4EDHA

The crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with adp,tmp and mg.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
208
structure length
208
Chain Sequence
TGLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVEIGLARAAARGRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLERLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with ADP,TMP and Mg.
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
molecule keywords Thymidylate kinase
total genus 88
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4edhA00
1QG4A 1QHYA 3KKMA 2HUPA 3FMIA 2D74A 3TK1A 5EE1A 2ZRJA 4PC7A 3T61A 1H65A 4HEJA 4QC2A 3IILA 2FGJA 3KB1A 5KSZA 4ESHA 4YMTA 3U61B 3A8TA 1ZC3A 4Y0VA 2A2ZA 2YC2C 4OQLA 4ZIRB 1HQCA 1E2IA 2XAUA 1BYIA 1OFHA 1Q44A 2D2EA 2HYDA 4QRHA 1FZQA 2EWWA 3IUYA 1MABA 4BLOA 1E9CA 3OIYA 2QTVB 3L0PA 3SOPA 2GF0A 4WZ6A 3UIEA 4JLKA 3GLIA 4GBMA 3QKSB 4AURA 3OIVA 2QGNA 3VU9B 5F2EA 5EZ6B 1IAQA 3L8ZA 4C2TA 2ZVPX 5DISB 5FOVA 1CR4A 2J87A 3B60A 5EP3A 1JJ7A 1FX0B 1T9HA 1XCGB 2NZJA 4NYIR 4URXR 2ODWA 2ODEA 3DL0A 5HR5A 5KU1A 2W0SA 3W3AA 4I1UA 3IDQA 3L43A 2C77A 2V9PA 2WIBA 4V0NA 4TSFD 3W6PA 3LAWA 1OT3A 4JSTA 5E4FA 4ZKDA 5FBLB 2VP0A 1NF3A 4EUNA 3T34A 3L0IB 2ZI3A 2VRWA 4MITA 4AYTA 1XTJA 3ND9A 3BAFA 1M7GA 4UNPA 1MO6A 3QXCA 4V03A 2VBCA 5EXPA 5FUWA 1P9NA 3H2YA 2AL7A 2D7DA 1IOZA 2BBSA 2PLFA 3QPUA 3ZIAD 3A4NA 2DFNA 3B7GA 5E7MA 1KSFX 2PCLA 3MMPA 3Q3JB 4EPRA 4IJMA 3WNDA 1CJTC 3BBPA 3B1ZA 2ATVA 4YMWA 4DSOA 4BFYA 5KHOC 4LSGA 4ZV4A 2Z43A 4L9WA 2H16A 3IHWA 1J90A 3KXKA 1PLLA 1XTKA 3PG5A 4TLCA 4Q4LA 2IT1A 2VSXA 3VQTA 1HEIA 3RC3A 4IOMA 4GRAA 4WIAA 1G8FA 1JALA 5FOUA 1OB2A 4JJKA 4KXFB 1HE1C 1U0JA 1VPLA 5FPYA 1L4UA 4US0R 4HSEA 5KPDA 1Q3TA 4R98A 3RLFA 1AGRA 1XEFA 4B35A 2OESA 3B1YA 4TYPA 5FPHA 4HAYA 2AX4A 3SC3A 1KZ7B 2BEJA 1G3IA 4NYIQ 1VCOA 3RDPA 4D6PA 3CRVA 3M4YA 3U60B 3OAAA 1KDTA 4HLUA 2XEXA 4Q1CA 2IYZA 4TYQA 4RFSA 1W0KA 5L3SA 1UPTA 4BLRA 2FDCA 1JB1A 1Q22A 2HYIC 3TAHA 3TE6A 3L0SA 2CVFA 3RS3A 1G3MA 2C8VA 4LBYA 1QVRA 2VF8A 2ZITA 2GEDA 1E2HA 3CUEF 1KI4A 1W4AA 3CWZA 1KMQA 3TR0A 3SQXA 1E9EA 4BFTA 2B21A 2IYXA 2LWIA 5C1BA 1EFTA 3CPHA 2ZU6A 5FPTA 1T91A 1Z6TA 4G5RA 3X1DA 1A2KC 3FFBA 1R2QA 5HZHA 5BQ5A 1SXJB 1N6NA 1TL7C 5EUMA 5JHGB 3KQHA 3THOA 5KSYA 1V43A 3GLGB 2CE2X 3K0EA 4DB2A 1W1WA 4NU0A 1TUIA 4B2LA 1KI9A 1M7HA 1FUKA 1HURA 3RS2A 1QZXA 2FU5C 2IYLD 3MGCA 1M74A 2A78A 3ZD7A 1YZKA 3PVSA 3ZS8A 1KMHA 2DWPA 3G5UA 4MYHA 5EE0A 4C0LA 3U4QB 1VYTA 2WWFA 4D4KA 5JECA 4A0FA 1CEEA 4JL8A 1SVKA 1AZTA 1XWIA 4DDUA 3W6NA 3J81k 1ZP6A 2RGNC 4DZZA 3CW2A 3OIWA 2YINC 3K0FB 1GFIA 1ZMXA 3M1IA 2AR7A 1CJKC 1DBSA 2VSFA 4HI0E 1OH5A 1WP9A 1W36C 4DSTA 4ACBA 4ILEA 1U2RA 1RKBA 1GUAA 1XD9A 1GVNB 5FTLA 2O8DA 4EAQA 2REXB 2CLSA 2P67A 3BH6A 1W48A 2QA5A 2ZS9A 2O8CA 1Z2AA 2DYKA 2OE2A 1XBTA 3QNUA 4LUCA 2W2XA 2NO6A 2A5YB 4HUQB 2VIIA 2IA5A 2IYSA 3U4QA 2H18A 3KJGA 4MA4A 4PHGA 1GL6A 1KNXA 1OPXA 2NO9A 4AD8A 3EPLA 3TLXA 1N2CE 1P5ZB 2R6FA 1BIFA 2PLRA 1Z06A 1KSGA 4DLTA 1KJWA 3HU2A 3KTAB 3FMPB 2F3RA 4O0MA 3CR8A 4A8JB 3SR0A 1CF4A 1NLFA 2QAGC 1PLJA 3M6AA 4IDHA 4Q21A 2V4ZA 3X1WA 2DB3A 1VTKA 1SXJA 1JR3E 3QY0A 3RRMA 4HAWA 4LCBA 4EPWA 2NO1A 4KSCA 5HZKA 5KDDA 3C7KA 1Q20A 3VU9A 4IRUB 2WWXA 4M1TA 4ZDWA 3OFNA 5HKKA 1ZINA 2QL6A 3EWAA 4XVQA 3AVUA 3RS0A 3TIFA 3I5YA 1MO3A 2B6HA 3SHFA 3N2IA 5JI3E 2QN6A 5TXGA 2QE7D 3VKHA 4RD3A 3QG5A 3O8RA 2CHQA 5CDFA 2QI9C 1S3SA 4B6EA 5EJEA 2GA8A 1ZUHA 1R7RA 1EX6A 3WRYC 2IYWA 4B48A 2QORA 4D0LB 3AVYA 4B34A 2IUSA 4J0QA 4NYJR 5AJYA 1KDRA 1N0VC 4Q4AA 4RKFA 4QJ5A 2PZFA 5JRJA 2ZYUX 3CONA 3EZ6A 2FWRA 1Z28A 4MKGA 4Q5IA 3E1SA 1G18A 1P72A 4FIDA 2DWQA 2OCAA 4BFWA 5AUQA 2YWEA 3IBYA 3UATA 1G16A 4ZPXA 3CNLA 2QSYA 5AWFC 1R0WA 4LJ6A 4NYJQ 5KOYA 2B92A 3BFXA 1E2EA 1N6HA 1XEXA 2BOVA 4IVRA 4NL4H 4OHZA 1XZPA 3TVTA 1TU4A 4M8NE 3D3QA 2HJVA 2CHGA 5DHAA 4JBYA 1G17A 2C9CA 3F8TA 1E9AA 5J4HA 3NG1A 3EASA 1UKYA 4G01B 4JLAA 2MSDB 1YZNA 1G291 2GK7A 4JLBA 4OJQA 1ZD1A 4E07A 5AJVB 4E22A 3TUZC 3BRWD 2ECKA 5CJ2A 3LXXA 4DCSA 3EC1A 2E87A 1UKZA 4HLCA 2ZJAA 3AM1A 1SKQA 1D9ZA 1EFRD 4LOAA 3I5XA 1OH8A 3SN6A 1AQUA 3CF6R 3C16C 2ZJBA 4URUR 1NKTA 4TMWA 1EX7A 3RWMB 4E03A 2QP4A 4JSYA 2R6GA 1MOZA 4DKXA 1MKYA 3WYFA 4OKSA 1ZU5A 4IDNA 1W36B 3ZVNA 1TUEA 2H92A 2JLQA 1E9BA 4RD0A 3EPHA 1E79A 3REFA 3Q72A 1OHHD 3W3ZB 5DI3B 4TL9A 4X8MA 2REOA 4B44A 4AK9A 5F98A 4M4SA 1IY1A 2XTNA 5CIWA 4B32A 4P31A 1Q12A 4R7ZA 3UKDA 2EU8A 5DI9A 3K09C 2X77A 5CK5A 1JXMA 1P2UA 2C04A 2R65A 1II9A 1H8EA 4D80A 2JATA 3A1SA 4TTRA 3FPAA 3Q7PA 1E2NA 2BWJA 1CBUA 1ZIOA 1OXXK 3CX7A 3MLEA 4FMDB 4ZCLA 4DDTA 1TQ6A 2JJ2D 3P32A 1EK0A 4OL0A 1LF5A 1Z0IA 4MRVA 1A1VA 2IEZA 4D26A 2WOJA 5IT5A 3MG9A 2R6AA 1UBEA 1YRBA 2ZI9A 1DAEA 3GEHA 2ZREA 5JLJA 1CXZA 4CEHB 4YMVA 4HZUA 2GCNA 3HJNA 2L0XA 1PV4A 1G20E 1NBME 3QENA 1W46A 1OSNA 1VCNA 5J4KA 5TV2A 2NO0A 4BEBA 5B2ZA 4QGHA 4IKEA 4B2PA 2GVDC 1OV4A 2CCGA 3SFVA 3GJ7A 3ZGXA 2ZSBA 4KFRA 1SXJE 5FBWB 4G5GA 4KFUA 1P75A 1GNRA 2NGRA 3LW8A 2GXQA 3AKDA 1YR6A 4PO1A 1OIWA 1QHHA 2R6DA 2WPDA 2F1JA 3FYHA 3QPWA 2PZEA 1CP2A 1E69A 2D7CA 4OI1A 1Q1EA 4GP6A 2FPMA 4M9XA 5JWHA 3FWYA 