X1U A;  3A2V A;  3CRU A;  3F3R A;  1RK4 A;  4GLT A;  5GSS A;  3PGT A;  1O8X A;  3ME8 A;  4GSS A;  1K0A A;  4YQM A;  2HSM A;  5D9T A;  1N2A A;  1A24 A;  2H8L A;  2VL3 A;  2FLS A;  1MDK A;  3IV4 A;  2GT5 A;  2WS2 A;  2AJQ B;  1E2Y A;  2I9H A;  2L57 A;  1BED A;  4WBJ A;  1VF4 A;  1SKW B;  2DJ0 A;  4DSR A;  3H79 A;  3M8N A;  4RQR A;  4IP6 A;  4JU5 A;  4BPY A;  2VCZ A;  4MZC A;  2DJ3 A;  5HFI A;  3MDK A;  3FZ4 A;  3DVW A;  2L6D A;  4ZB8 A;  3P7X A;  3EE2 A;  4L5L A;  5LCZ A;  2GS3 A;  16GS A;  5JCW A;  4EXJ A;  2N5A A;  4WF4 A;  1MDI A;  4AJ8 A;  1F3B A;  4IEL A;  4GRF A;  2RM5 A;  4WR5 A;  5AGY A;  5FHI A;  1YF1 A;  4MH3 A;  2H1A A;  1K0O A;  3KH7 A;  4F9Z A;  2L5O A;  4ZBA A;  5KEJ A;  2TRX A;  3KTB A;  2YZU A;  2H6Z A;  4K1F A;  3UBL A;  3LSZ A;  1SL0 B;  1XWG A;  3TKR A;  2BMX A;  2E2M A;  4V2L A;  4I2T A;  2HRA A;  5IMD A;  5CO3 A;  1PRX A;  1XFL A;  4ECJ A;  2IMD A;  1HQO A;  4IW9 A;  1URM A;  4HOJ A;  5DCH A;  3UVH A;  2PPT A;  2IIY A;  2VAF A;  1I5G A;  3HYP A;  2PVQ A;  1JZR A;  3G7J A;  3PPU A;  2LEG A;  1FB6 A;  5AIV A;  1U88 A;  2LV3 A;  1V9W A;  2YPM A;  2VUP A;  1N8J A;  1M2B A;  2M80 A;  2I1U A;  1Z3E A;  2J9H A;  2C3N A;  3CYN A;  3BJ5 A;  4ECC A;  1F2E A;  1X5D A;  3GN3 A;  3JCM L;  2X99 A;  1QFN A;  3IAM 2;  4HZ2 A;  1BG5 A;  4K0N A;  5G5E A;  5A4V A;  1LJR A;  5D8I A;  2XBI A;  4G10 A;  2G2Q A;  4ML1 A;  3CSI A;  4KDY A;  3G7Y A;  3APO A;  1B48 A;  3QCP A;  2WCI A;  8GSS A;  2CQ9 A;  2I81 A;  5D9W A;  3FHK A;  2MBT A;  3RPN A;  3LXT A;  4JRR A;  1S3C A;  4GXZ A;  4KCA A;  4J56 E;  2YV9 A;  2J23 A;  4TXO A;  2JU5 A;  4XS1 A;  4BWS A;  4HZ4 A;  1JLV A;  2LRT A;  1GL8 A;  3TJK A;  2YWO A;  2GSR A;  4PQH A;  5DQS A;  3H1N A;  5IMA A;  2H74 A;  3HZ4 A;  2EC4 A;  1PQN A;  1VF3 A;  1T4Z A;  3HVS A;  2CX3 A;  3L9S A;  5CP1 A;  5ECK B;  1R5A A;  2IMI A;  2IMK A;  2KP1 A;  18GS A;  4ZL8 A;  1MDJ A;  1T4Y A;  4MCU A;  1X0R A;  4K8M A;  3KP9 A;  1TK5 B;  3VK9 A;  1QUW A;  3F4T A;  4FYB A;  3GUS A;  5IQY A;  3FZ9 A;  4MPG A;  1KEB A;  3GH9 A;  3P90 A;  5GAP D;  1O81 A;  3KM6 A;  4JED A;  3EC3 A;  3MNG A;  1THX A;  3FW2 A;  4K7O A;  1W89 A;  1OC3 A;  4P3Y B;  3ZTL A;  5INY A;  3Q6O A;  3L9U A;  1PN9 A;  4IN0 A;  1PX6 A;  3N5O A;  6GSY A;  3M9J A;  3F4R A;  2FHE A;  2M72 A;  3FY7 A;  1R5P A;  3VUR A;  3HZ8 A;  1FG4 A;  3IK7 A;  1UN2 A;  4GQF A;  2DJK A;  2L4Q A;  3A2W A;  5A4W A;  2IFQ B;  4TXV A;  5EL8 A;  1X9S B;  4OO5 A;  2O85 A;  4ILF A;  4LA1 A;  3IHQ A;  4AF2 A;  3TRX A;  3QR6 A;  1GTB A;  1X5E A;  4EL1 A;  4V2M A;  5IMV A;  5DBQ A;  3WD6 A;  2QSI A;  3D5J A;  2OE3 A;  1V58 A;  4RQX A;  2OBI A;  2B5X A;  2C1Y A;  3KMO A;  13GS A;  4G19 A;  1QQ2 A;  5B8A A;  4IKH A;  1GSY A;  3UEM A;  1SK0 A;  1G7O A;  4E8H A;  3QFB C;  3LYK A;  4IS0 A;  3M0F A;  2N5B A;  5E4W A;  4EO3 A;  2XPE A;  3FZA A;  3D6I A;  1GTI A;  1XW5 A;  1S3D A;  4O7H A;  1GNE A;  1VRS D;  1ZZY A;  4DSS B;  5F07 A;  3LYP A;  4PNF A;  3DIE A;  6GSX A;  4POB A;  1Q98 A;  1TW9 A;  2RUE A;  1F3A A;  4CHS A;  1B8X A;  2B3S A;  3TJG A;  3CRT A;  2EIO A;  1GRX A;  1ZMA A;  1M2D A;  4DSS A;  1BQ7 A;  3H4K A;  3QAV A;  2GQL A;  3KIJ A;  3CMI A;  3TRQ A;  3D22 A;  3ERG A;  2H72 A;  4TR3 A;  9GSS A;  3LEF A;  5D93 A;  2KUC A;  2K8S A;  2BTO T;  2KP2 A;  4G0L A;  5LNK e;  2GT6 A;  2JSY A;  2GST A;  1VF2 A;  3R3E A;  1T8E B;  1Z7R A;  4GWR A;  1FHE A;  4ZIJ A;  3DML A;  2NTO A;  2R2J A;  3IOS A;  1TU7 A;  2CZ2 A;  4NV2 A;  2NBS A;  5EPF A;  5JWR B;  3GL3 A;  4JE1 A;  3E9J B;  2IME A;  2PWJ A;  5F0G A;  1I9D A;  5CNW A;  3KTL A;  3C8E A;  2E0Q A;  1TOF A;  2B7J A;  4F82 A;  5HQP A;  2MZC A;  3E3E A;  4K0G A;  2NVL A;  4MJB A;  3EUR A;  2HE3 A;  1K3Y A;  2R3X A;  4HJ2 A;  3I69 A;  2OE1 A;  3VWU A;  5KN2 A;  2ON7 A;  3DXB A;  2C80 A;  2IWT A;  1NHY A;  2JAD A;  4XTS A;  2HI7 A;  3QMX A;  1XCC A;  4MJE A;  2GDR A;  1M2A A;  5ABR A;  3GUR A;  1EOG A;  1YEP A;  2BJX A;  2YJ7 A;  5EY6 A;  3ZMK A;  1NSW A;  2XC2 A;  2WRT A;  3G7I A;  5J9B A;  2B1L A;  3EYT A;  3IR4 A;  4MH2 A;  4EE0 A;  5DAL A;  4I6X A;  3TRP A;  3FK8 A;  2ON5 A;  3HXS A;  3GH6 A;  3LQ7 A;  1ZL9 A;  3BBY A;  4ZBD A;  2I3Y A;  1THO A;  4K9Z A;  2PMT A;  4KH7 A;  2HRN A;  4TW5 A;  4WXT A;  4IP1 A;  4MZB A;  4MPF A;  3I9V 2;  3US3 A;  1GSE A;  5ECL B;  5CRD A;  1Z9H A;  3KZQ A;  2O89 A;  4ACS A;  5ECI B;  4MK3 A;  4KUN A;  2IMF A;  3W8J A;  1SJI A;  4BWQ A;  1O7U A;  3GKX A;  1ML6 A;  4JR6 A;  5DVB A;  5HFG A;  1WMJ A;  4NHW A;  4ZXG A;  4MMM A;  2RII A;  4WKW A;  1EGO A;  1CQH A;  5IOX A;  3QFA C;  3L78 A;  3L0H A;  4KGI A;  1GUL A;  3GSS A;  4NXI A;  3ME7 A;  2MYG A;  1OC8 A;  4KSO A;  6GSU A;  4KND A;  3CTG A;  3R2Q A;  4ULX A;  5ECR B;  4IJ3 A;  1Z7P A;  4Q5R A;  1OKT A;  2AUV A;  2UZ8 A;  2FY6 A;  