4EDPA

1.85 angstrom resolution crystal structure of an abc transporter from clostridium perfringens atcc 13124
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
KLVVSTWGLNEDVLKETVFEPFAKEHGVEIVLDIGNNSERLTKMKNNPNSQIDITYLAESFAEQGVEAGIFDKLDYSKIPNASEMNEKAKSTVEAGYGPAYTLNSIGIVVDPSAGIEINSWEDLWKPELKNKIAIPDITTTNGPAMVEIAAEKAGVDVKTDNGEAAFKELEALKPNVVKTYSKSSDLANMFSNGEIVAAVASDFAFGTISKAKPEVINVIPESGTYLNFNTININKNSKNKDLAYEFINYALSKEVQEKTAKALNESPVNKEVKLSEEETKNLTYGPVVDNAKVIDFKFVNSVMDQWVNNWNRIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.85 Angstrom resolution crystal structure of an ABC transporter from Clostridium perfringens ATCC 13124
rcsb
source organism Clostridium perfringens
molecule tags Transport protein
molecule keywords ABC transporter, substrate-binding protein
total genus 116
structure length 316
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4edpA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4edpA01
1MG1A 4YU0A 2Z8DA 4O3BA 1LGBC 3MVXA 3E4RA 3OO9A 4H8IA 3I3VA 4RYAA 3VVEA 3C33A 3EF7A 3GZGA 4EXLA 3MP8A 4N6PA 5H8NB 2I0CA 3IJOB 3TUSA 2QSXA 1A8EA 3KSXA 3TELA 4EXKA 1NNKA 4I9DA 4MF3A 2RCBA 2X7QA 4F2OA 4U1ZA 4Q30B 4YB6A 4JWXA 4XKPA 4ELRA 5TP9B 1LCTA 4G8NA 1Q35A 4IO2A 1MM6A 1MXVA 3M8UA 3O6HA 5K2XA 5CMBA 3QK6A 2D3IA 1Y3QA 2DE3A 5HPQA 5JTYA 2X26A 2PT1A 3QUJA 4ZE9A 4OFLA 4GIZA 2Z23A 4XKQA 2OJTA 3H06B 4DZ1A 2HAUA 1Y9UA 3TFLA 4U22A 1B5HA 1BTJA 2RC7A 2O1MA 3H6VA 5LOMA 1MY1A 3OO7A 3PMWA 3V83A 4GVOA 4TOZA 3TODA 5EHSA 5L9OA 3VLUA 4E0WA 3KN7A 4ZE8A 1MQIA 2XX8A 4L17A 1B9JA 4QF9A 1H43A 1O7TA 2P2AA 3R26A 2AYSA 3FXUA 4EUOA 3K6XA 4OFOA 5DVIA 1A55A 3O28A 1MH4A 2GRVA 2Q2AA 2UVJA 2R9JA 2QS3A 4C1UA 1AIVA 2F6PA 4DLDA 4WKMA 4F3SA 1QW0A 2V93A 3MC2A 3SEXA 3ZKKA 1N7WA 3H03A 3GLBA 4JB7A 3RTWB 3G3FA 3SDFA 3K0VA 3RQTA 1DTZA 1YCJA 1I6QA 1Y4CA 1AOVA 3RT8A 2ONKE 4Q8RA 1IUDA 1XVYA 1NNPA 3E3KA 3OEMA 1MXUA 1B1HA 2UYFA 3CSGA 2ZYMA 4IO5A 4ELOA 4H65A 3FV1A 4BDOA 3KN8A 1Y1MA 4ND9A 3UK4A 4OZ9A 2ALUA 3TTNA 4Z0IA 4TLLB 1B2HA 4PFUA 1J1NA 1CE2A 1IIWA 2ANJA 3EN3A 2BJJX 2WKYA 3FIRA 3PPQA 3KOSA 1EZPA 4KI0E 1P1NA 2O7IA 4FECA 3TZAA 4U21A 4NMYA 1VSOA 4F3GA 3WAEA 2H25A 4NWDA 4DCXA 3OEKA 4KQPA 2AIXA 4DCYA 2ZYNA 4OEVA 2XXXA 3I6VA 3SESA 4F31B 3FJMA 4ELQA 2A5TA 1ZLQA 4LATA 4QFLA 5DEXA 1TT1A 1R6ZA 1D9VA 2VHAA 1UQWA 4IY5A 3VLWA 3Q25A 4ELPA 1FTMA 1MDP1 1MXZA 1PB7A 1PEBA 3PV0E 3AXFA 3MP1A 4X1DA 3TMGA 4KHZE 1B52A 3D4GA 3H7MA 5H8FB 3TKDA 4H0WA 4LQ5A 1XS5A 4PETA 1B4HA 2IEEA 1MY0A 3OELA 2DVCA 1UTHA 3KGCA 3TTMA 4F3BA 4QHQA 1PC3A 1SYHA 1QKBA 4U23A 1S9TA 1MH3A 3KFMA 4JDFA 5ICQA 3GBBA 3IB2A 2YJPA 5H8QB 3PUWE 4G8HA 4H1XA 1N3XA 4NF4A 3N5LA 5AA4A 2F97A 4MBPA 3CFLA 2V3TA 3PPNA 4DXCA 3JV9A 2Q88A 3FASA 1I6BA 4NWCA 4X9TA 3FJ7A 1IXHA 1HSEA 4IB2A 4WXJA 2GHBA 1OQHA 2VD3A 5CM6A 5KCJB 3W9WA 4NF8A 3H6TA 4RK2A 2AL4A 2HCAA 3O29A 1GR2A 2XXIA 2Y7RA 4NF5A 1B05A 1PBPA 4Q5TA 5ITOA 4C0RA 4G68B 2DE4A 4PQJA 1IEJA 1EH3A 3UIFA 3ILUB 2O7UA 5KDTA 3O97A 3IK6B 4IO3A 2V3UA 4BDLA 5CI5A 2FNCA 2PX1A 3IO4A 4ZEDA 1N7XA 3S9EA 2Y84A 1M5FA 4XKRA 1IXIA 1M5DA 4R2BA 1OIBA 1HSLA 2DYXA 3IB0A 2Y7KA 1TXFA 3EPEA 3H3GA 4H67A 5FHNA 4KYDA 3R7XA 1ELJA 1MQHA 2REJA 1XOCA 2RCAA 3BFUA 1B7ZA 1R1NA 2O51A 2XX9A 2Z22A 4PFTA 3CIJA 3IJXB 1DSNA 5ISUA 2XXTA 1URGA 1B3EA 2RC8A 3IL1B 1SVXB 2DXRA 2F7CA 1B7UA 2FA7A 2ONRA 2Q89A 2V3QA 2QS2A 3GBAA 2I3VA 4LZ8A 4ZEIA 2O68A 1SW2A 4HS7A 5CC2A 2I3WA 3LR1A 1B3GA 1BIYA 4U2RA 3PUVE 1MM7A 2PMSA 3OENA 4LQ2A 4IO4A 4R73A 4GL0A 4YZZA 2DP8A 4EF2A 4GXSB 4FJPA 4R72A 2VD2A 4OETA 2E1SA 2UXAA 1MXXA 3E13X 2G93A 2GHAA 2OZZA 1JNFA 3LUYA 4H5FA 4UA8A 5AA2B 5DVJA 3T93B 1B3HA 4F1YA 2H9BA 3QYTA 3P7IA 2PT2A 4KCCA 4O3CA 3QAXA 1UIUA 1US4A 3SEUA 4BDRA 1OVTA 5I84A 4R6KA 1LAXA 1OLAA 5I56A 1YPNA 4RA1A 1M5EA 4GRKA 2ONSA 5HM4B 4H6DA 2XXWA 1Y3PA 1LBBA 1Y20A 4RJZA 4F3PA 3RTFB 4BDMA 1I6AA 1US5A 3T96B 3FZVA 3E9XA 3N26A 1TFDA 4OQOA 5JK4A 4RXLA 1NKXA 1LBCA 4U1OA 1NNFA 4LZ7A 3CFXA 1A8FA 5ITPA 4K3FA 3RT6B 1PDAA 1H44A 4QRZA 1JEUA 2D21A 3G7WA 1SQYA 1AMFA 1JVXA 4N07A 5DYHA 2O69A 3PD9A 5TP9A 3TDJA 3JZJA 4NF6B 2KLFA 3VVFA 1UTBA 4YAHX 4P11A 4ZZAA 1IZ1A 3S2VA 5I2KB 4F22A 4KFQA 3KG2A 5I2NB 1OQGA 5I57A 5EYFA 1IXGA 3CVGA 4R75A 2XXHA 2F35A 3MUQA 4GOTA 1BKAA 1Y1ZA 2OWTA 4ZS9A 3PMXA 5BUUA 4JWYA 4MFIA 3QSLA 1A7LA 3OO6A 3TTRA 4RY1A 3CRBA 3IOVA 3U93A 2XXUA 3MAMA 3IOUA 2QPQA 1A54A 3N94A 4ZEFA 3MPLA 1P1WA 4HTGA 1N0TA 3VDFA 4P0IA 1ANFA 2ZMBA 4WEDA 3CFZA 3LBSA 2F6GA 1JW4A 5I58A 2I58A 4IO7A 4LA9A 2V84A 3G3JA 5IKBA 3VVDA 3LSXA 1SI1A 2IA4A 2DQVA 1LFGA 3N6TA 1H3DA 5FTHA 1ZIUA 4GWOA 2DE2A 2RKMA 2DWAA 4JBZA 3OXNA 1FQBA 4EQBA 3EHSA 1DMBA 3M3LA 4ZDMA 4U4SA 2B65A 3HV1A 3V89B 1ZJLA 3IO6A 3FVNA 4OERA 1FTOA 3R6UA 3TPAA 3FUZA 1JETA 5H8NA 2Y7PA 1D4NA 1MQJA 4JSDA 2Y7IA 3TYHA 4OYVA 4H5GA 4GD5A 2VP1A 4RPOA 5DVFA 3PUYE 3HCQA 4QFPA 3TTLA 4AB5A 5I59A 3FV2A 4MH5A 3DELB 4GQOA 1SW1A 4QSDA 2UVHA 4QSEA 2QRYA 3Q26A 2QMXA 1FTLA 3IOTA 5H8HA 3LSFB 4FORA 4QFKA 3SETA 1USYH 2RC9A 4RNSA 3RPWA 4DXBA 4Q0CA 2Q2CA 3K6UA 2GH9A 3SEWA 1B5IA 5A5XB 3RY3A 3GXAA 1XVXA 3B6WA 4EQ9A 4R9GA 4QFOA 4G2ZA 2Q9TA 1WDNA 3QXMA 2NVUB 1SW5A 1ZTYA 4WEPA 2Q8JA 2REGA 1URSA 1B32A 3K2DA 3VV5A 2ABHA 3FATA 1F9BA 4F29A 5CBRA 3KEIA 2OLBA 3S9NC 2I6EA 1A99A 2XHDA 3TEPA 1P1OA 3MPKA 4DIGA 5IAIA 2HFBA 2Z8EA 4I62A 2DOJA 1GTKA 2I0BA 1VE4A 5EHMA 5H8SA 2Z8FA 4ISUA 2DS9A 2NUVA 2ZNTA 4GF8A 1POTA 3SERA 3S9MC 5TPAB 1B5JA 3M3FA 3O9PA 4OWDA 3G3HA 2F8DA 4OEUA 1GVCA 3Q27A 2F7AA 3FJGA 1SYIA 3C32A 3MZBA 1O64A 3KBRA 3IR1A 3N6UA 5FTIA 1UIVA 4YB7A 3DM0A 3MZ9A 4YKKA 4JWOA 4KD5A 2NWJA 4I1DA 4YKIA 5KCJA 1XHYA 4YICA 1GV8A 3K1NA 3ONMA 4PE5B 1OLCA 3I5OA 3JYRA 3MJNA 2R6GE 3S9LC 1FCKA 3IX1A 4P0GA 2O6AA 5HBCA 3H4ZA 1BP5A 3B6TA 4F1UA 2AL5A 2F5XA 4MLQA 1CB6A 1D3KA 2UYEA 4OFJA 2QJEA 3MVZA 1H45A 3C31A 1DPEA 4YB5A 1LAGE 4LUBA 4Z7EA 2HAVA 2D5WA 3DLNA 3OOAA 4KR5A 3RGYA 3WAFA 1FQAA 1B4ZA 2PVUA 4ZZEA 1S7YA 3PD8A 3T66A 5DT6A 1ZMGA 3Q28A 3FVOA 4KYSA 4M1VA 3RUMA 3V8XB 2B3FA 4FE8A 3CG3A 4OTEA 4F1VA 2I48A 1FQEA 1SDXA 3UP9A 3DP4A 2O1LA 3QIMA 5L8DA 5BWJA 1UTHB 3K1PA 1N84A 3A3UA 2P1SA 3KSJA 1B46A 1FQDA 2CZLA 3HN0A 3PPOA 4FEBA 2Y7WA 3C34A 2QS4A 3FGSA 1LAFE 2ESNA 3IB1A 4ECFA 5H8QA 1FW0A 1M5CA 2VGQA 3F11A 2LAOA 4NF4B 4NTLA 5M2VA 1JVYA 3U92A 3ZSFA 4ESWA 5AA4B 3SKPA 1LB8A 4POXA 1SI0A 4F19A 2P0SA 5AA2D 2DWIA 2YPNA 1RKMA 3EHUA 3O6IA 3ZS6A 2HXWA 2O84X 2QL3A 3MVWA 4ZEKA 3K6VA 3VE1B 1B1XA 4F18A 3SEVA 1QUKA 1OVBA 1R9LA 1MDQA 4FATA 4OESA 1LB9A 2XXVA 4OHNA 3MWBA 1LLSA 3B6QA 3C4MA 5ELVA 2W7YA 3S4UA 4HCWA 1NH7A 3UORA 3PGFA 2PBWA 2OWSA 1JW5A 3THIA 1SD3A 5CMKA 3LSWA 2DWHA 2CMOA 3MBPA 2XD3A 3A09A 2HQ0A 3PPPA 1N76A 3CSBA 4MLVA 1FQCA 1PBQA 1S50A 1MY2A 2HEUA 4FEDA 4NF6A 5CMMA 5DTBA 4BLAA 1UTBB 2OK2A 3MVYA 4NEDA 5I2KA 1EZ9A 2H4IA 4ONYA 4X48A 1DPPA 1IXCA 4R9FA 5I57B 3OO8A 4JXIA 3VFJA 1PB9A 2DXYA 4N13A 3K4UA 5JTYB 3C35A 5J1DA 5F7VA 4DE8A 3D4CA 3UGWA 1B3LA 4KCDA 2FYIA 3OSQA 5ICTA 1NFTA 5CMCA 3DP6A 3H6WA 1BLFA 3UN6A 1ZKBA 3M3KA 4XXUA 2XXQA 3V5AA 5I58B 2A5TB 5DEXB 3L6HA 2H98A 3ECRA 1RYOA 1VR5A 3A3CA 1II5A 1FTKA 3HSTA 4GFRA 2VOZA 3IORA 3TCFA 1USYE 5FHMA 2OCUA 3HPIA 4C1TA 5H8FA 1T0KA 1SBPA 2H99A 3U8QA 4EF1A 3PPRA 1B0HA 1YAEA 1MY4A 2G29A 4IGTA 4IGRA 1IQ7A 1WVJA 5CRYA 1Z7NE 5I59B 4PFWA 4FAJA 2F36A 2XXPA 4FIMA 1HSJA 4POWA 3G3GA 4GL8A 4I8CA 4X1BA 4E0XA 1POY1 2OBGA 5TU0A 1B7HA 1O63A 1OMPA 1URDA 4G4PA 3CR9A 5AA3A 3TCGA 2I4CA 4YKJA 2NXOA 1NL5A 2I4BA 3CI8A 4OXVA 4LONB 4RK9A 1AH5A 4RPNA 4YKPA 4U4XA 1MPBA 4NF8B 4IY6A 3FXRA 4LP2B 5K2YA 3ILTB 3O2AA 1P1QA 1R9QA 1NH8A 2H5YA 3BFTA 3K02A 1B0LA 1ZU0A 3PUZE 3KOTA 1RYXA 1N04A 3OD7A 1Y4TA 1ZBMA 3BKIB 5KDTB 1PB8A 4LZ5A 4THIA 3K1MA 4TLMB 3BBRA 3UA8A 3T22A 3VXCA 1P99A 3KJTA 3QUFA 1QKAA 4H8JA 4M4GA 1B51A 4BDNA 4JSOA 2DWJA 3W15C 1JW1A 1LSTA 4GXAA 1B40A 3LC8A 4PFYA 4UACA 3RLFE 3RN8A 1I69A 4AB6A 4HW8A 1IITA 3C36A 4IO6A 5AA1A 3C9HA 3T9HB 2F7BA 1FTJA 2UVIA 1LFHA 1MXYA 3L6GA 3TQLA 1NMUA 4ZEBA 3HHGA 4QSCA 2F34A 4R2FA 1YTVA 3EHTA 3TAJA 3U94A 1FQFA 4BDQA 3K00A 3PU5A 3CG1A 3OSRA 1ATGA 4ESXA 3TCHA 1EZOA 3MW0A 1SW4A 3VXBA 3G3KA 4G68C 4LVQA 5AA2A 4OENA 1AL3A 2RINA 3DP8A 2DVZA 2PYYA 2R71A 3FXQA 3LSLA 4TQUQ 4OVJA 5H8HB 5L9MA 4OMBA 4R6HA 3U1OA 4G8MA 4HCYA 2ZXTA 1TWYA 2XXRA 3RNNA 5I56B 3TTKA 3ZKLA 1QUIA 1XC1A 3T9XB 1MS7A 2ZNUA 4NF5B 5A5XA 1Q1KA 5CBSA 3O66A 3MQ9A 3K6WA 3Q29A 2M8CA 3PUXE 4G68A 3IOWA 3U72A 1QVSA 1XT8A 4GLIA 4NE4A 3MZ1A 4KYEA 2THIA 4F39A 3USDA 4F2QA 1D9YA 2ZNSA 1VFDA 3VLVA 4AQ4A 2GFEA 4EQ7A 4PP0A 1LCFA 1VFEA 2I49A 1JQFA 1H76A 1TFAA 1B6HA 1N3WA 1WODA 1MY3A 2UVGA 1Y3NA 1B3FA 2NOOA 2ZYKA 3H6UA 3KZGA 1QULA 4KPTA 2HZKA 3KJ7A 4DDDA 2V25A 1KWHA 2XX7A 1LFIA 1A40A 3O6GA 1MPCA 2QS1A 3FVGA 3OMBA 1MXWA 3PMVA 5TPAA 3T9UA 1MQDA 5I2NA 5FHOA 5B70A 4YMAA 2DSFA 4DXUA 4YMBA 3T9VA 1DTGA 1JEVA 3HHFA 3ODBA 2XD2A 3MP6A 3K01A 4EDPA 3G3IA 4R6YA 1MQGA 1P1UA 3FVKA 3EQ1A 5JEIA 1Z7ME 1EU8A 1MRPA 2XXYA 1NNTA 2A5SA 2RF1A 2E0SA 4QFNA 1DOTA 4XKNA 4R74A 1LAHE 3W9VA 1GGGA 5AE4A 5B7DA 4G77A 2QMWA 5KZTA 3B7DA 2YLNA 1B58A 1MPDA 1M5BA 2B3BA 3FD3A 4O3AA 3KN3A 4XTCQ 4XIGQ 1QUJA 5F1QA 3SEYA 4ZECA 1L5TA 2HZLA 2F78A 3IAZA 2X7PA 5L9SA 1QJMA 2ZYOA 3HO7A 3TQWA