4C0KA 4EQ6A 4E5UA 3IPYA 1M34E 4A8JC 4BFUA 3T1VA 5SZIA 1UKEA 4GOJA 3CWQA 5FUXA 5IK2D 4DCVA 1HT2E 1SHZA 2VPPA 3R7WB 1IN4A 4GT1A 4URYR 3SFZA 4DUGA 2WICA 4V0LA 1E9SA 5KO2A 1CJMA 1BKDR 4V0KA 2WKRA 4GZMA 4CT5A 1ZAKA 1OKKA 2Q6TA 3CRRA 1VHTA 3FMOB 4KLZA 5BXQC 4D82A 1T4GA 3NVAA 4TLDA 2OUKA 1XPUA 4WW0A 1AIPA 1W4RA 5EZ5A 1OB5A 2FSGA 5FBRB 1Z22A 3FOZA 2XTMA 1GP2A 5FH9A 2GCOB 1G3UA 2PZGA 2WV9A 1B0UA 4QHYA 5D3QA 4A9AA 4AYXA 2BM0A 4FW9A 4OI2A 5JSZA 4XWAA 5TY0A 1CR2A 4WVFA 3CRMA 3H1TA 5AJWA 4D2IA 4ASUA 1NVVQ 1ZCAA 4M1OA 1RE0A 4XH9B 3OE7A 5KPJA 5L3SB 3CNNA 2GZAA 2QMEA 2ZR0A 3B78A 4M21A 5G3YA 3DM5A 3U7FB 1IM2A 1ZNWA 2XZOA 2GETA 2VQSA 2F9LA 2PT7A 2BBWA 1Z47A 5M04A 4H1UA 1JEEA 4JBXA 1LW7A 3SYNA 2PEYA 2CMKA 1V5WA 4FCWA 2GESA 2WTUA 5F3WB 3I72A 2QENA 1XXHA 2QE7A 1MRNA 5L3QB 1UF9A 4TQUS 4MGYR 4TYWA 3IO5A 2PJRA 1RRGA 1Q1BA 5CK4A 1OW3B 4NONA 5DO9A 3CB4A 4RD6A 3TMKA 2MSCB 3FDIA 4XTCS 2ZI6A 1N0UA 1IJFA 3JVUA 1JNYA 5DN6A 2P65A 1EGAA 2YNMA 2LCFA 2GCOA 2WPDD 3BFVA 3GLFE 2VL7A 4PO8A 5H68A 4DT1A 4HB4A 4U02A 1KJYA 4TMVA 1XJQA 3VFDA 5AUPB 4XD7D 4POAA 4DLYA 3B6EA 1UDWA 2RGNA 4I81A 2J45A 5GADl 2GZDA 4HAUA 4QGAA 4H1VA 1ZNYA 4XVRA 1Z6GA 1E99A 4PANA 2F7SA 1KO4A 3X1YA 3FVQA 5C4MA 121PA 1Z8FA 4EPVA 2A5GA 3EAQA 4LJAA 1SVLA 1X1RA 3C15C 2F6RA 4PTLA 4W5HA 2ZTSA 3VX3A 1NG1A 3Q85A 4R71A 4Q1FA 1HV8A 3E2IA 1HE8B 1U0HC 4TN1A 4DB4A 1FFHA 3CO5A 5J47A 3THYB 2ZRIA 4G3XA 2IYVA 4X8HA 4BPBA 1UBGA 1XTSA 2BJWA 1W49A 2B8TA 3P27A 4A2WA 4JLNA 2G1JA 2ZIAA 5DIFA 3VKGA 3TNFA 4LHXA 2JAQA 3UG7A 3GPLA 3A1WA 3BJIC 1Y3AA 3K8YA 3B9PA 2WAXA 3OIUA 3KJEA 4PX9A 4Q9KA 2VEDA 4PQRA 1JR3A 4B3FX 4JLPA 4JS0A 1TQ2A 5JMTA 1OJLA 4O3MA 4ZI2A 3VR3A 3DKPA 5FBQB 3TW4A 3K0AB 1N6RA 1TU3A 2ZRHA 5HE8A 4B73A 3N5CA 4M1MA 1KIMA 2EYQA 3ZQ6A 2ZS7A 4XWKA 4BRWA 2KSQA 1WQ1R 1E9RA 4AWXA 2BBOA 3D8BA 2BM1A 2R44A 4Q9JA 3BIFA 1KDOA 2BV3A 2VP6A 5HCIA 3CZPA 3UWOA 3GEIA 3ZJYA 2ZU0C 4DWJA 4QGFA 1LV7A 2PEZA 4XD7A 4Z8YA 3I61A 1EESA 2D2FA 3UMFA 3RABA 2GAAA 3BB4A 4MGIR 1DG1G 2I4IA 2FF7A 4LYHA 3SHWA 2A30A 5DHFA 5AR1A 1QHXA 3LBNA 4PFSA 1K8RA 3HYRA 1UEJA 5G40A 1XDBA 3LBIA 4DLXA 4XWOA 2P0EA 3SS8A 4DLWA 3GLGE 5FFMA 2CL0X 4BLQA 1U99A 2N46A 521PA 1T6NA 4B71A 3H84A 4GOXA 1N6IA 2EFEB 4B3CA 4Q4AB 2AD1A 3B9QA 1BS1A 4HLQB 3VR1A 3TQFA 4L5BA 1KI6A 2BKUA 5TMPA 2G0NA 5A0FA 1ZM7A 1GKYA 5IDVA 3MRSA 4ZDJA 5JI2E 3LDAA 3LY5A 3LVQE 1GRNA 5C2JB 4LYFA 3BC1A 4C0SA 4QNRA 4TL7A 2QAGA 4U5XA 3IIMA 2IUUA 4A4DA 4OI0A 4B3GA 3QKRA 3RS7A 2QBYA 4JKIA 3QBVA 1KTVA 3W5JA 4P4UA 2C9YA 3QE0A 4R9UC 3DMDA 2XZLA 1N6PA 4LRWA 2ZANA 4OHXA 3O47A 4B47A 3I62A 2GXUA 3K0CA 3QKSA 5FTKA 1F5NA 5DYGA 2VLIA 2C78A 4NCKA 3TAUA 4BFVA 2ZYTX 2YWGA 3AKEA 3ICEA 4E09A 1EG7A 1XU4A 1NLYA 2BMJA 3MAAC 4Q4HB 3ADDA 3I4LA 3IIKA 2CNWD 2W6ID 4LPKA 2XJ9A 5K8IA 1P60A 5KNCA 4S2EA 2FFQA 2RAPA 1RRFA 2KJQA 4W5WA 1JR3D 1OXSC 2BMFA 1H8ED 1FNNA 4WOPA 3U5ZB 4UJ3A 4W5JA 1T3LA 1Q1ZA 2V3CC 3ADBA 2F1IA 1P61B 2KI5A 4M9QA 4QBHA 2AKAB 1F2UA 3KQLA 2VHUA 4G0NA 3PXGA 3AV0B 1EXMA 5BN3A 4RCYA 2O5VA 2V8OA 4MKHA 3L0OA 3GD7A 3K9HA 3SI7A 1KHTA 4OQFA 3RYTC 4I99A 4LHWA 1DOAA 2OFWA 3W9YA 1N6KA 1G19A 1L2TA 1Z0JA 1BH2A 3OFND 4ZIRA 5GVRA 3Q5EA 4PHFA 3UG6A 1S4QA 2ZUCA 4PZZA 4D0GA 4HUTA 3U44B 2O8EA 4ARZB 3EA0A 1XMIA 2D62A 2XITA 3CIOA 2ZS8A 3VR5A 3RHFA 4Z51A 4MKIA 3TGPA 2REBA 4OK6A 5ANRB 4B3DA 3QSYA 3T1QA 1E1QD 1E32A 1N3BA 4LPSA 4OJKA 2ZRLA 2J7KA 3G82C 3O8DA 1RFLA 4N1AA 1KK2A 3BFKA 2PBRA 1CJVC 1NVVR 2IYRA 1KGDA 2ASEA 3E5HA 1M6NA 4NCIA 2C2HA 1N25A 3WHLA 5FL7D 2DBYA 1L4YA 5FPSA 3QF7A 4B43A 2Q0HA 4QL3A 1U8YA 4YDSA 4BASA 5K8TA 5FTNA 6Q21A 5K8LA 3PEWA 1A4RA 4PPFA 3DZDA 1T5LA 2EYUA 2TMKA 3KTAA 2NMVA 4OQNA 1TADA 4PQYA 4L4UA 4A8JA 1QVAA 2DPXA 5IRCD 1JR6A 3TH5A 3FE2A 2XXAB 1H8HA 2WJIA 4GL2A 3DO6A 3JZAA 1VYVA 4NZYA 2V55B 5G3ZA 1W7AA 2AFIE 3A58B 3CPJB 4GP7A 4UQOA 5FL3A 2CHVA 3R9XA 1G3QA 3AB3A 1OKKD 3CF2A 4RD2A 1CRQA 1UBFA 2CJWA 3HU1A 1DAMA 2XB4A 3OE7D 5D3MB 1A2BA 1P6XA 2VP9A 1SULA 3QF4B 3NC1C 4AKIA 3NBYC 3RANA 5CITA 2ZRCA 4DLSA 1NMXA 2NG1A 2OV2A 4UXIA 3TW8B 1BMFD 2CL6X 3NKVA 5TVKA 2K5UA 1JAHA 3NWJA 4LYAA 4I1OA 1KYIA 4RCZA 2YWHA 2ZRDA 5H1YA 1X1SA 2AKYA 4IW3B 4Q1BA 3FHOA 2C9OA 2WZQA 4DXAA 2NPIA 2GBLA 2XNSA 2YJTD 4BUJA 1XPOA 1DVRA 4NCHA 4YQFA 2FV8A 4LV5B 4US2R 3X2SA 1NLZA 2PMKA 2A5JA 3WYGA 3SYLA 1T0JB 1YVDA 3NEYA 1HT1E 3QG1A 4ON9A 1Q1QA 2JA1A 4LJ4A 4JLDA 3THXB 4A6XA 4K8OA 4AG5A 1P9WA 1IXZA 3KQNA 5FI1B 1FUUA 3VNVA 2ZVQX 2JLXA 4M9ZA 3PEVA 1IBRA 2GJ8A 3T1TA 1US8A 2GAOA 1DTSA 2CJWB 4NH0A 3KFVA 3QKTA 4TT3A 1GKUB 2Z6VA 2ZRNA 2KE5A 3ECCA 4OHVA 4KBFA 1A7JA 2BKEA 2ZSDA 1TF7A 3VKWA 2CBZA 2F1HA 1RPZA 3CH4B 1OE0A 2OM2A 4GMDA 1E2PA 1KDPA 1NN5A 5TB5A 3U44A 1X6VA 5F9HA 2GCPA 4URZR 3GLGA 4QM7A 1XX6A 2PT5A 4TWZA 4EDHA 4B74A 2PJZA 1IY0A 1ZM2A 1P4SA 2ATXA 1JBKA 4PC3A 5EQTA 1G21E 1SQ5A 3AVWA 4I1VA 1S9HA 2B7CA 2ERYA 4LC0A 3EZ9A 4Q1DA 4V0MA 1G7TA 4C0JA 1H8HD 1DAKA 1T8UA 2OLKA 3IKJA 4IVPA 1GIAA 1GITA 1O3YA 5CLLA 4D0NA 1TX4B 2FZ4A 5C18A 1U9IC 5L8VA 3I3SR 4EPYA 1DO2A 2R9VA 2AXPA 2YOFA 1T5IA 2ZJYA 1GDDA 1VG9B 3K9GA 3UMSA 5L3QA 4OBEA 5EE9A 2IYUA 3HWSA 3LQRA 3NH6A 1Y63A 1S3GA 4BLSA 3TKLA 