1FOV A;  4GSN A;  1LBK A;  1EOH A;  4ECB A;  1Z5Y E;  1OC9 B;  2QKE A;  3LJR A;  4L5O A;  3VPT A;  2X8H A;  3CSJ A;  2VIM A;  2F3M A;  4YQU A;  1OC9 A;  4LLR A;  2TRC P;  1FW1 A;  1HYU A;  4ZB9 A;  1OKD A;  2DJJ A;  2WGR A;  5HR0 A;  4GST A;  4GQC A;  3PIN A;  4F0C A;  1GH2 A;  2DMM A;  3QAW A;  3NZN A;  2A2R A;  1SJZ A;  2JL4 A;  1SU9 A;  1EV9 A;  1QGV A;  2RM6 A;  2HQT A;  1GWC A;  2ZCT A;  2OBK A;  2D2Z A;  5DJL A;  1V57 A;  3LWA A;  2R4V A;  1WOU A;  3FZ5 A;  2A4V A;  4XS4 B;  5J5N A;  6GSV A;  1ZGN A;  4V2N A;  1UA5 A;  5ECH B;  4Q5N A;  2QC7 A;  2P31 A;  2HFD A;  1GUM A;  2CVD A;  1B9Y C;  3D21 A;  4TKY A;  2WDU A;  2AYT A;  4E8E A;  1C72 A;  2VL2 A;  2XBQ A;  4HUA A;  3DWV A;  5E59 A;  1G6Y A;  2K6V A;  2GSS A;  1GTA A;  1PKZ A;  1ERT A;  2HSN B;  1XOB A;  4YAV A;  3TB2 A;  2F8F A;  3V1W A;  2LRC A;  3TCO A;  1CQG A;  2LUS A;  1DE1 A;  1ERV A;  2O87 A;  4POK A;  2OE0 A;  2AHE A;  5C04 A;  3HY2 A;  3UIW A;  1XPV A;  4I97 A;  4YH2 A;  2M46 A;  5CRE A;  4G0I A;  5IO0 A;  3KEB A;  4K7I A;  5COH A;  4MP4 A;  1GNW A;  5G2Z A;  2DIZ A;  3VPQ A;  5ECO B;  2AB6 A;  4L8E A;  3L4N A;  5KN3 A;  3UJ1 A;  3I6A A;  3TKS C;  3ZRD A;  2VM1 A;  1T00 A;  1SL2 B;  3ED3 A;  1ERW A;  3IDV A;  3M3M A;  4I8B A;  2VOC A;  2LST A;  5BMU A;  2N5F A;  2YWN A;  2GZP A;  14GS A;  1GLQ A;  1TU8 A;  5ECN B;  1GSU A;  4DEJ A;  3L9V A;  4LMV A;  4KCE A;  3Q19 A;  4EC0 A;  5IO2 A;  2HSH A;  3F3Q A;  1PL2 A;  2O7K A;  3J7Y b;  1FVK A;  2OA7 A;  1DBY A;  1OVN A;  1AC1 A;  1JFU A;  3IPZ A;  3GMF A;  2IL3 A;  2OAC A;  2C0D A;  3DEX A;  3ZVJ D;  2VLV A;  1SL1 B;  1J9B A;  4FH8 A;  2DIY A;  3TKP A;  5D73 A;  4PQ1 A;  3KJY A;  2H01 A;  4ISD A;  4NAX A;  3F8U A;  5CRH A;  4XHM A;  3WGX A;  1NM3 A;  4FIW A;  2FUG 2;  2MMN A;  1XZO A;  4ID0 A;  1O73 A;  2GSQ A;  3E0U A;  1FB0 A;  1XW9 A;  5J41 A;  2IPA A;  4ML6 A;  2WJU A;  3CTF A;  3GV1 A;  4NPB A;  2P0G A;  4TR1 B;  3LFL A;  2XHF A;  1K3L A;  4AJ7 A;  4EDZ A;  6GSS A;  2HXK A;  1GSS A;  5FT3 A;  1R4W A;  2ALB A;  5A5K A;  3ZYW A;  4I5Q A;  4XRD A;  1AAZ A;  4MLY A;  1Z6M A;  3KP8 A;  3TJF A;  2P5Q A;  1BAY A;  4N11 A;  1AW9 A;  3UMA A;  3H8Q A;  3FR6 A;  3GKN A;  5DQY A;  2MBS A;  3EVI A;  1DUG A;  3TOT A;  1E6B A;  2PER A;  3KD0 A;  4HEA 2;  4RUV A;  3LOR A;  1HNB A;  3PH9 A;  3ERF A;  1A8L A;  1X5C A;  2KHP A;  1JZD A;  3TKQ A;  3BOA A;  2IFQ A;  2V2G A;  1ERU A;  1JHB A;  5CAX A;  1WIK A;  4OD7 A;  1KTE A;  1BJX A;  3RHB A;  2VM2 A;  2GTU A;  3W8S A;  4D73 B;  2VCV A;  2WZ9 A;  3HJM A;  3FYG A;  2LJK A;  1BYE A;  1SD9 A;  3HCZ A;  4G9H A;  1EWX A;  1OE7 A;  2HRK B;  2FCH A;  4D73 A;  4IJI A;  5HFK A;  1SYX A;  1ZYE A;  4PTS A;  2GQK A;  3C7M A;  1PA3 A; 
#chains in the Genus database with same CATH topology
 2H6X A;  3IAS 2;  4BVX B;  1AUC A;  1V98 A;  3CQF A;  5A1N A;  1VGL A;  1XVQ A;  5F06 A;  10GS A;  4HQS A;  3ZFL A;  3M9K A;  4TR0 A;  5IMC A;  3G9B A;  4NWY A;  3O3T A;  3S9F A;  2R6K A;  3H93 A;  4Z2R A;  3GX8 A;  3K8N A;  3ZIT A;  2HT9 A;  2V1M A;  1U87 A;  2VD1 A;  4LMW A;  3P8W A;  2GLR A;  3IC8 A;  2FGX A;  5D9V A;  3UBK A;  3CBU A;  4AGS A;  1DSB A;  1F6M C;  3P2A A;  4MF7 A;  4OCE A;  4PXO A;  1K0C A;  2JZS A;  3AY8 A;  2NPB A;  4ZL7 A;  2R37 A;  5J9C A;  4IQ1 A;  3CXG A;  3ZIV A;  3QD9 A;  3MAK A;  3KCM A;  2VCT A;  2KOK A;  3VFI A;  4MA9 A;  3U6V A;  2MMZ A;  1A8Y A;  1AQW A;  2WB9 A;  3CSH A;  1YF0 A;  3HJP A;  3BD2 A;  2PGT A;  4TOP A;  3RFR C;  2UV8 G;  1MTC A;  1SEN A;  5D9X A;  17GS A;  3RDW A;  3DD3 A;  2JAC A;  3GFK A;  2YCD A;  4F0B A;  1QXH A;  3GST A;  1YDK A;  5DAK B;  5ECP B;  4X0X A;  4X4J A;  3QPM A;  2YAN A;  4ZBB A;  2XPD A;  4EIQ A;  3ZML A;  3DRN A;  4O5R A;  1UVZ A;  2VO4 A;  2REM A;  3TOU A;  5DAK A;  2O8V B;  1Y1U A;  2L6C A;  5G1L A;  2HYX A;  1TP9 A;  1XWA A;  1B9X C;  3FR3 A;  2CZ3 A;  2CT6 A;  2WZS A;  3MIX A;  4TR4 A;  1X9W B;  3APQ A;  3HVX A;  3QAG A;  5C00 A;  1SK1 A;  1K0N A;  2LNT A;  1S3A A;  2CA8 A;  1R26 A;  1EGR A;  4GCI A;  3HA9 A;  4IQA A;  2H66 A;  4PQI A;  2OJL A;  2PBJ A;  1J08 A;  5ELA A;  2PN8 A;  5ECQ B;  1XBS A;  1B4P A;  2X8G A;  1JZW A;  4PHZ C;  1XXU A;  1J0F A;  3RPP A;  1NW2 A;  4XIH A;  2OAD A;  3QOU A;  2GGT A;  3TGZ A;  1YZX A;  1XWB A;  3IBH A;  5J3R A;  1V2A A;  1G6W A;  5B8B A;  3SWL A;  1OAZ A;  1H75 A;  5EVO A;  1PX7 A;  1GUK A;  2EFD A;  1AIU A;  2V41 A;  3WYW A;  1T7P B;  5J40 A;  1PD2 1;  4USS A;  1IYI A;  4AKG A;  2LQO A;  1QMV A;  4AKI A;  2PU9 C;  3M1G A;  1ON4 A;  3EU3 A;  2C4J A;  3GTU B;  2VLU A;  1DE2 A;  4KAE A;  1HNA A;  1F9M A;  5DJM A;  1ST9 A;  4XCS A;  4LL4 B;  3HMJ G;  2P5R A;  3IC4 A;  1PMT A;  5IM9 A;  1PSQ A;  2V6K A;  1PL1 A;  4ZIL A;  5H5S A;  2WUL A;  5CRG A;  3GTU A;  2EIR A;  2FWF A;  5ENU A;  5D96 