chains in the Genus database with same CATH superfamily
3EF7A 4EXLA 3MP8A 4GBWA 3TUSA 4PAKA 4F2OA 5A5LA 4JWXA 1FPLA 5TP9B 1Q35A 1IMFA 5K2XA 2PT1A 4OFLA 2OJTA 3H06B 4DZ1A 2HAUA 3TFLA 2O1MA 1DCUA 3OO7A 3PMWA 4L17A 1B9JA 4QF9A 1O7TA 2P2AA 4OFOA 3O28A 2WX9A 2R9JA 1AIVA 4WKMA 3MC2A 1N7WA 3RTWB 3SDFA 1Y4CA 2PFYA 1IMBA 3E3KA 5ET7A 4BDOA 3KN8A 3TTNA 1B2HA 2WBDA 4JVIA 3EN3A 3PPQA 4I3YA 4NMYA 2XWVA 1VSOA 4F3GA 2XWKA 4DCXA 4OEVA 3FJMA 4LATA 4IY5A 1MXZA 3AXFA 4N15A 1B52A 4PETA 1B4HA 1MY0A 3TTMA 1PC3A 1QGXA 3KFMA 2YJPA 4G8HA 3N5LA 2V3TA 3PPNA 4NWCA 3FJ7A 4IB2A 4WXJA 5KCJB 5CM6A 4NF5A 4Q5TA 5ITOA 1B05A 3ILUB 3IK6B 4BDLA 5CI5A 3S9EA 3FBPA 1IXIA 2DYXA 1TXFA 3BFUA 4PBHA 2O51A 2XXTA 1SVXB 2FA7A 3GBAA 2O68A 3VLVA 4AQ4A 4LQ2A 1YXIA 2UXAA 3E13X 2G93A 2GHAA 3LUYA 1JNFA 5KZTA 2FBPA 5DVJA 1B3HA 5ESYA 3QAXA 4BDRA 5I56A 1YPNA 4H6DA 1Y3PA 4RJZA 4PF8A 2KR0A 1NV5A 3FZVA 3N26A 4MX6A 1NKXA 1NNFA 4LZ7A 3E79A 4QRZA 1JEUA 1SQYA 1FPJA 3PD9A 4F22A 3KG2A 1NUXA 2XXHA 1Y1ZA 3QSLA 1A7LA 3OO6A 2QPQA 5I58A 5IKBA 2DQVA 1LFGA 2WBBA 5FTHA 3BIGA 2DE2A 3OXNA 1FQBA 1AWBA 1YYZA 1DMBA 4ZDMA 4U4SA 4G61A 3FVNA 1FTOA 3R6UA 2PCRA 4JSDA 1MQJA 4AB5A 2FVZA 3DELB 1SW1A 4NN3A 3T0JA 4FORA 1USYH 2OWZA 2RC9A 4Q0CA 5A5XB 1B5IA 3NOHA 3B6WA 4G2ZA 1WDNA 2Q8JA 1URSA 3K2DA 4H46A 3VV5A 3S9NC 2I6EA 4DIGA 5IAIA 2HFBA 2Z8EA 4I62A 1FBCA 1GTKA 4ISUA 4GF8A 3M3FA 2F8DA 1GVCA 3MZBA 5FTIA 3C32A 1O64A 3KBRA 3N6UA 3MZ9A 4KD5A 1XHYA 4PE5B 3ONMA 3IX1A 4P0GA 1BP5A 2AL5A 4MIJA 3RGYA 1FQAA 4AS4A 2I48A 3DP4A 4O94A 5L8DA 1N84A 3A3UA 2P1SA 5LDZA 1B46A 1FQDA 3HN0A 3PPOA 3FGSA 1LAFE 4ECFA 3ZSFA 3F11A 2LAOA 4NTLA 3U92A 3SKPA 4F19A 5AA2D 3CHGA 3EHUA 3ZS6A 2O84X 4ZEKA 4PFBA 4OESA 1LBZA 3B6QA 5ELVA 3PGFA 2OWSA 1JW5A 2XD3A 3A09A 2HEUA 1MY2A 4NF6A 4NGUA 3KC0A 1PB9A 4NAPA 3A29A 5J1DA 3D4CA 3UGWA 1B3LA 3DP6A 3M3KA 4XXUA 3A3CA 3TCFA 1FPDA 1T0KA 4I3EA 4GWZA 1MY4A 1FBPA 4PFWA 2F36A 3G3GA 4I8CA 4X1BA 2MKZA 4PE3A 3TCGA 2NXOA 4LONB 4GX4A 4RK9A 4NF8B 4LP2B 3BFTA 3BKIB 3UA8A 1P99A 4H8JA 4M4GA 4JSOA 3W15C 1B40A 3LC8A 3RLFE 3T9HB 5AA1A 4IO6A 1LFHA 4X8RA 3TQLA 2F34A 4BDQA 3OSRA 3VXBA 3SZPA 2RINA 3DP8A 2PYYA 2ZXTA 5I56B 1MS7A 5I3SA 3MQ9A 3PUXE 2THIA 4F2QA 5J16A 5ET8A 1VFDA 4EQ7A 1LCFA 2HXRA 1Y3NA 2NOOA 1QULA 1G0IA 2HZKA 4HE0A 1YZ0A 1MPCA 5I2NA 5FHOA 2DSFA 4DXUA 1JEVA 3HHFA 1IMEA 2XD2A 3MP6A 3FVKA 2B4MA 4QFNA 1MRPA 1NNTA 1K9YA 3W9VA 1GGGA 4P1EA 1FPEA 4O3AA 4ZECA 2HZLA 2BJIA 2F78A 2X7PA 3HO7A 4F31B 4YU0A 1EYJA 3E4RA 3I3VA 5H8NB 2I0CA 2QSXA 3ROJA 3KSXA 4I9DA 4PF6A 1LCTA 4G8NA 5DW8A 5I84A 5JTYA 2X26A 1FPFA 4N17A 4U22A 3H6VA 1BTJA 2RC7A 5LOMA 1MY1A 1FBHA 4GVOA 5L9OA 3KN7A 2DDKA 3ISPA 2GRVA 2UVJA 4C1UA 5IM2A 1QW0A 2V93A 3ZKKA 3GLBA 4JB7A 3G3FA 4PFRA 3RQTA 4GWXA 1I6QA 2ONKE 4Q8RA 4XEQA 1XVYA 1NNPA 3OEMA 1MXUA 3CSGA 4H65A 1Y1MA 3UK4A 4TLLB 2GQ1A 1CE2A 2ANJA 4P9KA 4KI0E 1P1NA 4FECA 1EZPA 3TZAA 1FBFA 4OVQA 3WAEA 2H25A 3OEKA 2AIXA 2ZYNA 2XXXA 3I6VA 3SESA 4ELQA 5DEXA 4PAFA 1UQWA 1FTMA 1PB7A 4X1DA 1PEBA 3MP1A 3TMGA 4LQ5A 3OELA 2DVCA 3D1RA 4QHQA 1SYHA 1QKBA 1MH3A 3IB2A 3PUWE 4H1XA 4AS5A 5IZ1A 1N3XA 4DI3D 2Q88A 4X9TA 3W9WA 4NF8A 3H6TA 2HCAA 4MHFA 3E78A 4C0RA 3KC1A 2QVVA 2DE4A 4PQJA 1IEJA 2PX1A 3IO4A 4ZEDA 1N7XA 4XKRA 1M5DA 4N91A 4H67A 3R7XA 2RCAA 2REJA 1NUYA 5T3JA 3IJXB 2QFLA 1IMCA 2V3QA 2QS2A 1B3GA 2XWOA 2PMSA 4EF2A 4IO4A 4FJPA 4ZZAA 4XIGQ 4OETA 2OZZA 5AA2B 4UA8A 2H9BA 3QYTA 4KCCA 1US4A 5ET5A 1OLAA 1M5EA 2XXWA 1Y20A 4OA4A 4BDMA 4MAGA 4RXLA 4U1OA 3RT6B 5ET6A 2F3DA 3G7WA 1AMFA 1JVXA 4N07A 5TP9A 3HFUA 2KLFA 3LUZA 4YAHX 5IZ3B 2V4CA 5I2NB 5I57A 3CVGA 2OWTA 3CRBA 3IOVA 3U93A 3MAMA 2ZMBA 3CFZA 3G3JA 3VVDA 3LSXA 2IA4A 1ZIUA 1JP4A 2DWAA 4JBZA 4EQBA 3EHSA 4MNCA 3IO6A 5H8NA 2VP1A 4QFPA 3FV2A 1KA1A 3SETA 4RNSA 3GXAA 1XVXA 4QFOA 2Q9TA 2ABHA 3FATA 4XFEA 3TEPA 2DOJA 5H8SA 4GWUA 3SERA 1POTA 3S9MC 3O9PA 4OVSA 2OX3A 2F7AA 3FJGA 1DBZA 4YKKA 5KCJA 3DM0A 4I1DA 4MCOA 3S9LC 2R6GE 5HBCA 3H4ZA 2QVRA 3PTYA 3B6TA 4F1UA 4MLQA 4OFJA 1D3KA 2UYEA 3MVZA 3DLNA 3WAFA 4ZZEA 5EQ7A 3PD8A 3V8XB 3CG3A 3KBZA 1FQEA 1SDXA 3QIMA 4N6KA 2QVUA 3UP9A 3KSJA 2QS4A 3IB1A 2VGQA 5M2VA 4NF4B 4MJOA 2P0SA 3O6IA 1QUKA 2F3BA 1IMDA 2XXVA 3MWBA 1LLSA 2XXKA 1SD3A 2CMOA 3CSBA 1FQCA 1PBQA 1S50A 4FEDA 2OK2A 3RPLB 1EZ9A 2H4IA 4X48A 1IXCA 4R9FA 4JXIA 3VFJA 2DXYA 3K4UA 3C35A 5LTCA 2FYIA 1NFTA 1VDWA 1EYIA 4KXPA 5I58B 5DEXB 3ECRA 1VR5A 1FSAA 1II5A 3HSTA 3HPIA 4C1TA 5H8FA 1SBPA 4GX6A 1YAEA 4N6DA 4IGRA 1IQ7A 1Z7NE 4FAJA 1HSJA 4JVDA 1POY1 1FBGA 5TU0A 1B7HA 4G4PA 3CR9A 5IZ3A 1NI9A 4O8MA 2I4BA 3CI8A 1AH5A 4P47A 1MPBA 3FXRA 4P56A 1P1QA 1NH8A 1ZU0A 3OD7A 1Y4TA 1ZBMA 1PB8A 3VXCA 3KJTA 3QUFA 2DWJA 1JW1A 4UACA 2F7BA 1FTJA 2UVIA 4R2FA 3EHTA 3TAJA 1FQFA 1ATGA 1EZOA 1SW4A 5AA2A 4PC9A 4OENA 3FXQA 4TQUQ 4OVJA 3U1OA 4G8MA 1TWYA 3RNNA 3TTKA 5CBSA 1Q1KA 3O66A 2VPNA 4GLIA 4KYEA 4GWWA 4PP0A 2I49A 1NV3A 1B6HA 1MY3A 2ZYKA 3KZGA 5F24A 4DDDA 2V25A 2CEYA 4NF0A 3O6GA 3OMBA 3FVGA 4GX3A 4YMAA 4YMBA 3T9VA 2L5VA 5IGAA 5JEIA 5I5PA 4XKNA 5AE4A 2QMWA 3B7DA 4XTCQ 1MPDA 2B3BA 3SEYA 5L9SA 5CMKA 1G0HA 1MG1A 2Z8DA 4H8IA 2Q8MA 3VVEA 3C33A 3GZGA 1A8EA 4NX1A 3TELA 2RCBA 4XKPA 4IO2A 1MM6A 3M8UA 5CMBA 5HPQA 1Y3QA 2DE3A 4GIZA 4XKQA 1Y9UA 1Q9DA 2XWIA 5EHSA 1MQIA 4PTKA 4EUOA 2AYSA 3FXUA 3K6XA 1A55A 1MH4A 2QS3A 2F6PA 1RDYA 3RT8A 1AOVA 4IO5A 4ELOA 3FV1A 4ND9A 4OZ9A 4Z0IA 1IIWA 3IFAA 2BJJX 2O7IA 2Q74A 4DCYA 2A5TA 4QFLA 2CEXA 3RYDA 1TT1A 5I7IA 1R6ZA 1KA0A 4MEVA 4KHZE 3D4GA 5H8FB 4H0WA 4GBVA 4UABA 4F3BA 1SPIA 4OVPA 5ICQA 5H8QB 4NF4A 3CFLA 4DXCA 3JV9A 3FASA 1I6BA 1RDZA 1IXHA 2GHBA 3O29A 3LV0A 2XXIA 2Y7RA 1PBPA 2WYKA 2O7UA 5KDTA 2V3UA 2FNCA 2Y84A 4R2BA 3IB0A 2Y7KA 3H3GA 4OANA 5FHNA 4KYDA 1NV1A 1ELJA 1MQHA 1XOCA 2FHYA 2Z22A 2XX9A 3CIJA 1DSNA 3IL1B 2DXRA 2F7CA 4PGPA 2ONRA 4LZ8A 3RPLA 5EQAA 4HS7A 2I3WA 4U2RA 3LR1A 1BIYA 3OENA 4R73A 4YZZA 4GL0A 4DI4B 1RDXA 4GXSB 4R72A 2VD2A 2E1SA 3MSTA 1MXXA 4F1YA 3P7IA 1UIUA 4P1LA 4PDHA 3SEUA 1OVTA 1LAXA 2Y5LA 2ONSA 4GRKA 4IR8A 1LBBA 4F3PA 1I6AA 3T96B 3E9XA 1FBEA 5JK4A 1A8FA 1PDAA 1H44A 2D21A 5DYHA 2VPOA 2O69A 3TDJA 5EQ8A 3JZJA 3S2VA 5I2KB 1D9QA 5EYFA 1IXGA 4BDNA 4GOTA 1BKAA 5BUUA 4JWYA 3TTRA 2XXUA 3N94A 4ZEFA 3MPLA 1P1WA 4HTGA 2F6GA 1SI1A 1H3DA 4GWOA 2XA5A 2B65A 3HV1A 3EKIA 4OERA 3TYHA 3FUZA 1JETA 1D4NA 4LN5A 1FBDA 5DVFA 4MH5A 4N8YA 4QSDA 4GQOA 4QSEA 2UVHA 3Q26A 1FTLA 5H8HA 4QFKA 4OVTA 3RPWA 4DXBA 2Q2CA 2GH9A 2FIXA 4P3LA 3SEWA 3RY3A 4EQ9A 4R9GA 4O7IA 3QXMA 2NVUB 1SW5A 1ZTYA 2REGA 1B32A 1F9BA 4N81A 3BIHA 3KEIA 2OLBA 3MPKA 5EQ9A 5EHMA 2Z8FA 2NUVA 2ZNTA 1B5JA 2FIEA 1SYIA 3S4UA 4ZE9A 1UIVA 2NWJA 4JWOA 4YKIA 1GV8A 3K1NA 1OLCA 3I5OA 3JYRA 3MJNA 2O6AA 2QJEA 3C31A 1DPEA 1LAGE 4LUBA 4Z7EA 2PVUA 3T66A 5DT6A 3Q28A 4KYSA 4M1VA 4FE8A 4OTEA 3K1PA 4EXKA 2Y7WA 3C34A 5H8QA 1M5CA 4OVRA 5AA4B 1JVYA 1LB8A 4POXA 1SI0A 2YPNA 4F18A 2HXWA 3VE1B 2QL3A 1R9LA 1MDQA 3U65A 1LB9A 4OHNA 4HCWA 1NH7A 3UORA 2WEFA 4N4UA 2HQ0A 1N76A 4MLVA 5DTBA 1FJ6A 5CMMA 4PBQA 5I57B 3QMFA 4N13A 5F7VA 4DE8A 5ICTA 5CMCA 2A5TB 3L6HA 4PCDA 1FTKA 2VOZA 3IORA 2OCUA 4GWYA 2H99A 1B0HA 2G29A 2XXPA 4FIMA 4GL8A 1NV4A 4X04A 2VT5A 1O63A 1OMPA 1URDA 1DK4A 5AA3A 4RPNA 4U4XA 4IY6A 5K2YA 4NQ8A 3ILTB 3O2AA 1R9QA 3K02A 1B0LA 3PUZE 1N04A 5KDTB 4LZ5A 4PAIA 4THIA 3BBRA 1NV0A 3T22A 1B51A 4GXAA 3RN8A 4PFYA 4GWSA 4HW8A 1IITA 3C36A 1NMUA 3HHGA 4QSCA 3U94A 3K00A 3CG1A 4ESXA 3TCHA 4G68C 4LVQA 1AL3A 5H8HB 2DVZA 2R71A 3LSLA 4HCYA 2XXRA 3ZKLA 1QUIA 1LBVA 2ZNUA 3IFCA 3K6WA 3Q29A 4G68A 3IOWA 4NE4A 4F39A 1D9YA 2ZNSA 1VFEA 2ZZVA 1JQFA 4N8GA 1WODA 2UVGA 1B3FA 3H6UA 2P3NA 2XX7A 4MNPA 1A40A 5TPAA 3T9UA 3PMVA 1MXWA 1INPA 1DTGA 4EDPA 4PFIA 3EQ1A 1Z7ME 2XXYA 2A5SA 2E0SA 1DOTA 4R74A 1LAHE 2YLNA 3FD3A 1M5BA 3KN3A 