3U3KA 1SVMA 3LNCA 3GLFB 2IC5A 3CKLA 3EIHA 2OAQ1 3EPJA 5KYKA 1U81A 2PMDA 4OK3A 5FOWA 3DPUA 3IIJA 1KY2A 1BYUA 3ADCA 1XTIA 4DCNA 1TMKA 2FPLA 3AF1A 4OHWA 3A4MA 3WP0A 2VP5A 3ASZA 2HLDD 4LY6A 2I3BA 1XF9A 5EP4A 4P4TA 4X8LA 1LNZA 4QHSA 2HJGA 1IXSB 2FSFA 4NYMR 4A2QA 1ZM3A 3A37A 5CLQA 3KL4A 4CF7A 1J99A 4TMZA 1D6JA 3RAPR 2JLWA 1KKLA 1IN6A 1UKVY 3LX5A 4AC9A 4RJLA 3BS4A 1P7CA 4H9GA 4LK2A 4NP6A 2QTHA 1TF5A 4HUQA 4LBWA 2AHOA 1F60A 4C2UA 3A1TA 5CM8B 1XCPA 2WM9B 1SGWA 1NN0A 2PX0A 2VP4A 2ZEJA 3GLIB 2DFKB 5E7JA 3ZD6A 3THWB 1S1CA 1MO4A 1YZLA 2R2AA 5A5GA 3KX2A 4KODA 1ZIPA 2VO1A 4DLUA 1JI0A 3UK6A 1DS6A 1RRPA 2X1VA 4MYUA 4G5OA 2VHTA 2QUZA 1K6MA 1LTQA 3LXRA 4CEJA 3WNBA 1D9XA 2G1KA 3K70D 4PHTA 1XMJA 1AQYA 1G64A 2CCJA 3LRPA 4MUAA 1XJCA 3HYTA 5KTYA 1XXHE 3FMFA 2V54A 1HH4A 3LBHA 4KVGA 1M8PA 1NY6A 3CX8A 1XMSA 2Q3HA 3H4MA 1NY5A 1W4BA 1E0JA 1FTSA 2WBLC 3SE0A 3TR5A 5L3RA 1WBBA 5DE3A 1AS0A 1Z3IX 2PH1A 2EFHB 4BWYA 1R8QA 3P26A 4Q9IA 4KSBA 4ZI3A 3I1FA 1XMVA 4QM6A 2RGXA 3U6BA 1GL9B 2JLRA 3UWKA 3C8UA 1YZTA 4URWR 4HLDA 4HAVA 3BERA 4LYJA 3VR2A 4Q1AA 5CJPA 5CYOA 3VNUA 1NRJB 2IL1A 1NBMA 3BB1A 2WWYA 3LQQA 4MDFA 2XB2A 1ZVQA 1VDZA 2FZLA 1Z6AA 1IN5A 3BH0A 4W9MC 3EC2A 2CEAA 4F7WA 1J8YF 2IWRA 1Z07A 1K5DA 3WRXC 4Q9HA 4AY2A 2ZRMA 3SJBA 3WBKA 3EXAA 2FFHA 2HLDA 3R9WA 1WBDA 1NL3A 2ZRPA 3TRFA 1S1MA 2EQBA 2YC4C 4MUBA 3TSZA 2R8RA 3GLHE 4OI4A 5TARA 1S8FA 1E0SA 4PAOA 4ERNA 2JCSA 1G7CA 2IYTA 2OZEA 3OESA 3QI2A 4JJZA 5DYIA 4A6PA 2ODBA 3N2EA 4EFLA 3ADKA 3GP8A 5P21A 4C0BA 4CZ2A 1XFAA 3T5GA 2RGEA 3O8BA 1G7RA 4QGGA 2Z5FA 3HU3A 3WNCA 1NG9A 3JZMA 1LVGA 1ZM9A 4ZCMA 3P1JA 3QQ5A 1G8PA 1GILA 1P2VA 4HDQB 4OQXA 4DLRA 4F91B 4Q7MB 4P33A 1KJZA 3IQXA 2G77B 3C5CA 4OK5A 1QHSA 2H1LA 1KSJA 1E9DA 1NP6A 2KBEA 2OHFA 4O25A 4DJTA 2ZI7A 3O8CA 4PZLA 1OIVA 4II7A 3IQWA 1EFUA 3F3YA 2ZE7A 1X8JA 3QF4A 4F4CA 3WHKA 3D31A 3RRZA 1GRRA 4IDOA 4GDFA 2BDTA 3UPUA 3CLVA 4DCTA 5JWOA 1PUJA 4MRSA 1QBKC 2CDNA 5KSPA 1VG1A 4DHEA 2WKPA 2WAYA 3B5JA 4ARZA 3GLHA 4N0EA 5HPYB 2YYZA 1KO1A 4KU4A 4FI3C 2ZRFA 3P20A 3X1XA 5IHPA 1FMJA 3NBFA 1X86B 2G88A 1XEWX 2N42A 4KAXA 3KB2A 2OBMA 4C0AC 1CU1A 2NOAA 3ZVMA 2QQEA 2ZAOA 2JASA 4F93B 4MH0R 2JLZA 3FFAA 2RGBA 1HUQA 1YHNA 2P5TB 4Q00A 4BLTA 3AF4A 3L82B 1TQDA 4JZKA 4Y0AA 2YV5A 3EARA 2IW3A 1ODFA 3B85A 2J0UA 2FEMA 4QXAA 4UNRA 3GMTA 5E95A 1E2QA 1FL9A 4P4SA 4YONB 2O8EB 4L8GA 4AKHA 3DOEA 3R8FA 2WMOB 4XVUA 4G5SA 1CR1A 3CR7A 3QEOA 4US1R 4RFSB 2D06A 1GWNA 5B30A 5FOXA 2GHIA 1YQTA 2H17A 2P6RA 4UXJA 2IBMA 3PFIA 1W36D 2BEKA 1N5LA 2G6BA 2ANCA 4YMSA 3VMFA 4YLGA 4DLZA 4RZ2A 2HDNB 2C98A 3BGWA 1Z63A 2FA9A 4N0DA 1YZQA 3KZ1E 1FP7A 821PA 1ZNZA 4F92B 2FMXA 2JGNA 3IO3A 3QKRB 1Z29A 3AH8A 2R62A 4Q01A 5HE9A 2A7QA 4CGZA 2QROA 4CYMA 2FPKA 3TVDA 3C4JA 1VIAA 3AVOA 4PC2A 4JLOA 4Q47A 2EFGA 2W2TA 3CNOA 2KB0A 4LX0A 2JJ1A 3NHBA 4BE7B 3PR1A 5FTJA 1E1QA 3KJIA 4EQ6B 3U3OA 1MO5A 4JL6A 4CIDA 1KY3A 5EE3A 2OCPA 4FMCB 3FKSD 4BLPA 1GM5A 4QBGB 1R0ZA 3H86A 1ZCBA 2G9NA 5D3MA 5AUOB 3MWLA 4Q1EA 3ZZTA 2KWIA 2ORVA 4NDZA 4M1WA 4DDVA 1RIFA 3K9NA 2UKDA 2DY1A 5KDLA 5J4VA 4PPGA 4P32A 2IS2A 3R7WA 1TEVA 2G0TA 2J0QA 1XEWY 1MABB 2IUTA 2RMKA 1K5GA 4HLUC 2J7PD 1UM8A 2MSEB 1R0YA 1UFQA 1PLKA 2E1RA 2P3SA 4BFXA 4IEEA 5LB4A 2X2FA 1JEDA 2VHJA 4C7OB 4NHOA 3V9PA 4TZ6A 1KZGB 1ZD8A 2O8FB 1G5TA 3EW9A 1I2DA 1AA9A 3MD0A 3MWKA 1II0A 2AD5A 3NC0C 4YMUA 4MRNA 1R10A 3U7HB 3I32A 4YC7A 1NIPA 2C96A 4JVSB 2F43A 4BEJA 1KK0A 3QVVA 1LY1A 2OBNA 5JWRA 1O87A 2GKSA 2G83A 3DZ8A 2GTPA 1G5PA 1TAGA 3N70A 2ZM5A 2QMOA 5JJKA 2CVHA 3RC8A 1WF3A 1L7VC 3SU8A 3V4FA 4LGMA 4ZCIA 4JLVA 3X1ZA 4TYYA 2DWOA 2IS4A 2W2VA 3K9LA 3DOFA 3HPQA 1KK1A 2QY9A 3A36A 3ASYA 1DAGA 4D4JA 4HB0A 1CR0A 3LVRE 3QKUA 4M9SA 1PVOA 4IDQA 1TQ4A 2ZR7A 5KDOA 3NDBB 2C99A 4CEJB 5CM9C 5GVSA 2OXCA 4P0TA 5FI0B 4FINA 2J59A 3K0AA 1Q0UA 4DBLC 3AGPA 2FFAA 1GL7A 4R2IA 4BECA 4Q7LA 4XSGA 3QBTA 1I4TD 3W8RA 2I1VB 1DADA 5KNDA 1AM4D 3W34A 3OEEA 3ETLA 5JHHB 3AVXA 2ZRGA 1FNMA 1FTNA 2RGDA 4LBZA 2WJJA 1NNEA 2FE4A 4DT1B 5FOTA 3UANA 5BN4A 2RGGA 2XOKA 2JLYA 1OH6A 3VR4A 1ONBA 4CEHA 5DH9A 3PQCA 1NJGA 1P62B 1D2EA 2Q21A 4M1KA 2I1QA 1F2TB 2ZJZA 2FSIA 1Z08A 4Q7JB 3FTQA 2ZJOA 3IBGA 2GJ9A 2WSMA 3U7EB 2A3RA 2Q3FA 3W5IA 3SEAA 2VA8A 3R9IA 5L3VA 3AP1A 4MYTA 3T35A 2BVNA 3WMEA 2SHKA 3GJ4A 4WAUA 3T15A 3C5HA 1WMSA 2WSSA 2ZE8A 2CXXA 1G6HA 4PXAA 1G1MA 3THYA 3QOFA 2V6JA 3VHXA 3MFYA 4JT2A 5J5CA 4CRWB 4DSUA 2AK2A 3DEFA 2AFHE 2BCJQ 3AKYA 1XEXB 1OXTA 1SXJD 1YZUA 3K0CC 3P4XA 2YWFA 3B13B 1JECA 1ZJ6A 4YDHB 2J1LA 1ZUIA 5KUTA 2HV8A 1T3HA 1G6OA 3T5DA 1COWA 1KKMA 4KO8A 1ESNA 5AJZA 4C0HA 4C4PA 1NN3A 4UNQA 1DO0A 3PUYA 3WYAA 1D2NA 4A0RA 2EWVA 4CDGA 1R5BA 3V4RA 3CZQA 2DCUA 2ZR9A 3KKPA 2Q9BA 4EJSC 4PC6A 5LD2B 1HTWA 3AKCA 2ZE5A 1IONA 1YR8A 4IOJA 3A4LA 4CEIA 2GF9A 2J7PA 1CULC 2ZRKA 3TUIC 1X8LA 3HP1A 5AK0A 3EIEA 1JAIA 2LKDA 3KXLA 1CS4C 5DLQC 1XZQA 1E0AA 1KK3A 4WXRA 4B76A 4QJ3A 4CVNA 3AF3A 1G7SA 1WB9A 3EPKA 2ZRBA 3L8YA 2Q9AA 4JKYA 4LHVA 4L15A 2O8CB 2IYQA 4ACAA 2XGJA 4HDCA 2N1BA 2GILA 3U3MA 2P6NA 1RC8A 4A36A 4RSGA 3S1AA 1D5CA 2YOHA 4NYMQ 4ZKEA 2F43B 1EWRA 2FJUA 421PA 2ZAMA 1OHHA 3GCGA 1GAJA 1DEKA 1W5TA 