A;  1XG8 A;  3EWL A;  2HSM B;  4H86 A;  5IPG A;  4MAB A;  2O36 A;  4TVE A;  5DCG A;  2V6O A;  2OT3 A;  4AJ6 A;  2DLX A;  2FWE A;  1BF5 A;  1XWK A;  4RI6 A;  1TRS A;  1UC7 A;  5IMZ A;  2H0I A;  3F9U A;  5HR2 A;  4G2E A;  2HNL A;  1T1V A;  3Q74 A;  2FWH A;  2FWG A;  3DGQ A;  2LJA A;  4PGT A;  1M9B A;  3C1R A;  1ILO A;  4WEY A;  4POM A;  5B7C A;  2LQQ A;  22GS A;  2C3Q A;  4CY6 A;  4PI2 C;  3LGC A;  3IE3 A;  3C71 A;  2KLX A;  2YNX A;  4IHU A;  5JCU A;  2C0F A;  3ERW A;  2RUF A;  1BX9 A;  3FKF A;  2H70 A;  2X8C A;  1WPI A;  2MMO A;  1KNG A;  5H5Q A;  1TXX A;  2WFC A;  3MSZ A;  4OCF A;  1TI3 A;  1ZYQ B;  3GIX A;  1NHO A;  2JZT A;  5JWO B;  4EDY A;  1ACV A;  3WT2 A;  4WR4 A;  3VI7 A;  5ECM B;  2YZH A;  1G0T A;  2C0G A;  1YQ1 A;  4KDU A;  2RLI A;  4L0U A;  4FYU A;  5F05 A;  2PVO C;  3FR9 A;  3RGB C;  3CHX C;  1A2J A;  3A2X A;  4XS4 A;  3HVV A;  4Q5F A;  4FYC A;  3VWX A;  3UL3 A;  1WWJ A;  2B5E A;  4YKG A;  3VI5 A;  2CX4 A;  3N9J A;  4BL7 B;  1TJD A;  2V32 A;  3MWH A;  2H30 A;  2YV7 A;  5A5H A;  2QGV A;  5HR1 A;  4HQZ A;  1SVL A;  2K18 A;  1WJK A;  1GUH A;  2A4H A;  2FA4 A;  3TDG A;  1K0M A;  2L4C A;  3RAZ A;  5GAN D;  5GZZ B;  3QDN A;  4N10 A;  4BL7 A;  4WBR D;  4OFN A;  4OO4 A;  2ES7 A;  1USB A;  4KW6 A;  1M3J A;  20GS A;  2VCQ A;  1TKD B;  1O8W A;  4GF0 A;  2B6M A;  1F37 A;  4HU9 A;  3IRA A;  4PUA A;  2OKA A;  1MD3 A;  4K7N A;  2VD0 A;  1A2M A;  2GQM A;  4OFM A;  4PNG A;  3GRX A;  5ECS A;  3KH9 A;  1R7H A;  4ZL9 A;  4V1A g;  2YP6 A;  4HJM A;  4YQV A;  1PGT A;  1EV4 A;  2H1G A;  1O6J A;  2HRF A;  4WF5 A;  1TDI A;  2HZF A;  3EMX A;  2FNO A;  1QK8 A;  4TXO B;  2AV4 A;  4IBP A;  3TJJ A;  3VWW A;  3WT1 A;  2CVK A;  3HKR A;  5F8B A;  2YN1 A;  5AIS A;  2LS5 A;  3U5R E;  1SKS B;  2LTK A;  1ZCP A;  4NV5 A;  1U3A A;  2LRN A;  1AQX A;  2H1B A;  3NOF A;  3TUE A;  4KF9 A;  4KX4 A;  3LXZ A;  1A2L A;  3IA1 A;  4PUF C;  3GYK A;  3UVT A;  5H5R A;  4QL7 A;  1Z6N A;  2HLS A;  1K0B A;  5L71 A;  4K6X A;  2MMA A;  4RI7 A;  1RQM A;  5ID2 B;  4MJC A;  2L5L A;  1B4Q A;  3D4T A;  2B5Y A;  5IMF A;  4JZQ A;  1V40 A;  3FMW A;  5KOW A;  1SD8 A;  3IXR A;  3J7Y k;  5B6M A;  2LKU A;  4N3Z A;  4EUY A;  5ID2 A;  1GSF A;  4TN8 A;  3TKS E;  2H19 A;  2X49 A;  4IGJ A;  1EP8 A;  4QQ7 A;  2GVP A;  3BCK A;  1TK0 B;  1PKW A;  1WRY A;  1XWC A;  5A4U A;  3KMN A;  3PR8 A;  2B7K A;  1XOA A;  1SJ6 A;  4EF0 A;  5J4V A;  3GKM A;  4KDX A;  2H0H A;  1K3O A;  2YWM A;  1FAA A;  3HHV A;  3VLN A;  19GS A;  3F6F A;  3F6D A;  2TIR A;  2ZUP A;  4J2F A;  2QA2 A;  1SYR A;  2IJY A;  4TR1 A;  2YWI A;  1A0R P;  4K2D A;  2JZR A;  2DC5 A;  2VL9 A;  1YKA A;  2C3T A;  3A5I A;  4X43 A;  3MYD A;  11GS A;  2H71 A;  3SBC A;  4BVY B;  5GST A;  1ZYP A;  3HDC A;  4GTU A;  3IK9 A;  3WGD A;  2YOI A;  4XS6 A;  3W6G A;  5IOW A;  4BVY A;  2Z9S A;  1A23 A;  1MEK A;  1EEJ A;  1YKC A;  4O32 A;  4KE3 A;  3ZRE A;  2H0G A;  5FWG A;  1JLW A;  4I2U A;  1X9M B;  3TKS A;  1YY7 A;  4HDE A;  1VF1 A;  1KBN A;  3HJO A;  1TRU A;  4POL A;  2F8A A;  1W4V A;  2H1D A;  1SKR B;  4MDC A;  2DBC A;  1LU4 A;  3EIN A;  3EPT A;  4WET A;  1JZO A;  3EMP A;  4K2X A;  1XW6 A;  4JBB A;  1T3B A;  5IPH A;  2EFH A;  2HRK A;  3TJB A;  2L59 A;  2JSZ A;  1YEX A;  2E2G A;  4Z7X A;  4LL1 B;  1GSQ A;  3HD5 A;  3GA4 A;  4BA7 A;  4MF5 A;  2FA8 A;  4OFT A;  3D4M A;  1GSD A;  1HNC A;  2E7P A;  3ZL5 A;  4YAP A;  4BVX A;  5J4U A;  3FEU A;  6GST A;  3FRC A;  4HI7 A;  4O5U A;  3VWV A;  4F03 A;  4QL9 A;  1K0D A;  1FVJ A;  1M0U A;  2K8V A;  4PUR A;  2VLT A;  3F0I A;  1RW1 A;  3OR5 A;  3DYR A;  3BCI A;  3I43 A;  3TU3 B;  2WW0 A;  3C73 A;  4FQU A;  3Q18 A;  3DVX A;  4DVC A;  1U3I A;  3UAP A;  5KN0 A;  3NIV A;  2CV4 A;  4KA0 A;  1O85 A;  5G31 A;  4KB3 A;  2IN3 A;  3F63 A;  4EIP A;  1EZK A;  2DML A;  1Q4J A;  2PUK C;  2NDO A;  1ZOF A;  4ZB6 A;  2R5G A;  5AIX A;  3ZZX A;  1FO5 A;  1YJ6 A;  1EP7 A;  2K9F A;  2B1K A;  3A5W A;  4Q5Q A;  5AN1 A;  1Y25 A;  2H76 A;  1IYH A;  2EIQ A;  3GHA A;  2DSA A;  3O6T A;  4IVF A;  3EU4 A;  4NHZ A;  3APS A;  2GZZ A;  2H75 A;  1TRV A;  4HS1 A;  5JWQ B;  3UOM A;  2H6Y A;  4K5S A;  2CAQ A;  2ZNM A;  3C1S A;  1TK8 B;  4OWY A;  2VCX A;  7GSS A;  1WP0 A;  4MJA A;  2C8U A;  3GX0 A;  4FO5 A;  4N0Z A;  4MF6 A;  5B6N A;  12GS A;  5KN1 A;  4DSQ A;  4O92 A;  1M7T A;  2HZE B;  4E68 A;  2C0E A;  4L0W A;  3D0Z A;  4PX1 A;  4MZW A;  4EKZ A;  1GLP A;  1H4O A;  2F51 A;  4N30 A;  2F9S A;  2HSY A;  4G0K A;  2FD3 A;  3RHC A;  2HZE A;  2H73 A;  5JCG A;  5G30 A;  1GP1 A;  3KXO A;  4KSM A;  1G7E A;  1AXD A;  4N0V A;  1EEM A;  4CDO A;  3ZFB A;  4J57 E;  1ABA A;  2X64 A;  1TTZ A;  2GZY A;  5HR3 A;  5DAL B;  6GSW A;  5LD0 A;  3GNJ A;  3DKS A;  1M9A A;  1OYJ A;  1TI1 A;  3O76 A;  2G0F A;  3WGE A;  4CW9 A;  5G5F A;  3ISO A;  1XIY A;  1A0F A;  