1QUJA 1L5TA 4JVCA 1XI6A 3IAZA 1QJMA 2ZYOA 4O3BA 1LGBC 3MVXA 3OO9A 4RYAA 4N6PA 3IJOB 1NNKA 4MF3A 2X7QA 4U1ZA 4Q30B 4YB6A 4ELRA 1MXVA 3O6HA 3QK6A 2D3IA 3QUJA 1NV2A 1EYKA 2Z23A 2ZZWA 1B5HA 3V83A 4TOZA 3TODA 4E0WA 4ZE8A 2XX8A 1H43A 3R26A 5DVIA 4P8BA 2Q2AA 4DLDA 4F3SA 1LBXA 3SEXA 3H03A 3K0VA 4MNIA 1DTZA 1YCJA 1IUDA 1B1HA 2UYFA 2ZYMA 2ALUA 4PFUA 1J1NA 3FIRA 2WKYA 3KOSA 4U21A 4NWDA 4KQPA 1ZLQA 4QBAA 1D9VA 2VHAA 3VLWA 3Q25A 4ELPA 1MDP1 3PV0E 3H7MA 3TKDA 1XS5A 2IEEA 1UTHA 3KGCA 4U23A 1S9TA 4JDFA 3GBBA 5AA4A 2F97A 4MBPA 4QXDA 5EYHA 1HSEA 1OQHA 2VD3A 4RK2A 2AL4A 1GR2A 4G68B 1EH3A 3UIFA 4HE1A 3O97A 4IO3A 1M5FA 1OIBA 1HSLA 3EPEA 3GYYA 2P3VA 1B7ZA 1R1NA 4PFTA 5ISUA 1URGA 1B3EA 2RC8A 3MYUA 1B7UA 2Q89A 4ZEIA 2I3VA 1SW2A 1FRPA 2CZKA 3PUVE 1MM7A 2DP8A 4H5FA 4HXVA 1NUWA 3T93B 2PT2A 4O3CA 4PGNA 4R6KA 2HHMA 4RA1A 5HM4B 3RTFB 1US5A 3T1BA 1TFDA 4OQOA 1LBCA 3CFXA 5ITPA 4K3FA 4NF6B 3VVFA 1UTBA 4P11A 1IZ1A 4KFQA 1OQGA 4R75A 5EYGA 2F35A 3MUQA 4ZS9A 3PMXA 4MFIA 4RY1A 3IOUA 1A54A 1LBYA 1N0TA 3VDFA 4P0IA 1ANFA 4WEDA 3LBSA 1JW4A 2I58A 4IO7A 4LA9A 2V84A 3N6TA 2RKMA 3V89B 3M3LA 1ZJLA 2JJKA 3TPAA 5CC2A 2Y7PA 2Y7IA 2HPGA 4OYVA 4H5GA 4GD5A 4RPOA 3TTLA 1K9ZA 3HCQA 3PUYE 5I59A 2QRYA 2QMXA 3IOTA 3LSFB 3K6UA 2KQZA 4WEPA 4F29A 5CBRA 2XHDA 1A99A 1P1OA 2CZHA 2I0BA 1VE4A 1FPKA 2DS9A 5TPAB 2WYPA 4OWDA 3G3HA 4OEUA 1FPIA 3Q27A 3VLUA 4MMPA 3IR1A 1FTAA 4YB7A 2B4LA 4YICA 1FCKA 2F5XA 1IMAA 1CB6A 1H45A 1NUZA 4YB5A 2HAVA 2D5WA 3OOAA 4KR5A 1CNQA 1B4ZA 1S7YA 1ZMGA 3FVOA 3RUMA 2B3FA 3B8BA 4F1VA 2O1LA 5BWJA 1UTHB 4FEBA 2CZLA 2ESNA 1FW0A 4ESWA 2DWIA 1RKMA 3MVWA 3K6VA 1B1XA 3SEVA 1OVBA 4FATA 3C4MA 2W7YA 2PBWA 3THIA 3LSWA 2DWHA 3MBPA 3PPPA 1KZ8A 4H45A 1NV7A 4BLAA 1UTBB 3MVYA 4NEDA 5I2KA 4ONYA 1DPPA 3OO8A 5JTYB 4KCDA 3OSQA 1FJ9A 3H6WA 1BLFA 3UN6A 1ZKBA 4XF5A 2XXQA 3V5AA 3FXBA 2H98A 1FPGA 2ZZXA 2CZIA 1RYOA 4GFRA 1USYE 5FHMA 1NV6A 3U8QA 4HE2A 4EF1A 3PPRA 4IGTA 1WVJA 5CRYA 5I59B 4POWA 4E0XA 2OBGA 3B50A 2I4CA 4YKJA 4NG7A 1NL5A 4OXVA 4YKPA 4NHBA 2H5YA 5FBPA 3KOTA 1RYXA 5IZZA 4TLMB 3K1MA 1QKAA 1BK4A 1LSTA 2Y5KA 4AB6A 1I69A 3C9HA 1MXYA 3L6GA 4ZEBA 1LEVA 1YTVA 3PU5A 3MW0A 3G3KA 1FPBA 5L9MA 4OMBA 4R6HA 1XC1A 3T9XB 5A5XA 4NF5B 2M8CA 3U72A 1QVSA 1XT8A 3MZ1A 3USDA 2GFEA 1H76A 1TFAA 1N3WA 4KPTA 3KJ7A 1KWHA 1LFIA 4I40A 2QS1A 1MQDA 1LBWA 5B70A 3ODBA 3K01A 3G3IA 4R6YA 1MQGA 1P1UA 1EU8A 2RF1A 5B7DA 4G77A 1B58A 4FBPA 4O7MA 5F1QA 2PFZA 2R8TA 4PDDA 3TQWA
chains in the Genus database with same CATH topology
1MG1A 4YU0A 2Z8DA 4O3BA 1LGBC 3MVXA 3E4RA 3OO9A 4H8IA 3I3VA 4RYAA 3VVEA 3C33A 3EF7A 3GZGA 4EXLA 3MP8A 4N6PA 5H8NB 2I0CA 3IJOB 3TUSA 2QSXA 1A8EA 3KSXA 3TELA 4EXKA 1NNKA 4I9DA 4MF3A 2RCBA 2X7QA 4F2OA 4U1ZA 4Q30B 4YB6A 4JWXA 4XKPA 4ELRA 5TP9B 1LCTA 4G8NA 1Q35A 4IO2A 1MM6A 1MXVA 3M8UA 3O6HA 5K2XA 5CMBA 3QK6A 2D3IA 1Y3QA 2DE3A 5HPQA 5JTYA 2X26A 2PT1A 3QUJA 4ZE9A 4OFLA 4GIZA 2Z23A 4XKQA 2OJTA 3H06B 4DZ1A 2HAUA 1Y9UA 3TFLA 4U22A 1B5HA 1BTJA 2RC7A 2O1MA 3H6VA 5LOMA 1MY1A 3OO7A 3PMWA 3V83A 4GVOA 4TOZA 3TODA 5EHSA 5L9OA 3VLUA 4E0WA 3KN7A 4ZE8A 1MQIA 2XX8A 4L17A 1B9JA 4QF9A 1H43A 1O7TA 2P2AA 3R26A 2AYSA 3FXUA 4EUOA 3K6XA 4OFOA 5DVIA 1A55A 3O28A 1MH4A 2GRVA 2Q2AA 2UVJA 2R9JA 2QS3A 4C1UA 1AIVA 2F6PA 4DLDA 4WKMA 4F3SA 1QW0A 2V93A 3MC2A 3SEXA 3ZKKA 1N7WA 3H03A 3GLBA 4JB7A 3RTWB 3G3FA 3SDFA 3K0VA 3RQTA 1DTZA 1YCJA 1I6QA 1Y4CA 1AOVA 3RT8A 2ONKE 4Q8RA 1IUDA 1XVYA 1NNPA 3E3KA 3OEMA 1MXUA 1B1HA 2UYFA 3CSGA 2ZYMA 4IO5A 4ELOA 4H65A 3FV1A 4BDOA 3KN8A 1Y1MA 4ND9A 3UK4A 4OZ9A 2ALUA 3TTNA 4Z0IA 4TLLB 1B2HA 4PFUA 1J1NA 1CE2A 1IIWA 2ANJA 3EN3A 2BJJX 2WKYA 3FIRA 3PPQA 3KOSA 1EZPA 4KI0E 1P1NA 2O7IA 4FECA 3TZAA 4U21A 4NMYA 1VSOA 4F3GA 3WAEA 2H25A 4NWDA 4DCXA 3OEKA 4KQPA 2AIXA 4DCYA 2ZYNA 4OEVA 2XXXA 3I6VA 3SESA 4F31B 3FJMA 4ELQA 2A5TA 1ZLQA 4LATA 4QFLA 5DEXA 1TT1A 1R6ZA 1D9VA 2VHAA 1UQWA 4IY5A 3VLWA 3Q25A 4ELPA 1FTMA 1MDP1 1MXZA 1PB7A 1PEBA 3PV0E 3AXFA 3MP1A 4X1DA 3TMGA 4KHZE 1B52A 3D4GA 3H7MA 5H8FB 3TKDA 4H0WA 4LQ5A 1XS5A 4PETA 1B4HA 2IEEA 1MY0A 3OELA 2DVCA 1UTHA 3KGCA 3TTMA 4F3BA 4QHQA 1PC3A 1SYHA 1QKBA 4U23A 1S9TA 1MH3A 3KFMA 4JDFA 5ICQA 3GBBA 3IB2A 2YJPA 5H8QB 3PUWE 4G8HA 4H1XA 1N3XA 4NF4A 3N5LA 5AA4A 2F97A 4MBPA 3CFLA 2V3TA 3PPNA 4DXCA 3JV9A 2Q88A 3FASA 1I6BA 4NWCA 4X9TA 3FJ7A 1IXHA 1HSEA 4IB2A 4WXJA 2GHBA 1OQHA 2VD3A 5CM6A 5KCJB 3W9WA 4NF8A 3H6TA 4RK2A 2AL4A 2HCAA 3O29A 1GR2A 2XXIA 2Y7RA 4NF5A 1B05A 1PBPA 4Q5TA 5ITOA 4C0RA 4G68B 2DE4A 4PQJA 1IEJA 1EH3A 3UIFA 3ILUB 2O7UA 5KDTA 3O97A 3IK6B 4IO3A 2V3UA 4BDLA 5CI5A 2FNCA 2PX1A 3IO4A 4ZEDA 1N7XA 3S9EA 2Y84A 1M5FA 4XKRA 1IXIA 1M5DA 4R2BA 1OIBA 1HSLA 2DYXA 3IB0A 2Y7KA 1TXFA 3EPEA 3H3GA 4H67A 5FHNA 4KYDA 3R7XA 1ELJA 1MQHA 2REJA 1XOCA 2RCAA 3BFUA 1B7ZA 1R1NA 2O51A 2XX9A 2Z22A 4PFTA 3CIJA 3IJXB 1DSNA 5ISUA 2XXTA 1URGA 1B3EA 2RC8A 3IL1B 1SVXB 2DXRA 2F7CA 1B7UA 2FA7A 2ONRA 2Q89A 2V3QA 2QS2A 3GBAA 2I3VA 4LZ8A 4ZEIA 2O68A 1SW2A 4HS7A 5CC2A 2I3WA 3LR1A 1B3GA 1BIYA 4U2RA 3PUVE 1MM7A 2PMSA 3OENA 4LQ2A 4IO4A 4R73A 4GL0A 4YZZA 2DP8A 4EF2A 4GXSB 4FJPA 4R72A 2VD2A 4OETA 2E1SA 2UXAA 1MXXA 3E13X 2G93A 2GHAA 2OZZA 1JNFA 3LUYA 4H5FA 4UA8A 5AA2B 5DVJA 3T93B 1B3HA 4F1YA 2H9BA 3QYTA 3P7IA 2PT2A 4KCCA 4O3CA 3QAXA 1UIUA 1US4A 3SEUA 4BDRA 1OVTA 5I84A 4R6KA 1LAXA 1OLAA 5I56A 1YPNA 4RA1A 1M5EA 4GRKA 2ONSA 5HM4B 4H6DA 2XXWA 1Y3PA 1LBBA 1Y20A 4RJZA 4F3PA 3RTFB 4BDMA 1I6AA 1US5A 3T96B 3FZVA 3E9XA 3N26A 1TFDA 4OQOA 5JK4A 4RXLA 1NKXA 1LBCA 4U1OA 1NNFA 4LZ7A 3CFXA 1A8FA 5ITPA 4K3FA 3RT6B 1PDAA 1H44A 4QRZA 1JEUA 2D21A 3G7WA 1SQYA 1AMFA 1JVXA 4N07A 5DYHA 2O69A 3PD9A 5TP9A 3TDJA 3JZJA 4NF6B 2KLFA 3VVFA 1UTBA 4YAHX 4P11A 4ZZAA 1IZ1A 3S2VA 5I2KB 4F22A 4KFQA 3KG2A 5I2NB 1OQGA 5I57A 5EYFA 1IXGA 3CVGA 4R75A 2XXHA 2F35A 3MUQA 4GOTA 1BKAA 1Y1ZA 2OWTA 4ZS9A 3PMXA 5BUUA 4JWYA 4MFIA 3QSLA 1A7LA 3OO6A 3TTRA 4RY1A 3CRBA 3IOVA 3U93A 2XXUA 3MAMA 3IOUA 2QPQA 1A54A 3N94A 4ZEFA 3MPLA 1P1WA 4HTGA 1N0TA 3VDFA 4P0IA 1ANFA 2ZMBA 4WEDA 3CFZA 3LBSA 2F6GA 1JW4A 5I58A 2I58A 4IO7A 4LA9A 2V84A 3G3JA 5IKBA 3VVDA 3LSXA 1SI1A 2IA4A 2DQVA 1LFGA 3N6TA 1H3DA 5FTHA 1ZIUA 4GWOA 2DE2A 2RKMA 2DWAA 4JBZA 3OXNA 1FQBA 4EQBA 3EHSA 1DMBA 3M3LA 4ZDMA 4U4SA 2B65A 3HV1A 3V89B 1ZJLA 3IO6A 3FVNA 4OERA 1FTOA 3R6UA 3TPAA 3FUZA 1JETA 5H8NA 2Y7PA 1D4NA 1MQJA 4JSDA 2Y7IA 3TYHA 4OYVA 4H5GA 4GD5A 2VP1A 4RPOA 5DVFA 3PUYE 3HCQA 4QFPA 3TTLA 4AB5A 5I59A 3FV2A 4MH5A 3DELB 4GQOA 1SW1A 4QSDA 2UVHA 4QSEA 2QRYA 3Q26A 2QMXA 1FTLA 3IOTA 5H8HA 3LSFB 4FORA 4QFKA 3SETA 1USYH 2RC9A 4RNSA 3RPWA 4DXBA 4Q0CA 2Q2CA 3K6UA 2GH9A 3SEWA 1B5IA 5A5XB 3RY3A 3GXAA 1XVXA 3B6WA 4EQ9A 4R9GA 4QFOA 4G2ZA 2Q9TA 1WDNA 3QXMA 2NVUB 1SW5A 1ZTYA 4WEPA 2Q8JA 2REGA 1URSA 1B32A 3K2DA 3VV5A 2ABHA 3FATA 1F9BA 4F29A 5CBRA 3KEIA 2OLBA 3S9NC 2I6EA 1A99A 2XHDA 3TEPA 1P1OA 3MPKA 4DIGA 5IAIA 2HFBA 2Z8EA 4I62A 2DOJA 1GTKA 2I0BA 1VE4A 5EHMA 5H8SA 2Z8FA 4ISUA 2DS9A 2NUVA 2ZNTA 4GF8A 1POTA 3SERA 3S9MC 5TPAB 1B5JA 3M3FA 3O9PA 4OWDA 3G3HA 2F8DA 4OEUA 1GVCA 3Q27A 2F7AA 3FJGA 1SYIA 3C32A 3MZBA 1O64A 3KBRA 3IR1A 3N6UA 5FTIA 1UIVA 4YB7A 3DM0A 3MZ9A 4YKKA 4JWOA 4KD5A 2NWJA 4I1DA 4YKIA 5KCJA 1XHYA 4YICA 1GV8A 3K1NA 3ONMA 4PE5B 1OLCA 3I5OA 3JYRA 3MJNA 2R6GE 3S9LC 1FCKA 3IX1A 4P0GA 2O6AA 5HBCA 3H4ZA 1BP5A 3B6TA 4F1UA 2AL5A 2F5XA 4MLQA 1CB6A 1D3KA 2UYEA 4OFJA 2QJEA 3MVZA 1H45A 3C31A 1DPEA 4YB5A 1LAGE 4LUBA 4Z7EA 2HAVA 2D5WA 3DLNA 3OOAA 4KR5A 3RGYA 3WAFA 1FQAA 1B4ZA 2PVUA 4ZZEA 1S7YA 3PD8A 3T66A 5DT6A 1ZMGA 3Q28A 3FVOA 4KYSA 4M1VA 3RUMA 3V8XB 2B3FA 4FE8A 3CG3A 4OTEA 4F1VA 2I48A 1FQEA 1SDXA 3UP9A 3DP4A 2O1LA 3QIMA 5L8DA 5BWJA 1UTHB 3K1PA 1N84A 3A3UA 2P1SA 3KSJA 1B46A 1FQDA 2CZLA 3HN0A 3PPOA 4FEBA 2Y7WA 3C34A 2QS4A 3FGSA 1LAFE 2ESNA 3IB1A 4ECFA 5H8QA 1FW0A 1M5CA 2VGQA 3F11A 2LAOA 4NF4B 4NTLA 5M2VA 1JVYA 3U92A 3ZSFA 4ESWA 5AA4B 3SKPA 1LB8A 4POXA 1SI0A 4F19A 2P0SA 5AA2D 2DWIA 2YPNA 1RKMA 3EHUA 3O6IA 3ZS6A 2HXWA 2O84X 2QL3A 3MVWA 4ZEKA 3K6VA 3VE1B 1B1XA 4F18A 3SEVA 1QUKA 1OVBA 1R9LA 1MDQA 4FATA 4OESA 1LB9A 2XXVA 4OHNA 3MWBA 1LLSA 3B6QA 3C4MA 5ELVA 2W7YA 3S4UA 4HCWA 1NH7A 3UORA 3PGFA 2PBWA 2OWSA 1JW5A 3THIA 1SD3A 5CMKA 3LSWA 2DWHA 2CMOA 3MBPA 2XD3A 3A09A 2HQ0A 3PPPA 1N76A 3CSBA 4MLVA 1FQCA 1PBQA 1S50A 1MY2A 2HEUA 4FEDA 4NF6A 5CMMA 5DTBA 4BLAA 1UTBB 2OK2A 3MVYA 4NEDA 5I2KA 1EZ9A 2H4IA 4ONYA 4X48A 1DPPA 1IXCA 4R9FA 5I57B 3OO8A 4JXIA 3VFJA 1PB9A 2DXYA 4N13A 3K4UA 5JTYB 3C35A 5J1DA 5F7VA 4DE8A 3D4CA 