2P5SA 3TUJC 2GZHA 1IN8A 3AUXA 3ZZ0A 2WHXA 1A5TA 3L2OB 4JVLA 4Q66C 5AUNB 2AK3A 1JPNA 4KBGA 3E70C 1IJEA 3EA5A 4R2HA 4LC1A 4TYNA 1QF9A 1EFCA 1FQKA 2CK3D 2DR3A 5FPKA 1QHNA 3VHLB 2AWNA 4TQ9A 3KXIA 4DEXA 1MRSA 4PPQA 1TEXA 1NI3A 3SBEA 2HXYA 2UZ3A 4LJ9A 1RZ3A 1KI3A 5JEDA 2BC9A 4M1YA 4Z54A 2VH5R 1Q3HA 3PUWA 2WWIA 3TJZA 4QFMA 3I92A 3SZRA 4O2RA 2D4HA 4EFMA 1P2TA 2GRJA 5EP1A 1E6CA 4Q02A 1E2LA 4RZ3A 2ZRAA 2RB4A 1WCV1 1Z83A 1NVXQ 4Q9LA 1F3OA 1J8MF 4DSNA 3HR8A 2W0MA 1KMHB 1EFRA 2CLCX 3B1VA 3LA6A 2CE7A 2IS6A 2E9SA 3D7MA 4IXMA 1U90A 4LZZA 4BZQA 3MJRA 2GEUA 4PO9A 1E2FA 5DNYB 3K09A 3AVVA 1Z5ZA 2QM7A 4JYBA 4B33A 4NE2A 1GRQA 1NVWQ 4QKQA 3B8HA 1WRBA 2CLDX 2WOOA 3HPRA 4NPHA 1TNDA 1E79D 3TQCA 3FB4A 4TMKA 1GOTA 2EW1A 2QRNA 1E1RA 1P3JA 2ZQ5A 4A2PA 5LDDC 5GJCA 5JFGA 3DKVA 2QP3A 2IS1A 1W0JD 1IXRC 2R6CA 4HB3A 4LJ7A 1YZGA 4ABYA 1UADA 1TPZA 2AXNA 4GPTA 1U0LA 2FFBA 3ZVRA 4C0QC 2QG6A 4MQBA 1UDXA 5DI3A 5CB8A 5TDHA 4XSHA 4Z1MD 3QXSA 5J40A 5JBQA 4IVQA 3CH5A 2GJAA 2PX3A 4BRUA 3NTUA 2X2EA 3FHCB 4WZBE 3WY9A 5FBVB 1Z2CA 1N0WA 1W5SA 4PAQA 1G3RA 4BFZA 3SYKA 3Q7QA 4UKDA 2JDIA 3WBJA 1RJ9B 4I4LA 4C3ZA 4HZIA 3Q8XB 4B2IA 3KUCA 4C9BA 1L8QA 4RD4A 2OCBA 3AEZA 4JYCA 3PUZA 5BN5A 1J2JA 4F38A 1ZW6A 2O0KA 4PSKA 1NVUQ 3NH9A 1QRAA 3BD9A 2RGCA 2X8AA 3AUYA 3RS4A 2WVJA 4NTZA 1KAGA 4KFSA 1RYFA 2YKGA 3LFUA 3NEJA 2QSZA 4EKDA 3MUFA 4JT4A 1E94E 4AG6A 4A82A 1VG8A 4ZO4A 1I2MA 2OBLA 3PEUA 2JJ8A 5JJIA 4Q4JA 4Q18A 2J0VA 1EFHA 3AF2A 3K0SA 3P4YA 1F6BA 1KNQA 2HF9A 4LV6A 3W90A 3FGNA 2J5XA 2NTYC 2UZIR 4Q03A 4FMCF 1G41A 2BHRA 1F2UB 3QXHA 2ZXUA 3QVUA 4IFEA 1RVDA 3KKNA 2ZI5A 5DN6D 2RCNA 1KO7A 1ZBDA 4JLJA 4CW7A 4DUGD 5BW8A 1W0JA 1I4DD 3R8CA 5IF9A 1XCMA 1P73A 4PAMA 1KI1A 2QTFA 2WKQA 4TQAA 2GBLC 2GEVA 3REGA 2J9RA 2OG2A 3IHLA 4WBSA 2ODNA 3G0HA 4P4SB 2A9KA 1P9RA 4KLNA 2P2LA 4EPXA 3K70B 2YVUA 4EJSB 5LD2C 1E98A 1OXUA 3LLUA 5JS7A 1FP6A 2JDID 5JS8A 5JZVA 4DDWA 2ZETA 1UAAA 3U7GA 3IEVA 4K46A 4QOSA 3KKOA 2QPOA 4W7SA 1US8B 2EVWX 4TL8A 2W00A 1QG2A 3ONWA 3MJHA 4QJ4A 1SVIA 4GI7A 5BYKA 4MYCA 5BWMA 2IXFA 4S35A 1LS6A 4LHYA 3BE4A 3Q5DA 4KITB 4IXNA 1IY2A 4DRZA 2QBYB 1E96A 2WSSD 2A5DA 2ZUDA 3CRQA 4V0OA 5SZJA 2VYFA 2HF8A 3CX6A 1N5JA 1DELA 4AI6A 4KVAA 1IHUA 4A1FA 2WJHA 1DG3A 1E0KA 2NZ8A 3TSWA 5J4YA 2JJ2A 3ZDQA 1VYUA 4XOIA 3CM0A 1OH7A 4B3BA 4HAZA 5FUYA 3PITA 1C9KA 1S96A 5AJXA 2QAJA 4Q19A 3VR6A 2J3EA 2WJVA 5GJVC 5E7IA 1Z0DA 3VAAA 3QJYA 2PCJA 2FH5B 4BGDA 1OIXA 2Q3MA 2QZ4A 2WIAA 1VECA 3AP3A 4PSVA 1CJUC 2Z0MA 1E2MA 1VHLA 4YXWA 2GXAA 1II8A 3NDPA 4B75A 1BMFA 1KI6B 2VHCA 4EIWA 5GJBA 2O0JA 4L9SA 5HKKD 3U3JA 1FX0A 1LS1A 4I1SA 2ZROA 4PZYA 3UXMA 1GNPA 4DIDA 2RHDA 1COWD 2O0HA 2W6JA 3A6PC 3B1WA 1FW6A 5DSZA 1NIJA 3A1UA 2JEOA 2XZPA 4NBSA 1CRPA 3QEJA 1JJVA 3CRW1 4KJZA 2ZYVX 5JEEA 1VCIA 1ZU4A 2X19A 4A0GA 2RH5A 3OHMA 2CNWA 2W6IA 5K8UA 4PHHA 2P6UA 4M0LA 3KQKA 4D25A 1G4AE 1JQLB 3M0EA 4M53A 4MKFA 1E2GA 1SVSA 1OYWA 1RW4A 2BMEA 1E3MA 4RD1A 3AQ4A 3DVLA 3PUXA 3QUSA 4EPTA 3EIQA 5EXTA 2O52A 3EX7C 2ERXA 1TTTA 1T3SA 4GMXA 4U00A 5LBIA 1N6LA 1YKSA 5G53C 3W8NA 3WMFA 1Q57A 2RHMA 1RRCA 4XIGS 4GZLA 4KV9A 4HATA 1C4OA 1YRAA 3EWSA 3GFOA 3SDZA 2CCKA 2D3WA 1R6BX 1W44A 2WJGA 4NKRA 2V7QD 2AWOA 3KJHA 3QIAA 4TLBA 4TMTA 1Z0KA 5EXSA 3CF0A 4FMBB 1ETUA 2V1UA 3TSOA 4A92A 1XTQA 3IPXA 3WP1B 2ORIA 3SQWA 2ZJ5A 2O8BB 1CTQA 4V02A 3ZZUA 3DHWC 2VTKA 4PR0A 3OEHA 3GFTA 4FCVA 4HDOB 3NBXX 2QGZA 3CPEA 1YJ5A 1HA3A 4N3NA 1G8GA 2ORWA 1XRJA 3OEED 4A15A 4M1SA 4A0HA 221PA 4M22A 1GNQA 3OZXA 2XTZA 1SKYE 4NCJA 3KKQA 1PJRA 1J7KA 1NMYA 2NQ2C 1NN1A 2GDJA 2F3TA 1YE8A 1PZNA 2OSBA 2OO7A 2ZPTX 3I8XA 3GJ0A 3PV0A 5EUQB 4F4IA 3BK7A 4JL5A 4LDJA 4TZ0A 2FOLA 4RZUA 4BFSA 4TLAA 1QHHB 2VF7A 2H57A 5IK2A 4LJYA 2OXRA 1MV5A 2XOKD 5B57C 4IOLA 1Z0FA 4TTPA 2WWGA 3S1AB 4HB2A 5B64A 4JIMA 4JVNA 3BXZA 1VMAA 2B7BA 4LV8B 2JLVA 3MSXA 2WJYA 4TL6A 4GFDA 3PUVA 1OFIA 2QNRA 1AN0A 5FUVA 2J0UB 2DHRA 2ZI4A 3SJAA 2QEQA 3RRYA 4XTRA 1C1YA 4G1UC 1D2MA 4LI0A 5BYJA 3I73A 1NMZA 4EJSA 3ZH9B 4MRPA 1KO8A 1YU9A 1AKYA 1ZUNB 1II8B 2JIZD 2IYYA 2IX3A 4M2LA 2O8DB 3FKQA 2XNDA 1OFUX 2ONJA 2C95A 1OFTA 3ZQJA 1CIPA 1OLOA 3THXA 1VKJA 5SZKB 4EFNA 2ZYWX 1KI7A 3K70C 1SHKA 1OF1A 4TLEA 3HDTA 3RVBA 4B6FA 2QU8A 4YXWD 4UJ5A 2IXEA 3LWNA 4AYWA 1SZPA 1W47A 4HYYA 2Z83A 5CIQA 1E9FA 3JVVA 2PL3A 2HCBA 3LLMA 1YR9A 4TTQA 3VX4A 4ESVA 1UJ2A 3B2EA 2QMHA 4FCTA 4Q4JB 1F48A 2H7VA 3LV8A 4KI0A 3T1OA 4XJXA 4CT4B 1X3SA 2FSHA 1AGPA 4QHTA 1DAHA 3D6TB 5JJLA 2NIPA 4FN5A 4IDPA 3EG5A 4LJ8A 1XP8A 1ZC4A 1G5RA 1S9DA 3DDCA 1KO5A 2QPAA 5C4GB 1UEIA 1G8YA 1XD8A 4JVMA 3RSLA 1MT0A 5GJWC 4WXPA 2OCYC 1I4LD 4TT3D 1ZRHA 4RFVA 1DAFA 721PA 3MCAA 1NSTA 3THWA 1ESMA 1DPFA 1P2SA 3AP2A 3OF5A 4QG7A 5H70A 2GXSA 3R20A 2WMNB 621PA 3GLFA 4U7DA 4JBWA 1RJ9A 3GJ3A 3NBZC 2KBFA 1U8ZA 1HY3A 3ZYCA 5CDFE 2ANBA 4AIIA 3LH5A 1Z0AA 1FMLA 4LBVA 2F1RA 2VSOA 4TSFA 2IF0A 1JPJA 2QQ0A 3EZFA 4GSYA 5JCPA 3U6KA 4QBIA 2V6IA 5EXXA 5CB6A 1HQYE 1KOFA 5JCZA 3EZ2A 1NSFA 2W58A 2IXGA 3TBKA 1NBMD 2OFOA 1SVWA 3KDSE 4ASUD 2B8WA 4DC9A 1NJFA 3AGQA 3KUDA 2CK3A 3BB3A 2O8BA 1R4AA 1W2HA 5E3HA 3W6OA 3WXMA 2FN4A 5SZHB 1U98A 1XD2B 3MWYW 4G5QA 3GJ6A 4KFTA 