3GL5 A;  2CVB A;  3ZLP A;  1WE0 A;  5G1K A;  2DJ2 A;  4ECI A;  4HU7 A;  3LG6 A;  1TRW A;  3F4S A;  2WW3 A;  2CAI A;  3KGK A;  5IIZ A;  3GKK A;  2AAW A;  4TRX A;  2R0G A;  4NMU A;  1U6T A;  3A3T A;  2DJ1 A;  1M99 A;  2VL2 C;  2YJH A;  3RBT A;  1XVW A;  5CRW A;  1SK2 A;  1Y6E A;  2LNS A;  1YEW C;  4OMV A;  5ELG A;  5CYY A;  4XRA A;  3ZVJ A;  1MD4 A;  2WVY A;  5DDL A;  2I4A A;  2LJR A;  3ZIJ A;  2EFC A;  2VCW A;  2DKH A;  4F2I A;  1GTU A;  3UAR A;  4EVM A;  1OE8 A;  4JR4 A;  4V1A p;  2A2S A;  1HD2 A;  1SVO A;  1AQV A;  4X1U A;  3A2V A;  3CRU A;  3F3R A;  1RK4 A;  4GLT A;  5GSS A;  2QA1 A;  3PGT A;  1O8X A;  4GSS A;  3ME8 A;  1K0A A;  4YQM A;  2HSM A;  4ZB7 A;  5D9T A;  1N2A A;  1A24 A;  2H8L A;  2VL3 A;  2FLS A;  1MDK A;  3IV4 A;  2GT5 A;  4ICY A;  2WS2 A;  2AJQ B;  1E2Y A;  2I9H A;  2L57 A;  1BED A;  4WBJ A;  1VF4 A;  5J47 A;  1SKW B;  2DJ0 A;  4DSR A;  3H79 A;  3M8N A;  4RQR A;  4IP6 A;  4JU5 A;  4BPY A;  2VCZ A;  4MZC A;  2DJ3 A;  5HFI A;  3MDK A;  3FZ4 A;  3DVW A;  2L6D A;  4ZB8 A;  3P7X A;  3EE2 A;  2X4A A;  4L5L A;  5LCZ A;  2GS3 A;  16GS A;  5JCW A;  2EFE A;  4EXJ A;  2N5A A;  4WF4 A;  1ZYN A;  1MDI A;  4AJ8 A;  1F3B A;  4IEL A;  4GRF A;  2RM5 A;  4WR5 A;  4PI0 C;  5AGY A;  3LW9 A;  5FHI A;  1YF1 A;  4MH3 A;  2H1A A;  4BIK A;  1K0O A;  3KH7 A;  4F9Z A;  3CWG A;  2L5O A;  4ZBA A;  5KEJ A;  2TRX A;  3KTB A;  2YZU A;  2H6Z A;  4K1F A;  3UBL A;  3LSZ A;  1SL0 B;  1XWG A;  3TKR A;  2BMX A;  2E2M A;  4V2L A;  4I2T A;  2HRA A;  5IMD A;  2O5V A;  5CO3 A;  1PRX A;  1XFL A;  4ECJ A;  2IMD A;  1HQO A;  4A5P A;  4IW9 A;  4O5Q A;  1URM A;  4HOJ A;  5DCH A;  1S4B P;  3UVH A;  2PPT A;  2IIY A;  2VAF A;  1I5G A;  3HYP A;  2PVQ A;  1JZR A;  3G7J A;  3PPU A;  2LEG A;  1FB6 A;  5AIV A;  1U88 A;  2LV3 A;  1V9W A;  2YPM A;  2VUP A;  1N8J A;  1M2B A;  2M80 A;  2I1U A;  1Z3E A;  2J9H A;  2C3N A;  3CYN A;  3BJ5 A;  4ECC A;  1F2E A;  1X5D A;  3GN3 A;  3JCM L;  2X99 A;  1QFN A;  3IAM 2;  4HZ2 A;  1BG5 A;  4K0N A;  5G5E A;  5A4V A;  1LJR A;  5D8I A;  2XBI A;  4G10 A;  2G2Q A;  4ML1 A;  3CSI A;  4KDY A;  3G7Y A;  3APO A;  1B48 A;  3QCP A;  2WCI A;  8GSS A;  2CQ9 A;  2I81 A;  5D9W A;  3FHK A;  2MBT A;  3RPN A;  3LXT A;  4JRR A;  1S3C A;  4GXZ A;  4KCA A;  4J56 E;  2YV9 A;  2J23 A;  4TXO A;  2JU5 A;  4XS1 A;  4BWS A;  4HZ4 A;  1JLV A;  2LRT A;  1GL8 A;  3TJK A;  1PFO A;  2YWO A;  1FOH A;  2GSR A;  4PQH A;  5DQS A;  3H1N A;  5IMA A;  2H74 A;  3HZ4 A;  2EC4 A;  2R0C A;  1PQN A;  1VF3 A;  1T4Z A;  3HVS A;  2CX3 A;  3L9S A;  5CP1 A;  5ECK B;  1R5A A;  2IMI A;  2IMK A;  2KP1 A;  18GS A;  4ZL8 A;  1MDJ A;  1T4Y A;  4MCU A;  1X0R A;  4QMK A;  4K8M A;  3KP9 A;  1TK5 B;  3VK9 A;  1QUW A;  3F4T A;  4FYB A;  5BRT A;  3GUS A;  5IQY A;  3FZ9 A;  4MPG A;  1KEB A;  3GH9 A;  3P90 A;  5GAP D;  1O81 A;  3KM6 A;  4JED A;  3EC3 A;  3MNG A;  2WW2 A;  1THX A;  3FW2 A;  4K7O A;  1W89 A;  1OC3 A;  4P3Y B;  3ZTL A;  5INY A;  3Q6O A;  3L9U A;  1PN9 A;  4IN0 A;  1PX6 A;  3N5O A;  6GSY A;  3M9J A;  3F4R A;  2FHE A;  2M72 A;  3FY7 A;  1R5P A;  3VUR A;  3HZ8 A;  1FG4 A;  3IK7 A;  1UN2 A;  4GQF A;  2DJK A;  2L4Q A;  3A2W A;  5A4W A;  2IFQ B;  4TXV A;  5EL8 A;  1X9S B;  4OO5 A;  5J4Y A;  2O85 A;  4ILF A;  4LA1 A;  1TXU A;  3IHQ A;  4AF2 A;  3TRX A;  3QR6 A;  1GTB A;  1X5E A;  4EL1 A;  4V2M A;  5IMV A;  5DBQ A;  3WD6 A;  2QSI A;  3D5J A;  2OE3 A;  4CY8 A;  1V58 A;  4RQX A;  2OBI A;  2B5X A;  2C1Y A;  3KMO A;  13GS A;  4G19 A;  1QQ2 A;  5B8A A;  4IKH A;  1GSY A;  3UEM A;  1SK0 A;  1G7O A;  4E8H A;  3QFB C;  3LYK A;  4IS0 A;  3M0F A;  1BG1 A;  2N5B A;  5E4W A;  5KOX A;  4EO3 A;  2XPE A;  3FZA A;  3D6I A;  1GTI A;  1XW5 A;  1S3D A;  4O7H A;  1GNE A;  1VRS D;  1ZZY A;  4DSS B;  5F07 A;  3LYP A;  4PNF A;  3DIE A;  6GSX A;  4POB A;  1Q98 A;  1TW9 A;  2RUE A;  1F3A A;  4CHS A;  1B8X A;  2B3S A;  3TJG A;  3CRT A;  2EIO A;  1GRX A;  1ZMA A;  1M2D A;  4DSS A;  1BQ7 A;  3H4K A;  3QAV A;  2GQL A;  3KIJ A;  3CMI A;  3TRQ A;  3D22 A;  3ERG A;  2H72 A;  4TR3 A;  9GSS A;  3LEF A;  5D93 A;  2KUC A;  2K8S A;  2BTO T;  2KP2 A;  4G0L A;  5LNK e;  2GT6 A;  2JSY A;  2GST A;  1VF2 A;  3R3E A;  1T8E B;  1Z7R A;  1N25 A;  4GWR A;  1FHE A;  4ZIJ A;  3DML A;  2NTO A;  2R2J A;  3IOS A;  4MNN A;  1TU7 A;  2CZ2 A;  4NV2 A;  2NBS A;  5EPF A;  5JWR B;  1YVL A;  1S3R A;  3GL3 A;  4JE1 A;  3E9J B;  2IME A;  2PWJ A;  5F0G A;  1I9D A;  5CNW A;  3KTL A;  3C8E A;  2E0Q A;  1TOF A;  2B7J A;  4F82 A;  3IHG A;  5HQP A;  2MZC A;  3E3E A;  4K0G A;  2R0P A;  2NVL A;  4HSC X;  4MJB A;  3EUR A;  2HE3 A;  1K3Y A;  2R3X A;  4HJ2 A;  3I69 A;  2OE1 A;  3VWU A;  5KN2 A;  2ON7 A;  3DXB A;  2C80 A;  2IWT A;  1NHY A;  4AKX B;  2JAD A;  4XTS A;  2HI7 A;  3QMX A;  1XCC A;  4MJE A;  2GDR A;  1M2A A;  5ABR A;  3GUR A;  1EOG A;  