3UGWA 1B3LA 4KCDA 2FYIA 3OSQA 5ICTA 1NFTA 5CMCA 3DP6A 3H6WA 1BLFA 3UN6A 1ZKBA 3M3KA 4XXUA 2XXQA 3V5AA 5I58B 2A5TB 5DEXB 3L6HA 2H98A 3ECRA 1RYOA 1VR5A 3A3CA 1II5A 1FTKA 3HSTA 4GFRA 2VOZA 3IORA 3TCFA 1USYE 5FHMA 2OCUA 3HPIA 4C1TA 5H8FA 1T0KA 1SBPA 2H99A 3U8QA 4EF1A 3PPRA 1B0HA 1YAEA 1MY4A 2G29A 4IGTA 4IGRA 1IQ7A 1WVJA 5CRYA 1Z7NE 5I59B 4PFWA 4FAJA 2F36A 2XXPA 4FIMA 1HSJA 4POWA 3G3GA 4GL8A 4I8CA 4X1BA 4E0XA 1POY1 2OBGA 5TU0A 1B7HA 1O63A 1OMPA 1URDA 4G4PA 3CR9A 5AA3A 3TCGA 2I4CA 4YKJA 2NXOA 1NL5A 2I4BA 3CI8A 4OXVA 4LONB 4RK9A 1AH5A 4RPNA 4YKPA 4U4XA 1MPBA 4NF8B 4IY6A 3FXRA 4LP2B 5K2YA 3ILTB 3O2AA 1P1QA 1R9QA 1NH8A 2H5YA 3BFTA 3K02A 1B0LA 1ZU0A 3PUZE 3KOTA 1RYXA 1N04A 3OD7A 1Y4TA 1ZBMA 3BKIB 5KDTB 1PB8A 4LZ5A 4THIA 3K1MA 4TLMB 3BBRA 3UA8A 3T22A 3VXCA 1P99A 3KJTA 3QUFA 1QKAA 4H8JA 4M4GA 1B51A 4BDNA 4JSOA 2DWJA 3W15C 1JW1A 1LSTA 4GXAA 1B40A 3LC8A 4PFYA 4UACA 3RLFE 3RN8A 1I69A 4AB6A 4HW8A 1IITA 3C36A 4IO6A 5AA1A 3C9HA 3T9HB 2F7BA 1FTJA 2UVIA 1LFHA 1MXYA 3L6GA 3TQLA 1NMUA 4ZEBA 3HHGA 4QSCA 2F34A 4R2FA 1YTVA 3EHTA 3TAJA 3U94A 1FQFA 4BDQA 3K00A 3PU5A 3CG1A 3OSRA 1ATGA 4ESXA 3TCHA 1EZOA 3MW0A 1SW4A 3VXBA 3G3KA 4G68C 4LVQA 5AA2A 4OENA 1AL3A 2RINA 3DP8A 2DVZA 2PYYA 2R71A 3FXQA 3LSLA 4TQUQ 4OVJA 5H8HB 5L9MA 4OMBA 4R6HA 3U1OA 4G8MA 4HCYA 2ZXTA 1TWYA 2XXRA 3RNNA 5I56B 3TTKA 3ZKLA 1QUIA 1XC1A 3T9XB 1MS7A 2ZNUA 4NF5B 5A5XA 1Q1KA 5CBSA 3O66A 3MQ9A 3K6WA 3Q29A 2M8CA 3PUXE 4G68A 3IOWA 3U72A 1QVSA 1XT8A 4GLIA 4NE4A 3MZ1A 4KYEA 2THIA 4F39A 3USDA 4F2QA 1D9YA 2ZNSA 1VFDA 3VLVA 4AQ4A 2GFEA 4EQ7A 4PP0A 1LCFA 1VFEA 2I49A 1JQFA 1H76A 1TFAA 1B6HA 1N3WA 1WODA 1MY3A 2UVGA 1Y3NA 1B3FA 2NOOA 2ZYKA 3H6UA 3KZGA 1QULA 4KPTA 2HZKA 3KJ7A 4DDDA 2V25A 1KWHA 2XX7A 1LFIA 1A40A 3O6GA 1MPCA 2QS1A 3FVGA 3OMBA 1MXWA 3PMVA 5TPAA 3T9UA 1MQDA 5I2NA 5FHOA 5B70A 4YMAA 2DSFA 4DXUA 4YMBA 3T9VA 1DTGA 1JEVA 3HHFA 3ODBA 2XD2A 3MP6A 3K01A 4EDPA 3G3IA 4R6YA 1MQGA 1P1UA 3FVKA 3EQ1A 5JEIA 1Z7ME 1EU8A 1MRPA 2XXYA 1NNTA 2A5SA 2RF1A 2E0SA 4QFNA 1DOTA 4XKNA 4R74A 1LAHE 3W9VA 1GGGA 5AE4A 5B7DA 4G77A 2QMWA 5KZTA 3B7DA 2YLNA 1B58A 1MPDA 1M5BA 2B3BA 3FD3A 4O3AA 3KN3A 4XTCQ 4XIGQ 1QUJA 5F1QA 3SEYA 4ZECA 1L5TA 2HZLA 2F78A 3IAZA 2X7PA 5L9SA 1QJMA 2ZYOA 3HO7A 3TQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG1 A;  4YU0 A;  2Z8D A;  4O3B A;  1LGB C;  3MVX A;  3E4R A;  3OO9 A;  4H8I A;  3I3V A;  4RYA A;  3VVE A;  3C33 A;  3EF7 A;  3GZG A;  4EXL A;  3MP8 A;  4N6P A;  5H8N B;  2I0C A;  3IJO B;  3TUS A;  2QSX A;  1A8E A;  3KSX A;  3TEL A;  4EXK A;  1NNK A;  4I9D A;  4MF3 A;  2RCB A;  2X7Q A;  4F2O A;  4U1Z A;  4Q30 B;  4YB6 A;  4JWX A;  4XKP A;  4ELR A;  5TP9 B;  1LCT A;  4G8N A;  1Q35 A;  4IO2 A;  1MM6 A;  1MXV A;  3M8U A;  3O6H A;  5K2X A;  5CMB A;  3QK6 A;  2D3I A;  1Y3Q A;  2DE3 A;  5HPQ A;  5JTY A;  2X26 A;  2PT1 A;  3QUJ A;  4ZE9 A;  4OFL A;  4GIZ A;  2Z23 A;  4XKQ A;  2OJT A;  3H06 B;  4DZ1 A;  2HAU A;  1Y9U A;  3TFL A;  4U22 A;  1B5H A;  1BTJ A;  2RC7 A;  2O1M A;  3H6V A;  5LOM A;  1MY1 A;  3OO7 A;  3PMW A;  3V83 A;  4GVO A;  4TOZ A;  3TOD A;  5EHS A;  5L9O A;  3VLU A;  4E0W A;  3KN7 A;  4ZE8 A;  1MQI A;  2XX8 A;  4L17 A;  1B9J A;  4QF9 A;  1H43 A;  1O7T A;  2P2A A;  3R26 A;  2AYS A;  3FXU A;  4EUO A;  3K6X A;  4OFO A;  5DVI A;  1A55 A;  3O28 A;  1MH4 A;  2GRV A;  2Q2A A;  2UVJ A;  2R9J A;  2QS3 A;  4C1U A;  1AIV A;  2F6P A;  4DLD A;  4WKM A;  4F3S A;  1QW0 A;  2V93 A;  3MC2 A;  3SEX A;  3ZKK A;  1N7W A;  3H03 A;  3GLB A;  4JB7 A;  3RTW B;  3G3F A;  3SDF A;  3K0V A;  3RQT A;  1DTZ A;  1YCJ A;  1I6Q A;  1Y4C A;  1AOV A;  3RT8 A;  2ONK E;  4Q8R A;  1IUD A;  1XVY A;  1NNP A;  3E3K A;  3OEM A;  1MXU A;  1B1H A;  2UYF A;  3CSG A;  2ZYM A;  4IO5 A;  4ELO A;  4H65 A;  3FV1 A;  4BDO A;  3KN8 A;  1Y1M A;  4ND9 A;  3UK4 A;  4OZ9 A;  2ALU A;  3TTN A;  4Z0I A;  4TLL B;  1B2H A;  4PFU A;  1J1N A;  1CE2 A;  1IIW A;  2ANJ A;  3EN3 A;  2BJJ X;  2WKY A;  3FIR A;  3PPQ A;  3KOS A;  1EZP A;  4KI0 E;  1P1N A;  2O7I A;  4FEC A;  3TZA A;  4U21 A;  4NMY A;  1VSO A;  4F3G A;  3WAE A;  2H25 A;  4NWD A;  4DCX A;  3OEK A;  4KQP A;  2AIX A;  4DCY A;  2ZYN A;  4OEV A;  2XXX A;  3I6V A;  3SES A;  4F31 B;  3FJM A;  4ELQ A;  2A5T A;  1ZLQ A;  4LAT A;  4QFL A;  5DEX A;  1TT1 A;  1R6Z A;  1D9V A;  2VHA A;  1UQW A;  4IY5 A;  3VLW A;  3Q25 A;  4ELP A;  1FTM A;  1MDP 1;  1MXZ A;  1PB7 A;  1PEB A;  3PV0 E;  3AXF A;  3MP1 A;  4X1D A;  3TMG A;  4KHZ E;  1B52 A;  3D4G A;  3H7M A;  5H8F B;  3TKD A;  4H0W A;  4LQ5 A;  1XS5 A;  4PET A;  1B4H A;  2IEE A;  1MY0 A;  3OEL A;  2DVC A;  1UTH A;  3KGC A;  3TTM A;  4F3B A;  4QHQ A;  1PC3 A;  1SYH A;  1QKB A;  4U23 A;  1S9T A;  1MH3 A;  3KFM A;  4JDF A;  5ICQ A;  3GBB A;  3IB2 A;  2YJP A;  5H8Q B;  3PUW E;  4G8H A;  4H1X A;  1N3X A;  4NF4 A;  3N5L A;  5AA4 A;  2F97 A;  4MBP A;  3CFL A;  2V3T A;  3PPN A;  4DXC A;  3JV9 A;  2Q88 A;  3FAS A;  1I6B A;  4NWC A;  4X9T A;  3FJ7 A;  1IXH A;  1HSE A;  4IB2 A;  4WXJ A;  2GHB A;  1OQH A;  2VD3 A;  5CM6 A;  5KCJ B;  3W9W A;  4NF8 A;  3H6T A;  4RK2 A;  2AL4 A;  2HCA A;  3O29 A;  1GR2 A;  2XXI A;  2Y7R A;  4NF5 A;  1B05 A;  1PBP A;  4Q5T A;  5ITO A;  4C0R A;  4G68 B;  2DE4 A;  4PQJ A;  1IEJ A;  1EH3 A;  3UIF A;  3ILU B;  2O7U A;  5KDT A;  3O97 A;  3IK6 B;  4IO3 A;  2V3U A;  4BDL A;  5CI5 A;  2FNC A;  2PX1 A;  3IO4 A;  4ZED A;  1N7X A;  3S9E A;  2Y84 A;  1M5F A;  4XKR A;  1IXI A;  1M5D A;  4R2B A;  1OIB A;  1HSL A;  2DYX A;  3IB0 A;  2Y7K A;  1TXF A;  3EPE A;  3H3G A;  4H67 A;  5FHN A;  4KYD A;  3R7X A;  1ELJ A;  1MQH A;  2REJ A;  1XOC A;  2RCA A;  3BFU A;  1B7Z A;  1R1N A;  2O51 A;  2XX9 A;  2Z22 A;  4PFT A;  3CIJ A;  3IJX B;  1DSN A;  5ISU A;  2XXT A;  1URG A;  1B3E A;  2RC8 A;  3IL1 B;  1SVX B;  2DXR A;  2F7C A;  1B7U A;  2FA7 A;  2ONR A;  2Q89 A;  2V3Q A;  2QS2 A;  3GBA A;  2I3V A;  4LZ8 A;  4ZEI A;  2O68 A;  1SW2 A;  4HS7 A;  5CC2 A;  2I3W A;  3LR1 A;  1B3G A;  1BIY A;  4U2R A;  3PUV E;  1MM7 A;  2PMS A;  3OEN A;  4LQ2 A;  4IO4 A;  4R73 A;  4GL0 A;  4YZZ A;  2DP8 A;  4EF2 A;  4GXS B;  4FJP A;  4R72 A;  2VD2 A;  4OET A;  2E1S A;  2UXA A;  1MXX A;  3E13 X;  2G93 A;  2GHA A;  2OZZ A;  1JNF A;  3LUY A;  4H5F A;  4UA8 A;  5AA2 B;  5DVJ A;  3T93 B;  1B3H A;  4F1Y A;  2H9B A;  3QYT A;  3P7I A;  2PT2 A;  4KCC A;  4O3C A;  3QAX A;  1UIU A;  1US4 A;  3SEU A;  4BDR A;  1OVT A;  5I84 A;  4R6K A;  1LAX A;  1OLA A;  5I56 A;  1YPN A;  4RA1 A;  1M5E A;  4GRK A;  2ONS A;  5HM4 B;  4H6D A;  2XXW A;  1Y3P A;  1LBB A;  1Y20 A;  4RJZ A;  4F3P A;  3RTF B;  4BDM A;  1I6A A;  1US5 A;  3T96 B;  3FZV A;  3E9X A;  3N26 A;  1TFD A;  4OQO A;  5JK4 A;  4RXL A;  1NKX A;  1LBC A;  4U1O A;  1NNF A;  4LZ7 A;  3CFX A;  1A8F A;  5ITP A;  4K3F A;  3RT6 B;  1PDA A;  1H44 A;  4QRZ A;  1JEU A;  2D21 A;  3G7W A;  1SQY A;  1AMF A;  1JVX A;  4N07 A;  5DYH A;  2O69 A;  3PD9 A;  5TP9 A;  3TDJ A;  3JZJ A;  4NF6 B;  2KLF A;  3VVF A;  1UTB A;  4YAH X;  4P11 A;  4ZZA A;  1IZ1 A;  3S2V A;  5I2K B;  4F22 A;  4KFQ A;  3KG2 A;  5I2N B;  1OQG A;  5I57 A;  5EYF A;  1IXG A;  3CVG A;  4R75 A;  2XXH A;  2F35 A;  3MUQ A;  4GOT A;  1BKA A;  1Y1Z A;  2OWT A;  4ZS9 A;  3PMX A;  5BUU A;  4JWY A;  4MFI A;  3QSL A;  1A7L A;  3OO6 A;  3TTR A;  4RY1 A;  3CRB A;  3IOV A;  3U93 A;  2XXU A;  3MAM A;  3IOU A;  2QPQ A;  1A54 A;  3N94 A;  4ZEF A;  3MPL A;  1P1W A;  4HTG A;  1N0T A;  3VDF A;  4P0I A;  1ANF A;  2ZMB A;  4WED A;  3CFZ A;  3LBS A;  2F6G A;  1JW4 A;  5I58 A;  2I58 A;  4IO7 A;  4LA9 A;  2V84 A;  3G3J A;  5IKB A;  3VVD A;  3LSX A;  1SI1 A;  2IA4 A;  2DQV A;  1LFG A;  3N6T A;  1H3D A;  5FTH A;  1ZIU A;  4GWO A;  2DE2 A;  2RKM A;  2DWA A;  4JBZ A;  3OXN A;  1FQB A;  4EQB A;  3EHS A;  1DMB A;  3M3L A;  4ZDM A;  4U4S A;  2B65 A;  3HV1 A;  3V89 B;  1ZJL A;  3IO6 A;  3FVN A;  4OER A;  1FTO A;  3R6U A;  3TPA A;  3FUZ A;  1JET A;  5H8N A;  2Y7P A;  1D4N A;  1MQJ A;  4JSD A;  2Y7I A;  3TYH A;  4OYV A;  4H5G A;  4GD5 A;  2VP1 A;  4RPO A;  5DVF A;  3PUY E;  3HCQ A;  4QFP A;  3TTL A;  4AB5 A;  5I59 A;  3FV2 A;  4MH5 A;  3DEL B;  4GQO A;  1SW1 A;  4QSD A;  2UVH A;  4QSE A;  2QRY A;  3Q26 A;  2QMX A;  1FTL A;  3IOT A;  5H8H A;  3LSF B;  4FOR A;  4QFK A;  3SET A;  1USY H;  2RC9 A;  4RNS A;  3RPW A;  4DXB A;  4Q0C A;  2Q2C A;  3K6U A;  2GH9 A;  3SEW A;  1B5I A;  5A5X B;  3RY3 A;  3GXA A;  