3RS5A 2GWHA 5ELXA 4FWTA 4RY2A 3H0KA 3BOSA 4RVCA 4IOKA 1SKYB 2DFTA 1LB1B 3LO5A 1RYHA 2W83A 3A1VA 4UNSA 3K1JA 4AKEA 3GJXC 3GJ5A 1XNJA 2YOGA 5JSZB 3LX8A 2FGKA 1XTRA 2WWWA 1ZD9A 2G3YA 3GQBA 5FOSA 2H5EA 3C14C 2GNOA 1BOFA 4Z8XA 2XJ4A 2QT0A 4JMPA 3KQUA 4DVGA 2BJVA 1E4YA 1NKSA 4AKGA 4K81B 3MWJA 1X8KA 4MRRA 2ONKA 1R8SA 3DM9B 5C46F 1SVOA 1E2JA 3T12A 2C03A 4BZXA 1VG0B 3FHTA 2O8FA 1JQJC 1XJ0A 1ZM4A 3NXSA 1F2TA 3OAAD 2ZJ8A 2MMCA 4WA7A 1B23P 1G8HA 1U94A 3DMNA 5LB2A 2NPFA 1AS3A 5JRZA 3PJRA 2F9MA 4ZDKA 2BMDA 4ZDIA 5FR2A 1QDEA 4JLMA 8OHMA 1DARA 3QPVA 4OYHA 1EWQA 1E1RD 1KSHA 4PC1A 1Z6YA 1S0UA 2QM8A 4DIEA 1XD2A 4D81A 2A5FA 2IHYA 1FQJA 1W4CA 2XX3A 4ITRC 2QMUA 2W6JD 1AKEA 3SJZA 5H8WA 3BORA 2ZUBA 2XSZA 2IWHA 2NO7A 2Q9CA 3IEUA 4PPNA 3ND8A 1T0HB 3GFPA 1M2OB 3ICQB 3OEHD 3RWOA 1HYQA 4DCUA 2GJSA 2ZE6A 3AVTA 1W0KD 2V1XA 2GVZC 3ZIAA 1U8AA 2J46A 1DAIA 2DFLA 3K0FA 2H8KA 4URVR 1AZSC 4BQSA 3PEYA 2AN9A 1WDTA 2J41A 4HAXA 4RKEA 3SNHA 3LW7A 2QT1A 4KHZA 2Z4RA 3Q9LA 3AF0A 5KSOA 4D4LA 3HR7A 4P3YA 5G41A 2GK6A 1LF0A 2Z4SA 2QRZA 2BCGY 2EFCB 1E4VA 2ZSAA 4HZUB 2HT1A 1AK2A 1MH1A 3U2QA 4QNMA 5HCNA 2F55A 3NHAA 2V7QA 1IN7A 2Y8EA 3ZLJA 4Z1MA 4BZPA 1WA5A 1CKEA 4MGKR 4V0ME 2FEOA 3QXXA 4NMMA 1BO6A 1E2DA 2QP9X 4KYIB 5FL7A 4PSAA 4FWIB 4Q48A 2LKCA 1LFDB 3PIRA 1N5IA 1N6OA 3K53A 2OILA 2VP2A 2XXAA 4RZXA 2OT3B 2MMGA 1ANKA 1QHIA 2ZSFA 4QBFA 2UVQA 4UXHA 2CL7X 3PCRB 2RGAA 1GZSA 2JIZA 4FXPA 1T8TA 2JJ1D 3IGFA 4MGZR 2XNDD 5CYPA 3KFXA 1M1YE 2GJKA 2BBTA 1FOEB 2J0SA 3AVQA 2HCJB 2BIFA 3F5FA 4X8OA 5FR1A 5A4JA 1VIYA 1OXVA 5J4LA 1TF2A 1KAOA 5HTKA 3V00A 1YR7A 1CLUA 4LWZA 1AS2A 1D8TA 2IK8A 5F9FA 1JXOA 3LD9A 2C5LA 1Z6XA 1UBCA 4D4MA 4PQFA 1WXQA 4B3XA 1M7BA 3FKSA 3UMRA 1KI8A 1WE2A 1G4UR 4LHZA 2YHSA 1W2GA 5UKDA 4DEYA 1A82A 3SBDA 3SJCA 1J70A 1ELOA 2IEYA 3NIBA 1FPMA 3CBQA 4F4JA 4C7OA 2FG5A 4NCNA 3T06B 3B82A 1QHGA 4L16A 1PUIA 3RSOA 1IQPA 4C30A 1ZYUA 4GNKA 2JLUA 2ZSEA 3ZS9A 2WWHA 5FTMA 3GLIE 2ZJ2A 4DLVA 2YZ2A 3B1XA 3PENA 2RKOA 3F0TA 1KI2A 3GEEA 1DE0A 3RNLA 1R5NA 4OHYA 4GOKA 2FNAA 2OLJA 4IFBA 1GTVA 2IHBA 1Q21A 1GG2A 3GLHB 5B58C 2OEPA 3AVPA 1SXJC 4TMXA 1ZNXA 3GJ8A 3BH7A 3WMGA 4UNNA 2JLSA 5DGXA 5LPNA 5KNBA 3EZ7A 4IHQA 1GKIA 1U9IA 2QPTA 2HEIA 2QAGB 5EE5B 1XPRA 4MDEA 2OFXA 4Q7KA 1XXHB 4Q4HA 1R0XA 3U3RA 4O2LA 1S2MA 1GSIA 1OYYA 1G9XA 3I8SA 4KYUA 4WZAE 3ZVLA 2XSZD 4CEIB 2OAP1 1R5OA 3BWDD 1N5KA 2HXSA 4OQMA 2VHQA 4IEIA 4KCGA 4FD2A 1XB2A 3VTKA 3RRNA 4LJ5A 1E2KA 1MR3F 2EFDB 5EP2A 1VCMA 1AJEA 2HT6A 2IF2A 2FX3A 3C41J 4FMDF 3QXJA
chains in the Genus database with same CATH superfamily
1QG4A 1R8XA 4QOJA 2HUPA 1ECJA 1E5VA 2V7PA 1NSYA 3I6BA 4XA8A 2B2XA 1NFFA 2CKDA 3EH1A 3I9JA 3T61A 1H65A 1OZFA 4HEJA 4JB3A 1M0EA 4YAGA 4RTMA 1KS2A 3BMCB 3KB1A 4ESHA 1YQ9A 2LIVA 2VJDA 3A8TA 3BXFA 3CT6A 4EW3A 2R1VB 3HJRA 3FF1A 2UYCA 4KR2A 1ICEA 5KTSA 2EDAA 2A2ZA 4PF1A 4ZIRB 3A2KA 1HQCA 3WL3A 5G0TA 1O57A 3UJ8A 3QY9A 2CN1A 1OFHA 1Q44A 3FTPA 1GLNA 3IB6A 2BHSA 1PS0A 1X8XA 2XHEA 3ETHA 4GR9A 5CNIA 2Z04A 3DDSA 1E9CA 4WZ6A 4FSHA 1FCJA 2VNSA 3DMPA 4Y2VA 3SZUA 4BNKA 3OSUA 4C2AA 5EZYA 5JS2A 3EIFA 1MTZA 2P9QA 2Z95A 4Y6PA 2FRXA 1PL8A 3C2QA 5DGTA 3R0QA 1I1NA 2BH9A 4ZOAA 1N36B 2PANA 3ND6A 1AGNA 3CVOA 3H1PA 1Y33E 3L8ZA 3DW3X 2O6HA 2BGIA 1C3OB 3GP5A 5DISB 5E0KB 5FOVA 1JJ7A 2ZUTA 2QU7A 3QE9Y 4X6YA 1W85A 3C3DA 4H17A 4YEDA 5AQ1A 5HR5A 2O2XA 5KU1A 3LT4A 2W0SA 2FMUA 3ZIUA 1ML3A 5HMLA 2ZXFA 5A02A 4BNJA 1A95A 4V0NA 3W6PA 3LAWA 2Q07A 4RH0A 5E4FA 2RH8A 2Z8YA 3VPCA 4CG3A 4WQMA 3LUGA 4NK5A 3FZEA 4JLWA 5E2BA 3WV4A 1MRZA 4MITA 3KELA 3SKXA 1FYEA 4I8DA 3ZDBA 1OBCA 1XTJA 1YULA 3ZGZA 3QXCA 3P5BA 2VZEA 2EBWA 3D4BA 1LSJA 3M3HA 1KZ1A 3QW4B 2PRJA 3RS9A 4Y9RA 2VBCA 4X1YB 3SYRA 1I7DA 3F96A 1YQXA 2PMWB 1T9ZA 2PHZA 3O95A 3H2YA 2AL7A 1K7SN 4TTSA 2DPYA 2D7DA 3DV0B 1VRVA 4MRMB 3B3AA 3FTNA 2PS1A 1A5BB 4U2KA 3NBKA 4WNAA 3ZIAD 3A4NA 4R1OA 2BGTA 4I08A 1I33A 1KSFX 2BEUA 4AN4A 2VG8A 2NXEA 5G0VA 4IDEA 2UUAB 3U7JA 2VPYA 2C2XA 4OIMA 4E1VA 4IJMA 1L5WA 3SE7A 3HCAA 2M6SA 1NXWA 2ATVA 4YMWA 2E18A 3M4NA 2HHJA 3OX4A 3ZU4A 3HV0A 4ZV4A 2Z43A 3H18A 1YMUA 4LDPA 3PG5A 1T5DX 2C4KA 3QHPA 4K87A 4Q4LA 2VSXA 4V0RA 3FPGA 4GLOA 3GGCA 5LJIA 1CZRA 1PZMA 1GPBA 1G8FA 1J49A 2AOWA 2IZ1A 2PA0A 1WW8A 1LLUA 1MHPA 1RLOA 3K0HA 4DEVA 1LX6A 4PX3A 4AMBA 1TT7A 2DT5A 3CHYA 4X3CA 5KAMA 3OZAA 1KFBB 3R4VA 5KPDA 4HSEA 1J25A 4C21A 2O7NA 3KV1A 4PQGA 5F7OA 4KG7A 2OESA 2XKAA 4YK7A 2ILVA 5FPHA 5TF0A 2AX4A 4BL5A 1KZ7B 2W6ZA 5LWQA 2WR8A 2Y2VA 4BDTA 3Q8MA 3W2GA 3CIFA 5JO0A 2FKNA 5L95A 1JHVA 2ZTVA 2NSHA 2FQYA 2C5EA 3P9ZA 1QPGA 4RFSA 3BM5A 3C4VA 1UPTA 2OHHA 1J8FA 2VTEA 3E2MA 3JYHA 3RVKA 4BLRA 4GUAA 3LGSA 2ES4A 3CISA 4OVKA 5EVCA 3TE6A 4KUGA 5A0TA 3L0SA 3ZQKA 3GF4A 5E2IA 2FW8A 4R5MA 4XPZA 4XYGA 3LC1O 2QN3A 3HEMA 5L51A 1QRTA 1KI4A 3ZK8A 3LF1A 4Y2JA 3TR0A 3SQXA 5ER9A 1SA0A 3C70A 2QE6A 5GQSA 2NTEA 2GLUA 2IYXA 5EJAA 4BFTA 3EFBA 1P39A 3F71A 4EQZA 1EXVA 1EFTA 2GTIA 1SC9A 2ZU6A 3SIRA 3HKCB 3OJFA 1CJSA 4D9EA 5HZHA 5BQ5A 4KH0A 4KKVA 1TL7C 3DFZA 3EIWA 3PE6A 5EUMA 3THOA 4HDRB 4COOA 5CFRA 2F8TA 1CQWA 1W1WA 1B1CA 1R00A 3FI0A 2RBGA 3GCDA 3GJTA 5LP6B 3LCMA 3KT3A 3KRTA 