1YEP A;  2BJX A;  2YJ7 A;  5EY6 A;  3ZMK A;  1NSW A;  2XC2 A;  2WRT A;  3G7I A;  3HVN A;  4K5R A;  5J9B A;  2B1L A;  3EYT A;  3IR4 A;  4MH2 A;  4EE0 A;  5DAL A;  4I6X A;  3TRP A;  2WVZ A;  3FK8 A;  2ON5 A;  3HXS A;  3GH6 A;  3LQ7 A;  1ZL9 A;  3BBY A;  4ZBD A;  2I3Y A;  1THO A;  4K9Z A;  2PMT A;  4KH7 A;  2HRN A;  4TW5 A;  4WXT A;  4IP1 A;  4MZB A;  4MPF A;  3I9V 2;  3US3 A;  1GSE A;  5ECL B;  5CRD A;  1Z9H A;  3KZQ A;  2O89 A;  4ACS A;  5ECI B;  4MK3 A;  4KUN A;  2IMF A;  3W8J A;  1SJI A;  4BWQ A;  1O7U A;  3GKX A;  1ML6 A;  4JR6 A;  5DVB A;  4G01 A;  5HFG A;  1WMJ A;  4NHW A;  4ZXG A;  4MMM A;  2RII A;  4WKW A;  1EGO A;  1CQH A;  4YKF A;  5IOX A;  3QFA C;  3L78 A;  1M3I A;  3L0H A;  4KGI A;  1GUL A;  3GSS A;  4NXI A;  3ME7 A;  2MYG A;  1OC8 A;  4KSO A;  6GSU A;  4KND A;  3CTG A;  3R2Q A;  4ULX A;  5ECR B;  4IJ3 A;  1Z7P A;  4Q5R A;  1OKT A;  2AUV A;  2UZ8 A;  2FY6 A;  1FOV A;  4GSN A;  1LBK A;  1EOH A;  4ECB A;  1Z5Y E;  1OC9 B;  2QKE A;  3LJR A;  4AI6 A;  4L5O A;  3VPT A;  2X8H A;  2DKI A;  3CSJ A;  5A34 B;  2VIM A;  2F3M A;  4YQU A;  1OC9 A;  4LLR A;  2TRC P;  1FW1 A;  1HYU A;  4ZB9 A;  1OKD A;  2DJJ A;  2WGR A;  5HR0 A;  4GST A;  4GQC A;  3PIN A;  4F0C A;  1GH2 A;  5A34 A;  2DMM A;  3QAW A;  4GDF A;  3NZN A;  2A2R A;  1SJZ A;  2JL4 A;  1SU9 A;  1EV9 A;  1QGV A;  2RM6 A;  2HQT A;  1GWC A;  2ZCT A;  2OBK A;  2D2Z A;  5DJL A;  1V57 A;  3LWA A;  2R4V A;  1WOU A;  3FZ5 A;  2A4V A;  4XS4 B;  5J5N A;  6GSV A;  1ZGN A;  4V2N A;  1UA5 A;  5ECH B;  4Q5N A;  2QC7 A;  2P31 A;  2HFD A;  1GUM A;  2CVD A;  1B9Y C;  5A5H B;  3D21 A;  4TKY A;  2WDU A;  2AYT A;  4E8E A;  1C72 A;  2VL2 A;  2XBQ A;  4HUA A;  3DWV A;  5E59 A;  1G6Y A;  2K6V A;  2GSS A;  1GTA A;  1PKZ A;  1ERT A;  2HSN B;  1XOB A;  4YAV A;  3TB2 A;  2F8F A;  3V1W A;  2LRC A;  3TCO A;  1CQG A;  2LUS A;  2VKZ G;  1DE1 A;  1ERV A;  2O87 A;  4POK A;  2OE0 A;  2AHE A;  5C04 A;  3HY2 A;  3UIW A;  1XPV A;  4I97 A;  2HSN A;  4YH2 A;  2M46 A;  5CRE A;  4G0I A;  5IO0 A;  3KEB A;  2H1L A;  4K7I A;  5COH A;  1I1I P;  4MP4 A;  1GNW A;  5G2Z A;  2DIZ A;  3VPQ A;  5ECO B;  5BMU B;  2AB6 A;  4L8E A;  3L4N A;  5KN3 A;  3UJ1 A;  3I6A A;  3TKS C;  3ZRD A;  2VM1 A;  1T00 A;  1SL2 B;  3ED3 A;  1ERW A;  3IDV A;  3M3M A;  4I8B A;  2VOC A;  2LST A;  5BMU A;  2N5F A;  2YWN A;  2GZP A;  14GS A;  1GLQ A;  1SVM A;  1TU8 A;  5ECN B;  1GSU A;  4DEJ A;  2A2P A;  3L9V A;  4LMV A;  4KCE A;  3Q19 A;  4EC0 A;  5IO2 A;  2HSH A;  3F3Q A;  1PL2 A;  2O7K A;  3J7Y b;  1FVK A;  2OA7 A;  1DBY A;  1OVN A;  1AC1 A;  1JFU A;  3IPZ A;  3GMF A;  2IL3 A;  2OAC A;  2C0D A;  3DEX A;  3ZVJ D;  2VLV A;  1SL1 B;  1J9B A;  4FH8 A;  2DIY A;  3TKP A;  5D73 A;  4PQ1 A;  3KJY A;  2H01 A;  4ISD A;  4NAX A;  3F8U A;  5CRH A;  4XHM A;  3WGX A;  1NM3 A;  4FIW A;  2FUG 2;  2MMN A;  1XZO A;  4ID0 A;  1O73 A;  2GSQ A;  3E0U A;  1FB0 A;  1XW9 A;  4Z2U A;  5J41 A;  2IPA A;  4ML6 A;  2WJU A;  3CTF A;  3GV1 A;  4Z2T A;  4NPB A;  2P0G A;  4TR1 B;  3LFL A;  2XHF A;  1K3L A;  4W66 A;  4FXY P;  4AJ7 A;  4EDZ A;  6GSS A;  2HXK A;  1GSS A;  5FT3 A;  1R4W A;  2ALB A;  4AKH A;  5A5K A;  3ZYW A;  4I5Q A;  4XRD A;  1AAZ A;  4MLY A;  1Z6M A;  3KP8 A;  3TJF A;  2P5Q A;  1BAY A;  4N11 A;  1AW9 A;  3UMA A;  3H8Q A;  3FR6 A;  3GKN A;  5DQY A;  2MBS A;  3EVI A;  1DUG A;  3TOT A;  1E6B A;  2PER A;  3KD0 A;  4HEA 2;  4RUV A;  3LOR A;  1HNB A;  3PH9 A;  3ERF A;  1A8L A;  1X5C A;  2KHP A;  1JZD A;  3TKQ A;  2WVX B;  3BOA A;  2IFQ A;  2V2G A;  1ERU A;  1JHB A;  5CAX A;  1WIK A;  4OD7 A;  1KTE A;  1BJX A;  3RHB A;  2VM2 A;  2GTU A;  3W8S A;  4D73 B;  2VCV A;  2WZ9 A;  3HJM A;  2WVX A;  3FYG A;  2LJK A;  2WW1 A;  1BYE A;  1SD9 A;  3HCZ A;  4G9H A;  1EWX A;  1OE7 A;  2HRK B;  2FCH A;  1PN0 A;  5A1N B;  4D73 A;  4IJI A;  5HFK A;  1SYX A;  1ZYE A;  4PTS A;  2GQK A;  3C7M A;  1PA3 A;  2O3E A; 
#chains in the Genus database with same CATH homology
 2H6X A;  3IAS 2;  4BVX B;  1AUC A;  1V98 A;  5A1N A;  1VGL A;  1XVQ A;  5F06 A;  10GS A;  4HQS A;  3ZFL A;  3M9K A;  4TR0 A;  5IMC A;  3G9B A;  4NWY A;  3O3T A;  3S9F A;  2R6K A;  3H93 A;  4Z2R A;  3GX8 A;  3K8N A;  3ZIT A;  2HT9 A;  2V1M A;  1U87 A;  2VD1 A;  4LMW A;  3P8W A;  2GLR A;  3IC8 A;  2FGX A;  5D9V A;  3UBK A;  3CBU A;  4AGS A;  1DSB A;  1F6M C;  3P2A A;  4MF7 A;  4OCE A;  4PXO A;  1K0C A;  2JZS A;  3AY8 A;  2NPB A;  4ZL7 A;  2R37 A;  5J9C A;  4IQ1 A;  3CXG A;  3ZIV A;  3QD9 A;  3MAK A;  3KCM A;  2VCT A;  2KOK A;  3VFI A;  4MA9 A;  3U6V A;  2MMZ A;  1A8Y A;  1AQW A;  2WB9 A;  3CSH A;  1YF0 A;  3HJP A;  3BD2 A;  2PGT A;  4TOP A;  2UV8 G;  1MTC A;  1SEN A;  5D9X A;  17GS A;  3RDW A;  3DD3 A;  2JAC A;  3GFK A;  2YCD A;  4F0B A;  1QXH A;  3GST A;  1YDK A;  5DAK B;  5ECP B;  4X0X A;  4X4J A;  3QPM A;  2YAN