1XVX A;  3B6W A;  4EQ9 A;  4R9G A;  4QFO A;  4G2Z A;  2Q9T A;  1WDN A;  3QXM A;  2NVU B;  1SW5 A;  1ZTY A;  4WEP A;  2Q8J A;  2REG A;  1URS A;  1B32 A;  3K2D A;  3VV5 A;  2ABH A;  3FAT A;  1F9B A;  4F29 A;  5CBR A;  3KEI A;  2OLB A;  3S9N C;  2I6E A;  1A99 A;  2XHD A;  3TEP A;  1P1O A;  3MPK A;  4DIG A;  5IAI A;  2HFB A;  2Z8E A;  4I62 A;  2DOJ A;  1GTK A;  2I0B A;  1VE4 A;  5EHM A;  5H8S A;  2Z8F A;  4ISU A;  2DS9 A;  2NUV A;  2ZNT A;  4GF8 A;  1POT A;  3SER A;  3S9M C;  5TPA B;  1B5J A;  3M3F A;  3O9P A;  4OWD A;  3G3H A;  2F8D A;  4OEU A;  1GVC A;  3Q27 A;  2F7A A;  3FJG A;  1SYI A;  3C32 A;  3MZB A;  1O64 A;  3KBR A;  3IR1 A;  3N6U A;  5FTI A;  1UIV A;  4YB7 A;  3DM0 A;  3MZ9 A;  4YKK A;  4JWO A;  4KD5 A;  2NWJ A;  4I1D A;  4YKI A;  5KCJ A;  1XHY A;  4YIC A;  1GV8 A;  3K1N A;  3ONM A;  4PE5 B;  1OLC A;  3I5O A;  3JYR A;  3MJN A;  2R6G E;  3S9L C;  1FCK A;  3IX1 A;  4P0G A;  2O6A A;  5HBC A;  3H4Z A;  1BP5 A;  3B6T A;  4F1U A;  2AL5 A;  2F5X A;  4MLQ A;  1CB6 A;  1D3K A;  2UYE A;  4OFJ A;  2QJE A;  3MVZ A;  1H45 A;  3C31 A;  1DPE A;  4YB5 A;  1LAG E;  4LUB A;  4Z7E A;  2HAV A;  2D5W A;  3DLN A;  3OOA A;  4KR5 A;  3RGY A;  3WAF A;  1FQA A;  1B4Z A;  2PVU A;  4ZZE A;  1S7Y A;  3PD8 A;  3T66 A;  5DT6 A;  1ZMG A;  3Q28 A;  3FVO A;  4KYS A;  4M1V A;  3RUM A;  3V8X B;  2B3F A;  4FE8 A;  3CG3 A;  4OTE A;  4F1V A;  2I48 A;  1FQE A;  1SDX A;  3UP9 A;  3DP4 A;  2O1L A;  3QIM A;  5L8D A;  5BWJ A;  1UTH B;  3K1P A;  1N84 A;  3A3U A;  2P1S A;  3KSJ A;  1B46 A;  1FQD A;  2CZL A;  3HN0 A;  3PPO A;  4FEB A;  2Y7W A;  3C34 A;  2QS4 A;  3FGS A;  1LAF E;  2ESN A;  3IB1 A;  4ECF A;  5H8Q A;  1FW0 A;  1M5C A;  2VGQ A;  3F11 A;  2LAO A;  4NF4 B;  4NTL A;  5M2V A;  1JVY A;  3U92 A;  3ZSF A;  4ESW A;  5AA4 B;  3SKP A;  1LB8 A;  4POX A;  1SI0 A;  4F19 A;  2P0S A;  5AA2 D;  2DWI A;  2YPN A;  1RKM A;  3EHU A;  3O6I A;  3ZS6 A;  2HXW A;  2O84 X;  2QL3 A;  3MVW A;  4ZEK A;  3K6V A;  3VE1 B;  1B1X A;  4F18 A;  3SEV A;  1QUK A;  1OVB A;  1R9L A;  1MDQ A;  4FAT A;  4OES A;  1LB9 A;  2XXV A;  4OHN A;  3MWB A;  1LLS A;  3B6Q A;  3C4M A;  5ELV A;  2W7Y A;  3S4U A;  4HCW A;  1NH7 A;  3UOR A;  3PGF A;  2PBW A;  2OWS A;  1JW5 A;  3THI A;  1SD3 A;  5CMK A;  3LSW A;  2DWH A;  2CMO A;  3MBP A;  2XD3 A;  3A09 A;  2HQ0 A;  3PPP A;  1N76 A;  3CSB A;  4MLV A;  1FQC A;  1PBQ A;  1S50 A;  1MY2 A;  2HEU A;  4FED A;  4NF6 A;  5CMM A;  5DTB A;  4BLA A;  1UTB B;  2OK2 A;  3MVY A;  4NED A;  5I2K A;  1EZ9 A;  2H4I A;  4ONY A;  4X48 A;  1DPP A;  1IXC A;  4R9F A;  5I57 B;  3OO8 A;  4JXI A;  3VFJ A;  1PB9 A;  2DXY A;  4N13 A;  3K4U A;  5JTY B;  3C35 A;  5J1D A;  5F7V A;  4DE8 A;  3D4C A;  3UGW A;  1B3L A;  4KCD A;  2FYI A;  3OSQ A;  5ICT A;  1NFT A;  5CMC A;  3DP6 A;  3H6W A;  1BLF A;  3UN6 A;  1ZKB A;  3M3K A;  4XXU A;  2XXQ A;  3V5A A;  5I58 B;  2A5T B;  5DEX B;  3L6H A;  2H98 A;  3ECR A;  1RYO A;  1VR5 A;  3A3C A;  1II5 A;  1FTK A;  3HST A;  4GFR A;  2VOZ A;  3IOR A;  3TCF A;  1USY E;  5FHM A;  2OCU A;  3HPI A;  4C1T A;  5H8F A;  1T0K A;  1SBP A;  2H99 A;  3U8Q A;  4EF1 A;  3PPR A;  1B0H A;  1YAE A;  1MY4 A;  2G29 A;  4IGT A;  4IGR A;  1IQ7 A;  1WVJ A;  5CRY A;  1Z7N E;  5I59 B;  4PFW A;  4FAJ A;  2F36 A;  2XXP A;  4FIM A;  1HSJ A;  4POW A;  3G3G A;  4GL8 A;  4I8C A;  4X1B A;  4E0X A;  1POY 1;  2OBG A;  5TU0 A;  1B7H A;  1O63 A;  1OMP A;  1URD A;  4G4P A;  3CR9 A;  5AA3 A;  3TCG A;  2I4C A;  4YKJ A;  2NXO A;  1NL5 A;  2I4B A;  3CI8 A;  4OXV A;  4LON B;  4RK9 A;  1AH5 A;  4RPN A;  4YKP A;  4U4X A;  1MPB A;  4NF8 B;  4IY6 A;  3FXR A;  4LP2 B;  5K2Y A;  3ILT B;  3O2A A;  1P1Q A;  1R9Q A;  1NH8 A;  2H5Y A;  3BFT A;  3K02 A;  1B0L A;  1ZU0 A;  3PUZ E;  3KOT A;  1RYX A;  1N04 A;  3OD7 A;  1Y4T A;  1ZBM A;  3BKI B;  5KDT B;  1PB8 A;  4LZ5 A;  4THI A;  3K1M A;  4TLM B;  3BBR A;  3UA8 A;  3T22 A;  3VXC A;  1P99 A;  3KJT A;  3QUF A;  1QKA A;  4H8J A;  4M4G A;  1B51 A;  4BDN A;  4JSO A;  2DWJ A;  3W15 C;  1JW1 A;  1LST A;  4GXA A;  1B40 A;  3LC8 A;  4PFY A;  4UAC A;  3RLF E;  3RN8 A;  1I69 A;  4AB6 A;  4HW8 A;  1IIT A;  3C36 A;  4IO6 A;  5AA1 A;  3C9H A;  3T9H B;  2F7B A;  1FTJ A;  2UVI A;  1LFH A;  1MXY A;  3L6G A;  3TQL A;  1NMU A;  4ZEB A;  3HHG A;  4QSC A;  2F34 A;  4R2F A;  1YTV A;  3EHT A;  3TAJ A;  3U94 A;  1FQF A;  4BDQ A;  3K00 A;  3PU5 A;  3CG1 A;  3OSR A;  1ATG A;  4ESX A;  3TCH A;  1EZO A;  3MW0 A;  1SW4 A;  3VXB A;  3G3K A;  4G68 C;  4LVQ A;  5AA2 A;  4OEN A;  1AL3 A;  2RIN A;  3DP8 A;  2DVZ A;  2PYY A;  2R71 A;  3FXQ A;  3LSL A;  4TQU Q;  4OVJ A;  5H8H B;  5L9M A;  4OMB A;  4R6H A;  3U1O A;  4G8M A;  4HCY A;  2ZXT A;  1TWY A;  2XXR A;  3RNN A;  5I56 B;  3TTK A;  3ZKL A;  1QUI A;  1XC1 A;  3T9X B;  1MS7 A;  2ZNU A;  4NF5 B;  5A5X A;  1Q1K A;  5CBS A;  3O66 A;  3MQ9 A;  3K6W A;  3Q29 A;  2M8C A;  3PUX E;  4G68 A;  3IOW A;  3U72 A;  1QVS A;  1XT8 A;  4GLI A;  4NE4 A;  3MZ1 A;  4KYE A;  2THI A;  4F39 A;  3USD A;  4F2Q A;  1D9Y A;  2ZNS A;  1VFD A;  3VLV A;  4AQ4 A;  2GFE A;  4EQ7 A;  4PP0 A;  1LCF A;  1VFE A;  2I49 A;  1JQF A;  1H76 A;  1TFA A;  1B6H A;  1N3W A;  1WOD A;  1MY3 A;  2UVG A;  1Y3N A;  1B3F A;  2NOO A;  2ZYK A;  3H6U A;  3KZG A;  1QUL A;  4KPT A;  2HZK A;  3KJ7 A;  4DDD A;  2V25 A;  1KWH A;  2XX7 A;  1LFI A;  1A40 A;  3O6G A;  1MPC A;  2QS1 A;  3FVG A;  3OMB A;  1MXW A;  3PMV A;  5TPA A;  3T9U A;  1MQD A;  5I2N A;  5FHO A;  5B70 A;  4YMA A;  2DSF A;  4DXU A;  4YMB A;  3T9V A;  1DTG A;  1JEV A;  3HHF A;  3ODB A;  2XD2 A;  3MP6 A;  3K01 A;  4EDP A;  3G3I A;  4R6Y A;  1MQG A;  1P1U A;  3FVK A;  3EQ1 A;  5JEI A;  1Z7M E;  1EU8 A;  1MRP A;  2XXY A;  1NNT A;  2A5S A;  2RF1 A;  2E0S A;  4QFN A;  1DOT A;  4XKN A;  4R74 A;  1LAH E;  3W9V A;  1GGG A;  5AE4 A;  5B7D A;  4G77 A;  2QMW A;  5KZT A;  3B7D A;  2YLN A;  1B58 A;  1MPD A;  1M5B A;  2B3B A;  3FD3 A;  4O3A A;  3KN3 A;  4XTC Q;  4XIG Q;  1QUJ A;  5F1Q A;  3SEY A;  4ZEC A;  1L5T A;  2HZL A;  2F78 A;  3IAZ A;  2X7P A;  5L9S A;  1QJM A;  2ZYO A;  3HO7 A;  3TQW A; 
#chains in the Genus database with same CATH topology
 3EF7 A;  4EXL A;  3MP8 A;  4GBW A;  3TUS A;  4PAK A;  4F2O A;  5A5L A;  4JWX A;  1FPL A;  5TP9 B;  1Q35 A;  1IMF A;  5K2X A;  2PT1 A;  4OFL A;  2OJT A;  3H06 B;  4DZ1 A;  2HAU A;  3TFL A;  2O1M A;  1DCU A;  3OO7 A;  3PMW A;  4L17 A;  1B9J A;  4QF9 A;  1O7T A;  2P2A A;  4OFO A;  3O28 A;  2WX9 A;  2R9J A;  1AIV A;  4WKM A;  3MC2 A;  1N7W A;  3RTW B;  3SDF A;  1Y4C A;  2PFY A;  1IMB A;  3E3K A;  5ET7 A;  4BDO A;  3KN8 A;  3TTN A;  1B2H A;  2WBD A;  4JVI A;  3EN3 A;  3PPQ A;  4I3Y A;  4NMY A;  2XWV A;  1VSO A;  4F3G A;  2XWK A;  4DCX A;  4OEV A;  3FJM A;  4LAT A;  4IY5 A;  1MXZ A;  3AXF A;  4N15 A;  1B52 A;  4PET A;  1B4H A;  1MY0 A;  3TTM A;  1PC3 A;  1QGX A;  3KFM A;  2YJP A;  4G8H A;  3N5L A;  2V3T A;  3PPN A;  4NWC A;  3FJ7 A;  4IB2 A;  4WXJ A;  5KCJ B;  5CM6 A;  4NF5 A;  4Q5T A;  5ITO A;  1B05 A;  3ILU B;  3IK6 B;  4BDL A;  5CI5 A;  3S9E A;  3FBP A;  1IXI A;  2DYX A;  1TXF A;  3BFU A;  4PBH A;  2O51 A;  2XXT A;  1SVX B;  2FA7 A;  3GBA A;  2O68 A;  3VLV A;  4AQ4 A;  4LQ2 A;  1YXI A;  2UXA A;  3E13 X;  2G93 A;  2GHA A;  3LUY A;  1JNF A;  5KZT A;  2FBP A;  5DVJ A;  1B3H A;  5ESY A;  3QAX A;  4BDR A;  5I56 A;  1YPN A;  4H6D A;  1Y3P A;  4RJZ A;  4PF8 A;  2KR0 A;  1NV5 A;  3FZV A;  3N26 A;  4MX6 A;  1NKX A;  1NNF A;  4LZ7 A;  3E79 A;  4QRZ A;  1JEU A;  1SQY A;  1FPJ A;  3PD9 A;  4F22 A;  3KG2 A;  1NUX A;  2XXH A;  1Y1Z A;  3QSL A;  1A7L A;  3OO6 A;  2QPQ A;  5I58 A;  5IKB A;  2DQV A;  1LFG A;  2WBB A;  5FTH A;  3BIG A;  2DE2 A;  3OXN A;  1FQB A;  1AWB A;  1YYZ A;  1DMB A;  4ZDM A;  4U4S A;  4G61 A;  3FVN A;  1FTO A;  3R6U A;  2PCR A;  4JSD A;  1MQJ A;  4AB5 A;  2FVZ A;  3DEL B;  1SW1 A;  4NN3 A;  3T0J A;  4FOR A;  1USY H;  2OWZ A;  2RC9 A;  4Q0C A;  5A5X B;  1B5I A;  3NOH A;  3B6W A;  4G2Z A;  1WDN A;  2Q8J A;  1URS A;  3K2D A;  4H46 A;  3VV5 A;  3S9N C;  2I6E A;  4DIG A;  5IAI A;  2HFB A;  2Z8E A;  4I62 A;  1FBC A;  1GTK A;  4ISU A;  4GF8 A;  3M3F A;  2F8D A;  1GVC A;  3MZB A;  5FTI A;  3C32 A;  1O64 A;  3KBR A;  3N6U A;  3MZ9 A;  4KD5 A;  1XHY A;  4PE5 B;  3ONM A;  3IX1 A;  4P0G A;  1BP5 A;  2AL5 A;  4MIJ A;  3RGY A;  1FQA A;  4AS4 A;  2I48 A;  3DP4 A;  4O94 A;  5L8D