1M7HA 2DXIA 3RS2A 2FU5C 4W5TA 2I6UA 3HFGA 3DZBA 3MGCA 1M74A 3C6XA 3GRRA 1XYVA 4W8HA 4GP9A 1VXRA 4YMIA 3HNOA 3HBNA 5I3ZA 3PVSA 4NR0A 2BYTA 3G5UA 4MR9B 4KGDA 1RLTA 2AXEA 3L79A 4AM8A 4GX2A 2DWUA 2OCKA 3AXTA 4ZD6A 3T38A 2X58A 5AJHA 2AOTA 3AHJA 4AUKA 3W6NA 1BQ4A 4ZV9A 5HUJA 3J81k 3NWPA 1RHKA 1XQ9A 3CJRA 3H5NA 4ROSA 3OIWA 4AZ3A 4KN9S 4E4TA 3H42B 5D51S 4RF2A 4JROA 3IP7A 3M1IA 2AR7A 1CJKC 1DBSA 3UWMA 4ZEVA 5B4VA 4ACBA 5AIAA 4FGUA 4E3WA 5IBQA 4ILEA 1U2RA 1DT3A 4ZYYA 1GUYA 1Y80A 3DAHA 4R05A 2YVLA 2O8DA 3N28A 4ONEA 3L4BC 4BMCA 3O8QA 2CLSA 3ET5A 2QA5A 2XMGA 4OGFA 2O8CA 4LTDA 5AVWA 3H17A 3A27A 1FS4A 2W2XA 3TCNA 3MERA 4MI1A 1NMEA 4MWEA 2DLNA 2J32A 2B9EA 2IYSA 2J3MA 2VHWA 3BXPA 4PHGA 3MOGA 4ZVUA 1KNXA 1OPXA 4L4XA 1N2CE 4PCUA 2J5BA 5TLSA 1Z06A 4QNNA 4KDFA 5AK6A 4CM1A 3GCZA 3RSSA 4WX2B 1NNUA 4H1HA 3BF7A 1OJ7A 3C6YA 4C7BA 1GKKA 5E6UB 3DOIA 3B89A 4KXQA 1E5DA 1QCYA 3SR0A 3R7FA 1LDMA 1NLFA 2CUKA 3CVJA 1GGHA 2QAGC 3LWZA 4M7OA 1WTAA 4RJKA 3M6AA 4GMGA 4IDHA 4UUPA 2AKEA 4IDBA 3X1WA 4O4HB 1Y42X 3BHIA 1ZLXA 1SXJA 2BFWA 4LE0A 5E0OA 2ID8A 2NVBA 3P9QA 4LCBA 3SHQA 4C43A 4EPWA 4F21A 1SBYA 4OA8A 4AZWA 4FOLA 3QE3A 1O94A 4FFBB 4WXMA 1U3FA 2WWXA 2II6A 2ZIVB 3FPHA 4M1TA 1R4ZA 1ZINA 5E4TA 2QL6A 4XQCA 1HOXA 2WTAA 1LTKA 4O2AB 3K1ZA 4UCFA 4EB6A 3BIXA 5JPCA 2B6HA 4FZJA 5LKRA 3EHEA 3DG9A 2CB0A 4KK3A 3WMXA 3VKHA 2XMDA 4RD3A 2XE7A 3DMTA 3QG5A 4KRGA 3O8RA 2PKQP 2ZFUA 3F3KA 3QU5A 4B6EA 2GA8A 2DUWA 4WIAA 1EX6A 1PG5A 3HO8A 1WX1A 1E1CA 4MWTA 4EGSA 1P5JA 2QORA 3IAS1 3ORQA 3AVYA 2X41A 2BD0A 2ZWOA 1QIMA 2C2GA 5F1PA 2YY6A 4JEMA 1OI2A 3QUCA 4HFRA 1WIWA 1UK6A 1SRRA 1P7YA 1TIKA 5JRJA 3D6UA 4AL4A 4K0KB 2ZYUX 1SB9A 4Y67A 3TL6A 3Q1KA 3CONA 3QFHA 2FWRA 3AM3A 4GC5A 1C7IA 4J16A 1UBSB 1S2DA 3VTAA 1G18A 4G0ZA 2DHCA 2Q28A 4GM4A 4ROTA 3JASB 4BFWA 2GO7A 3IBYA 5IAGA 3AWIA 1P9OA 1IXKA 2R1UA 3AEKA 4P5DA 4ZPXA 3UATA 4JC5A 1USIA 2QSYA 2RBEA 2VXOA 3B48A 1R0WA 5HCUA 2BL4A 1X9GA 4E11A 3AYXB 2EZ9A 3DUFA 3S81A 3AEQA 2EQAA 3BFXA 4EZEA 4ENQA 4OHZA 3L0CA 3KAKA 1IRXA 3DZKA 2WHPA 1RHUA 1LW6E 2PUFA 2P2GA 3WS7A 1MCZA 5JSQA 2HJVA 4H3VA 3UO8B 3OOEA 3TQSA 3I9KA 2VQ6A 3NFYA 5DHAA 2PJUA 3ZV3A 2FN9A 2C9CA 3IJPA 1XRMA 4BHTA 1D6NA 4UARA 4R40A 5J4HA 3CZRA 4R2JA 2Z2JA 4RY0A 2IGTA 4G01B 3BMCA 2MSDB 3WA6A 1G291 2HWKA 1T0BA 2ZSKA 5B1YA 5TJHA 1BTOA 5AJVB 3TUZC 3BRWD 4FCCA 4DCSA 3LXXA 3UF0A 3EC1A 4ABTA 2PQ6A 4HLCA 3IUNA 2FE1A 4JEUA 4H6WA 3RU3A 4PINA 4UU8A 4J7AA 2H31A 2O1XA 3MW8A 4URUR 1K66A 3P9IA 4LZNA 4RVSA 3K2EA 5BVHB 2R6GA 1MOZA 4MVXA 3ZGYA 1ES9A 1MKYA 2QD4A 5AXAA 3I0MA 1YJBA 2HA5A 4IDNA 5DYNA 3ZDFA 4RQBA 2J08A 4JQOA 1W34A 1YJAA 2GFQA 5T3YA 3P2YA 1E79A 3H3JA 3Q72A 1OHHD 3W3ZB 1ZSVA 4TL9A 2REOA 2UUBB 1C30A 4P58A 1CUHA 3WJ7A 2WKSA 1IY1A 1L3IA 4EYSA 4C5AA 1EGHA 2OGSA 1YRHA 3UKDA 3FOWA 3IAEA 4ARVA 1VKNA 2YJ4A 1T4BA 3G3EA 1JXMA 4IGKA 1MGOA 1II9A 2AZMA 1NXXA 3KQYA 1G5QA 2YYAA 2BWJA 4FFWA 4NABA 3CUYA 3CX7A 3ZTYA 3OJ0A 4CDRA 3QEMB 2ODTX 3PP8A 1LEHA 2MT9A 4MYRA 1CVRA 3L8EA 2J31A 4D26A 1GPDG 4MIYA 3G2PA 3REQA 2G1UA 1YBAA 4QRDA 4EYGA 1PTJC 1N4AA 3P7MA 1NYTA 3A3PA 1UBEA 2CLKB 1RS0A 2GX6A 4JR1A 4CM9A 5JLJA 4NCAA 5ALMA 5ETJA 4CEHB 1SKMA 2RH4A 4I9NA 3AR7A 2GCNA 1J20A 2PX2A 2O07A 5AHWA 5KI6A 2E4WA 1G20E 3TLMA 4YUYA 1NW6A 1W46A 3NEAA 1L7OA 2HQOA 3WLKX 1BFDA 2BT4A 1BAPA 2OFPA 4IXTA 1X14A 5LP6C 1UK9A 4BEBA 1Y3BE 2X3YA 4I50A 4D9CA 6CHYA 2CCGA 4JYPA 4F6RA 3SFVA 4FP9A 3CLSD 4XIFA 3VRHA 3LK6A 3GFVA 4N5LA 5ERYA 4H7JA 4G5GA 2X9NA 4OJMX 3LW8A 5A5EA 3KHTA 2GXQA 3AKDA 1NWHA 4KYVA 1C1XA 2R6DA 4HK4A 2R86A 1Y37A 3QPWA 3C3YA 1CP2A 2PNFA 1E69A 3MM4A 4GP6A 4MO9A 4AXBA 2G5PA 1NA5A 1RWBA 4C0KA 3U4MA 4M0DA 1JDZA 3JYOA 3TN7A 5BPHA 1ZN9A 3DL4A 5D6NA 4BGEA 4R1MA 4A8JC 1C9EA 2W9XA 1QK3A 4L0MA 2OBYA 5EN4A 3L07A 3MWEA 3OZEA 2I5PO 4UE3S 3UH1A 3E7XA 5I7FA 1YAJA 1SHUX 2WICA 1E9SA 5I9BA 1L4MA 1Z33A 5CMLA 2VHVA 5KO2A 1H4VB 1XELA 1ZAKA 4P08A 4BNZA 3HTXA 2J30A 3CRRA 2NSLA 2Q6TA 1O95A 3AU8A 3FMOB 4G1BA 2XBUA 4KLZA 4Y1EA 4DIOA 3RVDA 5IJ0A 3D8SA 1IM8A 2OUKA 1ZD2P 4X20A 1CZLA 2JJMA 4WW0A 1W4RA 2PY6A 3KEMA 1EFLA 2PS0A 2TMDA 1D0SA 1NDUA 5H9WA 1RIIA 3JV7A 3DPSA 1RVV1 1EP2B 5HJ5A 1Y0BA 3TRJA 1L5SA 3ZHTA 3EDOA 4FFDA 4XWAA 4R1UA 1BCRB 3FMGA 3FGZA 4EL5A 1K6IA 1R74A 4H08A 3CRMA 5DK6A 3A1FA 3GRKA 4D2IA 1NVVQ 1C8VB 1ZCAA 1RE0A 4RS4A 1HLGA 4Z49A 5CCEA 5I6DA 2VXCA 5LZ4A 3R6DA 3FCCA 2QMEA 1YU6A 4M21A 5AW5A 1LSOA 2DFPA 3D5EA 3SZLA 4CQLA 1M2FA 2B30A 3JCZA 2D1RA 3PGA1 1V3UA 2P69A 3KB6A 4BJ1A 2CYBA 2DSTA 1QCDA 3CXRA 4OATA 4P81A 3ET4A 2CXTA 2JPDA 2HREA 1FU8A 1IB0A 1UJ4A 2CMKA 3BF8A 4FCWA 3IRUA 3GNLA 1C29B 4AY4A 1N5DA 4JUBA 1XXHA 3V7WA 5AK3A 2PFGA 5A6SB 3A05A 3C39A 3UTDA 1JIIA 4QQFA 5E4YA 3IO5A 1OTHA 4GPD1 3AR8A 3A32A 4X71A 1OW3B 4KMRA 1DDOA 4NONA 1DV2A 3T7CA 3FHJA 1KJIA 2P9BA 1IJFA 2XADA 1GSAA 1EGAA 1DQNA 1AK1A 2D2XA 2WPDD 2YYSA 3SXJA 4EB3A 4EUSA 3GLFE 1U7TA 5H68A 2C0CA 1DIOB 1GARA 3CEAA 3PPYA 5I47A 1XJQA 3RARA 3ADPA 5AUPB 1SG6A 3D0OA 1J0XO 4WJLA 1SNYA 1DC5A 3IA7A 3PNQA 1ORTA 4KLRA 2O4CA 4L1KA 1ZHOA 3QWBA 2HY7A 2PZMA 4ZYXA 2J45A 2D7JA 2QXYA 4G8CA 5HM6A 3L7IA 3LRTA 1AKVA 3OTQA 4OFZA 4QGAA 4H1VA 