A;  4ZBB A;  2XPD A;  4EIQ A;  3ZML A;  3DRN A;  4O5R A;  1UVZ A;  2VO4 A;  2REM A;  3TOU A;  5DAK A;  2O8V B;  1Y1U A;  2L6C A;  5G1L A;  2HYX A;  1TP9 A;  1XWA A;  1B9X C;  3FR3 A;  2CZ3 A;  2CT6 A;  3MIX A;  4TR4 A;  1X9W B;  3APQ A;  3HVX A;  3QAG A;  5C00 A;  1SK1 A;  1K0N A;  2LNT A;  1S3A A;  2CA8 A;  1R26 A;  1EGR A;  4GCI A;  3HA9 A;  4IQA A;  2H66 A;  4PQI A;  2OJL A;  2PBJ A;  1J08 A;  5ELA A;  2PN8 A;  5ECQ B;  1XBS A;  1B4P A;  2X8G A;  1JZW A;  1XXU A;  1J0F A;  3RPP A;  1NW2 A;  4XIH A;  2OAD A;  3QOU A;  2GGT A;  3TGZ A;  1YZX A;  1XWB A;  3IBH A;  5J3R A;  1V2A A;  1G6W A;  5B8B A;  3SWL A;  1OAZ A;  1H75 A;  5EVO A;  1PX7 A;  1GUK A;  2EFD A;  1AIU A;  2V41 A;  3WYW A;  1T7P B;  5J40 A;  1PD2 1;  4USS A;  1IYI A;  4AKG A;  2LQO A;  1QMV A;  4AKI A;  2PU9 C;  3M1G A;  1ON4 A;  3EU3 A;  2C4J A;  3GTU B;  2VLU A;  1DE2 A;  4KAE A;  1HNA A;  1F9M A;  5DJM A;  1ST9 A;  4XCS A;  4LL4 B;  3HMJ G;  2P5R A;  3IC4 A;  1PMT A;  5IM9 A;  1PSQ A;  2V6K A;  1PL1 A;  4ZIL A;  5H5S A;  2WUL A;  5CRG A;  3GTU A;  2EIR A;  2FWF A;  5ENU A;  5D96 A;  3EWL A;  2HSM B;  4H86 A;  5IPG A;  4MAB A;  4TVE A;  5DCG A;  2V6O A;  2OT3 A;  4AJ6 A;  2DLX A;  2FWE A;  1BF5 A;  1XWK A;  4RI6 A;  1TRS A;  1UC7 A;  5IMZ A;  2H0I A;  3F9U A;  5HR2 A;  4G2E A;  2HNL A;  1T1V A;  3Q74 A;  2FWH A;  2FWG A;  3DGQ A;  2LJA A;  4PGT A;  1M9B A;  3C1R A;  1ILO A;  4WEY A;  4POM A;  5B7C A;  2LQQ A;  22GS A;  2C3Q A;  4CY6 A;  3LGC A;  3IE3 A;  3C71 A;  2KLX A;  2YNX A;  4IHU A;  5JCU A;  2C0F A;  3ERW A;  2RUF A;  1BX9 A;  3FKF A;  2H70 A;  2X8C A;  1WPI A;  2MMO A;  1KNG A;  5H5Q A;  1TXX A;  2WFC A;  3MSZ A;  4OCF A;  1TI3 A;  1ZYQ B;  3GIX A;  1NHO A;  2JZT A;  5JWO B;  4EDY A;  1ACV A;  3WT2 A;  4WR4 A;  3VI7 A;  5ECM B;  2YZH A;  1G0T A;  2C0G A;  1YQ1 A;  4KDU A;  2RLI A;  4L0U A;  4FYU A;  5F05 A;  2PVO C;  3FR9 A;  1A2J A;  3A2X A;  4XS4 A;  3HVV A;  4Q5F A;  4FYC A;  3VWX A;  3UL3 A;  1WWJ A;  2B5E A;  4YKG A;  3VI5 A;  2CX4 A;  3N9J A;  4BL7 B;  1TJD A;  2V32 A;  3MWH A;  2H30 A;  2YV7 A;  5A5H A;  2QGV A;  5HR1 A;  4HQZ A;  1SVL A;  2K18 A;  1WJK A;  1GUH A;  2A4H A;  2FA4 A;  3TDG A;  1K0M A;  2L4C A;  3RAZ A;  5GAN D;  5GZZ B;  3QDN A;  4N10 A;  4BL7 A;  4WBR D;  4OFN A;  4OO4 A;  2ES7 A;  1USB A;  4KW6 A;  20GS A;  2VCQ A;  1TKD B;  1O8W A;  4GF0 A;  2B6M A;  1F37 A;  4HU9 A;  3IRA A;  4PUA A;  2OKA A;  1MD3 A;  4K7N A;  2VD0 A;  1A2M A;  2GQM A;  4OFM A;  4PNG A;  3GRX A;  5ECS A;  3KH9 A;  1R7H A;  4ZL9 A;  4V1A g;  2YP6 A;  4HJM A;  4YQV A;  1PGT A;  1EV4 A;  2H1G A;  1O6J A;  2HRF A;  4WF5 A;  1TDI A;  2HZF A;  3EMX A;  2FNO A;  1QK8 A;  4TXO B;  2AV4 A;  4IBP A;  3TJJ A;  3VWW A;  3WT1 A;  2CVK A;  3HKR A;  5F8B A;  2YN1 A;  5AIS A;  2LS5 A;  3U5R E;  1SKS B;  2LTK A;  1ZCP A;  4NV5 A;  1U3A A;  2LRN A;  1AQX A;  2H1B A;  3NOF A;  3TUE A;  4KF9 A;  4KX4 A;  3LXZ A;  1A2L A;  3IA1 A;  4PUF C;  3GYK A;  3UVT A;  5H5R A;  4QL7 A;  1Z6N A;  2HLS A;  1K0B A;  5L71 A;  4K6X A;  2MMA A;  4RI7 A;  1RQM A;  5ID2 B;  4MJC A;  2L5L A;  1B4Q A;  3D4T A;  2B5Y A;  5IMF A;  4JZQ A;  1V40 A;  3FMW A;  5KOW A;  1SD8 A;  3IXR A;  3J7Y k;  5B6M A;  2LKU A;  4N3Z A;  4EUY A;  5ID2 A;  1GSF A;  4TN8 A;  3TKS E;  2H19 A;  2X49 A;  4IGJ A;  1EP8 A;  4QQ7 A;  2GVP A;  3BCK A;  1TK0 B;  1PKW A;  1WRY A;  1XWC A;  5A4U A;  3KMN A;  3PR8 A;  2B7K A;  1XOA A;  1SJ6 A;  4EF0 A;  5J4V A;  3GKM A;  4KDX A;  2H0H A;  1K3O A;  2YWM A;  1FAA A;  3HHV A;  3VLN A;  19GS A;  3F6F A;  3F6D A;  2TIR A;  2ZUP A;  4J2F A;  2QA2 A;  1SYR A;  2IJY A;  4TR1 A;  2YWI A;  1A0R P;  4K2D A;  2JZR A;  2DC5 A;  2VL9 A;  1YKA A;  2C3T A;  3A5I A;  4X43 A;  3MYD A;  11GS A;  2H71 A;  3SBC A;  4BVY B;  5GST A;  1ZYP A;  3HDC A;  4GTU A;  3IK9 A;  3WGD A;  2YOI A;  4XS6 A;  3W6G A;  5IOW A;  4BVY A;  2Z9S A;  1A23 A;  1MEK A;  1EEJ A;  1YKC A;  4O32 A;  4KE3 A;  3ZRE A;  2H0G A;  5FWG A;  1JLW A;  4I2U A;  1X9M B;  3TKS A;  1YY7 A;  4HDE A;  1VF1 A;  1KBN A;  3HJO A;  1TRU A;  4POL A;  2F8A A;  1W4V A;  2H1D A;  1SKR B;  4MDC A;  2DBC A;  1LU4 A;  3EIN A;  3EPT A;  4WET A;  1JZO A;  3EMP A;  4K2X A;  1XW6 A;  4JBB A;  1T3B A;  5IPH A;  2EFH A;  2HRK A;  3TJB A;  2L59 A;  2JSZ A;  1YEX A;  2E2G A;  4Z7X A;  4LL1 B;  1GSQ A;  3HD5 A;  3GA4 A;  4BA7 A;  4MF5 A;  2FA8 A;  4OFT A;  3D4M A;  1GSD A;  1HNC A;  2E7P A;  3ZL5 A;  4YAP A;  4BVX A;  5J4U A;  3FEU A;  6GST A;  3FRC A;  4HI7 A;  4O5U A;  3VWV A;  4F03 A;  4QL9 A;  1K0D A;  1FVJ A;  1M0U A;  2K8V A;  4PUR A;  2VLT A;  3F0I A;  1RW1 A;  3OR5 A;  3DYR A;  3BCI A;  3I43 A;  3TU3 B;  3C73 A;  4FQU A;  3Q18 A;  3DVX A;  4DVC A;  1U3I A;  3UAP A;  5KN0 A;  3NIV A;  2CV4 A;  4KA0 A;  1O85 A;  5G31 A;  4KB3 A;  2IN3 A;  