A;  1N84 A;  3A3U A;  2P1S A;  5LDZ A;  1B46 A;  1FQD A;  3HN0 A;  3PPO A;  3FGS A;  1LAF E;  4ECF A;  3ZSF A;  3F11 A;  2LAO A;  4NTL A;  3U92 A;  3SKP A;  4F19 A;  5AA2 D;  3CHG A;  3EHU A;  3ZS6 A;  2O84 X;  4ZEK A;  4PFB A;  4OES A;  1LBZ A;  3B6Q A;  5ELV A;  3PGF A;  2OWS A;  1JW5 A;  2XD3 A;  3A09 A;  2HEU A;  1MY2 A;  4NF6 A;  4NGU A;  3KC0 A;  1PB9 A;  4NAP A;  3A29 A;  5J1D A;  3D4C A;  3UGW A;  1B3L A;  3DP6 A;  3M3K A;  4XXU A;  3A3C A;  3TCF A;  1FPD A;  1T0K A;  4I3E A;  4GWZ A;  1MY4 A;  1FBP A;  4PFW A;  2F36 A;  3G3G A;  4I8C A;  4X1B A;  2MKZ A;  4PE3 A;  3TCG A;  2NXO A;  4LON B;  4GX4 A;  4RK9 A;  4NF8 B;  4LP2 B;  3BFT A;  3BKI B;  3UA8 A;  1P99 A;  4H8J A;  4M4G A;  4JSO A;  3W15 C;  1B40 A;  3LC8 A;  3RLF E;  3T9H B;  5AA1 A;  4IO6 A;  1LFH A;  4X8R A;  3TQL A;  2F34 A;  4BDQ A;  3OSR A;  3VXB A;  3SZP A;  2RIN A;  3DP8 A;  2PYY A;  2ZXT A;  5I56 B;  1MS7 A;  5I3S A;  3MQ9 A;  3PUX E;  2THI A;  4F2Q A;  5J16 A;  5ET8 A;  1VFD A;  4EQ7 A;  1LCF A;  2HXR A;  1Y3N A;  2NOO A;  1QUL A;  1G0I A;  2HZK A;  4HE0 A;  1YZ0 A;  1MPC A;  5I2N A;  5FHO A;  2DSF A;  4DXU A;  1JEV A;  3HHF A;  1IME A;  2XD2 A;  3MP6 A;  3FVK A;  2B4M A;  4QFN A;  1MRP A;  1NNT A;  1K9Y A;  3W9V A;  1GGG A;  4P1E A;  1FPE A;  4O3A A;  4ZEC A;  2HZL A;  2BJI A;  2F78 A;  2X7P A;  3HO7 A;  4F31 B;  4YU0 A;  1EYJ A;  3E4R A;  3I3V A;  5H8N B;  2I0C A;  2QSX A;  3ROJ A;  3KSX A;  4I9D A;  4PF6 A;  1LCT A;  4G8N A;  5DW8 A;  5I84 A;  5JTY A;  2X26 A;  1FPF A;  4N17 A;  4U22 A;  3H6V A;  1BTJ A;  2RC7 A;  5LOM A;  1MY1 A;  1FBH A;  4GVO A;  5L9O A;  3KN7 A;  2DDK A;  3ISP A;  2GRV A;  2UVJ A;  4C1U A;  5IM2 A;  1QW0 A;  2V93 A;  3ZKK A;  3GLB A;  4JB7 A;  3G3F A;  4PFR A;  3RQT A;  4GWX A;  1I6Q A;  2ONK E;  4Q8R A;  4XEQ A;  1XVY A;  1NNP A;  3OEM A;  1MXU A;  3CSG A;  4H65 A;  1Y1M A;  3UK4 A;  4TLL B;  2GQ1 A;  1CE2 A;  2ANJ A;  4P9K A;  4KI0 E;  1P1N A;  4FEC A;  1EZP A;  3TZA A;  1FBF A;  4OVQ A;  3WAE A;  2H25 A;  3OEK A;  2AIX A;  2ZYN A;  2XXX A;  3I6V A;  3SES A;  4ELQ A;  5DEX A;  4PAF A;  1UQW A;  1FTM A;  1PB7 A;  4X1D A;  1PEB A;  3MP1 A;  3TMG A;  4LQ5 A;  3OEL A;  2DVC A;  3D1R A;  4QHQ A;  1SYH A;  1QKB A;  1MH3 A;  3IB2 A;  3PUW E;  4H1X A;  4AS5 A;  5IZ1 A;  1N3X A;  4DI3 D;  2Q88 A;  4X9T A;  3W9W A;  4NF8 A;  3H6T A;  2HCA A;  4MHF A;  3E78 A;  4C0R A;  3KC1 A;  2QVV A;  2DE4 A;  4PQJ A;  1IEJ A;  2PX1 A;  3IO4 A;  4ZED A;  1N7X A;  4XKR A;  1M5D A;  4N91 A;  4H67 A;  3R7X A;  2RCA A;  2REJ A;  1NUY A;  5T3J A;  3IJX B;  2QFL A;  1IMC A;  2V3Q A;  2QS2 A;  1B3G A;  2XWO A;  2PMS A;  4EF2 A;  4IO4 A;  4FJP A;  4ZZA A;  4XIG Q;  4OET A;  2OZZ A;  5AA2 B;  4UA8 A;  2H9B A;  3QYT A;  4KCC A;  1US4 A;  5ET5 A;  1OLA A;  1M5E A;  2XXW A;  1Y20 A;  4OA4 A;  4BDM A;  4MAG A;  4RXL A;  4U1O A;  3RT6 B;  5ET6 A;  2F3D A;  3G7W A;  1AMF A;  1JVX A;  4N07 A;  5TP9 A;  3HFU A;  2KLF A;  3LUZ A;  4YAH X;  5IZ3 B;  2V4C A;  5I2N B;  5I57 A;  3CVG A;  2OWT A;  3CRB A;  3IOV A;  3U93 A;  3MAM A;  2ZMB A;  3CFZ A;  3G3J A;  3VVD A;  3LSX A;  2IA4 A;  1ZIU A;  1JP4 A;  2DWA A;  4JBZ A;  4EQB A;  3EHS A;  4MNC A;  3IO6 A;  5H8N A;  2VP1 A;  4QFP A;  3FV2 A;  1KA1 A;  3SET A;  4RNS A;  3GXA A;  1XVX A;  4QFO A;  2Q9T A;  2ABH A;  3FAT A;  4XFE A;  3TEP A;  2DOJ A;  5H8S A;  4GWU A;  3SER A;  1POT A;  3S9M C;  3O9P A;  4OVS A;  2OX3 A;  2F7A A;  3FJG A;  1DBZ A;  4YKK A;  5KCJ A;  3DM0 A;  4I1D A;  4MCO A;  3S9L C;  2R6G E;  5HBC A;  3H4Z A;  2QVR A;  3PTY A;  3B6T A;  4F1U A;  4MLQ A;  4OFJ A;  1D3K A;  2UYE A;  3MVZ A;  3DLN A;  3WAF A;  4ZZE A;  5EQ7 A;  3PD8 A;  3V8X B;  3CG3 A;  3KBZ A;  1FQE A;  1SDX A;  3QIM A;  4N6K A;  2QVU A;  3UP9 A;  3KSJ A;  2QS4 A;  3IB1 A;  2VGQ A;  5M2V A;  4NF4 B;  4MJO A;  2P0S A;  3O6I A;  1QUK A;  2F3B A;  1IMD A;  2XXV A;  3MWB A;  1LLS A;  2XXK A;  1SD3 A;  2CMO A;  3CSB A;  1FQC A;  1PBQ A;  1S50 A;  4FED A;  2OK2 A;  3RPL B;  1EZ9 A;  2H4I A;  4X48 A;  1IXC A;  4R9F A;  4JXI A;  3VFJ A;  2DXY A;  3K4U A;  3C35 A;  5LTC A;  2FYI A;  1NFT A;  1VDW A;  1EYI A;  4KXP A;  5I58 B;  5DEX B;  3ECR A;  1VR5 A;  1FSA A;  1II5 A;  3HST A;  3HPI A;  4C1T A;  5H8F A;  1SBP A;  4GX6 A;  1YAE A;  4N6D A;  4IGR A;  1IQ7 A;  1Z7N E;  4FAJ A;  1HSJ A;  4JVD A;  1POY 1;  1FBG A;  5TU0 A;  1B7H A;  4G4P A;  3CR9 A;  5IZ3 A;  1NI9 A;  4O8M A;  2I4B A;  3CI8 A;  1AH5 A;  4P47 A;  1MPB A;  3FXR A;  4P56 A;  1P1Q A;  1NH8 A;  1ZU0 A;  3OD7 A;  1Y4T A;  1ZBM A;  1PB8 A;  3VXC A;  3KJT A;  3QUF A;  2DWJ A;  1JW1 A;  4UAC A;  2F7B A;  1FTJ A;  2UVI A;  4R2F A;  3EHT A;  3TAJ A;  1FQF A;  1ATG A;  1EZO A;  1SW4 A;  5AA2 A;  4PC9 A;  4OEN A;  3FXQ A;  4TQU Q;  4OVJ A;  3U1O A;  4G8M A;  1TWY A;  3RNN A;  3TTK A;  5CBS A;  1Q1K A;  3O66 A;  2VPN A;  4GLI A;  4KYE A;  4GWW A;  4PP0 A;  2I49 A;  1NV3 A;  1B6H A;  1MY3 A;  2ZYK A;  3KZG A;  5F24 A;  4DDD A;  2V25 A;  2CEY A;  4NF0 A;  3O6G A;  3OMB A;  3FVG A;  4GX3 A;  4YMA A;  4YMB A;  3T9V A;  2L5V A;  5IGA A;  5JEI A;  5I5P A;  4XKN A;  5AE4 A;  2QMW A;  3B7D A;  4XTC Q;  1MPD A;  2B3B A;  3SEY A;  5L9S A;  5CMK A;  1G0H A;  1MG1 A;  2Z8D A;  4H8I A;  2Q8M A;  3VVE A;  3C33 A;  3GZG A;  1A8E A;  4NX1 A;  3TEL A;  2RCB A;  4XKP A;  4IO2 A;  1MM6 A;  3M8U A;  5CMB A;  5HPQ A;  1Y3Q A;  2DE3 A;  4GIZ A;  4XKQ A;  1Y9U A;  1Q9D A;  2XWI A;  5EHS A;  1MQI A;  4PTK A;  4EUO A;  2AYS A;  3FXU A;  3K6X A;  1A55 A;  1MH4 A;  2QS3 A;  2F6P A;  1RDY A;  3RT8 A;  1AOV A;  4IO5 A;  4ELO A;  3FV1 A;  4ND9 A;  4OZ9 A;  4Z0I A;  1IIW A;  3IFA A;  2BJJ X;  2O7I A;  2Q74 A;  4DCY A;  2A5T A;  4QFL A;  2CEX A;  3RYD A;  1TT1 A;  5I7I A;  1R6Z A;  1KA0 A;  4MEV A;  4KHZ E;  3D4G A;  5H8F B;  4H0W A;  4GBV A;  4UAB A;  4F3B A;  1SPI A;  4OVP A;  5ICQ A;  5H8Q B;  4NF4 A;  3CFL A;  4DXC A;  3JV9 A;  3FAS A;  1I6B A;  1RDZ A;  1IXH A;  2GHB A;  3O29 A;  3LV0 A;  2XXI A;  2Y7R A;  1PBP A;  2WYK A;  2O7U A;  5KDT A;  2V3U A;  2FNC A;  2Y84 A;  4R2B A;  3IB0 A;  2Y7K A;  3H3G A;  4OAN A;  5FHN A;  4KYD A;  1NV1 A;  1ELJ A;  1MQH A;  1XOC A;  2FHY A;  2Z22 A;  2XX9 A;  3CIJ A;  1DSN A;  3IL1 B;  2DXR A;  2F7C A;  4PGP A;  2ONR A;  4LZ8 A;  3RPL A;  5EQA A;  4HS7 A;  2I3W A;  4U2R A;  3LR1 A;  1BIY A;  3OEN A;  4R73 A;  4YZZ A;  4GL0 A;  4DI4 B;  1RDX A;  4GXS B;  4R72 A;  2VD2 A;  2E1S A;  3MST A;  1MXX A;  4F1Y A;  3P7I A;  1UIU A;  4P1L A;  4PDH A;  3SEU A;  1OVT A;  1LAX A;  2Y5L A;  2ONS A;  4GRK A;  4IR8 A;  1LBB A;  4F3P A;  1I6A A;  3T96 B;  3E9X A;  1FBE A;  5JK4 A;  1A8F A;  1PDA A;  1H44 A;  2D21 A;  5DYH A;  2VPO A;  2O69 A;  3TDJ A;  5EQ8 A;  3JZJ A;  3S2V A;  5I2K B;  1D9Q A;  5EYF A;  1IXG A;  4BDN A;  4GOT A;  1BKA A;  5BUU A;  4JWY A;  3TTR A;  2XXU A;  3N94 A;  4ZEF A;  3MPL A;  1P1W A;  4HTG A;  2F6G A;  1SI1 A;  1H3D A;  4GWO A;  2XA5 A;  2B65 A;  3HV1 A;  3EKI A;  4OER A;  3TYH A;  3FUZ A;  1JET A;  1D4N A;  4LN5 A;  1FBD A;  5DVF A;  4MH5 A;  4N8Y A;  4QSD A;  4GQO A;  4QSE A;  2UVH A;  3Q26 A;  1FTL A;  5H8H A;  4QFK A;  4OVT A;  3RPW A;  4DXB A;  2Q2C A;  2GH9 A;  2FIX A;  4P3L A;  3SEW A;  3RY3 A;  4EQ9 A;  4R9G A;  4O7I A;  3QXM A;  2NVU B;  1SW5 A;  1ZTY A;  2REG A;  1B32 A;  1F9B A;  4N81 A;  3BIH A;  3KEI A;  2OLB A;  3MPK A;  5EQ9 A;  5EHM A;  2Z8F A;  2NUV A;  2ZNT A;  1B5J A;  2FIE A;  1SYI A;  3S4U A;  4ZE9 A;  1UIV A;  2NWJ A;  4JWO A;  4YKI A;  1GV8 A;  3K1N A;  1OLC A;  3I5O A;  3JYR A;  3MJN A;  2O6A A;  2QJE A;  3C31 A;  1DPE A;  1LAG E;  4LUB A;  4Z7E A;  2PVU A;  3T66 A;  5DT6 A;  3Q28 A;  4KYS A;  4M1V A;  4FE8 A;  4OTE A;  3K1P A;  4EXK A;  2Y7W A;  3C34 A;  5H8Q A;  1M5C A;  4OVR A;  5AA4 B;  1JVY A;  1LB8 A;  4POX A;  1SI0 A;  2YPN A;  4F18 A;  2HXW A;  3VE1 B;  2QL3 A;  1R9L A;  1MDQ A;  3U65 A;  1LB9 A;  4OHN A;  4HCW A;  1NH7 A;  3UOR A;  2WEF A;  4N4U A;  2HQ0 A;  1N76 A;  4MLV A;  5DTB A;  1FJ6 A;  5CMM A;  4PBQ A;  5I57 B;  3QMF A;  4N13 A;  5F7V A;  4DE8 A;  5ICT A;  5CMC A;  2A5T B;  3L6H A;  4PCD A;  1FTK A;  2VOZ A;  3IOR A;  2OCU A;  4GWY A;  2H99 A;  1B0H A;  2G29 A;  2XXP A;  4FIM A;  4GL8 A;  1NV4 A;  4X04 A;  2VT5 A;  1O63 A;  1OMP A;  1URD A;  1DK4 A;  5AA3 A;  4RPN A;  4U4X A;  4IY6 A;  5K2Y A;  4NQ8 A;  