1ZNYA 1S02A 1SXHA 3EOAI 1NM5C 1P9LA 3HC7A 1MFPA 4PANA 2DTXA 4XFJA 3QMPA 5T6MA 1V26A 3RC7A 3T1HB 4FZRA 1SVLA 4R7TA 4BO0A 2F6RA 1I3MA 5TR9A 4FW8A 1WEHA 1A8HA 4R71A 2VWPA 3I83A 2HSEA 4TN1A 1L4NA 2H4FA 2I9KA 1DO8A 4RELA 5IG2A 1ZPDA 1FFHA 3REOA 1Z73A 3CO5A 3L0ZA 2IYVA 4DYVA 1AF4A 4HDKB 1W49A 2B8TA 4WK6A 1LRJA 4JLNA 1EP1B 3OM9A 4A2CA 4ZMSA 4P0QB 2WILA 1EM6A 1S3FA 4NE7A 3GZJA 3BJIC 4HNSA 1Z3CA 2PZKA 4L2IA 2HMWA 3HYNA 5IM4A 4PX9A 1U3DA 4GM1A 5IUJC 2C4MA 4D74A 1J07A 1JLLB 1NYRA 2CEKA 2HMAA 5JMTA 1YV9A 3IS3A 4TSKA 3L8GA 4WNIA 1MQ9A 4KE6A 3DKPA 3D9QX 5FBQB 5AH0A 2FLVA 2JH3A 1TU3A 1GGEA 3OSZA 2R8XA 3D6FA 4MS3A 3QM1A 5JSYA 3HY4A 3QQPA 3QWFA 1GGFA 1YR3A 5CW2A 5ALXA 3D8NA 3RVOA 4ZN6A 1FSPA 5I45A 1E9RA 4XM1A 5T4HA 4AWXA 4LF9B 1P7WA 1L7BA 1R0SA 2BBOA 2R44A 3D8BA 2R60A 1FJGB 3MJFA 1TXGA 4HX5A 4YCDA 1KDOA 3D7KA 4YRLA 4F9FA 3T5PA 1RE1A 5HCIA 2A88A 3K16A 3UWOA 1U80A 3CSDA 5D3ZA 1N75A 1XJWA 1BNCA 3UXYA 1E3TA 2EX4A 3LP5A 4LMRA 4Z8YA 4L75A 3I61A 1E9VA 2D2FA 2X8WA 4B4KA 3IUSA 1OX4A 4AJPA 2QRKA 4P5PA 3P9SA 4LYHA 3RHTA 4BMVA 2X9VA 3WL8A 2A30A 4IJVA 5DHFA 3UMCA 3KOZA 1WS6A 3KTFA 2QXUA 2YQ4A 3JQ7B 2A3NA 3M7IA 5EERA 1UEJA 5G40A 4ZVPA 3EC7A 1QMGA 1TZBA 1L5GB 2FDXA 3GLGE 1Q15A 4BLQA 3BGSA 2N46A 3B2NA 4LRXA 5DF1A 3AUJB 5LXTA 3H84A 4GOXA 3VJKA 1B4DA 4Q4AB 3AHHA 4YJ2F 2GEBA 3IP1A 3VVCA 3G49A 5K0ZA 1JIJA 1ZL2A 4UHFA 3TSAA 1ZMRA 4DJFC 3S8YA 4JK3A 1CSEE 2BKUA 2G0NA 1ZM7A 4HH1A 2PYDA 3VHRA 1EFPA 2SKCA 3LVQE 2H1SA 4C0SA 5KC8A 4QNRA 4TL7A 2QAGA 5K6AC 3DT6A 2QBYA 1JR4A 3ZY5A 1JFFB 4JB2A 4K88A 3HCCA 3STVA 2VHXA 4R41A 2QY6A 3IEKA 3OIDA 4R9UC 4HTFA 1FNBA 5C7IO 3ZC3A 1WKCA 2ZANA 4OHXA 1QLHA 2R85A 4B47A 1QKKA 1KPGA 5DLPA 3B1FA 3OOYA 2GXUA 3K0CA 3QKSA 5MF6A 1J0EA 3T7SA 3ZU5A 1CF2O 2IXBA 2VKQA 4O5OA 3WGLA 5JDCA 2C78A 3FN4A 4HL6A 2ZYTX 2YWGA 3ICEA 4FYMA 3OJCA 2Y05A 1DBVO 4V2IA 1P44A 2WTNA 4U2EA 3TQIA 3KR0A 4M99A 2BGLA 4Q4HB 4AY6A 2X0EA 1NXOA 3I4LA 2FMIA 1U3CA 1I6MA 1EK5A 5TRTA 4QVIA 4CTMA 1RI4A 4P98A 4J0JA 3DUFB 3DHNA 4LYYA 1G1AA 1UP6A 3DVAB 4LVUA 2RAPA 4S2EA 5CDSA 4W5WA 3VHQA 5G4KA 1BW9A 1ZJWA 1Y8AA 4UJ3A 2JKZA 2P2NA 1I8TA 3LX6A 2V3CC 3HKDA 2DP4E 3FCAA 4ZAYA 2Q5QA 1HOTA 3QIVA 1DBPA 2OB2A 5DCUA 4CMHA 1WWKA 4CLDA 2ONZA 4L8VA 3AR9A 2IY7A 2O5VA 4PYKA 1SVNA 3H97A 3SI7A 4EG0A 3RBVA 3ZNQA 1KHTA 5E9QA 3RYTC 4DOMA 4I99A 2GNPA 2NYAA 4CKWA 4V0QA 3B6JA 3DVQX 3W9YA 2I6QA 3OO0A 4F3CA 5LP6F 1G19A 1L2TA 1FYWA 2GJ4A 4H3SA 3OFND 2WJ6A 3A6HA 1M73E 3FVRA 5EXDA 4Y6QA 4D0GA 3O1JC 4YDQA 3U44B 4TN5A 3GZNA 4R3WA 3EGEA 4XB6B 1JG1A 2V0NA 1XMIA 1YS2X 2D62A 2JFUA 1YQUA 1ZOLA 2XITA 2ZS8A 3LDHA 3O74A 3WQQA 1IWPB 3LLCA 3GEDA 2D1FA 4BNVA 5IS2A 1E1QD 1I94B 3OCCA 1Z4JA 2VPXA 2WTBA 3CE9A 2JBHA 3O8DA 4X7RA 5FUBA 1PR9A 1LWOA 3AONB 4CM7A 1Q7EA 1U9JA 4J7UA 3URMA 4JY7A 5D1HA 4PAWA 4QXQA 1NF8A 3NM4A 1TUGA 3E5HA 2PXCA 4NCIA 4QTTB 5G0UA 5ILQA 1N25A 1QDUA 5DM4A 1LQUA 3WHLA 3VYTB 2JKVA 1IK6A 1W1UA 3QF7A 4ZCPA 5HDBB 4X93A 1YL7A 3VPFA 4BASA 5K8TA 2W4IA 6Q21A 1K8YB 2HTEA 3EG9B 4YRGA 1A4RA 5K8LA 2MSLA 4FGLA 3VJLA 1AB6A 1K8ZB 2PFSA 3AJDA 3IAFA 2NMVA 4UU0A 1DUVG 1PDVA 2O7VA 4ZT2A 4A8JA 1JR6A 3HCNA 3FE2A 2XXAB 2QMQA 4P53A 1ULSA 3BMNA 4GL2A 5JFTA 2BP7A 3QU2A 4I5DA 5DHPA 5G2OA 3RG2A 4U9HS 4RFLA 3RPEA 4YUAA 1K3TA 4CL2A 2P4EA 4GP7A 5FL3A 3RF7A 3VR6D 3I01A 3OUTA 2CHVA 1FDIA 2HJWA 1P0FA 4Y9UA 1CRQA 3ASUA 4JU8A 5BMVB 1NV8A 1QQAA 4XUGB 3N8IA 3QF4B 3M6IA 4IIGA 5LLSA 1TIBA 3L84A 1DC7A 4O4HF 4OXRA 3RANA 3BQNB 2ZRCA 3I04M 2OV2A 4LSZA 2HW8A 4YO7A 5A7GA 1BMFD 1FTYA 3MMXA 3I39X 1XRPA 2EZ8A 1V48A 1DFHA 1JAHA 3EQZA 3M6VA 3NWJA 2HJRA 5TMBA 1XA0A 1YR2A 5IUNC 1NQXA 2D0PB 1N2SA 2I1WA 4RCZA 4MQUA 4PAGA 4FLMA 3DWFA 4HX9A 1ZGAA 3H2BA 3KSUA 4JAVC 4Q1BA 4NU6A 5L4NA 2J4DA 4U0KA 3WAJA 2C2KA 3AWDA 1WXEA 3M4XA 4MROA 3RUDA 3E48A 1MNQA 3JARB 3VV2A 2GBLA 4D9JA 4REQA 1IIRA 3EMDA 1L5MA 1ULZA 3R6TA 2FV8A 4NCHA 4WOJA 5FTWA 1A9PA 4B8WA 3TO5A 4BP9A 1ZHHA 4RHTA 2P9ZA 5CP8A 4JXKA 3D6NB 1XLTC 2AN5A 3BRQA 2BONA 4Q3EA 4MUIA 1YVDA 4XCQA 1HT1E 5IH7A 1Y1SA 2VUTA 4ON9A 1MX9A 1SD5A 1ZJJA 3PGXA 4A6XA 1LVUA 3WB1A 4AG5A 1IXZA 4QWMA 2CV1A 5AI4A 2O8NA 1KYYA 2HHCA 4KTTE 1Q83A 3TZQA 1FUUA 1ONNA 1RAIA 5IXYA 4DTIA 1YB7A 2MDTA 1A9RA 4AAYA 3WLRA 4M9ZA 2HA0A 3PEVA 1Q7GA 4HPWA 1NUAA 3T1TA 1US8A 1DTSA 2QRPA 1Z5UA 2V6FA 4LYEA 5I8PA 1DLIA 1VRCA 3KO8A 2QDXA 3T3IA 4MVJF 1JSLA 1O77A 1WMAA 3GN2A 3A31A 1VPWA 4ZI7B 1W87A 2KE5A 4D56A 2Q1WA 4CKEB 4CLRB 4KBFA 2B20A 4NBTA 2BKEA 3OKPA 2F00A 4QEDA 1YMVA 3VVLA 4E5NA 2OM2A 1I3CA 1E58A 1E2PA 1NN5A 2WYHA 4GMDA 4TSRA 2AZXA 3BEDA 5KKNB 4CNQA 1AQLA 2PKRA 3OT4A 3T9BA 1M2WA 2ATXA 4P4GA 5LSAA 4REOA 1G21E 2M2IA 2O3TA 2ERYA 1SQGA 5C8XA 1RQRA 2X5XA 3CURA 4RZIA 1Y7HA 2UYHA 4V0MA 1G7TA 4DW8A 4GYWA 3V9AA 3WKCA 2BGMA 1HMPA 2OLKA 3DDHA 1KR2A 1JEOA 2AH5A 2QB5A 4IVPA 1K89A 1O3YA 2R79A 1USGA 2FZ4A 5TS3A 5C18A 5J43A 1V1MA 3X1KA 1U9IC 4Y2SA 4DQDA 3R7NA 1AO0A 4EZBA 2AXPA 2YHAA 1T5IA 1Y4ZA 4E6PA 1LRKA 3GAAA 2D5IA 4OBEA 5EE9A 3C45A 3HWSA 1A3CA 3VDRA 3NH6A 5I9LA 1V7CA 4MARA 2RI1A 5KNBH 4FNOA 1SVMA 1A77A 1LPPA 1MQSA 3OJEA 1Q0PA 5KYWB 6REQB 3MGBA 4R7GA 3EPJA 5KYKA 2PE5A 3GGJA 4OK3A 