3F63 A;  4EIP A;  1EZK A;  2DML A;  1Q4J A;  2PUK C;  2NDO A;  1ZOF A;  4ZB6 A;  2R5G A;  5AIX A;  3ZZX A;  1FO5 A;  1YJ6 A;  1EP7 A;  2K9F A;  2B1K A;  3A5W A;  4Q5Q A;  5AN1 A;  1Y25 A;  2H76 A;  1IYH A;  2EIQ A;  3GHA A;  2DSA A;  3O6T A;  4IVF A;  3EU4 A;  4NHZ A;  3APS A;  2GZZ A;  2H75 A;  1TRV A;  4HS1 A;  5JWQ B;  3UOM A;  2H6Y A;  4K5S A;  2CAQ A;  2ZNM A;  3C1S A;  1TK8 B;  4OWY A;  2VCX A;  7GSS A;  1WP0 A;  4MJA A;  2C8U A;  3GX0 A;  4FO5 A;  4N0Z A;  4MF6 A;  5B6N A;  12GS A;  5KN1 A;  4DSQ A;  4O92 A;  1M7T A;  2HZE B;  4E68 A;  2C0E A;  4L0W A;  3D0Z A;  4PX1 A;  4MZW A;  4EKZ A;  1GLP A;  1H4O A;  2F51 A;  4N30 A;  2F9S A;  2HSY A;  4G0K A;  2FD3 A;  3RHC A;  2HZE A;  2H73 A;  5JCG A;  5G30 A;  1GP1 A;  3KXO A;  4KSM A;  1G7E A;  1AXD A;  4N0V A;  1EEM A;  4CDO A;  3ZFB A;  4J57 E;  1ABA A;  2X64 A;  1TTZ A;  2GZY A;  5HR3 A;  5DAL B;  6GSW A;  5LD0 A;  3GNJ A;  3DKS A;  1M9A A;  1OYJ A;  1TI1 A;  3O76 A;  2G0F A;  3WGE A;  4CW9 A;  5G5F A;  3ISO A;  1XIY A;  1A0F A;  3GL5 A;  2CVB A;  3ZLP A;  1WE0 A;  5G1K A;  2DJ2 A;  4ECI A;  4HU7 A;  3LG6 A;  1TRW A;  3F4S A;  2CAI A;  3KGK A;  5IIZ A;  3GKK A;  2AAW A;  4TRX A;  2R0G A;  4NMU A;  1U6T A;  3A3T A;  2DJ1 A;  1M99 A;  2VL2 C;  2YJH A;  3RBT A;  1XVW A;  5CRW A;  1SK2 A;  1Y6E A;  2LNS A;  4OMV A;  5ELG A;  5CYY A;  4XRA A;  3ZVJ A;  1MD4 A;  5DDL A;  2I4A A;  2LJR A;  3ZIJ A;  2EFC A;  2VCW A;  2DKH A;  4F2I A;  1GTU A;  3UAR A;  4EVM A;  1OE8 A;  4JR4 A;  4V1A p;  2A2S A;  1HD2 A;  1SVO A;  1AQV A;  4X1U A;  3A2V A;  3CRU A;  3F3R A;  1RK4 A;  4GLT A;  5GSS A;  2QA1 A;  3PGT A;  1O8X A;  3ME8 A;  4GSS A;  1K0A A;  4YQM A;  2HSM A;  4ZB7 A;  5D9T A;  1N2A A;  1A24 A;  2H8L A;  2VL3 A;  2FLS A;  1MDK A;  3IV4 A;  2GT5 A;  4ICY A;  2WS2 A;  2AJQ B;  1E2Y A;  2I9H A;  2L57 A;  1BED A;  4WBJ A;  1VF4 A;  5J47 A;  1SKW B;  2DJ0 A;  4DSR A;  3H79 A;  3M8N A;  4RQR A;  4IP6 A;  4JU5 A;  4BPY A;  2VCZ A;  4MZC A;  2DJ3 A;  5HFI A;  3MDK A;  3FZ4 A;  3DVW A;  2L6D A;  4ZB8 A;  3P7X A;  3EE2 A;  2X4A A;  4L5L A;  5LCZ A;  2GS3 A;  16GS A;  5JCW A;  2EFE A;  4EXJ A;  2N5A A;  4WF4 A;  1ZYN A;  1MDI A;  4AJ8 A;  1F3B A;  4IEL A;  4GRF A;  2RM5 A;  4WR5 A;  5AGY A;  3LW9 A;  5FHI A;  1YF1 A;  4MH3 A;  2H1A A;  1K0O A;  3KH7 A;  4F9Z A;  3CWG A;  2L5O A;  4ZBA A;  5KEJ A;  2TRX A;  3KTB A;  2YZU A;  2H6Z A;  4K1F A;  3UBL A;  3LSZ A;  1SL0 B;  1XWG A;  3TKR A;  2BMX A;  2E2M A;  4V2L A;  4I2T A;  2HRA A;  5IMD A;  2O5V A;  5CO3 A;  1PRX A;  1XFL A;  4ECJ A;  2IMD A;  1HQO A;  4A5P A;  4IW9 A;  4O5Q A;  1URM A;  4HOJ A;  5DCH A;  3UVH A;  2PPT A;  2IIY A;  2VAF A;  1I5G A;  3HYP A;  2PVQ A;  1JZR A;  3G7J A;  3PPU A;  2LEG A;  1FB6 A;  5AIV A;  1U88 A;  2LV3 A;  1V9W A;  2YPM A;  2VUP A;  1N8J A;  1M2B A;  2M80 A;  2I1U A;  1Z3E A;  2J9H A;  2C3N A;  3CYN A;  3BJ5 A;  4ECC A;  1F2E A;  1X5D A;  3GN3 A;  3JCM L;  2X99 A;  1QFN A;  3IAM 2;  4HZ2 A;  1BG5 A;  4K0N A;  5G5E A;  5A4V A;  1LJR A;  5D8I A;  2XBI A;  4G10 A;  2G2Q A;  4ML1 A;  3CSI A;  4KDY A;  3G7Y A;  3APO A;  1B48 A;  3QCP A;  2WCI A;  8GSS A;  2CQ9 A;  2I81 A;  5D9W A;  3FHK A;  2MBT A;  3RPN A;  3LXT A;  4JRR A;  1S3C A;  4GXZ A;  4KCA A;  4J56 E;  2YV9 A;  2J23 A;  4TXO A;  2JU5 A;  4XS1 A;  4BWS A;  4HZ4 A;  1JLV A;  2LRT A;  1GL8 A;  3TJK A;  2YWO A;  1FOH A;  2GSR A;  4PQH A;  5DQS A;  3H1N A;  5IMA A;  2H74 A;  3HZ4 A;  2EC4 A;  2R0C A;  1PQN A;  1VF3 A;  1T4Z A;  3HVS A;  2CX3 A;  3L9S A;  5CP1 A;  5ECK B;  1R5A A;  2IMI A;  2IMK A;  2KP1 A;  18GS A;  4ZL8 A;  1MDJ A;  1T4Y A;  4MCU A;  1X0R A;  4QMK A;  4K8M A;  3KP9 A;  1TK5 B;  3VK9 A;  1QUW A;  3F4T A;  4FYB A;  5BRT A;  3GUS A;  5IQY A;  3FZ9 A;  4MPG A;  1KEB A;  3GH9 A;  3P90 A;  5GAP D;  1O81 A;  3KM6 A;  4JED A;  3EC3 A;  3MNG A;  1THX A;  3FW2 A;  4K7O A;  1W89 A;  1OC3 A;  4P3Y B;  3ZTL A;  5INY A;  3Q6O A;  3L9U A;  1PN9 A;  4IN0 A;  1PX6 A;  3N5O A;  6GSY A;  3M9J A;  3F4R A;  2FHE A;  2M72 A;  3FY7 A;  1R5P A;  3VUR A;  3HZ8 A;  1FG4 A;  3IK7 A;  1UN2 A;  4GQF A;  2DJK A;  2L4Q A;  3A2W A;  5A4W A;  2IFQ B;  4TXV A;  5EL8 A;  1X9S B;  4OO5 A;  5J4Y A;  2O85 A;  4ILF A;  4LA1 A;  1TXU A;  3IHQ A;  4AF2 A;  3TRX A;  3QR6 A;  1GTB A;  1X5E A;  4EL1 A;  4V2M A;  5IMV A;  5DBQ A;  3WD6 A;  2QSI A;  3D5J A;  2OE3 A;  4CY8 A;  1V58 A;  4RQX A;  2OBI A;  2B5X A;  2C1Y A;  3KMO A;  13GS A;  4G19 A;  1QQ2 A;  5B8A A;  4IKH A;  1GSY A;  3UEM A;  1SK0 A;  1G7O A;  4E8H A;  3QFB C;  3LYK A;  4IS0 A;  3M0F A;  1BG1 A;  2N5B A;  5E4W A;  5KOX A;  4EO3 A;  2XPE A;  3FZA A;  3D6I A;  1GTI A;  1XW5 A;  1S3D A;  4O7H A;  1GNE A;  1VRS D;  1ZZY A;  4DSS B;  5F07 A;  3LYP A;  4PNF A;  3DIE A;  6GSX A;  4POB A;  1Q98 A;  1TW9 A;  2RUE A;  1F3A A;  