3ILT B;  3O2A A;  1R9Q A;  3K02 A;  1B0L A;  3PUZ E;  1N04 A;  5KDT B;  4LZ5 A;  4PAI A;  4THI A;  3BBR A;  1NV0 A;  3T22 A;  1B51 A;  4GXA A;  3RN8 A;  4PFY A;  4GWS A;  4HW8 A;  1IIT A;  3C36 A;  1NMU A;  3HHG A;  4QSC A;  3U94 A;  3K00 A;  3CG1 A;  4ESX A;  3TCH A;  4G68 C;  4LVQ A;  1AL3 A;  5H8H B;  2DVZ A;  2R71 A;  3LSL A;  4HCY A;  2XXR A;  3ZKL A;  1QUI A;  1LBV A;  2ZNU A;  3IFC A;  3K6W A;  3Q29 A;  4G68 A;  3IOW A;  4NE4 A;  4F39 A;  1D9Y A;  2ZNS A;  1VFE A;  2ZZV A;  1JQF A;  4N8G A;  1WOD A;  2UVG A;  1B3F A;  3H6U A;  2P3N A;  2XX7 A;  4MNP A;  1A40 A;  5TPA A;  3T9U A;  3PMV A;  1MXW A;  1INP A;  1DTG A;  4EDP A;  4PFI A;  3EQ1 A;  1Z7M E;  2XXY A;  2A5S A;  2E0S A;  1DOT A;  4R74 A;  1LAH E;  2YLN A;  3FD3 A;  1M5B A;  3KN3 A;  1QUJ A;  1L5T A;  4JVC A;  1XI6 A;  3IAZ A;  1QJM A;  2ZYO A;  4O3B A;  1LGB C;  3MVX A;  3OO9 A;  4RYA A;  4N6P A;  3IJO B;  1NNK A;  4MF3 A;  2X7Q A;  4U1Z A;  4Q30 B;  4YB6 A;  4ELR A;  1MXV A;  3O6H A;  3QK6 A;  2D3I A;  3QUJ A;  1NV2 A;  1EYK A;  2Z23 A;  2ZZW A;  1B5H A;  3V83 A;  4TOZ A;  3TOD A;  4E0W A;  4ZE8 A;  2XX8 A;  1H43 A;  3R26 A;  5DVI A;  4P8B A;  2Q2A A;  4DLD A;  4F3S A;  1LBX A;  3SEX A;  3H03 A;  3K0V A;  4MNI A;  1DTZ A;  1YCJ A;  1IUD A;  1B1H A;  2UYF A;  2ZYM A;  2ALU A;  4PFU A;  1J1N A;  3FIR A;  2WKY A;  3KOS A;  4U21 A;  4NWD A;  4KQP A;  1ZLQ A;  4QBA A;  1D9V A;  2VHA A;  3VLW A;  3Q25 A;  4ELP A;  1MDP 1;  3PV0 E;  3H7M A;  3TKD A;  1XS5 A;  2IEE A;  1UTH A;  3KGC A;  4U23 A;  1S9T A;  4JDF A;  3GBB A;  5AA4 A;  2F97 A;  4MBP A;  4QXD A;  5EYH A;  1HSE A;  1OQH A;  2VD3 A;  4RK2 A;  2AL4 A;  1GR2 A;  4G68 B;  1EH3 A;  3UIF A;  4HE1 A;  3O97 A;  4IO3 A;  1M5F A;  1OIB A;  1HSL A;  3EPE A;  3GYY A;  2P3V A;  1B7Z A;  1R1N A;  4PFT A;  5ISU A;  1URG A;  1B3E A;  2RC8 A;  3MYU A;  1B7U A;  2Q89 A;  4ZEI A;  2I3V A;  1SW2 A;  1FRP A;  2CZK A;  3PUV E;  1MM7 A;  2DP8 A;  4H5F A;  4HXV A;  1NUW A;  3T93 B;  2PT2 A;  4O3C A;  4PGN A;  4R6K A;  2HHM A;  4RA1 A;  5HM4 B;  3RTF B;  1US5 A;  3T1B A;  1TFD A;  4OQO A;  1LBC A;  3CFX A;  5ITP A;  4K3F A;  4NF6 B;  3VVF A;  1UTB A;  4P11 A;  1IZ1 A;  4KFQ A;  1OQG A;  4R75 A;  5EYG A;  2F35 A;  3MUQ A;  4ZS9 A;  3PMX A;  4MFI A;  4RY1 A;  3IOU A;  1A54 A;  1LBY A;  1N0T A;  3VDF A;  4P0I A;  1ANF A;  4WED A;  3LBS A;  1JW4 A;  2I58 A;  4IO7 A;  4LA9 A;  2V84 A;  3N6T A;  2RKM A;  3V89 B;  3M3L A;  1ZJL A;  2JJK A;  3TPA A;  5CC2 A;  2Y7P A;  2Y7I A;  2HPG A;  4OYV A;  4H5G A;  4GD5 A;  4RPO A;  3TTL A;  1K9Z A;  3HCQ A;  3PUY E;  5I59 A;  2QRY A;  2QMX A;  3IOT A;  3LSF B;  3K6U A;  2KQZ A;  4WEP A;  4F29 A;  5CBR A;  2XHD A;  1A99 A;  1P1O A;  2CZH A;  2I0B A;  1VE4 A;  1FPK A;  2DS9 A;  5TPA B;  2WYP A;  4OWD A;  3G3H A;  4OEU A;  1FPI A;  3Q27 A;  3VLU A;  4MMP A;  3IR1 A;  1FTA A;  4YB7 A;  2B4L A;  4YIC A;  1FCK A;  2F5X A;  1IMA A;  1CB6 A;  1H45 A;  1NUZ A;  4YB5 A;  2HAV A;  2D5W A;  3OOA A;  4KR5 A;  1CNQ A;  1B4Z A;  1S7Y A;  1ZMG A;  3FVO A;  3RUM A;  2B3F A;  3B8B A;  4F1V A;  2O1L A;  5BWJ A;  1UTH B;  4FEB A;  2CZL A;  2ESN A;  1FW0 A;  4ESW A;  2DWI A;  1RKM A;  3MVW A;  3K6V A;  1B1X A;  3SEV A;  1OVB A;  4FAT A;  3C4M A;  2W7Y A;  2PBW A;  3THI A;  3LSW A;  2DWH A;  3MBP A;  3PPP A;  1KZ8 A;  4H45 A;  1NV7 A;  4BLA A;  1UTB B;  3MVY A;  4NED A;  5I2K A;  4ONY A;  1DPP A;  3OO8 A;  5JTY B;  4KCD A;  3OSQ A;  1FJ9 A;  3H6W A;  1BLF A;  3UN6 A;  1ZKB A;  4XF5 A;  2XXQ A;  3V5A A;  3FXB A;  2H98 A;  1FPG A;  2ZZX A;  2CZI A;  1RYO A;  4GFR A;  1USY E;  5FHM A;  1NV6 A;  3U8Q A;  4HE2 A;  4EF1 A;  3PPR A;  4IGT A;  1WVJ A;  5CRY A;  5I59 B;  4POW A;  4E0X A;  2OBG A;  3B50 A;  2I4C A;  4YKJ A;  4NG7 A;  1NL5 A;  4OXV A;  4YKP A;  4NHB A;  2H5Y A;  5FBP A;  3KOT A;  1RYX A;  5IZZ A;  4TLM B;  3K1M A;  1QKA A;  1BK4 A;  1LST A;  2Y5K A;  4AB6 A;  1I69 A;  3C9H A;  1MXY A;  3L6G A;  4ZEB A;  1LEV A;  1YTV A;  3PU5 A;  3MW0 A;  3G3K A;  1FPB A;  5L9M A;  4OMB A;  4R6H A;  1XC1 A;  3T9X B;  5A5X A;  4NF5 B;  2M8C A;  3U72 A;  1QVS A;  1XT8 A;  3MZ1 A;  3USD A;  2GFE A;  1H76 A;  1TFA A;  1N3W A;  4KPT A;  3KJ7 A;  1KWH A;  1LFI A;  4I40 A;  2QS1 A;  1MQD A;  1LBW A;  5B70 A;  3ODB A;  3K01 A;  3G3I A;  4R6Y A;  1MQG A;  1P1U A;  1EU8 A;  2RF1 A;  5B7D A;  4G77 A;  1B58 A;  4FBP A;  4O7M A;  5F1Q A;  2PFZ A;  2R8T A;  4PDD A;  3TQW A; 
#chains in the Genus database with same CATH homology
 1MG1 A;  4YU0 A;  2Z8D A;  4O3B A;  1LGB C;  3MVX A;  3E4R A;  3OO9 A;  4H8I A;  3I3V A;  4RYA A;  3VVE A;  3C33 A;  3EF7 A;  3GZG A;  4EXL A;  3MP8 A;  4N6P A;  5H8N B;  2I0C A;  3IJO B;  3TUS A;  2QSX A;  1A8E A;  3KSX A;  3TEL A;  4EXK A;  1NNK A;  4I9D A;  4MF3 A;  2RCB A;  2X7Q A;  4F2O A;  4U1Z A;  4Q30 B;  4YB6 A;  4JWX A;  4XKP A;  4ELR A;  5TP9 B;  1LCT A;  4G8N A;  1Q35 A;  4IO2 A;  1MM6 A;  1MXV A;  3M8U A;  3O6H A;  5K2X A;  5CMB A;  3QK6 A;  2D3I A;  1Y3Q A;  2DE3 A;  5HPQ A;  5JTY A;  2X26 A;  2PT1 A;  3QUJ A;  4ZE9 A;  4OFL A;  4GIZ A;  2Z23 A;  4XKQ A;  2OJT A;  3H06 B;  4DZ1 A;  2HAU A;  1Y9U A;  3TFL A;  4U22 A;  1B5H A;  1BTJ A;  2RC7 A;  2O1M A;  3H6V A;  5LOM A;  1MY1 A;  3OO7 A;  3PMW A;  3V83 A;  4GVO A;  4TOZ A;  3TOD A;  5EHS A;  5L9O A;  3VLU A;  4E0W A;  3KN7 A;  4ZE8 A;  1MQI A;  2XX8 A;  4L17 A;  1B9J A;  4QF9 A;  1H43 A;  1O7T A;  2P2A A;  3R26 A;  2AYS A;  3FXU A;  4EUO A;  3K6X A;  4OFO A;  5DVI A;  1A55 A;  3O28 A;  1MH4 A;  2GRV A;  2Q2A A;  2UVJ A;  2R9J A;  2QS3 A;  4C1U A;  1AIV A;  2F6P A;  4DLD A;  4WKM A;  4F3S A;  1QW0 A;  2V93 A;  3MC2 A;  3SEX A;  3ZKK A;  1N7W A;  3H03 A;  3GLB A;  4JB7 A;  3RTW B;  3G3F A;  3SDF A;  3K0V A;  3RQT A;  1DTZ A;  1YCJ A;  1I6Q A;  1Y4C A;  1AOV A;  3RT8 A;  2ONK E;  4Q8R A;  1IUD A;  1XVY A;  1NNP A;  3E3K A;  3OEM A;  1MXU A;  1B1H A;  2UYF A;  3CSG A;  2ZYM A;  4IO5 A;  4ELO A;  4H65 A;  3FV1 A;  4BDO A;  3KN8 A;  1Y1M A;  4ND9 A;  3UK4 A;  4OZ9 A;  2ALU A;  3TTN A;  4Z0I A;  4TLL B;  1B2H A;  4PFU A;  1J1N A;  1CE2 A;  1IIW A;  2ANJ A;  3EN3 A;  2BJJ X;  2WKY A;  3FIR A;  3PPQ A;  3KOS A;  1EZP A;  4KI0 E;  1P1N A;  2O7I A;  4FEC A;  3TZA A;  4U21 A;  4NMY A;  1VSO A;  4F3G A;  3WAE A;  2H25 A;  4NWD A;  4DCX A;  3OEK A;  4KQP A;  2AIX A;  4DCY A;  2ZYN A;  4OEV A;  2XXX A;  3I6V A;  3SES A;  4F31 B;  3FJM A;  4ELQ A;  2A5T A;  1ZLQ A;  4LAT A;  4QFL A;  5DEX A;  1TT1 A;  1R6Z A;  1D9V A;  2VHA A;  1UQW A;  4IY5 A;  3VLW A;  3Q25 A;  4ELP A;  1FTM A;  1MDP 1;  1MXZ A;  1PB7 A;  1PEB A;  3PV0 E;  3AXF A;  3MP1 A;  4X1D A;  3TMG A;  4KHZ E;  1B52 A;  3D4G A;  3H7M A;  5H8F B;  3TKD A;  4H0W A;  4LQ5 A;  1XS5 A;  4PET A;  1B4H A;  2IEE A;  1MY0 A;  3OEL A;  2DVC A;  1UTH A;  3KGC A;  3TTM A;  4F3B A;  4QHQ A;  1PC3 A;  1SYH A;  1QKB A;  4U23 A;  1S9T A;  1MH3 A;  3KFM A;  4JDF A;  5ICQ A;  3GBB A;  3IB2 A;  2YJP A;  5H8Q B;  3PUW E;  4G8H A;  4H1X A;  1N3X A;  4NF4 A;  3N5L A;  5AA4 A;  2F97 A;  4MBP A;  3CFL A;  2V3T A;  3PPN A;  4DXC A;  3JV9 A;  2Q88 A;  3FAS A;  1I6B A;  4NWC A;  4X9T A;  3FJ7 A;  1IXH A;  1HSE A;  4IB2 A;  4WXJ A;  2GHB A;  1OQH A;  2VD3 A;  5CM6 A;  5KCJ B;  3W9W A;  4NF8 A;  3H6T A;  4RK2 A;  2AL4 A;  2HCA A;  3O29 A;  1GR2 A;  2XXI A;  2Y7R A;  4NF5 A;  1B05 A;  1PBP A;  4Q5T A;  5ITO A;  4C0R A;  4G68 B;  2DE4 A;  4PQJ A;  1IEJ A;  1EH3 A;  3UIF A;  3ILU B;  2O7U A;  5KDT A;  3O97 A;  3IK6 B;  4IO3 A;  2V3U A;  4BDL A;  5CI5 A;  2FNC A;  2PX1 A;  3IO4 A;  4ZED A;  1N7X A;  3S9E A;  2Y84 A;  1M5F A;  4XKR A;  1IXI A;  1M5D A;  4R2B A;  1OIB A;  1HSL A;  2DYX A;  3IB0 A;  2Y7K A;  1TXF A;  3EPE A;  3H3G A;  4H67 A;  5FHN A;  4KYD A;  3R7X A;  1ELJ A;  1MQH A;  2REJ A;  1XOC A;  2RCA A;  3BFU A;  1B7Z A;  1R1N A;  2O51 A;  2XX9 A;  2Z22 A;  4PFT A;  3CIJ A;  3IJX B;  1DSN A;  5ISU A;  2XXT A;  1URG A;  1B3E A;  2RC8 A;  3IL1 B;  1SVX B;  2DXR A;  2F7C A;  1B7U A;  2FA7 A;  2ONR A;  2Q89 A;  2V3Q A;  2QS2 A;  3GBA A;  2I3V A;  4LZ8 A;  4ZEI A;  2O68 A;  1SW2 A;  4HS7 A;  5CC2 A;  2I3W A;  3LR1 A;  1B3G A;  1BIY A;  4U2R A;  3PUV E;  1MM7 A;  2PMS A;  3OEN A;  4LQ2 A;  4IO4 A;  4R73 A;  4GL0 A;  4YZZ A;  2DP8 A;  4EF2 A;  4GXS B;  4FJP A;  4R72 A;  2VD2 A;  4OET A;  2E1S A;  2UXA A;  1MXX A;  