1VLJA 3JD2A 3AIKA 4TT8A 5FWAA 2NV2B 3CYFA 3QYPA 4IIBA 4TWAA 4KOEC 4EUEA 4N82A 2V7TA 1XTIA 1BDJA 3GOQA 4N65A 4DCNA 5JSHA 1TA0A 2DF8A 4G5FA 5KJCA 5FNVA 4E51A 1OV6A 3TIGA 2ZJ7A 1PYOA 4OHWA 4BB5A 5CA1B 2P9GA 3A3OA 3ASZA 2IHZA 2XZTA 2UZ1B 5CH3A 4UZSA 3GZNB 4Y9DA 3WGVA 5JZ9A 3H3FA 4D6XA 4P4TA 2P4SA 5CW1A 5ALUA 1LNZA 3MQ4A 2B82A 1TM7E 3KVOA 4BMSA 5DM70 1U7UA 1ZM3A 4OBXA 4OQ4A 3A37A 3F7MA 4WUTA 4FQ8A 1GQ2A 4BWFB 2JLWA 1KKLA 3LCCA 3PFCA 1UKVY 2OZKA 2Q46A 3PC4A 4H59A 4HVTA 4CU5A 3HL4A 1EAMA 1XU9A 4KVFA 3J7AC 1CW2B 1OXMA 1CK4A 2WVAA 3GCXA 1ISJA 2GRAA 2QTHA 4LBWA 4LC9A 4I3HA 1HO3A 3KKLA 4ED9A 2NUPB 4V1CB 5JJCA 2WUFA 1JG4A 5L7YA 3X1JA 2VP4A 1BDMA 2N47A 2YYYA 5E7JA 3ZD6A 2INGX 3THWB 1F9AA 3MZ0A 4YP0A 1YZLA 2D8AA 2R2AA 3E8MA 4ZU3A 2HU8A 3NO4A 3WLEA 4DLUA 1UQTA 5T67A 1FNSA 2EATA 4IILA 2ZVDA 1GZ4A 3NORA 1V6AA 4G5OA 4CM3A 4IQGA 2QUZA 3LXRA 3RR2A 4CEJA 3GGGA 4WLFA 2EZTA 2A9OA 3DBHA 3BXXA 5E9WA 4OIFA 4ZOCA 1ZHFA 5C7YA 1TAQA 2OD9A 5A0VA 1KY4A 2Y3IA 3OKCA 4MUAA 5FUQA 3WI7A 2DJIA 3HYTA 1FTGA 2D2IA 3TIXB 1YUBA 4UHCA 3ED5A 3KE8A 3DV0A 1WMEA 1XMSA 2Q3HA 3A7EA 3MAJA 3ZU3A 4WFQA 3K9WA 5IBCA 4MNTA 4OY3A 4WUVA 3ZNPA 4RIIA 2HQSA 2PH1A 3G9XA 1NZFA 4J6EA 1V1RA 4BWYA 5AVZA 9LDTA 2ETVA 4RDXA 4XFDA 4YAFA 1V3TA 5AMXA 5FWNA 5COBA 1K9SA 3ME5A 2RGXA 2I6TA 3ETDA 1WEKA 3U6BA 1T15A 3MOIA 4D3SA 3CO0S 1GN8A 1WUHS 3NR2A 3UWKA 2YJNA 3LFHA 1I1HA 1T0UA 5CXSA 1T29A 2P77A 3AHCA 1C50A 2BHLA 3BERA 3GARA 4LYJA 2YDYA 1TKRA 3VNUA 1GPH1 2KW5A 1BG6A 1JN0A 4NMLA 1F7VA 1TK9A 2XB2A 1ZVQA 1Y48E 1RI2A 1SBTA 2QTGA 1C0PA 5AK5A 1Z6AA 1WZEA 4CMEC 2CEAA 1XL1A 2XMPA 4GI2A 4F7WA 5DOVA 2IWRA 1OA1A 3G88A 4IRMA 3QK7A 3NOXA 4EYQA 2J3KA 3UVEA 3OF3A 3MBOA 3R9WA 5BW6B 2ZT7A 3EUFA 1DEOA 5BYBA 1MJ5A 5COQA 2VQDA 1NL3A 3ZHXA 1UCFA 8AT1A 1XWFA 3UWSA 1ZK0A 4JNCA 4MUBA 4QSMA 4CM8B 4D3XA 5JV5A 4BMYA 1O97D 5DU2A 3W1VA 1S8FA 1YT5A 2IP4A 3V4ZA 4K9OA 4KNWA 3WLTA 2JCSA 4YDRA 2JK0A 3AX6A 4JODA 2I4LA 1C3XA 4FZVA 3ZE7A 1VSQA 2WIJA 2V6BA 5SICE 1NQOA 3A6FA 2HIGA 1KAHA 1U4OA 4FJ1A 5DYTA 2YVKA 1T5BA 3RODA 1YOBA 2C8JA 1XFAA 4XJSA 2RGEA 1L7DA 4AUNA 1Q0QA 2CF5A 2Q41A 3HU3A 3DEZA 4HDQB 1KEZA 2OC4A 1P7VA 1NC3A 3K15A 3HFRA 1TQ8A 3QBEA 3GJRA 4KWEA 1PEAA 1GG5A 3GT4A 4G86A 4L74A 5IVHA 4QOHA 3A70A 5AOAA 4N41A 3AEXA 1W59A 4EI8A 1XZDA 1QHSA 1KSJA 1PHPA 4RHYA 3V8MA 1T6BY 3QH4A 4BO7A 5J2UA 1PHRA 2WHYA 4KTVE 1YRLA 1PF7E 3SBOA 3NHRA 3COJA 1FFEA 3O93A 1V39A 3UV6A 3HBLA 2J3QA 1UDBA 3QF4A 1OTXA 4K9RA 1GRRA 1U2PA 4OU5A 3RAGA 4WZAA 1HDYA 4I6GA 3CLVA 1LI5A 2GZSA 3OD5A 1ZUD1 2AN1A 5EHQA 2XH8A 3BIOA 4WDQA 3D7RA 3WK9A 2PH5A 4EGFA 3RJ5A 2BTQB 1NXTA 3OIGA 4DHEA 2FP3A 3UHJA 2WAYA 4P1ZA 2OCIA 4N0EA 4BMXA 1KO1A 1E89A 3G59A 2XGMA 3WQHA 4E4YA 5LP6A 4FI3C 1U2DC 1NPTO 2ZRFA 3X1XA 5IHPA 3NBFA 1LPMA 5TT1A 4RKRA 4W9RA 3LQKA 2G88A 3KB2A 2QNBA 3TCKA 2NOAA 2ZAOA 3BCHA 4G09A 3RKRA 3FB1A 1CUCA 2EEPA 3FFAA 5HF8A 1E1KA 2WSIA 3QNMA 3FDZA 3RV4A 4MP6A 1JHUA 4RLSA 4I5FA 1P7PA 4U2DA 3TTSA 4BLTA 4F71A 1PT9A 4ISBA 3HGQA 3AR4A 3AF4A 1AZWA 2Y92A 2ZYAA 3NDJA 1JMVA 4JZKA 4ZRNA 4YV2A 1N2HA 2FPGA 3R77A 4KDCA 2LCQA 2LP4Y 4IWNA 4DSZA 4G56A 3B85A 2FEMA 2ZBDA 4XDHA 2H00A 3GMTA 2RC5A 4FDUA 3ETCA 1FL9A 3NZEA 4YONB 1CLEA 5LMUB 2VJLA 3DOEA 2ZXEA 4OXXA 4WBXC 1YL6A 4GRDA 3AI1A 1CR1A 5H59A 4YECA 3O8QB 1ZH8A 3NI2A 5D01A 4RFSB 3PQ4A 4DPLA 1TE2A 2DGDA 1OA0A 1YAHA 3S1LA 5B30A 3G2MA 1X7ZA 1YQTA 2XDYA 5HKOA 1IBSA 3ABZA 3VH3A 3MB8A 1QRSA 1OAOC 3KYBA 3O91A 4YMSA 3D4LA 1C3EA 3VMFA 1YS7A 4S12A 2RKBA 3KV3O 4EAAA 5KCZA 2C5BA 1AMOA 1HT3A 3S2EA 1DCFA 2GEKA 5TC4A 1F3LA 3VU0A 3ZLBA 2FA9A 1JAXA 4N0DA 3KZ1E 5F1KA 4DHWA 5KQLA 3BHMA 1ZNZA 4KGZA 5FHQA 4F92B 3GY0A 2PTGA 4ETWA 2CHUA 2R62A 3NHJA 3T95A 4ZQIA 4LFCB 5BV8A 4PXYA 3OQ1A 3TVDA 3VNRA 3C4JA 3WBBA 3QTLA 3JD3A 4KPUB 1THZA 2W2TA 1NRWA 3CNOA 3PX7A 4EKEA 3DA8A 3D4PA 1HDRA 5CR9A 5EXEA 3SCZA 3IQIX 4XQEA 4C3OB 4BE7B 5LQAA 1OI7A 4M1EA 1MO5A 4FB5A 3UMMA 4COKA 4X1YA 2R7NA 1KY3A 3LX4A 5DBFA 4Z0PA 1BU8A 2WUEA 4FMCB 4X3PA 4CIDA 2OUIA 4PFJA 1SZJG 3GVPA 2JFHA 3FPBA 1A5AB 1UPCA 3H86A 1ZCBA 2D3TA 2W22A 3LKVA 3MJEA 3QFSA 4KAFA 3U4DA 3ZZTA 3M6UA 3S2FA 5C80A 2O5RA 4NDZA 1RFGE 3QE4A 5CH5A 1RIFA 5TVGA 4DABA 5J4VA 3KJXA 5IMBA 3F8SA 4RJTA 2FG7C 1NVBA 2IOFK 4L78A 2WABA 3EOBI 1SBZA 1IMOA 3D54D 3R7WA 4WRRA 4F9TA 6REQA 3F73A 1MABB 1NAIA 1H23A 1VMKA 2J7PD 2GYUA 2XCSB 4JITA 1UFQA 3LQ1A 5L45A 1EQUA 5TIIA 1HKHA 1A88A 4LOHA 5DLDA 5EL0A 3I1YA 4UU1A 1YBMA 1Q0SA 4E0BA 5I7EA 3V9PA 1SQSA 1WHSB 3EW9A 5I5GA 1AA9A 3MD0A 4HH3C 3CH6A 1SU6A 2WJ3A 1BKYA 3X3HA 3LIIA 1QGYA 1R0LA 4QTUB 1R10A 1QGED 3BREA 3I32A 4YC7A 1NIPA 4B0PA 9ATCA 3QVVA 2OBNA 3KQOA 2L18A 4EF4A 1KRWA 2G83A 3LUAA 3RUCA 4LX8A 3GQBB 1TAGA 3FDJA 4H31A 3F6BX 2G9UA 2AUMA 2OL4A 1R6UA 5HK8A 2CSUA 3CRZA 3SU8A 4FHEA 5AI6A 4FFVA 4LGMA 3DEKA 1H2FA 4AO7A 5K4AA 3MQFA 3MB5A 3X1ZA 5JH7F 4PPYA 3GD5A 4UCXA 2B5VA 8ADHA 4R8MA 4DS3A 1CDOA 1SUBA 2W2PA 3HB7A 2W2LA 4FGKA 3L1KA 4O8CA 1FFSA 2Q2QA 3ASYA 3DQPA 1TRHA 3GN1A 4WWHA 4AJLA 4DNOA 4DG9A 3F3MA 1DAGA 1N5OX 3IESA 3JZFA 3LSYA 1LPBB 1CR0A 4M9SA 1PVOA 1P4HA 3EIOA 1EXWA 4IDQA 3TTWA 4RA6A 3PNPA 1MZVA 2REQA 4IGAA 1Q