4CHS A;  1B8X A;  2B3S A;  3TJG A;  3CRT A;  2EIO A;  1GRX A;  1ZMA A;  1M2D A;  4DSS A;  1BQ7 A;  3H4K A;  3QAV A;  2GQL A;  3KIJ A;  3CMI A;  3TRQ A;  3D22 A;  3ERG A;  2H72 A;  4TR3 A;  9GSS A;  3LEF A;  5D93 A;  2KUC A;  2K8S A;  2BTO T;  2KP2 A;  4G0L A;  5LNK e;  2GT6 A;  2JSY A;  2GST A;  1VF2 A;  3R3E A;  1T8E B;  1Z7R A;  1N25 A;  4GWR A;  1FHE A;  4ZIJ A;  3DML A;  2NTO A;  2R2J A;  3IOS A;  4MNN A;  1TU7 A;  2CZ2 A;  4NV2 A;  2NBS A;  5EPF A;  5JWR B;  1YVL A;  3GL3 A;  4JE1 A;  3E9J B;  2IME A;  2PWJ A;  5F0G A;  1I9D A;  5CNW A;  3KTL A;  3C8E A;  2E0Q A;  1TOF A;  2B7J A;  4F82 A;  3IHG A;  5HQP A;  2MZC A;  3E3E A;  4K0G A;  2R0P A;  2NVL A;  4MJB A;  3EUR A;  2HE3 A;  1K3Y A;  2R3X A;  4HJ2 A;  3I69 A;  2OE1 A;  3VWU A;  5KN2 A;  2ON7 A;  3DXB A;  2C80 A;  2IWT A;  1NHY A;  4AKX B;  2JAD A;  4XTS A;  2HI7 A;  3QMX A;  1XCC A;  4MJE A;  2GDR A;  1M2A A;  5ABR A;  3GUR A;  1EOG A;  1YEP A;  2BJX A;  2YJ7 A;  5EY6 A;  3ZMK A;  1NSW A;  2XC2 A;  2WRT A;  3G7I A;  4K5R A;  5J9B A;  2B1L A;  3EYT A;  3IR4 A;  4MH2 A;  4EE0 A;  5DAL A;  4I6X A;  3TRP A;  3FK8 A;  2ON5 A;  3HXS A;  3GH6 A;  3LQ7 A;  1ZL9 A;  3BBY A;  4ZBD A;  2I3Y A;  1THO A;  4K9Z A;  2PMT A;  4KH7 A;  2HRN A;  4TW5 A;  4WXT A;  4IP1 A;  4MZB A;  4MPF A;  3I9V 2;  3US3 A;  1GSE A;  5ECL B;  5CRD A;  1Z9H A;  3KZQ A;  2O89 A;  4ACS A;  5ECI B;  4MK3 A;  4KUN A;  2IMF A;  3W8J A;  1SJI A;  4BWQ A;  1O7U A;  3GKX A;  1ML6 A;  4JR6 A;  5DVB A;  4G01 A;  5HFG A;  1WMJ A;  4NHW A;  4ZXG A;  4MMM A;  2RII A;  4WKW A;  1EGO A;  1CQH A;  4YKF A;  5IOX A;  3QFA C;  3L78 A;  3L0H A;  4KGI A;  1GUL A;  3GSS A;  4NXI A;  3ME7 A;  2MYG A;  1OC8 A;  4KSO A;  6GSU A;  4KND A;  3CTG A;  3R2Q A;  4ULX A;  5ECR B;  4IJ3 A;  1Z7P A;  4Q5R A;  1OKT A;  2AUV A;  2UZ8 A;  2FY6 A;  1FOV A;  4GSN A;  1LBK A;  1EOH A;  4ECB A;  1Z5Y E;  1OC9 B;  2QKE A;  3LJR A;  4AI6 A;  4L5O A;  3VPT A;  2X8H A;  2DKI A;  3CSJ A;  5A34 B;  2VIM A;  2F3M A;  4YQU A;  1OC9 A;  4LLR A;  2TRC P;  1FW1 A;  1HYU A;  4ZB9 A;  1OKD A;  2DJJ A;  2WGR A;  5HR0 A;  4GST A;  4GQC A;  3PIN A;  4F0C A;  1GH2 A;  5A34 A;  2DMM A;  3QAW A;  4GDF A;  3NZN A;  2A2R A;  1SJZ A;  2JL4 A;  1SU9 A;  1EV9 A;  1QGV A;  2RM6 A;  2HQT A;  1GWC A;  2ZCT A;  2OBK A;  2D2Z A;  5DJL A;  1V57 A;  3LWA A;  2R4V A;  1WOU A;  3FZ5 A;  2A4V A;  4XS4 B;  5J5N A;  6GSV A;  1ZGN A;  4V2N A;  1UA5 A;  5ECH B;  4Q5N A;  2QC7 A;  2P31 A;  2HFD A;  1GUM A;  2CVD A;  1B9Y C;  5A5H B;  3D21 A;  4TKY A;  2WDU A;  2AYT A;  4E8E A;  1C72 A;  2VL2 A;  2XBQ A;  4HUA A;  3DWV A;  5E59 A;  1G6Y A;  2K6V A;  2GSS A;  1GTA A;  1PKZ A;  1ERT A;  2HSN B;  1XOB A;  4YAV A;  3TB2 A;  2F8F A;  3V1W A;  2LRC A;  3TCO A;  1CQG A;  2LUS A;  2VKZ G;  1DE1 A;  1ERV A;  2O87 A;  4POK A;  2OE0 A;  2AHE A;  5C04 A;  3HY2 A;  3UIW A;  1XPV A;  4I97 A;  2HSN A;  4YH2 A;  2M46 A;  5CRE A;  4G0I A;  5IO0 A;  3KEB A;  2H1L A;  4K7I A;  5COH A;  4MP4 A;  1GNW A;  5G2Z A;  2DIZ A;  3VPQ A;  5ECO B;  5BMU B;  2AB6 A;  4L8E A;  3L4N A;  5KN3 A;  3UJ1 A;  3I6A A;  3TKS C;  3ZRD A;  2VM1 A;  1T00 A;  1SL2 B;  3ED3 A;  1ERW A;  3IDV A;  3M3M A;  4I8B A;  2VOC A;  2LST A;  5BMU A;  2N5F A;  2YWN A;  2GZP A;  14GS A;  1GLQ A;  1SVM A;  1TU8 A;  5ECN B;  1GSU A;  4DEJ A;  2A2P A;  3L9V A;  4LMV A;  4KCE A;  3Q19 A;  4EC0 A;  5IO2 A;  2HSH A;  3F3Q A;  1PL2 A;  2O7K A;  3J7Y b;  1FVK A;  2OA7 A;  1DBY A;  1OVN A;  1AC1 A;  1JFU A;  3IPZ A;  3GMF A;  2IL3 A;  2OAC A;  2C0D A;  3DEX A;  3ZVJ D;  2VLV A;  1SL1 B;  1J9B A;  4FH8 A;  2DIY A;  3TKP A;  5D73 A;  4PQ1 A;  3KJY A;  2H01 A;  4ISD A;  4NAX A;  3F8U A;  5CRH A;  4XHM A;  3WGX A;  1NM3 A;  4FIW A;  2FUG 2;  2MMN A;  1XZO A;  4ID0 A;  1O73 A;  2GSQ A;  3E0U A;  1FB0 A;  1XW9 A;  4Z2U A;  5J41 A;  2IPA A;  4ML6 A;  2WJU A;  3CTF A;  3GV1 A;  4Z2T A;  4NPB A;  2P0G A;  4TR1 B;  3LFL A;  2XHF A;  1K3L A;  4W66 A;  4AJ7 A;  4EDZ A;  6GSS A;  2HXK A;  1GSS A;  5FT3 A;  1R4W A;  2ALB A;  4AKH A;  5A5K A;  3ZYW A;  4I5Q A;  4XRD A;  1AAZ A;  4MLY A;  1Z6M A;  3KP8 A;  3TJF A;  2P5Q A;  1BAY A;  4N11 A;  1AW9 A;  3UMA A;  3H8Q A;  3FR6 A;  3GKN A;  5DQY A;  2MBS A;  3EVI A;  1DUG A;  3TOT A;  1E6B A;  2PER A;  3KD0 A;  4HEA 2;  4RUV A;  3LOR A;  1HNB A;  3PH9 A;  3ERF A;  1A8L A;  1X5C A;  2KHP A;  1JZD A;  3TKQ A;  3BOA A;  2IFQ A;  2V2G A;  1ERU A;  1JHB A;  5CAX A;  1WIK A;  4OD7 A;  1KTE A;  1BJX A;  3RHB A;  2VM2 A;  2GTU A;  3W8S A;  4D73 B;  2VCV A;  2WZ9 A;  3HJM A;  3FYG A;  2LJK A;  1BYE A;  1SD9 A;  3HCZ A;  4G9H A;  1EWX A;  1OE7 A;  2HRK B;  2FCH A;  1PN0 A;  5A1N B;  4D73 A;  4IJI A;  5HFK A;  1SYX A;  1ZYE A;  4PTS A;  2GQK A;  3C7M A;  1PA3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...