3E13 X;  2G93 A;  2GHA A;  2OZZ A;  1JNF A;  3LUY A;  4H5F A;  4UA8 A;  5AA2 B;  5DVJ A;  3T93 B;  1B3H A;  4F1Y A;  2H9B A;  3QYT A;  3P7I A;  2PT2 A;  4KCC A;  4O3C A;  3QAX A;  1UIU A;  1US4 A;  3SEU A;  4BDR A;  1OVT A;  5I84 A;  4R6K A;  1LAX A;  1OLA A;  5I56 A;  1YPN A;  4RA1 A;  1M5E A;  4GRK A;  2ONS A;  5HM4 B;  4H6D A;  2XXW A;  1Y3P A;  1LBB A;  1Y20 A;  4RJZ A;  4F3P A;  3RTF B;  4BDM A;  1I6A A;  1US5 A;  3T96 B;  3FZV A;  3E9X A;  3N26 A;  1TFD A;  4OQO A;  5JK4 A;  4RXL A;  1NKX A;  1LBC A;  4U1O A;  1NNF A;  4LZ7 A;  3CFX A;  1A8F A;  5ITP A;  4K3F A;  3RT6 B;  1PDA A;  1H44 A;  4QRZ A;  1JEU A;  2D21 A;  3G7W A;  1SQY A;  1AMF A;  1JVX A;  4N07 A;  5DYH A;  2O69 A;  3PD9 A;  5TP9 A;  3TDJ A;  3JZJ A;  4NF6 B;  2KLF A;  3VVF A;  1UTB A;  4YAH X;  4P11 A;  4ZZA A;  1IZ1 A;  3S2V A;  5I2K B;  4F22 A;  4KFQ A;  3KG2 A;  5I2N B;  1OQG A;  5I57 A;  5EYF A;  1IXG A;  3CVG A;  4R75 A;  2XXH A;  2F35 A;  3MUQ A;  4GOT A;  1BKA A;  1Y1Z A;  2OWT A;  4ZS9 A;  3PMX A;  5BUU A;  4JWY A;  4MFI A;  3QSL A;  1A7L A;  3OO6 A;  3TTR A;  4RY1 A;  3CRB A;  3IOV A;  3U93 A;  2XXU A;  3MAM A;  3IOU A;  2QPQ A;  1A54 A;  3N94 A;  4ZEF A;  3MPL A;  1P1W A;  4HTG A;  1N0T A;  3VDF A;  4P0I A;  1ANF A;  2ZMB A;  4WED A;  3CFZ A;  3LBS A;  2F6G A;  1JW4 A;  5I58 A;  2I58 A;  4IO7 A;  4LA9 A;  2V84 A;  3G3J A;  5IKB A;  3VVD A;  3LSX A;  1SI1 A;  2IA4 A;  2DQV A;  1LFG A;  3N6T A;  1H3D A;  5FTH A;  1ZIU A;  4GWO A;  2DE2 A;  2RKM A;  2DWA A;  4JBZ A;  3OXN A;  1FQB A;  4EQB A;  3EHS A;  1DMB A;  3M3L A;  4ZDM A;  4U4S A;  2B65 A;  3HV1 A;  3V89 B;  1ZJL A;  3IO6 A;  3FVN A;  4OER A;  1FTO A;  3R6U A;  3TPA A;  3FUZ A;  1JET A;  5H8N A;  2Y7P A;  1D4N A;  1MQJ A;  4JSD A;  2Y7I A;  3TYH A;  4OYV A;  4H5G A;  4GD5 A;  2VP1 A;  4RPO A;  5DVF A;  3PUY E;  3HCQ A;  4QFP A;  3TTL A;  4AB5 A;  5I59 A;  3FV2 A;  4MH5 A;  3DEL B;  4GQO A;  1SW1 A;  4QSD A;  2UVH A;  4QSE A;  2QRY A;  3Q26 A;  2QMX A;  1FTL A;  3IOT A;  5H8H A;  3LSF B;  4FOR A;  4QFK A;  3SET A;  1USY H;  2RC9 A;  4RNS A;  3RPW A;  4DXB A;  4Q0C A;  2Q2C A;  3K6U A;  2GH9 A;  3SEW A;  1B5I A;  5A5X B;  3RY3 A;  3GXA A;  1XVX A;  3B6W A;  4EQ9 A;  4R9G A;  4QFO A;  4G2Z A;  2Q9T A;  1WDN A;  3QXM A;  2NVU B;  1SW5 A;  1ZTY A;  4WEP A;  2Q8J A;  2REG A;  1URS A;  1B32 A;  3K2D A;  3VV5 A;  2ABH A;  3FAT A;  1F9B A;  4F29 A;  5CBR A;  3KEI A;  2OLB A;  3S9N C;  2I6E A;  1A99 A;  2XHD A;  3TEP A;  1P1O A;  3MPK A;  4DIG A;  5IAI A;  2HFB A;  2Z8E A;  4I62 A;  2DOJ A;  1GTK A;  2I0B A;  1VE4 A;  5EHM A;  5H8S A;  2Z8F A;  4ISU A;  2DS9 A;  2NUV A;  2ZNT A;  4GF8 A;  1POT A;  3SER A;  3S9M C;  5TPA B;  1B5J A;  3M3F A;  3O9P A;  4OWD A;  3G3H A;  2F8D A;  4OEU A;  1GVC A;  3Q27 A;  2F7A A;  3FJG A;  1SYI A;  3C32 A;  3MZB A;  1O64 A;  3KBR A;  3IR1 A;  3N6U A;  5FTI A;  1UIV A;  4YB7 A;  3DM0 A;  3MZ9 A;  4YKK A;  4JWO A;  4KD5 A;  2NWJ A;  4I1D A;  4YKI A;  5KCJ A;  1XHY A;  4YIC A;  1GV8 A;  3K1N A;  3ONM A;  4PE5 B;  1OLC A;  3I5O A;  3JYR A;  3MJN A;  2R6G E;  3S9L C;  1FCK A;  3IX1 A;  4P0G A;  2O6A A;  5HBC A;  3H4Z A;  1BP5 A;  3B6T A;  4F1U A;  2AL5 A;  2F5X A;  4MLQ A;  1CB6 A;  1D3K A;  2UYE A;  4OFJ A;  2QJE A;  3MVZ A;  1H45 A;  3C31 A;  1DPE A;  4YB5 A;  1LAG E;  4LUB A;  4Z7E A;  2HAV A;  2D5W A;  3DLN A;  3OOA A;  4KR5 A;  3RGY A;  3WAF A;  1FQA A;  1B4Z A;  2PVU A;  4ZZE A;  1S7Y A;  3PD8 A;  3T66 A;  5DT6 A;  1ZMG A;  3Q28 A;  3FVO A;  4KYS A;  4M1V A;  3RUM A;  3V8X B;  2B3F A;  4FE8 A;  3CG3 A;  4OTE A;  4F1V A;  2I48 A;  1FQE A;  1SDX A;  3UP9 A;  3DP4 A;  2O1L A;  3QIM A;  5L8D A;  5BWJ A;  1UTH B;  3K1P A;  1N84 A;  3A3U A;  2P1S A;  3KSJ A;  1B46 A;  1FQD A;  2CZL A;  3HN0 A;  3PPO A;  4FEB A;  2Y7W A;  3C34 A;  2QS4 A;  3FGS A;  1LAF E;  2ESN A;  3IB1 A;  4ECF A;  5H8Q A;  1FW0 A;  1M5C A;  2VGQ A;  3F11 A;  2LAO A;  4NF4 B;  4NTL A;  5M2V A;  1JVY A;  3U92 A;  3ZSF A;  4ESW A;  5AA4 B;  3SKP A;  1LB8 A;  4POX A;  1SI0 A;  4F19 A;  2P0S A;  5AA2 D;  2DWI A;  2YPN A;  1RKM A;  3EHU A;  3O6I A;  3ZS6 A;  2HXW A;  2O84 X;  2QL3 A;  3MVW A;  4ZEK A;  3K6V A;  3VE1 B;  1B1X A;  4F18 A;  3SEV A;  1QUK A;  1OVB A;  1R9L A;  1MDQ A;  4FAT A;  4OES A;  1LB9 A;  2XXV A;  4OHN A;  3MWB A;  1LLS A;  3B6Q A;  3C4M A;  5ELV A;  2W7Y A;  3S4U A;  4HCW A;  1NH7 A;  3UOR A;  3PGF A;  2PBW A;  2OWS A;  1JW5 A;  3THI A;  1SD3 A;  5CMK A;  3LSW A;  2DWH A;  2CMO A;  3MBP A;  2XD3 A;  3A09 A;  2HQ0 A;  3PPP A;  1N76 A;  3CSB A;  4MLV A;  1FQC A;  1PBQ A;  1S50 A;  1MY2 A;  2HEU A;  4FED A;  4NF6 A;  5CMM A;  5DTB A;  4BLA A;  1UTB B;  2OK2 A;  3MVY A;  4NED A;  5I2K A;  1EZ9 A;  2H4I A;  4ONY A;  4X48 A;  1DPP A;  1IXC A;  4R9F A;  5I57 B;  3OO8 A;  4JXI A;  3VFJ A;  1PB9 A;  2DXY A;  4N13 A;  3K4U A;  5JTY B;  3C35 A;  5J1D A;  5F7V A;  4DE8 A;  3D4C A;  3UGW A;  1B3L A;  4KCD A;  2FYI A;  3OSQ A;  5ICT A;  1NFT A;  5CMC A;  3DP6 A;  3H6W A;  1BLF A;  3UN6 A;  1ZKB A;  3M3K A;  4XXU A;  2XXQ A;  3V5A A;  5I58 B;  2A5T B;  5DEX B;  3L6H A;  2H98 A;  3ECR A;  1RYO A;  1VR5 A;  3A3C A;  1II5 A;  1FTK A;  3HST A;  4GFR A;  2VOZ A;  3IOR A;  3TCF A;  1USY E;  5FHM A;  2OCU A;  3HPI A;  4C1T A;  5H8F A;  1T0K A;  1SBP A;  2H99 A;  3U8Q A;  4EF1 A;  3PPR A;  1B0H A;  1YAE A;  1MY4 A;  2G29 A;  4IGT A;  4IGR A;  1IQ7 A;  1WVJ A;  5CRY A;  1Z7N E;  5I59 B;  4PFW A;  4FAJ A;  2F36 A;  2XXP A;  4FIM A;  1HSJ A;  4POW A;  3G3G A;  4GL8 A;  4I8C A;  4X1B A;  4E0X A;  1POY 1;  2OBG A;  5TU0 A;  1B7H A;  1O63 A;  1OMP A;  1URD A;  4G4P A;  3CR9 A;  5AA3 A;  3TCG A;  2I4C A;  4YKJ A;  2NXO A;  1NL5 A;  2I4B A;  3CI8 A;  4OXV A;  4LON B;  4RK9 A;  1AH5 A;  4RPN A;  4YKP A;  4U4X A;  1MPB A;  4NF8 B;  4IY6 A;  3FXR A;  4LP2 B;  5K2Y A;  3ILT B;  3O2A A;  1P1Q A;  1R9Q A;  1NH8 A;  2H5Y A;  3BFT A;  3K02 A;  1B0L A;  1ZU0 A;  3PUZ E;  3KOT A;  1RYX A;  1N04 A;  3OD7 A;  1Y4T A;  1ZBM A;  3BKI B;  5KDT B;  1PB8 A;  4LZ5 A;  4THI A;  3K1M A;  4TLM B;  3BBR A;  3UA8 A;  3T22 A;  3VXC A;  1P99 A;  3KJT A;  3QUF A;  1QKA A;  4H8J A;  4M4G A;  1B51 A;  4BDN A;  4JSO A;  2DWJ A;  3W15 C;  1JW1 A;  1LST A;  4GXA A;  1B40 A;  3LC8 A;  4PFY A;  4UAC A;  3RLF E;  3RN8 A;  1I69 A;  4AB6 A;  4HW8 A;  1IIT A;  3C36 A;  4IO6 A;  5AA1 A;  3C9H A;  3T9H B;  2F7B A;  1FTJ A;  2UVI A;  1LFH A;  1MXY A;  3L6G A;  3TQL A;  1NMU A;  4ZEB A;  3HHG A;  4QSC A;  2F34 A;  4R2F A;  1YTV A;  3EHT A;  3TAJ A;  3U94 A;  1FQF A;  4BDQ A;  3K00 A;  3PU5 A;  3CG1 A;  3OSR A;  1ATG A;  4ESX A;  3TCH A;  1EZO A;  3MW0 A;  1SW4 A;  3VXB A;  3G3K A;  4G68 C;  4LVQ A;  5AA2 A;  4OEN A;  1AL3 A;  2RIN A;  3DP8 A;  2DVZ A;  2PYY A;  2R71 A;  3FXQ A;  3LSL A;  4TQU Q;  4OVJ A;  5H8H B;  5L9M A;  4OMB A;  4R6H A;  3U1O A;  4G8M A;  4HCY A;  2ZXT A;  1TWY A;  2XXR A;  3RNN A;  5I56 B;  3TTK A;  3ZKL A;  1QUI A;  1XC1 A;  3T9X B;  1MS7 A;  2ZNU A;  4NF5 B;  5A5X A;  1Q1K A;  5CBS A;  3O66 A;  3MQ9 A;  3K6W A;  3Q29 A;  2M8C A;  3PUX E;  4G68 A;  3IOW A;  3U72 A;  1QVS A;  1XT8 A;  4GLI A;  4NE4 A;  3MZ1 A;  4KYE A;  2THI A;  4F39 A;  3USD A;  4F2Q A;  1D9Y A;  2ZNS A;  1VFD A;  3VLV A;  4AQ4 A;  2GFE A;  4EQ7 A;  4PP0 A;  1LCF A;  1VFE A;  2I49 A;  1JQF A;  1H76 A;  1TFA A;  1B6H A;  1N3W A;  1WOD A;  1MY3 A;  2UVG A;  1Y3N A;  1B3F A;  2NOO A;  2ZYK A;  3H6U A;  3KZG A;  1QUL A;  4KPT A;  2HZK A;  3KJ7 A;  4DDD A;  2V25 A;  1KWH A;  2XX7 A;  1LFI A;  1A40 A;  3O6G A;  1MPC A;  2QS1 A;  3FVG A;  3OMB A;  1MXW A;  3PMV A;  5TPA A;  3T9U A;  1MQD A;  5I2N A;  5FHO A;  5B70 A;  4YMA A;  2DSF A;  4DXU A;  4YMB A;  3T9V A;  1DTG A;  1JEV A;  3HHF A;  3ODB A;  2XD2 A;  3MP6 A;  3K01 A;  4EDP A;  3G3I A;  4R6Y A;  1MQG A;  1P1U A;  3FVK A;  3EQ1 A;  5JEI A;  1Z7M E;  1EU8 A;  1MRP A;  2XXY A;  1NNT A;  2A5S A;  2RF1 A;  2E0S A;  4QFN A;  1DOT A;  4XKN A;  4R74 A;  1LAH E;  3W9V A;  1GGG A;  5AE4 A;  5B7D A;  4G77 A;  2QMW A;  5KZT A;  3B7D A;  2YLN A;  1B58 A;  1MPD A;  1M5B A;  2B3B A;  3FD3 A;  4O3A A;  3KN3 A;  4XTC Q;  4XIG Q;  1QUJ A;  5F1Q A;  3SEY A;  4ZEC A;  1L5T A;  2HZL A;  2F78 A;  3IAZ A;  2X7P A;  5L9S A;  1QJM A;  2ZYO A;  3HO7 A;  3TQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...